BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1636_g1_i1 len=1154 path=[1204:0-1153]

Length=1154
                                                                      Score     E

ref|XP_004236090.1|  PREDICTED: strictosidine synthase 3-like           271   3e-84   
ref|XP_006345201.1|  PREDICTED: strictosidine synthase 3-like           267   1e-82   
ref|XP_004252261.1|  PREDICTED: strictosidine synthase 3-like           265   9e-82   
ref|XP_004236089.1|  PREDICTED: strictosidine synthase 1-like           240   3e-72   
ref|XP_002274134.3|  PREDICTED: strictosidine synthase 3-like           235   3e-70   Vitis vinifera
ref|XP_006345203.1|  PREDICTED: strictosidine synthase 1-like           234   8e-70   
ref|XP_010319099.1|  PREDICTED: strictosidine synthase 1-like           233   3e-69   
emb|CBI15377.3|  unnamed protein product                                236   4e-67   
emb|CDP21322.1|  unnamed protein product                                227   2e-66   
ref|XP_011071027.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    225   2e-66   
ref|XP_011071025.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    220   3e-64   
ref|XP_010663511.1|  PREDICTED: strictosidine synthase 1-like           218   2e-63   
emb|CDP10794.1|  unnamed protein product                                215   2e-62   
ref|XP_010099019.1|  Strictosidine synthase 1                           214   3e-62   
emb|CDP21857.1|  unnamed protein product                                213   1e-61   
ref|XP_010663512.1|  PREDICTED: strictosidine synthase 3-like           212   2e-61   
emb|CDP21321.1|  unnamed protein product                                211   9e-61   
gb|AFK49369.1|  unknown                                                 208   5e-60   
emb|CAN77945.1|  hypothetical protein VITISV_044021                     208   2e-59   Vitis vinifera
ref|XP_002274235.1|  PREDICTED: strictosidine synthase 3-like           207   2e-59   Vitis vinifera
gb|AES93117.1|  strictosidine synthase                                  206   3e-59   
emb|CAN78855.1|  hypothetical protein VITISV_013355                     206   4e-59   Vitis vinifera
ref|XP_003635414.1|  PREDICTED: strictosidine synthase 1-like           204   1e-58   
dbj|BAJ53159.1|  JHL10I11.5                                             205   1e-58   
ref|XP_009597336.1|  PREDICTED: strictosidine synthase 1-like           202   2e-58   
ref|XP_008811198.1|  PREDICTED: strictosidine synthase 1-like           204   2e-58   
emb|CBI18784.3|  unnamed protein product                                204   2e-58   
emb|CDO98507.1|  unnamed protein product                                204   3e-58   
emb|CBI28988.3|  unnamed protein product                                203   4e-58   
emb|CAN59852.1|  hypothetical protein VITISV_000854                     203   5e-58   Vitis vinifera
ref|XP_002275622.2|  PREDICTED: strictosidine synthase 1-like           204   7e-58   Vitis vinifera
ref|XP_010655935.1|  PREDICTED: strictosidine synthase 1-like           202   1e-57   
emb|CBI28990.3|  unnamed protein product                                202   1e-57   
emb|CBI28987.3|  unnamed protein product                                202   1e-57   
emb|CAN78856.1|  hypothetical protein VITISV_013356                     208   2e-57   Vitis vinifera
ref|XP_010658741.1|  PREDICTED: strictosidine synthase 1-like           201   2e-57   
ref|XP_010656041.1|  PREDICTED: strictosidine synthase 1-like           200   4e-57   
ref|XP_010099026.1|  Strictosidine synthase 1                           200   5e-57   
emb|CAN77943.1|  hypothetical protein VITISV_044019                     199   7e-57   Vitis vinifera
ref|XP_010656040.1|  PREDICTED: strictosidine synthase 1-like           200   1e-56   
ref|XP_010655933.1|  PREDICTED: strictosidine synthase 1-like           201   3e-56   
ref|XP_003609162.1|  Strictosidine synthase                             198   4e-56   
ref|XP_010532262.1|  PREDICTED: strictosidine synthase 1-like           198   5e-56   
ref|XP_010099021.1|  Strictosidine synthase 1                           198   5e-56   
ref|XP_006301516.1|  hypothetical protein CARUB_v10021942mg             198   7e-56   
emb|CBI40188.3|  unnamed protein product                                196   9e-56   
emb|CBI15378.3|  unnamed protein product                                207   1e-55   
ref|XP_010428359.1|  PREDICTED: strictosidine synthase 3-like iso...    197   1e-55   
ref|XP_003531955.1|  PREDICTED: strictosidine synthase 3-like           197   2e-55   
ref|XP_006437788.1|  hypothetical protein CICLE_v10032008mg             197   2e-55   
ref|XP_002273580.1|  PREDICTED: strictosidine synthase 3                196   4e-55   Vitis vinifera
emb|CAN63240.1|  hypothetical protein VITISV_034462                     196   4e-55   Vitis vinifera
emb|CAN77942.1|  hypothetical protein VITISV_044018                     196   5e-55   Vitis vinifera
ref|XP_002270060.2|  PREDICTED: strictosidine synthase 1-like           196   5e-55   Vitis vinifera
ref|XP_010471490.1|  PREDICTED: strictosidine synthase 1-like           195   6e-55   
ref|XP_010428361.1|  PREDICTED: strictosidine synthase 1-like           195   7e-55   
emb|CBI35408.3|  unnamed protein product                                202   1e-54   
ref|XP_004298328.1|  PREDICTED: strictosidine synthase-like             195   1e-54   
gb|KDO70174.1|  hypothetical protein CISIN_1g019290mg                   194   2e-54   
ref|XP_010110081.1|  Strictosidine synthase 1                           194   3e-54   
ref|XP_006436700.1|  hypothetical protein CICLE_v10033919mg             194   3e-54   
gb|ACU23577.1|  unknown                                                 194   4e-54   Glycine max [soybeans]
ref|XP_010416232.1|  PREDICTED: strictosidine synthase 3-like           193   4e-54   
ref|XP_006436702.1|  hypothetical protein CICLE_v10033429mg             193   5e-54   
emb|CDP14992.1|  unnamed protein product                                192   7e-54   
ref|XP_002312353.2|  hypothetical protein POPTR_0008s10940g             193   7e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006436705.1|  hypothetical protein CICLE_v10033909mg             192   9e-54   
ref|XP_003576963.1|  PREDICTED: strictosidine synthase 3-like           192   9e-54   
ref|XP_010428362.1|  PREDICTED: strictosidine synthase 1-like           192   1e-53   
ref|XP_006440860.1|  hypothetical protein CICLE_v10023327mg             192   1e-53   
emb|CBI18783.3|  unnamed protein product                                191   1e-53   
emb|CDP12339.1|  unnamed protein product                                192   2e-53   
emb|CDY47728.1|  BnaA02g16670D                                          191   2e-53   
ref|XP_009128019.1|  PREDICTED: strictosidine synthase 1-like           191   2e-53   
gb|KDO65594.1|  hypothetical protein CISIN_1g048181mg                   191   2e-53   
gb|AES91361.2|  strictosidine synthase-like protein, putative           191   2e-53   
emb|CDP06823.1|  unnamed protein product                                191   2e-53   
ref|XP_004508606.1|  PREDICTED: strictosidine synthase 1-like           191   2e-53   
ref|XP_010471491.1|  PREDICTED: strictosidine synthase 1-like           191   2e-53   
ref|XP_002888957.1|  strictosidine synthase family protein              191   2e-53   
ref|XP_006436697.1|  hypothetical protein CICLE_v10033295mg             191   2e-53   
ref|XP_002321516.2|  hypothetical protein POPTR_0015s04660g             191   3e-53   Populus trichocarpa [western balsam poplar]
ref|NP_177541.1|  strictosidine synthase-like protein                   190   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609164.1|  Strictosidine synthase                             190   6e-53   
ref|XP_006485738.1|  PREDICTED: strictosidine synthase 1-like           189   7e-53   
ref|XP_006436612.1|  hypothetical protein CICLE_v10033527mg             189   1e-52   
ref|XP_006351273.1|  PREDICTED: strictosidine synthase 1-like           190   2e-52   
ref|XP_004963976.1|  PREDICTED: strictosidine synthase-like             189   3e-52   
ref|XP_006390480.1|  hypothetical protein EUTSA_v10018852mg             188   3e-52   
gb|EYU18642.1|  hypothetical protein MIMGU_mgv1a008518mg                189   3e-52   
ref|XP_009799719.1|  PREDICTED: strictosidine synthase 1-like           188   4e-52   
emb|CDX73037.1|  BnaC06g34850D                                          187   4e-52   
ref|XP_002454704.1|  hypothetical protein SORBIDRAFT_04g035910          188   5e-52   Sorghum bicolor [broomcorn]
ref|XP_009631158.1|  PREDICTED: strictosidine synthase 1-like           187   6e-52   
emb|CDP12401.1|  unnamed protein product                                187   7e-52   
ref|XP_006301702.1|  hypothetical protein CARUB_v10022158mg             192   9e-52   
ref|XP_009627580.1|  PREDICTED: strictosidine synthase 1-like           188   9e-52   
ref|XP_002438841.1|  hypothetical protein SORBIDRAFT_10g027060          187   1e-51   Sorghum bicolor [broomcorn]
ref|XP_004978210.1|  PREDICTED: strictosidine synthase 1-like           187   1e-51   
ref|XP_004249227.1|  PREDICTED: strictosidine synthase 1                187   1e-51   
ref|XP_002273764.1|  PREDICTED: strictosidine synthase 1                187   1e-51   Vitis vinifera
ref|XP_006485325.1|  PREDICTED: strictosidine synthase 3-like           190   1e-51   
gb|KDP29321.1|  hypothetical protein JCGZ_18242                         186   2e-51   
gb|EMT31336.1|  Strictosidine synthase 1                                187   2e-51   
emb|CDY47729.1|  BnaA02g16660D                                          186   2e-51   
gb|EMT14932.1|  Strictosidine synthase 3                                187   2e-51   
ref|XP_006421116.1|  hypothetical protein CICLE_v10005245mg             186   2e-51   
ref|XP_010246302.1|  PREDICTED: strictosidine synthase 3-like           186   3e-51   
emb|CDP16919.1|  unnamed protein product                                186   4e-51   
ref|XP_009106059.1|  PREDICTED: strictosidine synthase 1-like           185   4e-51   
ref|XP_010257835.1|  PREDICTED: strictosidine synthase 3-like           185   4e-51   
ref|XP_004298326.1|  PREDICTED: strictosidine synthase-like             185   5e-51   
ref|XP_011000464.1|  PREDICTED: strictosidine synthase 3-like           185   6e-51   
ref|XP_002452919.1|  hypothetical protein SORBIDRAFT_04g034960          185   6e-51   Sorghum bicolor [broomcorn]
ref|XP_003576476.1|  PREDICTED: strictosidine synthase 3-like           185   8e-51   
ref|XP_006390479.1|  hypothetical protein EUTSA_v10018851mg             184   8e-51   
gb|KEH23600.1|  strictosidine synthase family protein                   184   9e-51   
ref|XP_009797408.1|  PREDICTED: strictosidine synthase 1-like           185   1e-50   
gb|KHG17610.1|  Strictosidine synthase 1 -like protein                  184   1e-50   
emb|CDY45861.1|  BnaC02g22590D                                          184   1e-50   
emb|CDY45863.1|  BnaC02g22570D                                          184   1e-50   
ref|XP_003524502.1|  PREDICTED: strictosidine synthase 1-like           184   1e-50   
ref|XP_008243874.1|  PREDICTED: strictosidine synthase 3-like           184   1e-50   
ref|XP_006494389.1|  PREDICTED: strictosidine synthase 1-like           184   2e-50   
ref|XP_003609161.1|  Strictosidine synthase                             183   2e-50   
ref|XP_009106057.1|  PREDICTED: strictosidine synthase 1-like           182   3e-50   
ref|XP_009128018.1|  PREDICTED: strictosidine synthase 3-like           182   3e-50   
ref|XP_002452976.1|  hypothetical protein SORBIDRAFT_04g035870          183   3e-50   Sorghum bicolor [broomcorn]
ref|XP_009400113.1|  PREDICTED: strictosidine synthase 1-like           183   4e-50   
ref|XP_002323253.2|  strictosidine synthase family protein              183   4e-50   Populus trichocarpa [western balsam poplar]
ref|XP_003547789.1|  PREDICTED: strictosidine synthase-like             183   5e-50   
gb|KHN15177.1|  Strictosidine synthase 1                                182   5e-50   
ref|XP_008244837.1|  PREDICTED: strictosidine synthase 1                183   5e-50   
ref|XP_003576994.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    182   5e-50   
ref|XP_010655934.1|  PREDICTED: strictosidine synthase 1-like           180   6e-50   
dbj|BAK06958.1|  predicted protein                                      183   7e-50   
ref|XP_010537421.1|  PREDICTED: strictosidine synthase 1-like           182   8e-50   
ref|XP_006291448.1|  hypothetical protein CARUB_v10017585mg             182   9e-50   
ref|XP_010110077.1|  Strictosidine synthase 1                           181   1e-49   
ref|XP_002467870.1|  hypothetical protein SORBIDRAFT_01g035660          182   1e-49   Sorghum bicolor [broomcorn]
ref|XP_010647214.1|  PREDICTED: strictosidine synthase 1                182   1e-49   
emb|CDX73039.1|  BnaC06g34870D                                          181   1e-49   
ref|XP_010416233.1|  PREDICTED: strictosidine synthase 3                181   1e-49   
ref|XP_004308613.1|  PREDICTED: strictosidine synthase-like             181   1e-49   
ref|XP_006301859.1|  hypothetical protein CARUB_v10022329mg             180   2e-49   
ref|XP_002888956.1|  hypothetical protein ARALYDRAFT_476540             181   2e-49   
ref|XP_010412433.1|  PREDICTED: strictosidine synthase 1-like           181   2e-49   
ref|XP_004307669.1|  PREDICTED: strictosidine synthase 1-like iso...    181   3e-49   
ref|XP_007204530.1|  hypothetical protein PRUPE_ppa017675mg             181   3e-49   
ref|XP_003549591.1|  PREDICTED: strictosidine synthase 1-like           180   3e-49   
ref|XP_007045664.1|  Calcium-dependent phosphotriesterase superfa...    181   3e-49   
ref|XP_009356499.1|  PREDICTED: strictosidine synthase 3-like           181   3e-49   
ref|NP_001063033.1|  Os09g0374900                                       180   6e-49   Oryza sativa Japonica Group [Japonica rice]
emb|CDP07817.1|  unnamed protein product                                179   6e-49   
gb|KHN18404.1|  Strictosidine synthase 1                                179   7e-49   
ref|XP_004974473.1|  PREDICTED: strictosidine synthase 1-like           179   7e-49   
gb|KFK41838.1|  hypothetical protein AALP_AA2G178000                    179   7e-49   
ref|XP_010672985.1|  PREDICTED: strictosidine synthase 1-like           180   8e-49   
ref|XP_006390477.1|  hypothetical protein EUTSA_v10018854mg             179   8e-49   
ref|XP_004986991.1|  PREDICTED: strictosidine synthase 3-like           179   1e-48   
ref|XP_007028511.1|  Calcium-dependent phosphotriesterase superfa...    179   1e-48   
ref|XP_004970743.1|  PREDICTED: strictosidine synthase 3-like           179   1e-48   
ref|XP_006376714.1|  hypothetical protein POPTR_0012s04360g             177   1e-48   
ref|XP_007156378.1|  hypothetical protein PHAVU_003G281200g             179   1e-48   
gb|EAZ01725.1|  hypothetical protein OsI_23751                          179   2e-48   Oryza sativa Indica Group [Indian rice]
gb|ACU19372.1|  unknown                                                 178   2e-48   Glycine max [soybeans]
ref|NP_177540.3|  strictosidine synthase 3                              178   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128020.1|  PREDICTED: strictosidine synthase 1 isoform X1     178   2e-48   
ref|XP_004974468.1|  PREDICTED: strictosidine synthase 1-like           178   2e-48   
emb|CBI24410.3|  unnamed protein product                                178   2e-48   
gb|EAZ01726.1|  hypothetical protein OsI_23752                          178   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_010425613.1|  PREDICTED: strictosidine synthase 3-like           178   3e-48   
ref|XP_002308895.2|  hypothetical protein POPTR_0006s03930g             179   3e-48   Populus trichocarpa [western balsam poplar]
dbj|BAD35676.1|  putative strictosidine synthase precursor              178   3e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010672984.1|  PREDICTED: strictosidine synthase 1-like           179   3e-48   
gb|EMT28724.1|  putative Strictosidine synthase                         177   3e-48   
ref|XP_010430839.1|  PREDICTED: strictosidine synthase 1-like           177   3e-48   
ref|XP_002888958.1|  hypothetical protein ARALYDRAFT_476542             177   4e-48   
ref|XP_003564761.1|  PREDICTED: strictosidine synthase 3-like           177   4e-48   
gb|AAB40593.1|  strictosidine synthase                                  177   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004974461.1|  PREDICTED: strictosidine synthase 1-like           177   4e-48   
ref|NP_177542.1|  strictosidine synthase 2                              177   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465977.1|  PREDICTED: strictosidine synthase 1-like           178   4e-48   
gb|EEC84480.1|  hypothetical protein OsI_31139                          177   4e-48   Oryza sativa Indica Group [Indian rice]
gb|AFK33536.1|  unknown                                                 176   4e-48   
ref|XP_004967164.1|  PREDICTED: strictosidine synthase 1-like           177   5e-48   
ref|XP_007202861.1|  hypothetical protein PRUPE_ppa015510mg             177   5e-48   
ref|XP_011035620.1|  PREDICTED: strictosidine synthase 3-like           176   5e-48   
ref|XP_004971567.1|  PREDICTED: strictosidine synthase 1-like           177   7e-48   
ref|XP_010108510.1|  Strictosidine synthase 1                           178   7e-48   
ref|XP_008655533.1|  PREDICTED: strictosidine synthase 3-like           177   7e-48   
emb|CDP09527.1|  unnamed protein product                                177   7e-48   
tpg|DAA61232.1|  TPA: strictosidine synthase 3                          177   8e-48   
emb|CDX95058.1|  BnaC05g06130D                                          177   8e-48   
emb|CDM84363.1|  unnamed protein product                                176   1e-47   
ref|XP_008244844.1|  PREDICTED: strictosidine synthase 1                177   2e-47   
ref|XP_007146688.1|  hypothetical protein PHAVU_006G061000g             176   2e-47   
ref|XP_004967142.1|  PREDICTED: strictosidine synthase 1-like           176   2e-47   
ref|XP_004237337.1|  PREDICTED: strictosidine synthase 3-like           176   2e-47   
emb|CDM84367.1|  unnamed protein product                                180   2e-47   
ref|XP_003580953.1|  PREDICTED: strictosidine synthase 1-like           175   3e-47   
ref|XP_002452451.1|  hypothetical protein SORBIDRAFT_04g026050          175   3e-47   Sorghum bicolor [broomcorn]
ref|XP_004488398.1|  PREDICTED: strictosidine synthase 3-like           175   3e-47   
ref|XP_004955245.1|  PREDICTED: strictosidine synthase 1-like           175   3e-47   
ref|XP_011027271.1|  PREDICTED: strictosidine synthase 3-like iso...    176   3e-47   
ref|XP_002456721.1|  hypothetical protein SORBIDRAFT_03g041380          175   3e-47   Sorghum bicolor [broomcorn]
ref|XP_011027270.1|  PREDICTED: strictosidine synthase 3-like iso...    176   3e-47   
ref|XP_004986993.1|  PREDICTED: strictosidine synthase 3-like           175   3e-47   
ref|XP_010110078.1|  Strictosidine synthase 1                           175   4e-47   
ref|XP_009391266.1|  PREDICTED: strictosidine synthase 3-like           174   4e-47   
ref|NP_001150769.1|  strictosidine synthase 3 precursor                 175   4e-47   Zea mays [maize]
ref|XP_007045667.1|  Calcium-dependent phosphotriesterase superfa...    178   4e-47   
ref|XP_009128022.1|  PREDICTED: strictosidine synthase 1 isoform X2     174   5e-47   
ref|XP_004974462.1|  PREDICTED: strictosidine synthase 1-like           174   5e-47   
ref|XP_011075408.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    175   5e-47   
ref|XP_004305393.1|  PREDICTED: strictosidine synthase-like             174   5e-47   
ref|XP_010471492.1|  PREDICTED: strictosidine synthase 1-like           174   6e-47   
ref|XP_004974464.1|  PREDICTED: strictosidine synthase 1-like           174   6e-47   
ref|XP_011075619.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    174   6e-47   
ref|XP_004967140.1|  PREDICTED: strictosidine synthase 1-like           174   8e-47   
ref|XP_010042385.1|  PREDICTED: strictosidine synthase 1-like           175   9e-47   
ref|XP_010023798.1|  PREDICTED: strictosidine synthase 1-like           174   1e-46   
ref|XP_010428364.1|  PREDICTED: strictosidine synthase 1-like           173   1e-46   
ref|XP_002514533.1|  strictosidine synthase, putative                   174   1e-46   Ricinus communis
ref|XP_010416234.1|  PREDICTED: strictosidine synthase 1                173   2e-46   
ref|XP_010922155.1|  PREDICTED: strictosidine synthase 3-like           174   2e-46   
ref|XP_007037729.1|  Calcium-dependent phosphotriesterase superfa...    173   2e-46   
ref|XP_009339573.1|  PREDICTED: strictosidine synthase 3-like           174   2e-46   
tpg|DAA45309.1|  TPA: hypothetical protein ZEAMMB73_979948              173   2e-46   
ref|XP_010091689.1|  Strictosidine synthase                             173   2e-46   
gb|EMT33531.1|  Strictosidine synthase 1                                172   2e-46   
ref|XP_003561520.1|  PREDICTED: strictosidine synthase 1-like           172   3e-46   
ref|XP_008655524.1|  PREDICTED: strictosidine synthase 3-like           172   3e-46   
ref|XP_003575472.1|  PREDICTED: strictosidine synthase 1-like           172   3e-46   
ref|XP_004986966.1|  PREDICTED: strictosidine synthase 3-like           172   4e-46   
gb|EAZ40180.1|  hypothetical protein OsJ_24625                          172   4e-46   Oryza sativa Japonica Group [Japonica rice]
emb|CDX93560.1|  BnaA06g04880D                                          173   4e-46   
gb|EAZ04232.1|  hypothetical protein OsI_26376                          172   4e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_010056146.1|  PREDICTED: strictosidine synthase 1                173   5e-46   
ref|XP_003595639.1|  Strictosidine synthase-like protein                171   7e-46   
ref|XP_004150130.1|  PREDICTED: strictosidine synthase 1-like           172   7e-46   
ref|XP_009394278.1|  PREDICTED: strictosidine synthase 1-like           172   7e-46   
gb|KFK34942.1|  hypothetical protein AALP_AA5G213900                    172   8e-46   
dbj|BAD05221.1|  putative male fertility protein                        172   9e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ41691.1|  hypothetical protein OsJ_26224                          171   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009148103.1|  PREDICTED: strictosidine synthase 3                172   1e-45   
ref|XP_008655507.1|  PREDICTED: strictosidine synthase 3-like           171   1e-45   
ref|XP_011013883.1|  PREDICTED: strictosidine synthase 3-like           169   1e-45   
ref|XP_002278088.1|  PREDICTED: strictosidine synthase 3                172   1e-45   Vitis vinifera
ref|XP_007037730.1|  Calcium-dependent phosphotriesterase superfa...    171   1e-45   
ref|XP_006826427.1|  hypothetical protein AMTR_s00004p00163660          172   1e-45   
ref|XP_002267323.1|  PREDICTED: strictosidine synthase 3                171   2e-45   Vitis vinifera
emb|CBI30108.3|  unnamed protein product                                171   2e-45   
ref|XP_002438640.1|  hypothetical protein SORBIDRAFT_10g023490          171   2e-45   Sorghum bicolor [broomcorn]
ref|XP_009614698.1|  PREDICTED: strictosidine synthase 1-like           171   2e-45   
emb|CDP09529.1|  unnamed protein product                                171   2e-45   
emb|CDX73038.1|  BnaC06g34860D                                          170   2e-45   
gb|EAZ01722.1|  hypothetical protein OsI_23748                          170   2e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_004955242.1|  PREDICTED: strictosidine synthase 1-like           170   2e-45   
ref|XP_010427562.1|  PREDICTED: strictosidine synthase 1-like           170   2e-45   
ref|XP_006340100.1|  PREDICTED: strictosidine synthase 1-like iso...    171   3e-45   
ref|XP_002456259.1|  hypothetical protein SORBIDRAFT_03g033070          170   3e-45   Sorghum bicolor [broomcorn]
ref|XP_004487437.1|  PREDICTED: adipocyte plasma membrane-associa...    171   3e-45   
ref|XP_009803216.1|  PREDICTED: strictosidine synthase 1-like           171   3e-45   
ref|XP_006291321.1|  hypothetical protein CARUB_v10017454mg             171   3e-45   
ref|XP_008392402.1|  PREDICTED: strictosidine synthase 1-like           171   3e-45   
gb|EAZ01723.1|  hypothetical protein OsI_23749                          170   3e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_003528253.1|  PREDICTED: strictosidine synthase 3-like iso...    169   3e-45   
ref|XP_004493427.1|  PREDICTED: adipocyte plasma membrane-associa...    171   4e-45   
ref|XP_004307668.1|  PREDICTED: strictosidine synthase 1-like iso...    171   4e-45   
ref|XP_003554139.1|  PREDICTED: strictosidine synthase 1-like           170   4e-45   
gb|KFK41840.1|  hypothetical protein AALP_AA2G178200                    169   4e-45   
dbj|BAC83776.1|  putative strictosidine synthase                        170   4e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008652645.1|  PREDICTED: strictosidine synthase 3-like           171   4e-45   
ref|XP_008443273.1|  PREDICTED: strictosidine synthase 1                170   5e-45   
gb|ABR18211.1|  unknown                                                 171   5e-45   Picea sitchensis
ref|XP_002456643.1|  hypothetical protein SORBIDRAFT_03g040000          169   6e-45   Sorghum bicolor [broomcorn]
ref|XP_003625042.1|  Adipocyte plasma membrane-associated protein       170   6e-45   
ref|XP_004956696.1|  PREDICTED: strictosidine synthase 3-like           169   6e-45   
gb|KEH23602.1|  strictosidine synthase family protein                   169   6e-45   
gb|EYU18639.1|  hypothetical protein MIMGU_mgv1a009932mg                169   6e-45   
ref|XP_010056166.1|  PREDICTED: strictosidine synthase 1-like           169   8e-45   
ref|XP_004169880.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    169   1e-44   
ref|XP_002532597.1|  strictosidine synthase, putative                   169   1e-44   
ref|XP_009106058.1|  PREDICTED: strictosidine synthase 3-like           168   1e-44   
ref|XP_008657056.1|  PREDICTED: strictosidine synthase 3-like           168   1e-44   
ref|XP_010269382.1|  PREDICTED: strictosidine synthase 1-like           169   1e-44   
ref|XP_006348919.1|  PREDICTED: strictosidine synthase 1-like           169   1e-44   
dbj|BAC83125.1|  putative male fertility protein                        168   1e-44   
ref|NP_191262.2|  calcium-dependent phosphotriesterase superfamil...    169   1e-44   
ref|XP_008657057.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    168   1e-44   
ref|XP_008657058.1|  PREDICTED: strictosidine synthase 3-like           168   1e-44   
ref|XP_010504621.1|  PREDICTED: strictosidine synthase 1-like           168   1e-44   
ref|XP_002878128.1|  strictosidine synthase family protein              169   1e-44   
emb|CDX72079.1|  BnaC08g27950D                                          167   2e-44   
gb|AFW84563.1|  hypothetical protein ZEAMMB73_589231                    168   2e-44   
dbj|BAD35673.1|  putative strictosidine synthase precursor              168   2e-44   
ref|XP_004984421.1|  PREDICTED: strictosidine synthase-like             168   2e-44   
emb|CAB72173.1|  putative protein                                       169   2e-44   
gb|EPS66876.1|  hypothetical protein M569_07898                         169   2e-44   
emb|CDP09528.1|  unnamed protein product                                169   2e-44   
gb|EMT11668.1|  Strictosidine synthase 1                                167   2e-44   
ref|XP_004243243.1|  PREDICTED: strictosidine synthase 1-like           168   2e-44   
ref|XP_002443591.1|  hypothetical protein SORBIDRAFT_08g022130          167   2e-44   
dbj|BAE99809.1|  hypothetical protein                                   168   3e-44   
ref|XP_006417683.1|  hypothetical protein EUTSA_v10007865mg             168   3e-44   
ref|XP_006344500.1|  PREDICTED: adipocyte plasma membrane-associa...    168   3e-44   
ref|XP_006657226.1|  PREDICTED: strictosidine synthase 1-like           167   3e-44   
ref|NP_001059909.2|  Os07g0543600                                       167   3e-44   
ref|XP_010427563.1|  PREDICTED: strictosidine synthase 1-like           167   4e-44   
ref|XP_003596929.1|  Adipocyte plasma membrane-associated protein       168   4e-44   
emb|CDP17488.1|  unnamed protein product                                166   4e-44   
pdb|2FP8|A  Chain A, Structure Of Strictosidine Synthase, The Bio...    166   4e-44   
pdb|2V91|A  Chain A, Structure Of Strictosidine Synthase In Compl...    166   4e-44   
gb|AES67180.2|  strictosidine synthase family protein                   168   4e-44   
ref|XP_006494390.1|  PREDICTED: strictosidine synthase 1-like           167   4e-44   
ref|XP_003576475.1|  PREDICTED: strictosidine synthase 3-like           167   5e-44   
ref|XP_003572967.1|  PREDICTED: strictosidine synthase 1-like           167   5e-44   
ref|XP_010677108.1|  PREDICTED: strictosidine synthase 1-like           166   5e-44   
sp|P68175.1|STSY_RAUSE  RecName: Full=Strictosidine synthase; Fla...    166   5e-44   
sp|P68174.1|STSY_RAUMA  RecName: Full=Strictosidine synthase; Fla...    166   6e-44   
ref|XP_002298158.2|  strictosidine synthase family protein              167   7e-44   
ref|XP_007132511.1|  hypothetical protein PHAVU_011G100400g             167   7e-44   
ref|XP_008657062.1|  PREDICTED: strictosidine synthase 3-like           166   7e-44   
ref|XP_002966382.1|  hypothetical protein SELMODRAFT_230896             167   8e-44   
ref|XP_009783664.1|  PREDICTED: strictosidine synthase 3-like           167   8e-44   
ref|XP_007162124.1|  hypothetical protein PHAVU_001G125900g             167   9e-44   
gb|KHF98782.1|  Adipocyte plasma membrane-associated                    167   9e-44   
ref|XP_010031590.1|  PREDICTED: adipocyte plasma membrane-associa...    167   9e-44   
ref|XP_009116408.1|  PREDICTED: strictosidine synthase 1                167   9e-44   
ref|XP_010247897.1|  PREDICTED: strictosidine synthase 3-like           167   1e-43   
ref|XP_006644568.1|  PREDICTED: strictosidine synthase 1-like           166   1e-43   
ref|XP_008657012.1|  PREDICTED: strictosidine synthase 3-like           166   1e-43   
gb|EEE69596.1|  hypothetical protein OsJ_29148                          165   1e-43   
ref|XP_010475646.1|  PREDICTED: strictosidine synthase 3-like           167   1e-43   
ref|XP_010488915.1|  PREDICTED: strictosidine synthase 3-like           167   1e-43   
ref|XP_004981761.1|  PREDICTED: adipocyte plasma membrane-associa...    167   1e-43   
ref|XP_002513740.1|  strictosidine synthase, putative                   166   1e-43   
ref|XP_003521146.1|  PREDICTED: strictosidine synthase 1-like           166   1e-43   
ref|XP_004137361.1|  PREDICTED: adipocyte plasma membrane-associa...    167   1e-43   
ref|XP_004172338.1|  PREDICTED: adipocyte plasma membrane-associa...    167   1e-43   
ref|XP_002460150.1|  hypothetical protein SORBIDRAFT_02g023460          165   2e-43   
gb|EAY75495.1|  hypothetical protein OsI_03394                          165   2e-43   
ref|XP_004974394.1|  PREDICTED: strictosidine synthase 3-like           165   2e-43   
emb|CDY22515.1|  BnaC03g23250D                                          165   2e-43   
gb|KEH29729.1|  strictosidine synthase family protein                   166   2e-43   
ref|XP_006582039.1|  PREDICTED: strictosidine synthase 3-like iso...    165   3e-43   
ref|XP_008777477.1|  PREDICTED: strictosidine synthase 1-like           166   3e-43   
ref|XP_008657055.1|  PREDICTED: strictosidine synthase 3-like           165   3e-43   
gb|AFK49602.1|  unknown                                                 166   3e-43   
ref|XP_011044611.1|  PREDICTED: strictosidine synthase 3-like           166   3e-43   
ref|XP_002443589.1|  hypothetical protein SORBIDRAFT_08g022110          164   3e-43   
ref|XP_010516303.1|  PREDICTED: strictosidine synthase 3-like           166   3e-43   
gb|KDP31453.1|  hypothetical protein JCGZ_11829                         164   3e-43   
ref|XP_010525478.1|  PREDICTED: strictosidine synthase 1-like           165   3e-43   
ref|XP_008657061.1|  PREDICTED: strictosidine synthase 3-like           164   3e-43   
ref|XP_010504622.1|  PREDICTED: strictosidine synthase 1-like           165   3e-43   
ref|XP_006305032.1|  hypothetical protein CARUB_v10009397mg             166   3e-43   
ref|XP_010031589.1|  PREDICTED: adipocyte plasma membrane-associa...    166   3e-43   
ref|XP_002892459.1|  strictosidine synthase family protein              166   3e-43   
gb|KFK36980.1|  hypothetical protein AALP_AA4G196900                    165   3e-43   
ref|XP_011037298.1|  PREDICTED: strictosidine synthase 3-like           166   4e-43   
ref|XP_003625041.1|  Adipocyte plasma membrane-associated protein       166   4e-43   
gb|KFK43153.1|  hypothetical protein AALP_AA1G086800                    165   4e-43   
gb|EMT00978.1|  Strictosidine synthase 1                                164   5e-43   
ref|XP_002460151.1|  hypothetical protein SORBIDRAFT_02g023470          164   5e-43   
gb|ABZ79473.1|  strictosidine synthase                                  164   6e-43   
ref|XP_004136643.1|  PREDICTED: strictosidine synthase 1-like           164   7e-43   
ref|XP_002463871.1|  hypothetical protein SORBIDRAFT_01g007960          165   7e-43   
gb|EAZ37681.1|  hypothetical protein OsJ_22019                          162   7e-43   
ref|NP_001150945.1|  strictosidine synthase 1 precursor                 163   8e-43   
ref|XP_010458085.1|  PREDICTED: strictosidine synthase 3-like           164   8e-43   
gb|KHN41250.1|  Adipocyte plasma membrane-associated protein            164   8e-43   
ref|XP_008776219.1|  PREDICTED: adipocyte plasma membrane-associa...    164   9e-43   
gb|EPS65875.1|  hypothetical protein M569_08902                         164   9e-43   
gb|KHG24230.1|  Strictosidine synthase 3 -like protein                  162   1e-42   
ref|XP_004955258.1|  PREDICTED: strictosidine synthase 1-like           163   1e-42   
ref|XP_010431421.1|  PREDICTED: strictosidine synthase 3-like           163   1e-42   
dbj|BAD35674.1|  putative strictosidine synthase                        162   1e-42   
emb|CDP21347.1|  unnamed protein product                                164   1e-42   
ref|XP_009599899.1|  PREDICTED: strictosidine synthase 3-like           164   1e-42   
ref|XP_006411394.1|  hypothetical protein EUTSA_v10016811mg             164   1e-42   
ref|XP_004956695.1|  PREDICTED: strictosidine synthase 3-like           163   1e-42   
emb|CDM83814.1|  unnamed protein product                                163   2e-42   
ref|XP_008453519.1|  PREDICTED: strictosidine synthase 3                164   2e-42   
ref|XP_010507098.1|  PREDICTED: uncharacterized protein LOC104783669    167   2e-42   
ref|XP_002972283.1|  hypothetical protein SELMODRAFT_231921             163   2e-42   
ref|XP_004164012.1|  PREDICTED: strictosidine synthase 1-like           163   2e-42   
gb|ABA95779.2|  Strictosidine synthase family protein, expressed        164   2e-42   
ref|XP_008230556.1|  PREDICTED: strictosidine synthase 3                163   2e-42   
emb|CDY35420.1|  BnaA03g19400D                                          162   3e-42   
ref|XP_008677622.1|  PREDICTED: strictosidine synthase isoform X1       163   3e-42   
ref|XP_010516308.1|  PREDICTED: strictosidine synthase 1-like           162   3e-42   
ref|XP_003527512.1|  PREDICTED: adipocyte plasma membrane-associa...    164   3e-42   
ref|XP_010932965.1|  PREDICTED: strictosidine synthase 3-like           163   3e-42   
gb|AAB40595.1|  strictosidine synthase                                  162   3e-42   
ref|XP_004493426.1|  PREDICTED: strictosidine synthase 1-like           162   3e-42   
gb|AFW84434.1|  strictosidine synthase 1                                162   3e-42   
gb|EMT28721.1|  Strictosidine synthase 3                                160   3e-42   
ref|XP_007205319.1|  hypothetical protein PRUPE_ppa006884mg             163   3e-42   
gb|KDP37825.1|  hypothetical protein JCGZ_06727                         162   3e-42   
ref|XP_006348986.1|  PREDICTED: strictosidine synthase 1-like           162   3e-42   
gb|KDO48949.1|  hypothetical protein CISIN_1g015463mg                   162   4e-42   
ref|XP_003581637.1|  PREDICTED: strictosidine synthase 1-like           161   4e-42   
ref|XP_010544326.1|  PREDICTED: strictosidine synthase 3                162   4e-42   
ref|XP_002978184.1|  hypothetical protein SELMODRAFT_108020             163   4e-42   
ref|XP_009133478.1|  PREDICTED: strictosidine synthase 3                162   4e-42   
gb|ADK91432.1|  strictosidine synthase                                  161   5e-42   
gb|KDP42972.1|  hypothetical protein JCGZ_23914                         162   5e-42   
ref|XP_006340101.1|  PREDICTED: strictosidine synthase 1-like iso...    162   6e-42   
ref|XP_011000438.1|  PREDICTED: strictosidine synthase 1                162   6e-42   
ref|NP_001150008.1|  strictosidine synthase precursor                   162   6e-42   
ref|NP_563818.1|  strictosidine synthase-like 3                         162   7e-42   
gb|EPS68312.1|  hypothetical protein M569_06455                         162   7e-42   
ref|XP_010554777.1|  PREDICTED: strictosidine synthase 3-like           161   1e-41   
ref|XP_006487831.1|  PREDICTED: adipocyte plasma membrane-associa...    161   1e-41   
ref|XP_003521147.1|  PREDICTED: strictosidine synthase 1-like           161   1e-41   
emb|CDY23858.1|  BnaC04g01790D                                          160   1e-41   
pdb|2FPB|A  Chain A, Structure Of Strictosidine Synthase, The Bio...    159   1e-41   
ref|XP_006424057.1|  hypothetical protein CICLE_v10028617mg             161   2e-41   
ref|XP_009142736.1|  PREDICTED: strictosidine synthase 3-like           160   2e-41   
gb|EMT05184.1|  Strictosidine synthase 1                                160   2e-41   
ref|XP_008382118.1|  PREDICTED: strictosidine synthase 3                162   2e-41   
emb|CDX79944.1|  BnaA05g02120D                                          160   2e-41   
ref|XP_004506244.1|  PREDICTED: adipocyte plasma membrane-associa...    160   2e-41   
emb|CDM86638.1|  unnamed protein product                                159   3e-41   
gb|ABK24858.1|  unknown                                                 161   3e-41   
ref|XP_010685469.1|  PREDICTED: strictosidine synthase 3-like           160   3e-41   
ref|NP_001063030.1|  Os09g0373200                                       159   4e-41   
ref|XP_004241357.2|  PREDICTED: strictosidine synthase 3-like           160   5e-41   
ref|XP_002881766.1|  hypothetical protein ARALYDRAFT_483200             159   5e-41   
ref|NP_001234466.1|  uncharacterized protein LOC543656 precursor        159   5e-41   
dbj|BAJ89445.1|  predicted protein                                      160   6e-41   
dbj|BAJ91613.1|  predicted protein                                      160   6e-41   
gb|KHN31827.1|  Strictosidine synthase 3                                157   6e-41   
ref|XP_006287902.1|  hypothetical protein CARUB_v10001136mg             159   6e-41   
ref|NP_001172522.1|  Os01g0698200                                       158   6e-41   
ref|XP_004986926.1|  PREDICTED: strictosidine synthase-like             159   6e-41   
ref|XP_002532594.1|  strictosidine synthase, putative                   159   7e-41   
gb|AGU43759.1|  strictosidine synthase                                  159   7e-41   
ref|XP_002984195.1|  hypothetical protein SELMODRAFT_156492             159   8e-41   
gb|EEC84476.1|  hypothetical protein OsI_31134                          158   8e-41   
ref|XP_002323255.1|  strictosidine synthase family protein              159   8e-41   
gb|EAY82206.1|  hypothetical protein OsI_37409                          158   1e-40   
ref|XP_010230125.1|  PREDICTED: strictosidine synthase 1-like           157   1e-40   
ref|XP_009378622.1|  PREDICTED: strictosidine synthase 3-like           160   1e-40   
gb|ABA95780.1|  Strictosidine synthase family protein, expressed        158   1e-40   
ref|XP_006361111.1|  PREDICTED: adipocyte plasma membrane-associa...    159   1e-40   
emb|CDX92388.1|  BnaA10g14270D                                          158   1e-40   
gb|ABA91449.1|  Strictosidine synthase family protein                   158   1e-40   
gb|EYU22112.1|  hypothetical protein MIMGU_mgv1a007437mg                159   1e-40   
gb|AES81258.2|  strictosidine synthase family protein                   158   2e-40   
ref|XP_010263076.1|  PREDICTED: adipocyte plasma membrane-associa...    158   2e-40   
emb|CDY06143.1|  BnaA09g36370D                                          158   2e-40   
ref|XP_011088992.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    157   3e-40   
ref|XP_006662726.1|  PREDICTED: strictosidine synthase 3-like           157   3e-40   
ref|XP_009797832.1|  PREDICTED: strictosidine synthase 3-like           157   3e-40   
gb|EAZ05772.1|  hypothetical protein OsI_28006                          157   3e-40   
emb|CBI30107.3|  unnamed protein product                                154   3e-40   
ref|XP_004977501.1|  PREDICTED: strictosidine synthase 1-like           157   4e-40   
gb|KHG24912.1|  Adipocyte plasma membrane-associated                    157   4e-40   
emb|CDY16615.1|  BnaC09g36580D                                          157   5e-40   
gb|EAY79903.1|  hypothetical protein OsI_35066                          156   6e-40   
ref|XP_001783026.1|  predicted protein                                  157   7e-40   
gb|KFK26348.1|  hypothetical protein AALP_AA8G236100                    156   8e-40   
ref|XP_010535734.1|  PREDICTED: adipocyte plasma membrane-associa...    156   9e-40   
ref|XP_006436707.1|  hypothetical protein CICLE_v10033463mg             153   1e-39   
ref|XP_006294436.1|  hypothetical protein CARUB_v10023450mg             155   1e-39   
ref|XP_003595643.1|  Strictosidine synthase-like protein                155   1e-39   
ref|XP_003559512.1|  PREDICTED: strictosidine synthase-like             156   1e-39   
ref|XP_009412315.1|  PREDICTED: strictosidine synthase 3-like           155   1e-39   
ref|XP_011090280.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    157   1e-39   
dbj|BAK04872.1|  predicted protein                                      155   2e-39   
ref|XP_010420991.1|  PREDICTED: adipocyte plasma membrane-associa...    155   2e-39   
ref|XP_010454464.1|  PREDICTED: strictosidine synthase 3-like           155   2e-39   
emb|CBX24423.1|  hypothetical_protein                                   156   3e-39   
ref|XP_003617474.1|  Strictosidine synthase                             153   3e-39   
ref|XP_010086695.1|  Strictosidine synthase 1                           155   3e-39   
ref|XP_006478730.1|  PREDICTED: strictosidine synthase-like             155   3e-39   
gb|KFK36981.1|  hypothetical protein AALP_AA4G197000                    154   3e-39   
ref|XP_002436534.1|  hypothetical protein SORBIDRAFT_10g004310          152   4e-39   
dbj|BAC83778.1|  putative strictosidine synthase                        151   4e-39   
gb|EMT18390.1|  Strictosidine synthase 1                                153   4e-39   
gb|EMT04951.1|  Strictosidine synthase 1                                160   4e-39   
ref|XP_004978641.1|  PREDICTED: strictosidine synthase 3-like iso...    154   5e-39   
ref|XP_010253308.1|  PREDICTED: adipocyte plasma membrane-associa...    154   5e-39   
ref|XP_010686168.1|  PREDICTED: strictosidine synthase 3-like           153   5e-39   
gb|ACF21007.1|  strictosidine synthase                                  153   5e-39   
ref|XP_010554776.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    154   6e-39   
ref|XP_010108508.1|  Adipocyte plasma membrane-associated protein       155   6e-39   
gb|EAZ28597.1|  hypothetical protein OsJ_12584                          153   6e-39   
ref|XP_010508735.1|  PREDICTED: strictosidine synthase 3                154   6e-39   
gb|AEY82399.1|  strictosidine synthase                                  152   7e-39   
ref|XP_002448962.1|  hypothetical protein SORBIDRAFT_05g002520          154   7e-39   
ref|XP_006658662.1|  PREDICTED: strictosidine synthase-like             150   7e-39   
ref|XP_006847661.1|  hypothetical protein AMTR_s00149p00021810          153   7e-39   
ref|XP_010493259.1|  PREDICTED: strictosidine synthase 3-like           154   8e-39   
emb|CDO98508.1|  unnamed protein product                                151   8e-39   
emb|CDP06820.1|  unnamed protein product                                150   8e-39   
ref|XP_010427557.1|  PREDICTED: strictosidine synthase 3-like           153   9e-39   



>ref|XP_004236090.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=332

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 213/329 (65%), Gaps = 18/329 (5%)
 Frame = +2

Query  44   LMFISSLCMIHSHPERDL-----IAKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDGRILKF  205
            ++F+    M++  P          +KL+L     GP+ +AFD +GGGPYTG+ DGRI+K+
Sbjct  10   VLFVQIWIMLNVSPSIAWCRFPAFSKLQLPLQTIGPEASAFDRKGGGPYTGIADGRIVKY  69

Query  206  SNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLR  379
                  F DFA+TSP RTK KCDG NG  L  ICGRP GL F  RTGDLYI D  +GL+ 
Sbjct  70   QGPRVGFTDFAVTSPNRTKAKCDGKNGPELQQICGRPFGLGFYYRTGDLYITDAFYGLVV  129

Query  380  VGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSG  559
            VG +GGL  ++  G  G+NF F D++ +DQ  G  YFV+SG IFLT +  RI +SGDTSG
Sbjct  130  VGPSGGLVTRVP-GFQGRNFAFLDALDIDQSKGVVYFVDSGAIFLTGNRTRIVESGDTSG  188

Query  560  RLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETV  739
            RL KY+ AT QVT +L+GL+GPVG A+S+D++++ +T +I ++I + +++G KA +++ V
Sbjct  189  RLFKYDIATKQVTLILSGLSGPVGVALSKDNSYVLVTEYIAQRIRRFWLKGAKANSSD-V  247

Query  740  LENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY  919
              N+ G P+ +KR  ++ G FWV ++  ++    P T S+  + ++ GK++ET N T  Y
Sbjct  248  FANVDGIPDNIKR--TVLGDFWVAISNTKQ----PTTFSLGQRINQFGKVVETCNFTAQY  301

Query  920  --PKLLGSYFEYFGKAYTGSLEADFVGVY  1000
              P  +    EY GK Y GSL+ +F+GV+
Sbjct  302  NSPNGITEVQEYKGKLYVGSLDQNFIGVF  330



>ref|XP_006345201.1| PREDICTED: strictosidine synthase 3-like [Solanum tuberosum]
Length=332

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 213/329 (65%), Gaps = 18/329 (5%)
 Frame = +2

Query  44   LMFISSLCMIHSHPERDL-----IAKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDGRILKF  205
            ++F+    M++  P   L      +KL+L     GP+ +AFD +GGGPYTG+ DGRI+K+
Sbjct  10   VLFVQIWVMLNVSPSVALCRFPAFSKLQLPLQTIGPEASAFDRKGGGPYTGIADGRIVKY  69

Query  206  SNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLR  379
                  F DFA+TSP RTK KCDG NG  L  ICGRP GL F  +TGDLYI D  +GL+ 
Sbjct  70   QGPRVGFTDFAVTSPNRTKAKCDGKNGPELQQICGRPFGLGFYYKTGDLYITDAFYGLVV  129

Query  380  VGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSG  559
            VG +GGL  ++ +   G+NF F D++ +DQ TG  YFV+SG IFLT +  RI +SGD SG
Sbjct  130  VGPSGGLVTRVPS-FQGRNFAFLDALDIDQRTGVVYFVDSGAIFLTGNTTRIVESGDISG  188

Query  560  RLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETV  739
            RL KY+ AT QVT +L+GL+GP+G A+S+D++++ IT  I ++I + +++G KA +++ V
Sbjct  189  RLFKYDIATKQVTLLLSGLSGPIGVALSKDNSYVLITESIAQRIRRFWLKGAKANSSD-V  247

Query  740  LENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY  919
              N+ G P+ +KR  ++ G FWV ++  +++     T S+  + +R GK++ET N T  Y
Sbjct  248  FANVDGIPDNIKR--TVLGDFWVAISNTKQR----TTFSLGQRINRFGKVVETCNFTAQY  301

Query  920  --PKLLGSYFEYFGKAYTGSLEADFVGVY  1000
              P  +    EY GK Y GSL+ +F+GV+
Sbjct  302  KSPNGITEVQEYKGKLYVGSLDQNFIGVF  330



>ref|XP_004252261.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=333

 Score =   265 bits (677),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 193/303 (64%), Gaps = 7/303 (2%)
 Frame = +2

Query  104  KLKLQNA-FGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGT  274
            KL+L +   GP+  AFD  G GPYT V DGR+LK+      F+DFA TSP RTKE C+G 
Sbjct  32   KLQLPSGTVGPEAIAFDLLGNGPYTSVADGRVLKYQGPRIGFIDFATTSPLRTKEVCNGK  91

Query  275  NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADS  454
            N  NLL  CGRPLGL F  R+GDLYIADI++GLL VG NGG A+QL  GI+GK F F ++
Sbjct  92   NDPNLLITCGRPLGLGFYYRSGDLYIADINYGLLVVGRNGGPARQLVTGIDGKPFAFTNA  151

Query  455  VSLDQLTGDAYFVESGEIF-LTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVG  631
            V +DQL G  YF +SG +F  T +   I +S DT+GRL KY+  T +VT +L+GLAGPVG
Sbjct  152  VDIDQLNGVVYFTDSGPLFRATRNITLILESKDTTGRLFKYDIRTNKVTLLLSGLAGPVG  211

Query  632  NAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVP  811
             A+S D +++ +T  I  +I + ++RG +A T++    NL G P+ +KR  ++ G +WV 
Sbjct  212  VAVSLDGSYVLVTELIANRIKRFWVRGTRANTSQE-FTNLNGYPDNIKR--TILGDYWVA  268

Query  812  VNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFV  991
            VN    Q  +P   S A K +  G +  + NL+  Y   +    E FG+ Y GSLE DFV
Sbjct  269  VNIVNNQSMTPPKFSFAQKINVLGNVFVSLNLSTQYRNSISEVQEKFGRLYIGSLEEDFV  328

Query  992  GVY  1000
            GVY
Sbjct  329  GVY  331



>ref|XP_004236089.1| PREDICTED: strictosidine synthase 1-like [Solanum lycopersicum]
Length=336

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 202/328 (62%), Gaps = 11/328 (3%)
 Frame = +2

Query  38   SMLMFISSLCMIHSHPERDLIAKLKLQ---NAFGPKDTAFDPRGGGPYTGVRDGRILKFS  208
            +M + +  L  +++ P     A  +LQ    AFGP  +AFD +G GPYTGV DGR++K+ 
Sbjct  9    AMFLILQILIFLNASPYLVHCAFSRLQLPLQAFGPDSSAFDTKGVGPYTGVGDGRVMKYQ  68

Query  209  NGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRV  382
              N  F +FAITSP RTK+ C+GTN       CGRP GL F  +TGDLYI D ++GLL V
Sbjct  69   GPNVGFTEFAITSPNRTKQICNGTNDPISQISCGRPYGLGFYNKTGDLYITDAYYGLLVV  128

Query  383  GSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGR  562
              +GGLA  L     G  F F DS+ +DQ  G  YF++SG IF T +   IA SGDT+GR
Sbjct  129  KPSGGLATPLVTSFEGTPFSFLDSLDIDQEEGVIYFIDSGAIFRTGNRVLIALSGDTTGR  188

Query  563  LLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVL  742
            L KY+ AT QVT +L  L+GP G A+S+D +F+ ++  IG++I + +++G KA +++ V 
Sbjct  189  LFKYDIATKQVTLLLNKLSGPAGIALSKDKSFLLVSEAIGKRIRRFWLKGAKANSSD-VF  247

Query  743  ENLGGNPEFVKRATSLSGGFWVPVNTPREQQ-PSPMTDSIAVKFDRNGKILETRNLTKDY  919
             N+ GNP+ +KR  ++SG FWV V T + +    P   S   + +++GK++ETR+ T  Y
Sbjct  248  ANIDGNPDNIKR--TVSGDFWVAVVTVKTKVLIIPTIISTGQRINQSGKLVETRDFTAQY  305

Query  920  PKLLG--SYFEYFGKAYTGSLEADFVGV  997
                G     EY  K Y GSL+ +F+GV
Sbjct  306  MSFNGITEVQEYNDKLYIGSLDQNFIGV  333



>ref|XP_002274134.3| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=329

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 193/330 (58%), Gaps = 14/330 (4%)
 Frame = +2

Query  26   MFWVSMLMFISSLCMIHSHPERDLIAKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDGRILK  202
            M  + +L+F S   + H+        +L+L  N  GP+  AFD  GGGPYTGV DGR+LK
Sbjct  1    MISIFLLLFFS---VPHTVLTLSFFTQLQLPPNVTGPEALAFDRLGGGPYTGVSDGRVLK  57

Query  203  FS--NGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLL  376
            +   +  F DFA T+P R+K  CDGT   N    CGRPLG+ FN  TG LYIAD + GLL
Sbjct  58   YGGPSAGFTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAYSGLL  117

Query  377  RVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTS  556
             VGSNGGLA  +A    G  F F + + +DQLTG+ YF ++  ++   D  +  ++ D S
Sbjct  118  VVGSNGGLATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVENNDAS  177

Query  557  GRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTET  736
            GRLLKY+ +T QVT ++ GL+GP G A+S D +F+ ++ FI  +  K ++RGPKA T+E 
Sbjct  178  GRLLKYDPSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKANTSE-  236

Query  737  VLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKD  916
            +     G P+ +K  TS++  FWV VN  +     P T     + D +G +L+T N   +
Sbjct  237  LFFTFQGRPDNIK--TSITDTFWVAVNIGKS---VPTTVPTGQRMDAHGNVLQTVNFEAE  291

Query  917  YPKLLGSYFEYFGKA--YTGSLEADFVGVY  1000
            Y   + S  +  G+   Y GS +A +VGVY
Sbjct  292  YGSTMISEVQGRGEIFLYVGSRDASYVGVY  321



>ref|XP_006345203.1| PREDICTED: strictosidine synthase 1-like [Solanum tuberosum]
Length=337

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 187/303 (62%), Gaps = 9/303 (3%)
 Frame = +2

Query  104  KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTN  277
            +LKLQ + GP   AFDP+G GPY  V DGR++K+ + N  F +FAITSP RTK++CDGTN
Sbjct  36   QLKLQTS-GPDSAAFDPKGDGPYACVGDGRVIKYKDPNVGFTEFAITSPNRTKKRCDGTN  94

Query  278  GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
                  +CGRP GL F  +TGDLYI D ++GL+    +GGL  ++A    G  F F DS+
Sbjct  95   DPISQPVCGRPYGLGFYDKTGDLYITDAYYGLVMAKPSGGLVTRVATSFEGTPFAFLDSL  154

Query  458  SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
             +DQ  G  YFV+SG IF T +   IA SGDT+GRL KY+ AT QVT +L  L+GP G A
Sbjct  155  DIDQEMGIIYFVDSGAIFRTGNRLLIALSGDTTGRLFKYDIATKQVTLLLNKLSGPAGIA  214

Query  638  ISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVN  817
            +S+D +++ ++  I +K  + ++ G  A +++ V  N+ GNP+ +KR    SG FWV V 
Sbjct  215  LSKDKSYLLVSETIAKKNRRFWLTGANANSSD-VFANIDGNPDNIKRTE--SGDFWVAVV  271

Query  818  TPR-EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLG--SYFEYFGKAYTGSLEADF  988
            + + +    P   S   + +  G+++ETR+ T  Y  + G     E+ GK Y GSL+  F
Sbjct  272  SIKLKYLIVPAIISTGQRMNEKGEVVETRDFTAQYKGINGITEVQEHKGKLYVGSLDQKF  331

Query  989  VGV  997
            +GV
Sbjct  332  IGV  334



>ref|XP_010319099.1| PREDICTED: strictosidine synthase 1-like [Solanum lycopersicum]
Length=336

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 186/295 (63%), Gaps = 8/295 (3%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP   AFD +G GPYTGV DGR+ K+   N  F +FAITSP RTK+ C+GTN       C
Sbjct  42   GPDSAAFDTKGDGPYTGVGDGRVFKYQGPNTGFTEFAITSPNRTKQICNGTNDPISQISC  101

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRP GL F  +TGDLYI D ++GLL V  +GGLA  L     G+ F F DS+ +DQ  G 
Sbjct  102  GRPYGLGFYSKTGDLYITDAYYGLLVVKPSGGLATPLVTSFEGRPFGFLDSLDIDQEMGI  161

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YFV++G IF T++   IA SGDT+GRL KY+ AT QVT +L+ L+GP G A+S+D +++
Sbjct  162  IYFVDAGAIFRTSNRFLIALSGDTTGRLFKYDIATKQVTLLLSKLSGPAGVALSKDKSYL  221

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR-EQQP  838
             ++  IG++I + ++ G KA +++ V  N+ GNP+ +KR  ++SG FWV V + R +   
Sbjct  222  LVSEAIGKRITRFWLEGTKANSSD-VFTNIDGNPDNIKR--TVSGDFWVAVVSVRIKLLI  278

Query  839  SPMTDSIAVKFDRNGKILETRNLTKDYPKLLG--SYFEYFGKAYTGSLEADFVGV  997
             P  +S   + ++ G+++ETR+ T  Y    G     E   K Y GSL+ +F+GV
Sbjct  279  IPTLNSTGQRINQLGEVVETRDFTAQYTSANGITEVQECNDKLYIGSLDQNFIGV  333



>emb|CBI15377.3| unnamed protein product [Vitis vinifera]
Length=693

 Score =   236 bits (602),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 136/334 (41%), Positives = 195/334 (58%), Gaps = 14/334 (4%)
 Frame = +2

Query  14   KSLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDG  190
             ++ M  + +L+F S   + H+        +L+L  N  GP+  AFD  GGGPYTGV DG
Sbjct  11   STVAMISIFLLLFFS---VPHTVLTLSFFTQLQLPPNVTGPEALAFDRLGGGPYTGVSDG  67

Query  191  RILKFS--NGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIH  364
            R+LK+   +  F DFA T+P R+K  CDGT   N    CGRPLG+ FN  TG LYIAD +
Sbjct  68   RVLKYGGPSAGFTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAY  127

Query  365  FGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQS  544
             GLL VGSNGGLA  +A    G  F F + + +DQLTG+ YF ++  ++   D  +  ++
Sbjct  128  SGLLVVGSNGGLATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVEN  187

Query  545  GDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAK  724
             D SGRLLKY+ +T QVT ++ GL+GP G A+S D +F+ ++ FI  +  K ++RGPKA 
Sbjct  188  NDASGRLLKYDPSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKAN  247

Query  725  TTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRN  904
            T+E +     G P+ +K  TS++  FWV VN  +     P T     + D +G +L+T N
Sbjct  248  TSE-LFFTFQGRPDNIK--TSITDTFWVAVNIGKS---VPTTVPTGQRMDAHGNVLQTVN  301

Query  905  LTKDYPKLLGSYFEYFGKA--YTGSLEADFVGVY  1000
               +Y   + S  +  G+   Y GS +A +VGVY
Sbjct  302  FEAEYGSTMISEVQGRGEIFLYVGSRDASYVGVY  335


 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 132/341 (39%), Positives = 188/341 (55%), Gaps = 13/341 (4%)
 Frame = +2

Query  2    TTNMKSLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQN-----AFGPKDTAFDPRGGG  166
            T+ +  L M  + + +F+S    +H      +  K +        A GP+  AFD  GGG
Sbjct  348  TSILTMLVMLSIFLSIFLSFYSQLHLSSGEHVTYKAQFLERLPLPATGPESIAFDAAGGG  407

Query  167  PYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTG  340
            PYTG+ DGRILK+ NG+  FV+FAITS   ++E C G     L   CGRP GL F+ +TG
Sbjct  408  PYTGISDGRILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDFTCGRPFGLGFHYQTG  467

Query  341  DLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTN  520
            DLYIAD ++GL+ VG NGG+A QLA   +G  F F +++ +D  TG  Y V+    F  N
Sbjct  468  DLYIADAYYGLMVVGPNGGVATQLANAADGVPFGFTNALDVDTETGMVYLVDYSSQFSVN  527

Query  521  DFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKH  700
            +F+   Q+ D +GRL+KY+  + ++T +L GL G  G AIS+D +FI IT  + ++I K 
Sbjct  528  EFSVSLQAHDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDGSFILITETVTKRIRKF  587

Query  701  YIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP-MTDSIAVKFDR  877
            +++GPKA T+E +L+     P  +KR  +  G FWV      E    P    S  ++   
Sbjct  588  WLQGPKATTSE-ILKEFTVRPANIKR--NEEGEFWVAFLVADETGSCPSQQQSPGLRISG  644

Query  878  NGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
            +G ILE  +L  D    +     Y GK Y GS    FV VY
Sbjct  645  DGMILEAISL--DTQSGISEVAVYNGKMYIGSPFLHFVDVY  683



>emb|CDP21322.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/334 (40%), Positives = 196/334 (59%), Gaps = 16/334 (5%)
 Frame = +2

Query  14    KSLTMFWVSMLMFISS-LCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDG  190
             +++  F+V +  F+ + LC  H       + KL L +  GP+  AFD  GGGPYT V DG
Sbjct  61    ETILCFYVLVFCFLPTVLCAGH-------LKKLYLPDP-GPESFAFDWAGGGPYTSVADG  112

Query  191   RILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIH  364
             R+LK+      FVDF + S    ++ CDGTN T++  ICGRP GL F  +TG+LY+AD  
Sbjct  113   RVLKYEGPKVGFVDFQVLSSHMPRKFCDGTNRTDISQICGRPTGLGFYYKTGELYLADGG  172

Query  365   FGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQS  544
              GL+ +G  GG  KQLA+   G  F F D + +DQ TG  YF ++   +  +  A +  +
Sbjct  173   LGLVVIGPKGGPGKQLASAAGGLRFGFPDGLEVDQRTGIVYFTDASSRYNISQIAEVVAN  232

Query  545   GDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAK  724
              D +GRLLKY+  T +VT +L GLAG  G AISED +++ +T F+  ++ K++++GP A 
Sbjct  233   RDQTGRLLKYDPRTKKVTVLLRGLAGAAGVAISEDGSYLLVTEFVKARVSKYWLKGPLAH  292

Query  725   TTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRN  904
             T+  V+ NL G P+ +KR +  +G +W+ V T + Q+P+P       K + NGKILET  
Sbjct  293   TSH-VIANLSGAPDKIKRNS--AGDYWIAV-TVQSQKPTPTLQLQGQKINGNGKILETIT  348

Query  905   LTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              +  +   L+    EY  K Y GS+   +VGVYR
Sbjct  349   FSPGFNSSLITEVQEYKRKLYLGSIYIGYVGVYR  382



>ref|XP_011071027.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 12-like [Sesamum 
indicum]
Length=335

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/301 (43%), Positives = 186/301 (62%), Gaps = 10/301 (3%)
 Frame = +2

Query  122   AFGPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKCDGTNGTN--L  289
             A G +  AFD    GPYTG+ DGRI+K+      FV+FA TS  R+KE CDGT+GT+  +
Sbjct  31    AVGSESYAFDSHNVGPYTGLNDGRIVKYQGPETGFVEFATTSANRSKEFCDGTDGTDPIV  90

Query  290   LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
               ICGR +G++FN +TG+LY+ D ++GL+ VGS GGLA QLA G + + F   DS+++D 
Sbjct  91    TLICGRAIGMEFNHKTGELYLVDANYGLMVVGSRGGLATQLAGGGDAERFDQVDSLAIDP  150

Query  470   LTGDAYFVESGEIFL-TNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISE  646
              TG  Y  + G IF  T +   I  SGDTSGRLLKY+  T  +T +L GLA   G A+SE
Sbjct  151   TTGAVYIGDIGTIFQKTKNMTEILLSGDTSGRLLKYDPKTKGLTVLLRGLAMANGVAVSE  210

Query  647   DHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR  826
             D +F+ ++ +I  +I +++++GPKA T+E  +E L GNP+ ++R    SG FWV VN  +
Sbjct  211   DGSFVLVSEYITCRITRYWLKGPKANTSEIFVE-LPGNPDNIQRTE--SGDFWVVVNI-Q  266

Query  827   EQQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             +  P     +   +   NG+ILET N   +Y    +    E+ G  Y  S++ +FVGVYR
Sbjct  267   KLYPKLTCFAFGQRISANGRILETLNFFAEYNTTYITEVHEHLGSLYLASVDTNFVGVYR  326

Query  1004  A  1006
              
Sbjct  327   G  327



>ref|XP_011071025.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 12-like [Sesamum 
indicum]
Length=337

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 187/306 (61%), Gaps = 11/306 (4%)
 Frame = +2

Query  104   KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKCDGTN  277
             KL+L  A G +  AFD    GPYTG+ DGRI+K+      FV+FA TS  R+KE CDGT+
Sbjct  26    KLQLP-AVGSESYAFDSHNVGPYTGLSDGRIVKYQGPETGFVEFATTSANRSKELCDGTD  84

Query  278   GTNL--LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFAD  451
             G +L     CGR LG++F+ +TG+LY+ D  +GL+ VGS GGLA QLA G +G+ F  AD
Sbjct  85    GNDLKLTETCGRALGMEFDHKTGELYLVDAVYGLMVVGSGGGLATQLAGGKDGERFDEAD  144

Query  452   SVSLDQLTGDAYFVESGEIF-LTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             ++ +D  TG+ Y  + G +   TN+   I  S + +GRLLKY+  T ++T +L GLA   
Sbjct  145   ALDIDPNTGEIYIGDLGTLLHKTNNLTEILLSEERTGRLLKYDPKTKKLTVLLKGLALAA  204

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G A+S+D +F+ +  +I  +I +++++GPKA T+E  +E L GNP+ +KR  + SG FWV
Sbjct  205   GVAVSKDGSFVLVGEYIACRITRYWLKGPKATTSEIFVE-LPGNPDNIKR--TKSGDFWV  261

Query  809   PVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEAD  985
              VN  R  QP P   ++  K   +G+ILET N   +Y    +    E+ G  Y  S  A+
Sbjct  262   AVNIQR-LQPKPSCFALGQKIGADGQILETVNFYAEYNATSVAEVQEHHGLMYLSSTNAN  320

Query  986   FVGVYR  1003
             F GVY 
Sbjct  321   FAGVYE  326



>ref|XP_010663511.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=330

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 171/294 (58%), Gaps = 9/294 (3%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPY  V DGR+LK+   +  FVDF + SP R+K+ CDG++       C
Sbjct  41   GPEALAFDCSGAGPYASVADGRVLKWQAESAGFVDFTVASPSRSKQLCDGSSDPAKEPTC  100

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLG+ FN +TGDLYIAD ++GL  VG +GG A QLA    G  F F ++V +DQ TG 
Sbjct  101  GRPLGIGFNNKTGDLYIADAYYGLFVVGPDGGRATQLATEAEGVPFRFLNAVDVDQETGI  160

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++   F   +F     +GD +GRL+KY+  T QVT +L GL   VG AI++D +F+
Sbjct  161  VYFTDASARFQRREFQNAVLAGDMTGRLMKYDPRTKQVTVLLRGLGLAVGVAINKDGSFV  220

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             ++ FI  +I ++++RGPKA T+E  L+   G P+ +KR  +  G FWV  N   E   +
Sbjct  221  LVSEFIATRIQRYWLRGPKANTSELFLKPT-GTPDNIKR--NARGEFWVAANIGAEMAAA  277

Query  842  PMTDSIAVKFDRNGKILETRNL-TKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
                 + ++    GKIL+     T D  + +    EY G  Y GSL   FVGV+
Sbjct  278  A---PLGLRVSEEGKILQVVAFDTGDITRTISEVHEYNGALYVGSLALPFVGVF  328



>emb|CDP10794.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 191/323 (59%), Gaps = 17/323 (5%)
 Frame = +2

Query  59    SLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFA  232
             SL +  SH  + LI       + G +  AFDP GGGPYT + DGRI+K+  S   F DFA
Sbjct  16    SLQVHASHSFKKLILP-----SIGSEACAFDPHGGGPYTSLSDGRIVKYQGSRIGFTDFA  70

Query  233   ITSPFRTKEKCDGT---NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLA  403
              T   R+K+ CDG    +   L + CGRP+GL+F+++TGDLY+ D   G + VG  GG+A
Sbjct  71    TTVANRSKKLCDGIVPGDNVELAAKCGRPIGLEFDQKTGDLYVIDAFHGPMVVGPKGGIA  130

Query  404   KQLAAGINGKNFIFADSVSLDQLTGDAYFVESGE-IFLTNDFARIAQSGDTSGRLLKYEA  580
               L + ++G      D++ +D +TG  ++ + G  I    +      SGDT+GRLLKY+ 
Sbjct  131   TPLTS-MDGVPVDVPDAIDVDPVTGTVFYTDIGPGILKIKNMTAFLLSGDTNGRLLKYDP  189

Query  581   ATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGN  760
              T Q T +LTGL+GP G A+S+D +F+ I+ ++  +I K +++GPKA ++E VL NL G+
Sbjct  190   KTRQRTVLLTGLSGPNGVAVSKDGSFVLISEYVAGRIRKFWVKGPKANSSE-VLVNLPGS  248

Query  761   PEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKL-LGS  937
             P+ +KR    SG FWVPVN      P   T  +A KF+  G+ILET N   +Y  + +  
Sbjct  249   PDNIKRTG--SGDFWVPVNI-ENLLPRKTTFPLAQKFNSYGQILETVNFYAEYNNIYITE  305

Query  938   YFEYFGKAYTGSLEADFVGVYRA  1006
               ++ G  Y  S+ A+FVGV+R 
Sbjct  306   VHQHLGSLYVASVYANFVGVFRG  328



>ref|XP_010099019.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76377.1| Strictosidine synthase 1 [Morus notabilis]
Length=325

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 186/329 (57%), Gaps = 10/329 (3%)
 Frame = +2

Query  26   MFWVSMLMF-ISSLCMIHSHPERDLIAKLKL-QNAFGPKDTAFDPRGGGPYTGVRDGRIL  199
            MF++ +++  + S C++ S  +     KL L   + GP+   FD  G GPYTG+ DGRI+
Sbjct  1    MFFILLILLSVPSNCIVLSQ-KISTFRKLYLPTTSVGPESITFDSLGRGPYTGISDGRIV  59

Query  200  KFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGL  373
            ++      FVDFA TS  R+K  CDGTN   L  ICGRPLG++F  R   L+IAD   GL
Sbjct  60   RYDEHTTGFVDFAYTSRNRSKALCDGTNDPALRPICGRPLGIEFFHRKNMLFIADAFLGL  119

Query  374  LRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDT  553
              VG NGGLA  LA    G  F F + +S+DQ TGD YF +    FL +       + D+
Sbjct  120  FVVGPNGGLATGLATAAEGTPFRFLNGLSVDQHTGDVYFTDFSSKFLQSQILDAIAANDS  179

Query  554  SGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTE  733
            +GRLLKY+  + +V  +L+GL+G  G AIS D +++ +   I  +  + ++RG +A T+E
Sbjct  180  TGRLLKYDCRSKKVRVLLSGLSGANGVAISSDRSYLLVAETIAYRTRRFWLRGTRAFTSE  239

Query  734  TVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTK  913
             V+    G P+ +KRA   SG FWV VN PR + PS +   I  + +  G  L+T  L +
Sbjct  240  -VVAKFPGRPDNIKRAP--SGDFWVAVNIPRTEVPSSVPAEI--RINGAGGNLQTLPLDQ  294

Query  914  DYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
             Y   +    +   + Y GS +ADFVGV+
Sbjct  295  YYNTTVSELLQRGSRYYAGSAQADFVGVF  323



>emb|CDP21857.1| unnamed protein product, partial [Coffea canephora]
Length=337

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/297 (41%), Positives = 178/297 (60%), Gaps = 9/297 (3%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFR--TKEKCDGTNGTNLLS  295
             GP+  AFD  G GPYTGV DGRILK+      FV++  T   R  +K+ CD  + T+L  
Sbjct  43    GPESYAFDLAGHGPYTGVADGRILKYEGPILGFVEYGYTKENRQESKQLCDNIDTTDLAK  102

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
             ICGRPLG+ F  +TG+L+ AD   GL+ VG  GG  KQLA+G  G  F   D + +D+ T
Sbjct  103   ICGRPLGIGFYYKTGELHTADAGLGLVVVGPEGGPGKQLASGAEGVPFGLPDGLEVDKKT  162

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             G  +F E+   +  +  ++I  + D SGRLLKY+  T +VT +L  LAGP G AIS D +
Sbjct  163   GVIFFTEASSRYNISQISQIISTRDASGRLLKYDPQTKKVTVLLRSLAGPAGVAISRDGS  222

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
             ++ +T F+ ++++K++++GP A TT  VL NL G+P+ +KR +   G +W+ +N  + Q 
Sbjct  223   YLLVTEFLNQRVLKYWLKGPLANTTR-VLVNLSGSPDKIKRNS--RGDYWIGLNV-QSQG  278

Query  836   PSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             P+P T     + +  G ILET   + D+   ++    EY G  Y GSL   +VGVYR
Sbjct  279   PNPTTIIQGQRINGKGHILETITFSPDFNASVITEVQEYKGALYLGSLFVGYVGVYR  335



>ref|XP_010663512.1| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=335

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/325 (38%), Positives = 176/325 (54%), Gaps = 9/325 (3%)
 Frame = +2

Query  47    MFISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNG--N  217
             +FI  LC+        L  KL+L ++  GP+  AFD +G GPYTGV DGR+LK+      
Sbjct  13    IFIFLLCLPSGVLPFTLFNKLQLPSSITGPESLAFDLKGEGPYTGVSDGRVLKYQGPAVG  72

Query  218   FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGG  397
             F DFA+TSP RT+E CDG+    L + CGRPLGL FN  TGDLY+ D + GL+ VGS+GG
Sbjct  73    FTDFAVTSPNRTEEMCDGSIDPALEATCGRPLGLGFNYHTGDLYMVDAYLGLMVVGSSGG  132

Query  398   LAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYE  577
             +A QLAA   G  F F   + +DQ  G  YF E+   F   D   +  S D++G L +Y+
Sbjct  133   IATQLAAAAEGIPFRFLAGLDVDQGNGMVYFTEASTRFQLRDMQELIASNDSTGSLFRYD  192

Query  578   AATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGG  757
               + +V  +L GL+  VG A+S D  F+ +      +I + ++ GPKA T+E  +E L G
Sbjct  193   PQSREVRVLLGGLSVAVGVAVSRDGMFVLVAELTANRIRRFWLGGPKANTSEVFMELL-G  251

Query  758   NPEFVKRATSLSGGFWVPVNTP--REQQPSPMTDSIAVKFDRNGKILETRNLTKDYP-KL  928
              P  +KR     G FWV +N        P  +   + ++   +G++LE   L   Y    
Sbjct  252   KPSNIKRNE--RGEFWVAINNALGPPAPPESLVMPLGLRLSNDGRVLEVAPLVGAYQISA  309

Query  929   LGSYFEYFGKAYTGSLEADFVGVYR  1003
             +    E  G+ Y  SL A +  +YR
Sbjct  310   ISEVQERNGELYVASLVAAYASIYR  334



>emb|CDP21321.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 183/329 (56%), Gaps = 16/329 (5%)
 Frame = +2

Query  29    FWVSMLMFISSL-CMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF  205
             F+V +L F+ ++ C  H       + KL L +  GP   AFD  G GPYTGV DGRI K+
Sbjct  17    FYVFVLCFLPAVFCAGH-------LQKLHLPDP-GPDSFAFDSAGQGPYTGVADGRIFKY  68

Query  206   SNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLR  379
                   FV++  +   R+   CDGTN T L   CGRP GL F  +TG+LY+AD   GL+ 
Sbjct  69    KGPKVGFVEYGYSKADRSARFCDGTNSTALAKSCGRPSGLGFYYKTGELYVADDGVGLVV  128

Query  380   VGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSG  559
             +G  GG  K LA+G     F   D + +DQ TG  YF ++   +  N+  +I  SGD++G
Sbjct  129   IGPKGGAGKVLASGAEKVPFGLPDGLDVDQNTGIVYFTDATARYTINEIPQIIASGDSTG  188

Query  560   RLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETV  739
             RLLKY   T +VT +L  LAGP G AIS+D +++ +T F+  ++ K+++RGPKA T   V
Sbjct  189   RLLKYNPRTKKVTVLLRRLAGPAGVAISKDRSYLLVTEFLKSRVWKYWLRGPKANTAH-V  247

Query  740   LENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY  919
             L N+ G+P  + R     G FW+ +   R Q P+P      ++ +  GKILET      +
Sbjct  248   LLNVPGSPSKIVRNN--VGDFWLAMTVKR-QVPTPRIKLQGLRINGYGKILETITFNPGF  304

Query  920   -PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
                ++    E+ G  Y GSL   +VGVYR
Sbjct  305   DSSMITEVHEHKGALYLGSLYVGYVGVYR  333



>gb|AFK49369.1| unknown [Lotus japonicus]
Length=334

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/333 (37%), Positives = 191/333 (57%), Gaps = 16/333 (5%)
 Frame = +2

Query  35   VSMLM--FISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKF  205
            V+M++  F + + ++ +     L+ +L L +   GP+  AFD  G GPY    DGRI K+
Sbjct  5    VTMMISVFATFIFLVCTPSAALLLNRLPLPSPLTGPEALAFDRNGSGPYVSSSDGRIFKY  64

Query  206  --SNGNFVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLL  376
               N  F ++A TSP R K  CDG  + + L + CGRPLGL FN +TG+LY+AD +FGLL
Sbjct  65   VGPNEGFQEYAYTSPNRNKITCDGLADFSTLQATCGRPLGLGFNHQTGELYVADAYFGLL  124

Query  377  RVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTS  556
            ++G+NGG   QL     G + +FAD + +D  TG  YF E+   F   D + I  SGD++
Sbjct  125  KIGANGGPPIQLVGPAQGNSSMFADGLDIDPDTGIVYFTEASANFQIKDISTILTSGDST  184

Query  557  GRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTET  736
            GRLLKY+ +T Q T +L+ LA P G A+S D +F+ ++ F+  +I + +++GP+A  ++T
Sbjct  185  GRLLKYDPSTNQTTVLLSDLAVPNGVAVSRDGSFVLVSEFMENRIQRFWLKGPRANLSDT  244

Query  737  VLENLGGNPEFVKRATSLSGGFWVPVNT----PREQQPSPMTDSIAVKFDRNGKILETRN  904
             +  L G P+ +KR +   G FWV VN+    PR  +P        V+   NG +L+  +
Sbjct  245  FIR-LAGKPDNIKRNS--RGQFWVAVNSYLGLPR--RPIRRVLPSGVRISENGLVLQVVS  299

Query  905  LTKDYPKLLGSYFEYF-GKAYTGSLEADFVGVY  1000
            L ++Y     S  + F G  Y GSL   +  ++
Sbjct  300  LAQEYGTEPASEVQEFNGTLYAGSLFVSYASIF  332



>emb|CAN77945.1| hypothetical protein VITISV_044021 [Vitis vinifera]
Length=361

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/328 (41%), Positives = 185/328 (56%), Gaps = 15/328 (5%)
 Frame = +2

Query  35    VSMLMFISSLCMIHSHPERDLIAKLKLQN-AFGPKDTAFDPRGGGPYTGVRDGRILKF--  205
             ++ ++FI       SH    ++ +LKL +   GP+  AFD  G GPY  V DGR+LK+  
Sbjct  45    LAHVLFIIPNMWYLSH----VVLRLKLPSPTVGPEAIAFDYTGAGPYASVADGRVLKWLD  100

Query  206   SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVG  385
             ++  FVDFA  SP R+K+ CDG+    L   CGRPLGL FN RT DLYIAD + GL  VG
Sbjct  101   ASAGFVDFAFISPSRSKKLCDGSTDPALEPTCGRPLGLGFNYRTVDLYIADAYHGLNVVG  160

Query  386   SNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRL  565
                G   QLA    G  F+F ++V +DQ TG  YF ++   F   +F    Q+GD +GRL
Sbjct  161   PKDGRIIQLATAAEGVPFLFLNAVDVDQETGIVYFTDASARFQRREFMLAVQTGDMTGRL  220

Query  566   LKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLE  745
             +KY+  T +VT +L GL G  G  IS+D +FI +T F+  +I + +++GPKA T+E  L+
Sbjct  221   MKYDPRTQEVTVLLRGLGGAGGVTISKDGSFILVTEFVTNRIQRFWLKGPKANTSELFLK  280

Query  746   NLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNL-TKDYP  922
                G P+ +KR  ++ G FWV VN        P      ++    GK+L+     T D P
Sbjct  281   P-PGTPDNIKR--NVRGEFWVAVNIGAGTAVLPS----GLRLSEEGKVLQVVAFGTGDIP  333

Query  923   KLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
             K +    EY+   Y GSL   FVGVYR+
Sbjct  334   KTISEVQEYYRALYIGSLALPFVGVYRS  361



>ref|XP_002274235.1| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=342

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 176/336 (52%), Gaps = 16/336 (5%)
 Frame = +2

Query  35    VSMLMFISSLCMIHSHPERDLIAKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDGRILKF--  205
             V + +FI  LC            +L+L  N  GP   AFD   GGPY GV DGRI+++  
Sbjct  11    VFLSIFILFLCFPAKVCSLSSFTQLQLPPNVTGPVSLAFDLTVGGPYAGVNDGRIIRYGG  70

Query  206   SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVG  385
             ++  F DFA  +P R+K  CDGT   +    CGRPLGL FN     +YIAD + GL   G
Sbjct  71    TDVGFTDFAFCTPTRSKAVCDGTTDPDSGPTCGRPLGLSFNNLRNQMYIADAYSGLFVAG  130

Query  386   SNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSG------  547
             +NG LA +LA    G  F F + + +D L+G  YF +        + +R   SG      
Sbjct  131   TNGRLATKLATSAEGVPFCFLNGLDVDPLSGLVYFTDFSTTIQLRNISRALASGNTTQFS  190

Query  548   -DTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAK  724
              D +GRLL+Y+  T  VT +L GL+G  G A+S D  F+ ++ F   +I+K ++RGPKA 
Sbjct  191   SDATGRLLRYDPETKNVTVLLRGLSGAAGTAVSNDGMFVLVSEFNANRILKFWLRGPKAS  250

Query  725   TTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRN  904
             T ET + +  G P  +KR  + SG FWV VN P  Q P P T     +    G ILET +
Sbjct  251   TAETFV-SFRGRPVNIKR--TASGNFWVAVNVPNNQSP-PTTILTGQRISYYGTILETVS  306

Query  905   LTKDY--PKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
                 Y    L+    ++ G  Y G+  A+FVGV+ A
Sbjct  307   FDDQYGGSTLITEVQQHLGALYIGANSANFVGVHMA  342



>gb|AES93117.1| strictosidine synthase [Camptotheca acuminata]
Length=330

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/299 (42%), Positives = 174/299 (58%), Gaps = 13/299 (4%)
 Frame = +2

Query  122   AFGPKDTAFD-PRG-GGPYTGVRDGRILKFSN--GNFVDFAITSPFRTKEKCDGTNGTNL  289
             A GP    FD P G G  YTG+ DGRI+++      FV++  T+P R +  CDGTN T L
Sbjct  39    APGPASFTFDLPLGIGALYTGLADGRIVRYQRLRSTFVNYGYTAPNRNQAFCDGTNNTFL  98

Query  290   LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
               ICGRPLGL F   T  LY AD  FGL+ +   GG A QLA G++G  F +  +V +DQ
Sbjct  99    APICGRPLGLAFQFGTRRLYAADAAFGLVVIEPYGGPATQLATGVDGVRFRYPAAVDVDQ  158

Query  470   LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
              +G  YF ++   F  +  +++ ++ DT+GRLLKY+  T QVT +L GLAGP   AIS D
Sbjct  159   FSGTVYFTDASTRFNLSQLSQLIRTRDTTGRLLKYDPNTRQVTVLLRGLAGPFAVAISSD  218

Query  650   HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
              T++ I+ FI  +I K+++ GP A T E VL N+ G+P  ++R  ++ G FWV +N    
Sbjct  219   RTYVLISEFIRNRIQKYWLTGPNANTAE-VLLNVAGSPGNIRR--TIRGDFWVAINV---  272

Query  830   QQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             Q P+ +     +  D  G IL+T   + D+   L+    EY G  Y GSL   FVGVY+
Sbjct  273   QTPTVVLRGQRINGD--GTILQTETFSPDFNTTLITEVNEYGGALYLGSLYPKFVGVYK  329



>emb|CAN78855.1| hypothetical protein VITISV_013355 [Vitis vinifera]
Length=342

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/336 (38%), Positives = 176/336 (52%), Gaps = 16/336 (5%)
 Frame = +2

Query  35    VSMLMFISSLCMIHSHPERDLIAKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDGRILKF--  205
             V + +FI  LC            +L+L  N  GP   AFD   GGPY GV DGRI+++  
Sbjct  11    VFLSIFILFLCFPAKVCSLSSFTQLQLPPNVTGPVSLAFDLTVGGPYAGVNDGRIIRYGG  70

Query  206   SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVG  385
             ++  F DFA  +P R+K  CDGT   +    CGRPLGL FN     +YIAD + GL   G
Sbjct  71    TDVGFTDFAFCTPTRSKAVCDGTTDPDSGPTCGRPLGLSFNNLRNQMYIADAYSGLFVAG  130

Query  386   SNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSG------  547
             +NG LA +LA    G  F F + + +D L+G  YF +        + +R   SG      
Sbjct  131   TNGRLATKLATSAEGVPFCFLNGLDVDPLSGLVYFTDFSTTIQLRNISRALASGNTTQFS  190

Query  548   -DTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAK  724
              D +GRLL+Y+  T  VT +L GL+G  G A+S D  F+ ++ F   +I+K ++RGPKA 
Sbjct  191   SDATGRLLRYDPETKNVTVLLRGLSGAAGTAVSNDGMFVLVSEFNANRILKFWLRGPKAS  250

Query  725   TTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRN  904
             T ET + +  G P  +KR  + SG FWV VN P  Q P P T     +    G ILET +
Sbjct  251   TAETFV-SFRGRPVNIKR--TASGNFWVAVNVPNNQSP-PTTILTGQRISYYGTILETVS  306

Query  905   LTKDY--PKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
                 Y    L+    ++ G  Y G+  A+FVG++ A
Sbjct  307   FDDQYGGSTLITEVQQHLGALYIGANSANFVGIHMA  342



>ref|XP_003635414.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=322

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 165/269 (61%), Gaps = 11/269 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD    GPYTG+ DGRILK+  S   + +FAITSPFR  E CDG+    +  +C
Sbjct  39   GPESIAFDCNRDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPEFCDGSANPAMEQVC  98

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A  + G  F F +++ +DQ TG 
Sbjct  99   GRPLGLKFNEATCDLYIADAYFGLLVVGRNGGVAKQVAISVEGVPFRFTNALDIDQNTGV  158

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q+GD +GRLLKY+  T +VT +L GL+   G A+S+D  F+
Sbjct  159  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKDFV  218

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     K+ +++++G K++ ++T    L G P+ ++R  ++ G FWV  N        
Sbjct  219  LVTETTAAKVTRYWLQGQKSQLSDT-FTRLVGCPDNIQR--NIHGEFWVAQNNCGR----  271

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKL  928
            P     +VK +R G+I+E   L++D+  L
Sbjct  272  PELKVRSVKLNREGRIME--ELSEDFGPL  298



>dbj|BAJ53159.1| JHL10I11.5 [Jatropha curcas]
 gb|KDP20050.1| hypothetical protein JCGZ_05819 [Jatropha curcas]
Length=336

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 186/331 (56%), Gaps = 15/331 (5%)
 Frame = +2

Query  38    SMLMFISSLCMIHSHPERDL----IAKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDGRILK  202
             ++ M +S L +  + P   +      KL L     GP+  AFD +G GPYTGV DGR LK
Sbjct  10    AVAMLVSMLVLSFTIPSLAISISSFTKLPLPPQVMGPEAFAFDLQGQGPYTGVLDGRTLK  69

Query  203   FSNGN--FVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGL  373
             +   +  F+D+A  SP R+K  CDG TN +    ICGRPLG+ F + TG+LYIAD + GL
Sbjct  70    YQGPSLGFLDYAFDSPNRSKAACDGNTNPSAFGGICGRPLGIGF-QYTGELYIADANLGL  128

Query  374   LRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDT  553
             L   +NG LA+ +A+   G+ F F D + +  LT   +  ++   F  ++ A+   + D+
Sbjct  129   LVASTNGRLARAVASSAEGQPFKFLDGLDIYPLTKTVFLTDASSRFNFSELAQAVAANDS  188

Query  554   SGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTE  733
             +GR +KYE      T +L  L+ P G A+S D +F+ +T ++  +++K++++GPKA T+E
Sbjct  189   TGRFIKYEPNINTTTVLLRNLSAPAGVAVSLDGSFVLVTEYLANRVLKYWLKGPKANTSE  248

Query  734   TVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTK  913
               L    G P+ +KR  +  G FWV VN   ++ P+      AVK + +GKIL +  L+ 
Sbjct  249   -ALVTFQGRPDNIKR--NPLGDFWVAVNV--QETPTAPIVPTAVKINYSGKILASFPLSD  303

Query  914   DY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              Y    +    EY G  Y GSLE  FVG YR
Sbjct  304   QYNTTTISEVNEYDGNLYIGSLETKFVGKYR  334



>ref|XP_009597336.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=270

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/329 (41%), Positives = 177/329 (54%), Gaps = 65/329 (20%)
 Frame = +2

Query  26   MFWVSMLMFISSLCMIHSHPERDLIAKLKL-QNAFGPKDTAFDPRGGGPYTGVRDGRILK  202
            MF + +L+F SSL      P      KL+L Q   GP  TAFD +G GPYT V DGR+LK
Sbjct  1    MFSMLLLIFSSSLAYSSQLPPLQF-KKLQLPQQTVGPDSTAFDLKGNGPYTSVADGRVLK  59

Query  203  FSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLL  376
            +   N  F+DFA TSP RTKE+CDGTN  NLL   GRPLG+ F  +TGDLYI DI++GLL
Sbjct  60   YQGPNIGFIDFATTSPLRTKEECDGTNDPNLLITRGRPLGVGFYYKTGDLYITDINYGLL  119

Query  377  RVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTS  556
             VGSNGGLA QL +GI+G  F FAD++ +DQ+ G  YF++SG IF T             
Sbjct  120  SVGSNGGLATQLVSGIDGVPFAFADALDVDQIGGVIYFIDSGLIFRT-------------  166

Query  557  GRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTET  736
             R+ ++             L GP                              KA +TE 
Sbjct  167  -RIRRFW------------LKGP------------------------------KANSTE-  182

Query  737  VLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKD  916
            +  NL G+P+ +KR  ++ G + V VN  ++QQ +P   ++A + D  G ++ + NLT  
Sbjct  183  IFANLTGHPDNIKR--TILGDYCVAVNIVKQQQ-TPTIFALAQRVDVLGNVVLSLNLTAQ  239

Query  917  YPKLLGSYFEYFGKAYTGS-LEADFVGVY  1000
            YP       EYFG+ Y GS    +FVGVY
Sbjct  240  YPNSFSEVQEYFGRLYIGSFFLENFVGVY  268



>ref|XP_008811198.1| PREDICTED: strictosidine synthase 1-like [Phoenix dactylifera]
Length=324

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 175/308 (57%), Gaps = 22/308 (7%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLS  295
            A GP+  AFD  GGGPYTGV DGRI+K+      + DFA+ S +R +  C G+N + L S
Sbjct  22   AVGPESLAFDHLGGGPYTGVSDGRIVKWQGQGLGWADFAVHSKYRER-VCHGSNDSMLES  80

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            ICGRPLGL F + TGDLY+AD +FGLL V  NGG+A QLA G +G+ F FA+ + +DQ T
Sbjct  81   ICGRPLGLQFYKATGDLYVADAYFGLLVVAPNGGVATQLATGADGQPFNFANGLDVDQET  140

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            G  YF +S   F   D+      GD +GRL+ Y+     VT ++ GLA P G AIS D T
Sbjct  141  GVVYFTDSSTRFRRRDYILAVIMGDATGRLMNYDPKAKNVTVLIRGLAFPNGLAISNDTT  200

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ-  832
            F+ I      +++K++++GP+  T E V   L G P+ +KR  +  G FWV +N  + Q 
Sbjct  201  FLLIAETGTCRVLKYWLQGPRNGTFE-VFAELPGYPDNIKR--NPGGEFWVALNQDKVQL  257

Query  833  ------------QPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSL  976
                        +PS     +A++  + GK+LE   L +     +    E  G  + GS+
Sbjct  258  NGQTASDFGKTGEPSEH-HPVALRLSQEGKVLEV--LERRAATSVSEVEERNGTMWLGSV  314

Query  977  EADFVGVY  1000
            +  +VGVY
Sbjct  315  DMPYVGVY  322



>emb|CBI18784.3| unnamed protein product [Vitis vinifera]
Length=334

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 165/269 (61%), Gaps = 11/269 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD    GPYTG+ DGRILK+  S   + +FAITSPFR  E CDG+    +  +C
Sbjct  51   GPESIAFDCNRDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPEFCDGSANPAMEQVC  110

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A  + G  F F +++ +DQ TG 
Sbjct  111  GRPLGLKFNEATCDLYIADAYFGLLVVGRNGGVAKQVAISVEGVPFRFTNALDIDQNTGV  170

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q+GD +GRLLKY+  T +VT +L GL+   G A+S+D  F+
Sbjct  171  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKDFV  230

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     K+ +++++G K++ ++T    L G P+ ++R  ++ G FWV  N        
Sbjct  231  LVTETTAAKVTRYWLQGQKSQLSDT-FTRLVGCPDNIQR--NIHGEFWVAQNNCGR----  283

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKL  928
            P     +VK +R G+I+E   L++D+  L
Sbjct  284  PELKVRSVKLNREGRIME--ELSEDFGPL  310



>emb|CDO98507.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/334 (39%), Positives = 183/334 (55%), Gaps = 15/334 (4%)
 Frame = +2

Query  26    MFWVSMLMFISSLCMIHSHPERDLIAKLKLQN-AFGPKDTAFDPRGGGPYTGVRDGRILK  202
             M  +S+ + +S L  I +        +L L + A GP+  A D R  GPY  + DGR+LK
Sbjct  1     MAALSIFVIVSFLPSIIALDPYSKFIQLNLPSGATGPESVALDSRNEGPYCAISDGRVLK  60

Query  203   F--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLL  376
             +  SN  FVDFA TSP RTK+ CDGT   NL   CGRPLG  F+     LYI D   GL 
Sbjct  61    YIDSNTGFVDFAYTSPKRTKQLCDGTTDANLGPTCGRPLGFSFDNLINVLYIVDAFLGLF  120

Query  377   RVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSG---  547
             +VG +GGLA  LA    G    F   + ++ +T D Y  ++    LT D   I Q     
Sbjct  121   KVGPDGGLATLLANSAGGVKLNFLTGIDVNPITRDVYITDAS---LTYDLRNITQPNLVT  177

Query  548   DTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKT  727
             D+SGRL+KY     +VT +  GL+ P+G A+S D +F+  + +  ++++K+++ GPKA T
Sbjct  178   DSSGRLIKYNPRKNEVTVLQEGLSVPIGPAVSFDGSFVLFSEYSAKRVVKYWLLGPKANT  237

Query  728   TETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNL  907
             +E VL +L GNP  VKRA+++ G FWV V+    QQP   T     K D  G +L  ++L
Sbjct  238   SE-VLRDLPGNPSKVKRASNV-GEFWVAVDI-NVQQPR-FTTPYGYKIDSFGNLLFVKDL  293

Query  908   TKDYPKLLGSYF-EYFGKA-YTGSLEADFVGVYR  1003
                Y  +  S   EYFG     GS   +FVG+Y+
Sbjct  294   EDHYYNVPVSVVQEYFGTTLLVGSRGENFVGIYK  327



>emb|CBI28988.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 159/258 (62%), Gaps = 9/258 (3%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DG+ILK+  S   + +FAITSPFR  + CDG+    +  +C
Sbjct  39   GPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  98

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  99   GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  158

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A + Q GD +GRLLKY+  T +VT +L GL+   G A+SED  F+
Sbjct  159  VYFTDTSTIFQRWAYAIVMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKYFV  218

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     KI +++++G K++ ++T  + L G P+ ++R  ++ G FWV  N        
Sbjct  219  LVTEMTAAKITRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----  271

Query  842  PMTDSIAVKFDRNGKILE  895
            P      V+ ++ GKI+E
Sbjct  272  PEVKVRPVRLNKEGKIVE  289



>emb|CAN59852.1| hypothetical protein VITISV_000854 [Vitis vinifera]
Length=326

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 133/314 (42%), Positives = 170/314 (54%), Gaps = 19/314 (6%)
 Frame = +2

Query  95    LIAKLKL-QNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKC  265
             +  KL L +N   P   AFD  GGGPYTGV DGRI K+      F +FA T+P R+KE C
Sbjct  20    IFIKLPLPKNVTSPYSFAFDQLGGGPYTGVTDGRIFKYGGPKVGFTEFAFTAPNRSKEVC  79

Query  266   DGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
             DGT   NL  ICGRPLGL ++  +  LYIAD +FGLL VGSNGG A Q A    G  F F
Sbjct  80    DGTRDINLGPICGRPLGLGYDHSSXXLYIADAYFGLLAVGSNGGPATQAATSAEGVPFRF  139

Query  446   ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSG------DTSGRLLKYEAATGQVTEVL  607
                + +D +TG     +    +   D  +   SG      DT+GRLLKY+  T QVT +L
Sbjct  140   LSGLDVDPVTGTVXITDFSTEYELRDIRQALVSGNATVLSDTTGRLLKYDPRTSQVTVLL  199

Query  608   TGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATS  787
               L+G V  A+S D +FI +T F   +I K ++ G KA T E +L  L G P  ++  T+
Sbjct  200   RNLSGAVXTALSTDRSFILVTEFNANRIQKFWLEGTKASTAE-ILVGLEGRPTNIR--TT  256

Query  788   LSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAY  964
             L   FWV V+     Q +P T   A + D  G ILE+ N    Y   LL    EY G  Y
Sbjct  257   LE-SFWVAVSI----QSTPTTVPTAQRIDPYGNILESLNFAAQYGSNLLSEVQEYHGALY  311

Query  965   TGS-LEADFVGVYR  1003
              G+   ADFVG ++
Sbjct  312   IGAGPSADFVGYFK  325



>ref|XP_002275622.2| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=359

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 159/258 (62%), Gaps = 9/258 (3%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DG+ILK+  S   + +FAITSPFR  + CDG+    +  +C
Sbjct  76   GPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  135

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  136  GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  195

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A + Q GD +GRLLKY+  T +VT +L GL+   G A+SED  F+
Sbjct  196  VYFTDTSTIFQRWAYAIVMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKYFV  255

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     KI +++++G K++ ++T  + L G P+ ++R  ++ G FWV  N        
Sbjct  256  LVTEMTAAKITRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----  308

Query  842  PMTDSIAVKFDRNGKILE  895
            P      V+ ++ GKI+E
Sbjct  309  PEVKVRPVRLNKEGKIVE  326



>ref|XP_010655935.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=322

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 175/292 (60%), Gaps = 12/292 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR  + CDG+    +  +C
Sbjct  39   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSINPVMEQVC  98

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  99   GRPLGLKFNEATCDLYIADAYFGLLVVGRNGGVAKQVAINAEGVPFRFTNALDIDQNTGV  158

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q+GD +GRLLKY+  + +VT +L GL+   G A+S+D  F+
Sbjct  159  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKDKDFV  218

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     K+ +++++G K++ ++T  + L G P+ ++R  ++ G FWV  N        
Sbjct  219  LVTETTAAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----  271

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            P     +VK ++ GKI+E   L++D+   L    E     + GS+   ++G+
Sbjct  272  PELKVRSVKLNKEGKIME--ELSEDFGP-LSEVQEKDNDLWLGSVLLSYIGL  320



>emb|CBI28990.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 175/292 (60%), Gaps = 12/292 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR  + CDG+    +  +C
Sbjct  60   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSINPVMEQVC  119

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  120  GRPLGLKFNEATCDLYIADAYFGLLVVGRNGGVAKQVAINAEGVPFRFTNALDIDQNTGV  179

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q+GD +GRLLKY+  + +VT +L GL+   G A+S+D  F+
Sbjct  180  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKDKDFV  239

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     K+ +++++G K++ ++T  + L G P+ ++R  ++ G FWV  N        
Sbjct  240  LVTETTAAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----  292

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            P     +VK ++ GKI+E   L++D+   L    E     + GS+   ++G+
Sbjct  293  PELKVRSVKLNKEGKIME--ELSEDFGP-LSEVQEKDNDLWLGSVLLSYIGL  341



>emb|CBI28987.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 171/292 (59%), Gaps = 12/292 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR  + CDG+    +  +C
Sbjct  32   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  91

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  92   GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  151

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q GD +GRLLKY+  T +VT +L GL+   G A+SED  F+
Sbjct  152  VYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFV  211

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     K+ +++++G K++ ++T  + L G P+ ++R  ++ G FWV  N        
Sbjct  212  LVTETTAAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----  264

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            P      V+ ++ GKI+E   L+ D    L    E     + GS+   ++GV
Sbjct  265  PEVKVRPVRLNKEGKIVE--ELSVDVGP-LSEVQEKNNSLWLGSVILSYIGV  313



>emb|CAN78856.1| hypothetical protein VITISV_013356 [Vitis vinifera]
Length=600

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/309 (39%), Positives = 171/309 (55%), Gaps = 9/309 (3%)
 Frame = +2

Query  95    LIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRTKEKC  265
             L  KL+L ++  GP+  AFD +G GPYTGV DGR+LK+      F DFA+TSP RT+E C
Sbjct  294   LFNKLQLPSSITGPESLAFDLKGEGPYTGVSDGRVLKYQGPXVGFTDFAVTSPNRTEEMC  353

Query  266   DGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
             DG+    L + CGRPLGL FN  TGDLY+ D + GL+ VGS+GG+A QLAA   G  F F
Sbjct  354   DGSIDPALAATCGRPLGLGFNYHTGDLYMVDAYLGLMVVGSSGGIATQLAAAAEGIPFRF  413

Query  446   ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
                + +DQ  G  YF E+   F   D   +  S D++G L +Y+  + +V  +L GL+  
Sbjct  414   LAGLDVDQGNGMVYFTEASTRFQLRDMQELIASNDSTGSLFRYDPQSREVRVLLGGLSVA  473

Query  626   VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
             VG A+S D  F+ +      +I + ++ GPKA T+E  +E L G P  +KR  +  G FW
Sbjct  474   VGVAVSRDGMFVLVAELTANRIRRFWLGGPKANTSEVFMELL-GKPSNIKR--NERGEFW  530

Query  806   VPVNTP--REQQPSPMTDSIAVKFDRNGKILETRNLTKDYP-KLLGSYFEYFGKAYTGSL  976
             V +N        P  +   + ++   +G++LE   L   Y    +    E  G+ Y  SL
Sbjct  531   VAINNALGPPAPPESLVMPLGLRLSNDGRVLEVAPLVGAYQISAISEVQERNGELYVASL  590

Query  977   EADFVGVYR  1003
              A +  +YR
Sbjct  591   VAAYASIYR  599


 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 129/252 (51%), Gaps = 26/252 (10%)
 Frame = +2

Query  245  FRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGI  424
             R+K+ CDG+    L   CGRPLGL FN RT    I                  QLA   
Sbjct  63   LRSKKLCDGSTDPGLEPTCGRPLGLGFNYRTDGRII------------------QLATAA  104

Query  425  NGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEV  604
             G  F+F ++V +DQ TG  YF ++   F   +F    Q+GD +GRL+KY+  T +VTE+
Sbjct  105  EGVPFLFLNAVDVDQETGIVYFTDASARFQRREFMLAVQTGDMTGRLMKYDPRTQEVTEL  164

Query  605  LTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRAT  784
            L GL G  G  IS+D +FI +T F+  +I + +++G KA T++  L+   G P+ +K  +
Sbjct  165  LRGLGGAGGVTISKDGSFILVTEFVTNRIQRFWLKGRKANTSQLFLKP-PGTPDNIK--S  221

Query  785  SLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNL-TKDYPKLLGSYFEYFGKA  961
            +  G FWV VN        P+     ++    GK+L+     T D PK +    EY G  
Sbjct  222  NARGEFWVAVNIGAGTAVVPL----GLRLSEEGKVLQMVAFGTGDIPKTISEVQEYNGAL  277

Query  962  YTGSLEADFVGV  997
            Y GSL   FVGV
Sbjct  278  YIGSLPLHFVGV  289



>ref|XP_010658741.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
 emb|CBI40189.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/267 (43%), Positives = 163/267 (61%), Gaps = 10/267 (4%)
 Frame = +2

Query  104  KLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT  274
            KLKL +   GP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR  + C+G+
Sbjct  30   KLKLPSWVSGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCNGS  89

Query  275  NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADS  454
                +  +CGRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F ++
Sbjct  90   INPAMEQVCGRPLGLKFNEATCDLYIADAYFGLLVVGHNGGVAKQIAISAEGVPFRFTNA  149

Query  455  VSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGN  634
            + +DQ TG  YF ++  IF    +A   Q+GD +GRLLKY+  T +VT +L GL+   G 
Sbjct  150  LDIDQNTGIVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGV  209

Query  635  AISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPV  814
            A+S+D  F+ +T     K+ ++++RG K++ ++T  + L G P+ ++R  ++ G FWV  
Sbjct  210  ALSKDKDFVLVTETTTAKVTRYWLRGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQ  266

Query  815  NTPREQQPSPMTDSIAVKFDRNGKILE  895
            N        P      V+ +  GKI+E
Sbjct  267  NNCGR----PELKVRPVRLNEEGKIME  289



>ref|XP_010656041.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=309

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 175/292 (60%), Gaps = 12/292 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR  + CDG+    +  +C
Sbjct  26   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  85

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN    DLYIA+ +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  86   GRPLGLKFNEAKCDLYIANAYFGLLVVGRNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  145

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q+GD +GRLLKY+  + +VT +L GL+   G A+S+D  F+
Sbjct  146  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKDKDFV  205

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     K+ +++++G K++ ++T  + L G P+ ++R  ++ G FWV  N        
Sbjct  206  LVTETTTAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----  258

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            P    I++K ++ GKI+E   L++D+   L    E     + GS+   ++G+
Sbjct  259  PELKVISIKLNKEGKIME--ELSEDFGP-LSEVQEKDNDLWLGSVLLSYIGM  307



>ref|XP_010099026.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76384.1| Strictosidine synthase 1 [Morus notabilis]
Length=324

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 170/296 (57%), Gaps = 11/296 (4%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTNGTNLLSI-  298
            + GP+   FD  GGGPYTG+ DGR++K +   F++  ITSP RT  +CDGTN    L + 
Sbjct  34   SVGPEAITFDRFGGGPYTGISDGRVVKHNGSTFIEIFITSPNRTSLECDGTNNPATLGVT  93

Query  299  CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGG-LAKQLAAGINGKNFIFADSVSLDQLT  475
            CGRP G+ F  R   L+IAD + GLL VG  G  LA  +A G  G  F F +++ +DQLT
Sbjct  94   CGRPFGVGFYFRENQLFIADAYRGLL-VGVLGKKLAVPIATGAEGVPFKFPNALDVDQLT  152

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            GD YF ++   F  +       + D++GRLLKY+  T QVT +L  L+G  G AI+ + T
Sbjct  153  GDVYFTDASARFSLSQIQEAVATNDSTGRLLKYDRRTQQVTVLLKNLSGAAGVAINANRT  212

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
            F+ ++ FI  +I K ++RGP A  ++ V+    G P+ +KR    SG FWV VN P    
Sbjct  213  FVLVSEFIANRITKFWLRGPNAFKSQ-VVATFQGMPDNIKRTP--SGDFWVAVNVP---G  266

Query  836  PSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEY--FGKAYTGSLEADFVGV  997
            P  +    A++ + NG IL+T +L K Y     S F+   FG  Y GS   +FVGV
Sbjct  267  PGGVMLPTAIRINGNGNILKTLHLEKYYKNTPISEFQQRGFGTYYIGSRVGNFVGV  322



>emb|CAN77943.1| hypothetical protein VITISV_044019 [Vitis vinifera]
Length=300

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 155/263 (59%), Gaps = 8/263 (3%)
 Frame = +2

Query  218  FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGG  397
            F DFA T+P R+K  CDGT   N    CGRPLG+ FN  TG LYIAD + GLL VGSNGG
Sbjct  36   FTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAYSGLLVVGSNGG  95

Query  398  LAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYE  577
            LA  +A    G  F F + + +DQLTG+ YF ++  ++   D  +  ++ D SGRLLKY+
Sbjct  96   LATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVENNDASGRLLKYD  155

Query  578  AATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGG  757
             +T QVT ++ GL+GP G A+S D +F+ ++ FI  +  K ++RGPKA T+E +     G
Sbjct  156  PSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKANTSE-LFFTFQG  214

Query  758  NPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGS  937
             P+ +K  TS++  FWV VN  +     P T     + D +G +L+T N   +Y   + S
Sbjct  215  RPDNIK--TSITDTFWVAVNIGKS---VPTTVPTGQRMDAHGNVLQTVNFEAEYGSTMIS  269

Query  938  YFEYFGKA--YTGSLEADFVGVY  1000
              +  G    Y GS +A +VGVY
Sbjct  270  EVQXRGXIFLYVGSRDASYVGVY  292



>ref|XP_010656040.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=352

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 169/294 (57%), Gaps = 9/294 (3%)
 Frame = +2

Query  20   LTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRIL  199
            L+ F++   + IS    ++SH               GP+  AFD  G GPYTG+ DGRIL
Sbjct  3    LSQFFIFSFILISLFGCVNSHQALKYNTLELPSGVSGPESIAFDCNGDGPYTGISDGRIL  62

Query  200  KF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGL  373
            K+  S   + +FAITSPFR  + CDG+    +  +CGRPLGL FN  T DLYIAD +FGL
Sbjct  63   KWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVCGRPLGLKFNEATCDLYIADAYFGL  122

Query  374  LRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDT  553
            L VG NGG+AKQ+A    G  F F +++ +DQ TG  YF ++  IF    +A   Q GD 
Sbjct  123  LVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGVVYFTDTSTIFQRWAYAIAMQIGDK  182

Query  554  SGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTE  733
            +GRLLKY+  T +VT +L GL+   G A+SED  F+ +T     K+ +++++  K++ ++
Sbjct  183  TGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFVLVTETTAAKVTRYWLQCQKSQLSD  242

Query  734  TVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILE  895
            T  + L G P+ ++R  ++ G FWV  N        P      V+ ++ GKI+E
Sbjct  243  TFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----PEVKVRPVRLNKEGKIVE  289



>ref|XP_010655933.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=411

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 171/292 (59%), Gaps = 12/292 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR  + CDG+    +  +C
Sbjct  128  GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  187

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  188  GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  247

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q GD +GRLLKY+  T +VT +L GL+   G A+SED  F+
Sbjct  248  VYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFV  307

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     K+ +++++G K++ ++T  + L G P+ ++R  ++ G FWV  N        
Sbjct  308  LVTETTAAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----  360

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            P      V+ ++ GKI+E   L+ D    L    E     + GS+   ++GV
Sbjct  361  PEVKVRPVRLNKEGKIVE--ELSVDVGP-LSEVQEKNNSLWLGSVILSYIGV  409



>ref|XP_003609162.1| Strictosidine synthase [Medicago truncatula]
 gb|AES91359.1| SMP-30/gluconolaconase/LRE-like region protein [Medicago truncatula]
Length=335

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 125/335 (37%), Positives = 189/335 (56%), Gaps = 18/335 (5%)
 Frame = +2

Query  17   SLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGR  193
            S +M    +L+ I  LC   S     L+ KL+L     GP+  AFD  GGGPY    DGR
Sbjct  2    SKSMVVSVILLAIFLLCSPSSVAV--LLNKLQLPPPLTGPESLAFDRNGGGPYVTSSDGR  59

Query  194  ILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLL-SICGRPLGLDFNRRTGDLYIADIH  364
            I K+  SN  F ++A T+P R +  CDG    +++ +ICGRPLGL FN +T DLY+AD +
Sbjct  60   IFKYVGSNEGFKEYAYTAPNRNRTICDGLADFSVVQAICGRPLGLGFNHQTNDLYVADAY  119

Query  365  FGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARI--A  538
            FGL++VG NGG A QL       + +FAD + +D  TG  YF  +   +   DF  +  +
Sbjct  120  FGLVKVGPNGGNATQLVGPTQANSTMFADGLDVDPDTGIVYFTIASTNYKLKDFQTVLAS  179

Query  539  QSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPK  718
             SGD SG LL+Y+ +T Q T +L  L  P G A+S++ +F+ ++ ++  +I + +++GP+
Sbjct  180  GSGDNSGSLLRYDPSTNQTTVLLRNLTIPSGVAVSKEGSFVLVSEYLANRIQRVWLKGPR  239

Query  719  AKTTETVLENLGGNPEFVKRATSLSGGFWVPVN----TPREQQPSPMTDSIAVKFDRNGK  886
            A ++E  +  L G P+ +KR +   G FW+ V+    TPR   P   T    V+ + NG 
Sbjct  240  ANSSELFML-LAGRPDNIKRNS--GGQFWISVSSFLGTPRS--PGCSTLPSGVRVNENGL  294

Query  887  ILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADF  988
            +L+  +L ++Y P+      EY G  Y GSL A +
Sbjct  295  VLQIVSLVEEYGPEAASEVQEYNGTLYGGSLLASY  329



>ref|XP_010532262.1| PREDICTED: strictosidine synthase 1-like [Tarenaya hassleriana]
Length=328

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 164/296 (55%), Gaps = 11/296 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK++    +VDFA TS    K  C+G  GT L  ICG
Sbjct  39    GPEAFAFDSTGKGFYTGVSGGKILKYTPETGYVDFAQTSKPANKIWCEGVLGTVLAQICG  98

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ F+ +TGDLYIAD   GL  V   GGLA ++A  ++GK F F D + +D  TGD 
Sbjct  99    RPAGIAFDEKTGDLYIADAPLGLHVVSKAGGLATKIADSVDGKPFKFLDGLDVDPTTGDV  158

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F            D SG+L KYEAAT ++T ++ GL+G  G A+S D +F+ 
Sbjct  159   YFTSFSSKFTPAQVYIAVGLKDASGKLFKYEAATKKITVLVEGLSGSAGCAVSSDGSFVL  218

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVP--VNTPREQQP  838
             +  FI  KI +H+I+GPKA  TE    N+  NP+ +KR  S +G FWV   VN   +   
Sbjct  219   VGEFIKSKIQRHWIKGPKAGQTEEFTSNV-TNPDNIKRIGS-TGNFWVASVVNVGLK---  273

Query  839   SPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
                T+  AVK D  GK+L+T  L   +   L+    E+ G  Y G+L   F  V +
Sbjct  274   --ATNPSAVKIDSEGKVLQTVPLKDTFGDTLVSEANEFNGSLYVGTLLGPFAAVLK  327



>ref|XP_010099021.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76379.1| Strictosidine synthase 1 [Morus notabilis]
Length=328

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 122/303 (40%), Positives = 170/303 (56%), Gaps = 8/303 (3%)
 Frame = +2

Query  104  KLKLQN-AFGPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKCDGT  274
            +L L N + GP+   FD  G GPYTG+ DG+I+++      FVDFA TS  R+K  CDGT
Sbjct  28   RLNLPNTSVGPESITFDSLGRGPYTGISDGKIVRYDRRTAGFVDFAFTSRNRSKALCDGT  87

Query  275  NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADS  454
            N   L  ICGRPLG++F  R   L+IAD   GL +VG NGGLA QLA    G  F F + 
Sbjct  88   NNPALRPICGRPLGMEFFIRKNMLFIADAFLGLFKVGLNGGLATQLANAAEGIPFRFLNG  147

Query  455  VSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGN  634
            +S+DQ TGD YF +    FL     +   + D++GRLLKY+  T  VT +L  L+G  G 
Sbjct  148  LSVDQHTGDVYFTDFSSRFLQTQIQQAVAANDSTGRLLKYDYRTKNVTVLLRRLSGANGV  207

Query  635  AISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPV  814
            AIS D +++ +  F+  +  + ++ G KA T+E ++    G P+ ++RA    G F V V
Sbjct  208  AISSDSSYVLVAEFLANRTRRFWLHGTKAFTSE-IVATFRGMPDNIRRAP--FGNFLVAV  264

Query  815  NTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKA-YTGSLEADFV  991
            N  R     P     A++ +  G+ L+T  L + Y     S     GK  Y GS+EA+FV
Sbjct  265  NVERPAG-GPRLIPTAIRINGAGQTLQTLPLDRYYNNTTISEVLQCGKQYYIGSVEANFV  323

Query  992  GVY  1000
            GV+
Sbjct  324  GVF  326



>ref|XP_006301516.1| hypothetical protein CARUB_v10021942mg, partial [Capsella rubella]
 gb|EOA34414.1| hypothetical protein CARUB_v10021942mg, partial [Capsella rubella]
Length=361

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 128/340 (38%), Positives = 180/340 (53%), Gaps = 24/340 (7%)
 Frame = +2

Query  20   LTMFWVSMLMFISSLC-MIHSHPERDLIAKLKL-------QNAFGPKDTAFDPRGGGPYT  175
            +T+ WVS    +S LC ++       L++ L+        Q   GP+  AFD  GGGPYT
Sbjct  29   VTLVWVSQFDVLSILCFLLILFSSHSLVSALQTFQKIPLPQRITGPEAFAFDSHGGGPYT  88

Query  176  GVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLY  349
            GV  G+ILK+      F +FA   P   K  C+   GT L SICGRP+GL FN +TGDLY
Sbjct  89   GVSGGKILKYQGPTLGFTEFAYILPIANKSLCEKAVGTFLGSICGRPVGLAFNEKTGDLY  148

Query  350  IADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFA  529
            IAD + GL  V   GGLAK+LA    G  F F D + +D +TG  YF      F  ++  
Sbjct  149  IADAYLGLYVVSYRGGLAKRLADTAAGYPFRFLDGLDVDPVTGMVYFTSFSTRFGPSELV  208

Query  530  RIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIR  709
                  DT+GRL +Y+  T  VT +L+GL+G  G A+S D  F+ +  F+  +I++++I+
Sbjct  209  LAVAVKDTTGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFVLVGEFLRNRILRYWIK  268

Query  710  GPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR----EQQPSPMTDSIAVKFDR  877
            GPKA T +  + ++ G P+ ++R     G FWV  N+ +      +PS      AVK   
Sbjct  269  GPKANTWDIFVPSIPG-PDNIRRTD--GGDFWVASNSVKLIVLPTEPS------AVKISS  319

Query  878  NGKILETRNLTKDYPKLLGSYF-EYFGKAYTGSLEADFVG  994
            +G+IL    L + Y   L S   EY    Y G+L   FVG
Sbjct  320  DGEILRRMPLGEYYGDTLVSEVNEYKNVVYLGTLTTTFVG  359



>emb|CBI40188.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 154/241 (64%), Gaps = 6/241 (2%)
 Frame = +2

Query  104  KLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT  274
            KLKL +   GP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR  + C+G+
Sbjct  47   KLKLPSGVSGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCNGS  106

Query  275  NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADS  454
                +  +CGRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F ++
Sbjct  107  INPAMEQVCGRPLGLKFNEATCDLYIADAYFGLLVVGHNGGVAKQIAISAEGVPFRFTNA  166

Query  455  VSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGN  634
            + +DQ TG  YF ++  IF    +A   Q+GD +GRLLKY+  T +VT +L GL+   G 
Sbjct  167  LDIDQNTGIVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGV  226

Query  635  AISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPV  814
            A+S+D  F+ +T     K+ +++++G K++ ++T  + L G P+ ++R  ++ G FWV  
Sbjct  227  ALSKDKDFVLVTETTTAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQ  283

Query  815  N  817
            N
Sbjct  284  N  284



>emb|CBI15378.3| unnamed protein product [Vitis vinifera]
Length=1075

 Score =   207 bits (528),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/286 (41%), Positives = 164/286 (57%), Gaps = 9/286 (3%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPY  V DGR+LK+   +  FVDF + SP R+K+ CDG++       C
Sbjct  41   GPEALAFDCSGAGPYASVADGRVLKWQAESAGFVDFTVASPSRSKQLCDGSSDPAKEPTC  100

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLG+ FN +TGDLYIAD ++GL  VG +GG A QLA    G  F F ++V +DQ TG 
Sbjct  101  GRPLGIGFNNKTGDLYIADAYYGLFVVGPDGGRATQLATEAEGVPFRFLNAVDVDQETGI  160

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++   F   +F     +GD +GRL+KY+  T QVT +L GL   VG AI++D +F+
Sbjct  161  VYFTDASARFQRREFQNAVLAGDMTGRLMKYDPRTKQVTVLLRGLGLAVGVAINKDGSFV  220

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             ++ FI  +I ++++RGPKA T+E  L+   G P+ +KR  +  G FWV  N   E   +
Sbjct  221  LVSEFIATRIQRYWLRGPKANTSELFLKPT-GTPDNIKR--NARGEFWVAANIGAEMAAA  277

Query  842  PMTDSIAVKFDRNGKILETRNL-TKDYPKLLGSYFEYFGKAYTGSL  976
                 + ++    GKIL+     T D  + +    EY G  Y G  
Sbjct  278  A---PLGLRVSEEGKILQVVAFDTGDITRTISEVHEYNGALYVGEF  320


 Score =   204 bits (518),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 127/330 (38%), Positives = 178/330 (54%), Gaps = 16/330 (5%)
 Frame = +2

Query  32    WVSMLMFISSLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF--  205
             ++  L F + +C + S  +  L       N  GP   AFD   GGPY GV DGRI+++  
Sbjct  757   FILFLCFPAKVCSLSSFTQLQLPP-----NVTGPVSLAFDLTVGGPYAGVNDGRIIRYGG  811

Query  206   SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVG  385
             ++  F DFA  +P R+K  CDGT   +    CGRPLGL FN     +YIAD + GL   G
Sbjct  812   TDVGFTDFAFCTPTRSKAVCDGTTDPDSGPTCGRPLGLSFNNLRNQMYIADAYSGLFVAG  871

Query  386   SNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVE-SGEIFLTNDFARIAQSGDTSGR  562
             +NG LA +LA    G  F F + + +D L+G  YF + S  I L+ +  +   S D +GR
Sbjct  872   TNGRLATKLATSAEGVPFCFLNGLDVDPLSGLVYFTDFSTTIQLSGNTTQF--SSDATGR  929

Query  563   LLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVL  742
             LL+Y+  T  VT +L GL+G  G A+S D  F+ ++ F   +I+K ++RGPKA T ET +
Sbjct  930   LLRYDPETKNVTVLLRGLSGAAGTAVSNDGMFVLVSEFNANRILKFWLRGPKASTAETFV  989

Query  743   ENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY-  919
              +  G P  +KR  + SG FWV VN P  Q P P T     +    G ILET +    Y 
Sbjct  990   -SFRGRPVNIKR--TASGNFWVAVNVPNNQSP-PTTILTGQRISYYGTILETVSFDDQYG  1045

Query  920   -PKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
                L+    ++ G  Y G+  A+FVGV+ A
Sbjct  1046  GSTLITEVQQHLGALYIGANSANFVGVHMA  1075


 Score =   199 bits (505),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 159/280 (57%), Gaps = 8/280 (3%)
 Frame = +2

Query  95   LIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRTKEKC  265
            L  KL+L ++  GP+  AFD +G GPYTGV DGR+LK+      F DFA+TSP RT+E C
Sbjct  447  LFNKLQLPSSITGPESLAFDLKGEGPYTGVSDGRVLKYQGPAVGFTDFAVTSPNRTEEMC  506

Query  266  DGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
            DG+    L + CGRPLGL FN  TGDLY+ D + GL+ VGS+GG+A QLAA   G  F F
Sbjct  507  DGSIDPALEATCGRPLGLGFNYHTGDLYMVDAYLGLMVVGSSGGIATQLAAAAEGIPFRF  566

Query  446  ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
               + +DQ  G  YF E+   F   D   +  S D++G L +Y+  + +V  +L GL+  
Sbjct  567  LAGLDVDQGNGMVYFTEASTRFQLRDMQELIASNDSTGSLFRYDPQSREVRVLLGGLSVA  626

Query  626  VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
            VG A+S D  F+ +      +I + ++ GPKA T+E  +E L G P  +KR  +  G FW
Sbjct  627  VGVAVSRDGMFVLVAELTANRIRRFWLGGPKANTSEVFMELL-GKPSNIKR--NERGEFW  683

Query  806  VPVNTP--REQQPSPMTDSIAVKFDRNGKILETRNLTKDY  919
            V +N        P  +   + ++   +G++LE   L   Y
Sbjct  684  VAINNALGPPAPPESLVMPLGLRLSNDGRVLEVAPLVGAY  723


 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = +2

Query  521  DFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKH  700
            +F    Q+GD +GRL+KY+  T +VTE+L GL G  G  IS+D +FI +T F+  +I + 
Sbjct  319  EFMLAVQTGDMTGRLMKYDPRTQEVTELLRGLGGAGGVTISKDGSFILVTEFVTNRIQRF  378

Query  701  YIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRN  880
            +++G KA T++  L+   G P+ +K  ++  G FWV VN        P+     ++    
Sbjct  379  WLKGRKANTSQLFLKP-PGTPDNIK--SNARGEFWVAVNIGAGTAVVPL----GLRLSEE  431

Query  881  GKILE  895
            GK+L+
Sbjct  432  GKVLQ  436



>ref|XP_010428359.1| PREDICTED: strictosidine synthase 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010428360.1| PREDICTED: strictosidine synthase 3-like isoform X2 [Camelina 
sativa]
Length=338

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 165/296 (56%), Gaps = 16/296 (5%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFDP+GGGPYTGV  G+ILK+      F +FA   P   K  C+   GT L +IC
Sbjct  50   GPEAFAFDPQGGGPYTGVSGGKILKYQGPTLGFTEFAYILPIANKSLCEKAIGTFLGNIC  109

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRP+GL FN +TGDLYIAD + GL  V   GGLAK+LA    G  F F D + +D +TG 
Sbjct  110  GRPVGLAFNEKTGDLYIADAYLGLYVVSYRGGLAKRLADSAAGVPFRFLDGLDVDPVTGM  169

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF      F  +         DTSGRL +Y+  T  VT +L+GL+G  G A+S D  F+
Sbjct  170  VYFTSFSTRFGPSQLVLAVAVKDTSGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFV  229

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR----E  829
             +  F+  +I++++I+GPKA T E  + ++ G P+ ++R    SG FWV  N+ +     
Sbjct  230  LVGEFLRNRILRYWIKGPKANTFEIFVPSIPG-PDNIRRTE--SGDFWVASNSVKLIVVP  286

Query  830  QQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVG  994
             +PS      AVK   +G+IL+   L + Y   L+    EY    Y G+L   FVG
Sbjct  287  TEPS------AVKISSDGEILQHMPLGEYYGDTLVSEVNEYKNVVYLGTLTTTFVG  336



>ref|XP_003531955.1| PREDICTED: strictosidine synthase 3-like [Glycine max]
 gb|KHN37142.1| Strictosidine synthase [Glycine soja]
Length=349

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/314 (39%), Positives = 171/314 (54%), Gaps = 21/314 (7%)
 Frame = +2

Query  116   QNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNL  289
              + FG +  AFD  G GPY GV DGRILK+  +   ++DFA+TSP R K+ CDG     +
Sbjct  40    HSVFGSESVAFDCHGKGPYVGVSDGRILKWQETKREWIDFAVTSPHRNKKLCDGLQNDKM  99

Query  290   LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              S+CGRPLGL FN  T +LYIAD +FGLL VG +GG+AKQLA    G  F F +++ +D 
Sbjct  100   ESMCGRPLGLKFNTVTCELYIADAYFGLLVVGPSGGVAKQLATSAEGVPFRFTNALDIDT  159

Query  470   LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
              TG+ YF +S  +F    +  I  SGD +GRLLKY  +T  V  ++ GLA P G A+S+D
Sbjct  160   KTGEVYFTDSSILFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGVALSKD  219

Query  650   HTFIFITLFIGRKIIKHYIRGPKAKTTETV--LENLGGNPEFVKRATSLSGGFWVPVNTP  823
             ++FI +      KI+K  +R  K      +     +  +P+ +KR     G FWV  N+ 
Sbjct  220   NSFILVAESTTFKILKIQLRDSKTNNNNNIEPFAQVPRSPDNIKRNN--KGEFWVAQNSG  277

Query  824   R----------EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF---EYFGKAY  964
             R          E       D +A+KFD  G+ +    L  +Y + L S     E+ G  +
Sbjct  278   RGLIQKLGNEIETTLPWNADPVAIKFDEKGRAIVV--LDGEYGRQLDSVSEVEEHEGSLW  335

Query  965   TGSLEADFVGVYRA  1006
              GS    F+G+ +A
Sbjct  336   IGSAVQPFIGLIKA  349



>ref|XP_006437788.1| hypothetical protein CICLE_v10032008mg [Citrus clementina]
 ref|XP_006484567.1| PREDICTED: strictosidine synthase 3-like [Citrus sinensis]
 gb|ESR51028.1| hypothetical protein CICLE_v10032008mg [Citrus clementina]
Length=343

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/343 (36%), Positives = 183/343 (53%), Gaps = 25/343 (7%)
 Frame = +2

Query  38    SMLMFISSL---CMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF-  205
             S ++FI  L   C+I S        +L+L    GP+  AFD  G GPY GV DGRILK+ 
Sbjct  6     SFIIFIFPLVFPCVILSSKSYQ---QLQLPGVVGPESLAFDCNGEGPYVGVSDGRILKWK  62

Query  206   -SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRV  382
              +N  + +FA T+P R +E CDG+  T L  +CGRPLG+ FN  T DLYIAD +FGL+ V
Sbjct  63    AANSGWTEFATTAPHRAREICDGSTNTTLEPLCGRPLGIKFNPVTCDLYIADAYFGLMVV  122

Query  383   GSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGR  562
             G NGG A+QLA+   G  F F + + +D  TG  YF +S   F    +     +GD SGR
Sbjct  123   GPNGGQAQQLASSAGGIPFRFTNDLDIDPNTGIVYFTDSSIYFQRRQYFMSIATGDRSGR  182

Query  563   LLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVL  742
             LLKY+     VT +  GL+ P G A+S +++F+ +      KI++ +++G +   T  + 
Sbjct  183   LLKYDPLKKNVTVMYNGLSFPNGVALSNNNSFLLLAESATLKILRFWLQGERTTYTPQLF  242

Query  743   ENLGGNPEFVKRATSLSGGFWVPVNTPR------------EQQPSP--MTDSIAVKFDRN  880
               +   P+ +K  +   G FW+ +N+ R            E+   P  + D + VKFD N
Sbjct  243   AEMPRFPDNIKSDS--KGEFWIAMNSARGKIESNKKTAFCEETAKPWFLRDPVGVKFDVN  300

Query  881   GKILETRNLTK-DYPKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
             G +++  +  + +    +    EY G  YTGS    +V V +A
Sbjct  301   GNVVDVLDGNEGNTLNSVSEVQEYGGYLYTGSSVQPYVVVIKA  343



>ref|XP_002273580.1| PREDICTED: strictosidine synthase 3 [Vitis vinifera]
 emb|CBI35398.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 181/322 (56%), Gaps = 16/322 (5%)
 Frame = +2

Query  20   LTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNA-FGPKDTAFDPRGGGPYTGVRDGRI  196
            L  F V  L+ +     + S   R    +L+L +  +GP+   FD  G GPYTGV DGRI
Sbjct  10   LISFAVFPLIVMWVFPQLVSSVSRRQYNQLELPSGTYGPETLVFDCNGEGPYTGVSDGRI  69

Query  197  LKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFG  370
            LK+  S   + DFA+TSP RT   CDG + T+   +CGRPLGL FN+ T DLYIAD +FG
Sbjct  70   LKWHGSEVGWKDFAVTSPLRTSRLCDGLSDTSAEHVCGRPLGLKFNQATCDLYIADAYFG  129

Query  371  LLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGD  550
            LL VG  GGLA+QLA    G  F+FA++V +DQ TG  YF ++   F   +F    +SGD
Sbjct  130  LLVVGRKGGLARQLATSAEGIPFLFANAVDIDQKTGTVYFTDTSTRFRRWEFGIAMESGD  189

Query  551  TSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTT  730
             +GRL++Y+  T +V  +L  L    G A+S + +F+ +T     ++++ ++ GP+++T 
Sbjct  190  NTGRLMRYDPKTKKVKVLLKHLFFANGVALSRNGSFLLVTETNANRVLRFWLEGPRSQTR  249

Query  731  ETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSI-AVKFDRNGKILETRN-  904
            + V   L G P+ ++R  +  G FWV  N   +   +P+  +I A+K D  GK+L   N 
Sbjct  250  D-VFAKLDGCPDNIER--NPKGEFWVAQNPKFDSIGTPLQTNISALKLDEEGKVLRVLNE  306

Query  905  --------LTKDYPKLLGSYFE  946
                    + KD    LGS  +
Sbjct  307  EFGSLSDVIEKDDCMWLGSVLQ  328



>emb|CAN63240.1| hypothetical protein VITISV_034462 [Vitis vinifera]
Length=340

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 181/322 (56%), Gaps = 16/322 (5%)
 Frame = +2

Query  20   LTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNA-FGPKDTAFDPRGGGPYTGVRDGRI  196
            L  F V  L+ +     + S   R    +L+L +  +GP+   FD  G GPYTGV DGRI
Sbjct  10   LISFAVFPLIVMWVFPQLVSSVSRRQYDQLELPSGTYGPETLVFDCBGEGPYTGVSDGRI  69

Query  197  LKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFG  370
            LK+  S   + DFA+TSP RT   CDG + T+   +CGRPLGL FN+ T DLYIAD +FG
Sbjct  70   LKWHGSEVGWKDFAVTSPLRTSRLCDGLSDTSAEHVCGRPLGLKFNQATCDLYIADAYFG  129

Query  371  LLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGD  550
            LL VG  GGLA+QLA    G  F+FA++V +DQ TG  YF ++   F   +F    +SGD
Sbjct  130  LLVVGRKGGLARQLATSAEGIPFLFANAVDIDQKTGTVYFTDTSTRFRRWEFGIAMESGD  189

Query  551  TSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTT  730
             +GRL++Y+  T +V  +L  L    G A+S + +F+ +T     ++++ ++ GP+++T 
Sbjct  190  NTGRLMRYDPKTKKVKVLLKHLFFANGVALSRNGSFLLVTETNANRVLRFWLEGPRSQTR  249

Query  731  ETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSI-AVKFDRNGKILETRN-  904
            + V   L G P+ ++R  +  G FWV  N   +   +P+  +I A+K D  GK+L   N 
Sbjct  250  D-VFAKLDGCPDNIER--NPKGEFWVAQNPKFDSIGTPLQTNISALKLDEEGKVLRVLNE  306

Query  905  --------LTKDYPKLLGSYFE  946
                    + KD    LGS  +
Sbjct  307  EFGSLSDVIEKDDCMWLGSVLQ  328



>emb|CAN77942.1| hypothetical protein VITISV_044018 [Vitis vinifera]
Length=341

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 187/333 (56%), Gaps = 12/333 (4%)
 Frame = +2

Query  20   LTMFWVSMLMFISSLCMI---HSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDG  190
            L++F    L F S L +    H   +   + +L L  A GP+  AFD  GGGPYTG+ DG
Sbjct  5    LSIFLSIFLSFYSQLHLSSGEHVTYKAQFLERLPLP-ATGPESIAFDAAGGGPYTGISDG  63

Query  191  RILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIH  364
            RILK+ NG+  FV+FAITS   ++E C G     L   CGRP GL F+ +TGDLYIAD +
Sbjct  64   RILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDFTCGRPFGLGFHYQTGDLYIADAY  123

Query  365  FGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQS  544
            +GL+ VG NGG+A QLA   +G  F F +++ +D  TG  Y V+    F  N+F+   Q+
Sbjct  124  YGLMVVGPNGGVATQLANAADGVPFGFTNALDVDTETGMVYLVDYSSQFSVNEFSVSLQA  183

Query  545  GDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAK  724
             D +GRL+KY+  + ++T +L GL G  G AIS+D +FI IT  + ++I K +++GPKA 
Sbjct  184  HDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDGSFILITETVTKRIRKFWLQGPKAT  243

Query  725  TTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP-MTDSIAVKFDRNGKILETR  901
            T+E +L+     P  +KR  +  G FWV      E    P    S  ++   +G ILE  
Sbjct  244  TSE-ILKEFTVRPANIKR--NEEGEFWVAFLVADETGSCPSQQQSPGLRISGDGMILEAI  300

Query  902  NLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
            +L  D    +     Y GK Y GS    FV VY
Sbjct  301  SL--DTQSGISEVAVYNGKMYIGSPFLHFVDVY  331



>ref|XP_002270060.2| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=341

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 187/333 (56%), Gaps = 12/333 (4%)
 Frame = +2

Query  20   LTMFWVSMLMFISSLCMI---HSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDG  190
            L++F    L F S L +    H   +   + +L L  A GP+  AFD  GGGPYTG+ DG
Sbjct  5    LSIFLSIFLSFYSQLHLSSGEHVTYKAQFLERLPLP-ATGPESIAFDAAGGGPYTGISDG  63

Query  191  RILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIH  364
            RILK+ NG+  FV+FAITS   ++E C G     L   CGRP GL F+ +TGDLYIAD +
Sbjct  64   RILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDFTCGRPFGLGFHYQTGDLYIADAY  123

Query  365  FGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQS  544
            +GL+ VG NGG+A QLA   +G  F F +++ +D  TG  Y V+    F  N+F+   Q+
Sbjct  124  YGLMVVGPNGGVATQLANAADGVPFGFTNALDVDTETGMVYLVDYSSQFSVNEFSVSLQA  183

Query  545  GDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAK  724
             D +GRL+KY+  + ++T +L GL G  G AIS+D +FI IT  + ++I K +++GPKA 
Sbjct  184  HDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDGSFILITETVTKRIRKFWLQGPKAT  243

Query  725  TTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP-MTDSIAVKFDRNGKILETR  901
            T+E +L+     P  +KR  +  G FWV      E    P    S  ++   +G ILE  
Sbjct  244  TSE-ILKEFTVRPANIKR--NEEGEFWVAFLVADETGSCPSQQQSPGLRISGDGMILEAI  300

Query  902  NLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
            +L  D    +     Y GK Y GS    FV VY
Sbjct  301  SL--DTQSGISEVAVYNGKMYIGSPFLHFVDVY  331



>ref|XP_010471490.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=328

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 164/296 (55%), Gaps = 16/296 (5%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFDP+GGGPYTGV  G+ILK+      F +FA   P   K  C+   GT L +IC
Sbjct  40   GPEAFAFDPQGGGPYTGVSGGKILKYQGPALGFTEFAYILPVANKSLCEKAVGTFLGNIC  99

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRP+GL FN +TGDLYIAD + GL  V   GGLAK+LA    G  F F D + +D +TG 
Sbjct  100  GRPVGLAFNEKTGDLYIADAYLGLYVVSYRGGLAKRLADSAAGIPFRFLDGLDVDPVTGM  159

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF      F  +         DTSGRL +Y+  T  VT +L+GL+G  G A+S D  F+
Sbjct  160  VYFTSFSTRFGPSQLVLAVAVKDTSGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFV  219

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR----E  829
             +  F+  +I++++I+GPKA T E  + ++ G P+ ++R     G FWV  N+ +     
Sbjct  220  LVGEFLRNRILRYWIKGPKANTFEIFVPSIPG-PDNIRRTE--GGDFWVASNSVKLIVVP  276

Query  830  QQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVG  994
             +PS      AVK   +G+IL+   L + Y   L+    EY    Y G+L   FVG
Sbjct  277  TEPS------AVKISSDGEILQHMPLGEYYGDTLVSEVHEYKNVVYLGTLTTTFVG  326



>ref|XP_010428361.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=326

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 164/294 (56%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFDP G G YTGV  G+ILK++  N FVDFA  +     + C+G  GT     CG
Sbjct  37    GPESFAFDPTGKGFYTGVSGGKILKYTPENGFVDFAQMTKSSNSKWCNGALGTAFAGKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+  N +TGDLY+AD   GL  +   GGLA ++A  ++GK F F D + +D  TG  
Sbjct  97    RPSGIALNSKTGDLYVADAPLGLHVISPAGGLATKIADSLDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F   +        D SG+L KY+ AT  VT+++ GL+G  G A+S D +F+ 
Sbjct  157   YFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKTVTQLMEGLSGAAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I +++I GPKA T+E    NL  NP+ ++R+ S +G FWV     +   P  
Sbjct  217   VSEFIKSNIKRYWITGPKAGTSED-FSNLVSNPDNIRRSAS-TGNFWVASVVNKVVVP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NG++L+T +L  ++   LL    E  G  Y G+L   F G+ +
Sbjct  273   -TDPKAVKIDSNGQVLQTISLNNEFGNTLLSEVNELNGHLYIGTLTGSFAGIMK  325



>emb|CBI35408.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 169/294 (57%), Gaps = 9/294 (3%)
 Frame = +2

Query  20   LTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRIL  199
            L+ F++   + IS    ++SH               GP+  AFD  G GPYTG+ DGRIL
Sbjct  3    LSQFFIFSFILISLFGCVNSHQALKYNTLELPSGVSGPESIAFDCNGDGPYTGISDGRIL  62

Query  200  KF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGL  373
            K+  S   + +FAITSPFR  + CDG+    +  +CGRPLGL FN  T DLYIAD +FGL
Sbjct  63   KWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVCGRPLGLKFNEATCDLYIADAYFGL  122

Query  374  LRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDT  553
            L VG NGG+AKQ+A    G  F F +++ +DQ TG  YF ++  IF    +A   Q GD 
Sbjct  123  LVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGVVYFTDTSTIFQRWAYAIAMQIGDK  182

Query  554  SGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTE  733
            +GRLLKY+  T +VT +L GL+   G A+SED  F+ +T     K+ +++++  K++ ++
Sbjct  183  TGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFVLVTETTAAKVTRYWLQCQKSQLSD  242

Query  734  TVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILE  895
            T  + L G P+ ++R  ++ G FWV  N        P      V+ ++ GKI+E
Sbjct  243  TFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----PEVKVRPVRLNKEGKIVE  289


 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 175/292 (60%), Gaps = 12/292 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR  + CDG+    +  +C
Sbjct  370  GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  429

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN    DLYIA+ +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  430  GRPLGLKFNEAKCDLYIANAYFGLLVVGRNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  489

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q+GD +GRLLKY+  + +VT +L GL+   G A+S+D  F+
Sbjct  490  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKDKDFV  549

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +T     K+ +++++G K++ ++T  + L G P+ ++R  ++ G FWV  N        
Sbjct  550  LVTETTTAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQR--NIHGEFWVAQNNCGR----  602

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            P    I++K ++ GKI+E   L++D+   L    E     + GS+   ++G+
Sbjct  603  PELKVISIKLNKEGKIME--ELSEDFGP-LSEVQEKDNDLWLGSVLLSYIGM  651



>ref|XP_004298328.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=346

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 168/301 (56%), Gaps = 10/301 (3%)
 Frame = +2

Query  116  QNAFGPKDTAFDPRGGGPYTGVRDGRILKFSN--GNFVDFAITSPFRTKEKCDGTNGTNL  289
             N  GP+  AFD RG GPY GV DGRILK+      + +F+ TSP R ++ CDG+     
Sbjct  46   NNTVGPESVAFDCRGQGPYVGVSDGRILKWEEPLKGWTEFSYTSPNRQRKLCDGSTNKFN  105

Query  290  LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              ICGRPLGL FN  T +LYIAD +FGLL+ G NGG   QLA+   G  F F +++ +D 
Sbjct  106  EPICGRPLGLKFNPTTCELYIADAYFGLLKTGPNGGRPHQLASSAGGVPFHFLNALDVDN  165

Query  470  LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
             +G  YF ++  IF  + +     S D +GRL++Y+  T + T +L GLA P G A+S+D
Sbjct  166  ESGMVYFTDTSLIFQRSVWILSIISADRTGRLMQYDPRTKKATVLLKGLAFPDGVALSKD  225

Query  650  HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
             +F+ +      KI++ ++RGPKA T E +   L G P+ +KR    +G FWV +N    
Sbjct  226  KSFLLLIETGTLKILRLWLRGPKANTLE-LFAQLVGFPDNIKRND--NGEFWVAINNGVG  282

Query  830  QQPSP--MTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF---EYFGKAYTGSLEADFVG  994
               S   + D +  KFD +G +LE  +       LL S     E+ G  + GS +  +VG
Sbjct  283  GSISATLLGDPVGAKFDEDGNVLEVLDGKDSAAALLQSVSEVEEHNGMLWIGSAQNSYVG  342

Query  995  V  997
            V
Sbjct  343  V  343



>gb|KDO70174.1| hypothetical protein CISIN_1g019290mg [Citrus sinensis]
Length=343

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/346 (36%), Positives = 182/346 (53%), Gaps = 31/346 (9%)
 Frame = +2

Query  38    SMLMFISSL---CMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF-  205
             S ++FI  L   C+I S        +L+L    GP+  AFD  G GPY GV DGRILK+ 
Sbjct  6     SFIIFIFPLVFPCVILSSKSYQ---QLQLPGVVGPESLAFDCNGEGPYVGVSDGRILKWK  62

Query  206   -SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRV  382
              +N  + +FA T+P R +E CDG+  T L  +CGRPLG+ FN  T DLYIAD +FGL+ V
Sbjct  63    AANSGWTEFATTAPHRAREICDGSTNTTLEPLCGRPLGIKFNPVTCDLYIADAYFGLMVV  122

Query  383   GSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGR  562
             G NGG A+QLA+   G  F F + + +D  TG  YF +S   F    +     +GD SGR
Sbjct  123   GPNGGQAQQLASSAGGIPFRFTNDLDIDPNTGIVYFTDSSIYFQRRQYFMSIATGDRSGR  182

Query  563   LLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVL  742
             LLKY+     VT +  GL+ P G A+S +++F+ +      KI++ +++G +   T  + 
Sbjct  183   LLKYDPLKKNVTVMYNGLSFPNGVALSNNNSFLLLAESATLKILRFWLQGERTTYTPQLF  242

Query  743   ENLGGNPEFVKRATSLSGGFWVPVNTPR------------EQQPSP--MTDSIAVKFDRN  880
               +   P+ +K  +   G FW+ +N+ R            E+   P  + D + VKFD N
Sbjct  243   AEMPRFPDNIKSDS--KGEFWIAMNSARGKIESNKKTAFCEETAKPWFLRDPVGVKFDVN  300

Query  881   GKILET----RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
             G +++        T +    +  Y EY    YTGS    +V V +A
Sbjct  301   GNVVDVLDGNEGNTLNSVSEVQEYGEYL---YTGSSVQPYVVVIKA  343



>ref|XP_010110081.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25148.1| Strictosidine synthase 1 [Morus notabilis]
Length=353

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 188/336 (56%), Gaps = 14/336 (4%)
 Frame = +2

Query  14   KSLTMFWVSMLMFIS--SLCMIHSHPERDLIAKLKL-QNAFGPKDTAFDPRGGGPYTGVR  184
            +++TM  + +L+F+S  S  ++ S  +     KL L   + GP+   FD  G GPYTG+ 
Sbjct  23   ETVTMLLI-LLIFLSVPSNYIVLSQ-QISTFRKLNLPTTSVGPEPIDFDALGRGPYTGIS  80

Query  185  DGRILKFSN--GNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIAD  358
            DGRI+++     +FVDFA  S  R+K  CDGTN   L  +CGRPLG++F  R   L+IAD
Sbjct  81   DGRIVRYDKRTSSFVDFAFASQNRSKAVCDGTNSPALRPVCGRPLGIEFFHRRNLLFIAD  140

Query  359  IHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIA  538
               GL  VG NGGLA QLA    G +  F + +S+DQ TGD YF +    FL     +  
Sbjct  141  AFAGLCVVGPNGGLATQLATTAEGISLRFLNGLSVDQHTGDVYFTDYSSRFLQTQIQQAI  200

Query  539  QSGDTSGRLLKYEAATGQVTE-VLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGP  715
             + D++GRLLKY+  T  VT  +L GL+G  G AIS D T++     I  +  + ++RG 
Sbjct  201  AANDSTGRLLKYDYRTKNVTVLLLRGLSGANGVAISSDGTYLLFAESIANRTQRFWLRGA  260

Query  716  KAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILE  895
            +A T+E V+ N  G P  ++R    SG F V V+  R   PS +    A++ +  G+IL+
Sbjct  261  RAFTSE-VVANFQGMPRNIRRTP--SGDFLVGVSVQRPGAPSIV--PTAIRINGAGQILQ  315

Query  896  TRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVY  1000
            T  L   Y   ++  + +   + Y GS +A+FVGV+
Sbjct  316  TLPLDHYYNTTVISEFLQRGSRYYAGSAQANFVGVF  351



>ref|XP_006436700.1| hypothetical protein CICLE_v10033919mg [Citrus clementina]
 gb|ESR49940.1| hypothetical protein CICLE_v10033919mg [Citrus clementina]
Length=344

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/308 (40%), Positives = 169/308 (55%), Gaps = 13/308 (4%)
 Frame = +2

Query  107   LKLQ---NAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEK-CD  268
             LKLQ      GP+  AFD  G GPY GV DGRILK+ +    + +FAIT+PFR   + CD
Sbjct  42    LKLQLPAGVVGPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICD  101

Query  269   GTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFA  448
             GT+ T L  +CGRPLG+ FN  T DLYIAD +FGL+ VG NGG AKQLA+      F F 
Sbjct  102   GTSSTILEPLCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFT  161

Query  449   DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             +++ +D  TG  YF +S   F    +  + +SGD SGRLLKY+    QVT +  GLA P 
Sbjct  162   NALDIDPNTGVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPN  221

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G  +S+D +F+ +     R+I++ ++ G     +      +   P+ ++  T  +G FWV
Sbjct  222   GVTLSKDKSFLLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIE--TDRNGDFWV  279

Query  809   PVNTPREQQPSPMTDSIAVKFD-RNGKILETRNLTKDYP-KLLGSYFEYFGKAYTGSLEA  982
              +NT R       TD +AVK D  NG +L+     K      +    E+ G  Y GS   
Sbjct  280   ALNTKRGND---KTDLVAVKLDGSNGNVLDVLEGNKQNALDSVSEVEEHGGYLYAGSPVQ  336

Query  983   DFVGVYRA  1006
              +V V +A
Sbjct  337   PYVVVIKA  344



>gb|ACU23577.1| unknown [Glycine max]
Length=349

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 169/314 (54%), Gaps = 21/314 (7%)
 Frame = +2

Query  116   QNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNL  289
              + FG +  AFD  G GPY GV DGRILK+  +   ++DFA+TSP R K+ CDG     +
Sbjct  40    HSVFGSESVAFDCHGKGPYVGVSDGRILKWQETKREWIDFAVTSPHRNKKLCDGLQNDKM  99

Query  290   LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              S+CGRPLGL FN  T +LYIAD +FGLL VG +GG+AKQLA    G  F F +++ +D 
Sbjct  100   ESMCGRPLGLKFNTVTCELYIADAYFGLLVVGPSGGVAKQLATSAEGVPFRFTNALDIDT  159

Query  470   LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
              TG+ YF +S  +F    +  I  SGD +GRLLKY  +T  V  ++ GLA P G A+S+D
Sbjct  160   KTGEVYFTDSSILFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGVALSKD  219

Query  650   HTFIFITLFIGRKIIKHYIRGPKAKTTETV--LENLGGNPEFVKRATSLSGGFWVPVNTP  823
             ++FI +      KI+K  +R  K      +     +  +P+ +KR     G FWV  N+ 
Sbjct  220   NSFILVAESTTFKILKIQLRDSKTNNNNNIEPFAQVPRSPDNIKRNN--KGEFWVAQNSG  277

Query  824   R----------EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF---EYFGKAY  964
             R          E       D +A+KFD  G+ +    L  +Y + L S     E+ G  +
Sbjct  278   RGLMQKLGNEIETTLPWNADPVAIKFDEKGRAIVV--LDGEYGRQLDSVSEVEEHEGSLW  335

Query  965   TGSLEADFVGVYRA  1006
              G     F+G  +A
Sbjct  336   IGFAVQPFIGFIKA  349



>ref|XP_010416232.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=338

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 164/296 (55%), Gaps = 16/296 (5%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD +GGGPYTGV  G+ILK+      F++FA   P   K  C+   GT L +IC
Sbjct  50   GPEAFAFDSQGGGPYTGVSGGKILKYQGPTLGFIEFAYILPIANKSLCEKAIGTFLGNIC  109

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRP+GL FN +TGDLYIAD + GL  V   GGLAK+LA    G  F F D + +D +TG 
Sbjct  110  GRPVGLAFNEKTGDLYIADAYLGLYVVSHRGGLAKRLADSAAGIPFRFLDGLDVDPVTGM  169

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF      F  ++        DTSGRL +Y+  T  VT +L+GL+G  G A+S D  F+
Sbjct  170  VYFTSFSTRFGPSELVLAVAVKDTSGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFV  229

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR----E  829
             +  F+  +I++++I+GPKA T E  + ++ G P+ ++R     G FWV  N+ +     
Sbjct  230  LVGEFLRNRILRYWIKGPKANTFEIFVPSIPG-PDNIRRTE--GGDFWVASNSVKLIVVP  286

Query  830  QQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF-EYFGKAYTGSLEADFVG  994
             +PS      AVK   +G+IL    L + Y   L S   EY    Y G+L   FVG
Sbjct  287  TEPS------AVKISSDGEILRHMPLGEYYRDTLVSEVNEYKNVVYLGTLTTTFVG  336



>ref|XP_006436702.1| hypothetical protein CICLE_v10033429mg [Citrus clementina]
 gb|ESR49942.1| hypothetical protein CICLE_v10033429mg [Citrus clementina]
Length=338

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 122/308 (40%), Positives = 169/308 (55%), Gaps = 13/308 (4%)
 Frame = +2

Query  107   LKLQ---NAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEK-CD  268
             LKLQ      GP+  AFD  G GPY GV DGRILK+ +    + +FAIT+PFR   + CD
Sbjct  36    LKLQLPAGVVGPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICD  95

Query  269   GTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFA  448
             GT+ T L  +CGRPLG+ FN  T DLYIAD +FGL+ VG NGG AKQLA+      F F 
Sbjct  96    GTSSTILEPLCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFT  155

Query  449   DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             +++ +D  TG  YF +S   F    +  + +SGD SGRLLKY+    QVT +  GLA P 
Sbjct  156   NALDIDPNTGVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPN  215

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G  +S+D +F+ +     R+I++ ++ G     +      +   P+ ++  T  +G FWV
Sbjct  216   GVTLSKDKSFLLVAESDSRRILRLWVEGESVIYSPQPFAQVAQFPDNIE--TDRNGDFWV  273

Query  809   PVNTPREQQPSPMTDSIAVKFD-RNGKILETRNLTKDYP-KLLGSYFEYFGKAYTGSLEA  982
              +NT R       TD +AVK D  NG +L+     K      +    E+ G  Y GS   
Sbjct  274   ALNTKRGND---KTDLVAVKLDGSNGNVLDVLEGNKQNALDSVSEVEEHGGYLYAGSPVQ  330

Query  983   DFVGVYRA  1006
              +V V +A
Sbjct  331   PYVVVIKA  338



>emb|CDP14992.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 163/260 (63%), Gaps = 8/260 (3%)
 Frame = +2

Query  227  FAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAK  406
            F++T  FRTK+ CDG N ++  S CGRPLGL FN +TG+LY+ D  FG L V   GGLA 
Sbjct  55   FSLTG-FRTKQLCDGAN-SSAASTCGRPLGLGFNFKTGELYVLDFKFGFLVVSPGGGLAT  112

Query  407  QLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAAT  586
            QLA G+NG  F+F +++ +DQ     YF ++G IFL+ + + I QS DTSG+L KY+A T
Sbjct  113  QLATGLNGTTFVFPNALDIDQANQIVYFTDAGAIFLSRNLSTIIQSNDTSGKLYKYDART  172

Query  587  GQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPE  766
              ++ +L GL+GP+G A+S+   ++ I  +I  ++ +++ RGPKA ++E +L NL G+P+
Sbjct  173  KTLSLMLNGLSGPLGVAVSKCGAYVLIDEYIASRVRRYWARGPKAGSSE-ILVNLPGSPD  231

Query  767  FVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILE-TRNLTKDYP-KLLGSY  940
             +KR  ++S  F+  V T   +     T S+  + + +  I+E T NLT  Y   L+   
Sbjct  232  NIKR--TISDDFFAAV-TILNRHTFQTTSSLGQRINGDLGIVEATVNLTAQYTNNLISEV  288

Query  941  FEYFGKAYTGSLEADFVGVY  1000
             E+ GK Y GS  A FVGVY
Sbjct  289  QEFLGKLYIGSSTASFVGVY  308



>ref|XP_002312353.2| hypothetical protein POPTR_0008s10940g [Populus trichocarpa]
 gb|EEE89720.2| hypothetical protein POPTR_0008s10940g [Populus trichocarpa]
Length=357

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 160/279 (57%), Gaps = 19/279 (7%)
 Frame = +2

Query  104  KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTN  277
            +L L    GP+  AFD  G GPY  V DGRILK+      +++F+++SP R +  CDG+ 
Sbjct  41   QLALPAVVGPESIAFDCNGKGPYVSVSDGRILKWQGAKLGWIEFSVSSPQRDRHMCDGST  100

Query  278  GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
             T L  +CGRPLGL FN  T DLYIAD ++GLL VG  GG+A QLAA   G  F F +++
Sbjct  101  NTKLEPVCGRPLGLKFNSATCDLYIADAYYGLLVVGPEGGVATQLAASAEGVPFRFMNAL  160

Query  458  SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
             +D  TG  YF +S   F   ++     S D +GRL+KY+  + +VT +L GLA P G A
Sbjct  161  DVDSRTGVVYFTDSSIYFQRREYLLAIISADKTGRLMKYDPNSKKVTVLLKGLAFPNGVA  220

Query  638  ISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVN  817
            IS+D++FI +      +I+K Y+ G +    ET ++ LG  P+ +KR    +G FWV +N
Sbjct  221  ISKDNSFILVAESFTMRILKFYLVGSEIHGQETFIQ-LGRFPDNIKRTA--NGEFWVALN  277

Query  818  TPR-----------EQQPSP---MTDSIAVKFDRNGKIL  892
            T R           +Q+ S    + D +AV+    GK++
Sbjct  278  TGRGKIRRLDSTKLQQETSIDWFVDDPVAVRLTSGGKVV  316



>ref|XP_006436705.1| hypothetical protein CICLE_v10033909mg [Citrus clementina]
 gb|ESR49945.1| hypothetical protein CICLE_v10033909mg [Citrus clementina]
Length=338

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 122/308 (40%), Positives = 168/308 (55%), Gaps = 13/308 (4%)
 Frame = +2

Query  107   LKLQ---NAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEK-CD  268
             LKLQ      GP+  AFD  G GPY GV DGRILK+ +    + +FAIT+PFR   + CD
Sbjct  36    LKLQLPAGVVGPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICD  95

Query  269   GTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFA  448
             GT+ T L  +CGRPLG+ FN  T DLYIAD +FGL+ VG NGG AKQLA+      F F 
Sbjct  96    GTSSTILEPLCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFT  155

Query  449   DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             +++ +D  TG  YF +S   F    +  + +SGD SGRLLKY+    QVT +  GLA P 
Sbjct  156   NALDIDPNTGVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPN  215

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G  +S D +F+ +     R+I++ ++ G     +      +   P+ ++  T  +G FWV
Sbjct  216   GVTLSNDKSFLLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIE--TDRNGDFWV  273

Query  809   PVNTPREQQPSPMTDSIAVKFD-RNGKILETRNLTKDYP-KLLGSYFEYFGKAYTGSLEA  982
              +NT R       TD +AVK D  NG +L+     K      +    E+ G  Y GS   
Sbjct  274   ALNTKRGND---KTDLVAVKLDGSNGNVLDVLEGNKQNALDSVSEVEEHGGYLYAGSPVQ  330

Query  983   DFVGVYRA  1006
              +V V +A
Sbjct  331   PYVVVIKA  338



>ref|XP_003576963.1| PREDICTED: strictosidine synthase 3-like [Brachypodium distachyon]
Length=345

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 170/299 (57%), Gaps = 14/299 (5%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKC--DGTNGTNLLS  295
            G +  AFDPRG GPY GV DGR+L++  S   +  FA  + +R    C           S
Sbjct  51   GAESLAFDPRGQGPYAGVSDGRVLRWGGSAVGWTTFAHHADYRRIPLCTVPVAPSQETES  110

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            ICGRPLGL F+R++GDLYIAD + GLLRVGS+GG A+ LA G++G  F F + + +DQ T
Sbjct  111  ICGRPLGLAFHRKSGDLYIADAYKGLLRVGSDGGEAEVLATGVDGVPFHFVNGIDVDQAT  170

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            GD YF +S   +       I  + D +GRLLKYEA T QVT +  GL  P G A+S D T
Sbjct  171  GDVYFTDSSVTYSRRFNTEIMMNADATGRLLKYEARTKQVTVLKDGLPYPNGVAVSHDWT  230

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
            ++ +   +  + +++Y+RGPKA   E ++ +L G P+ V+R +   GGFWV +N  R + 
Sbjct  231  YVVVAHTVPCQALRYYLRGPKAGQYE-LMADLPGYPDNVRRDS--KGGFWVALNQERARP  287

Query  836  PSPMTDS-----IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
             +    +     + V+ D +G  LE   LT      L    +   + + GS+E D++GV
Sbjct  288  DAAAAPAVTKHLVGVRLDGDGAQLE--ELTAAKGVTLSEVTQRSNRLWLGSVELDYIGV  344



>ref|XP_010428362.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=326

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 163/294 (55%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFDP G G YTGV  G+ILK++  N FVDFA  +     + C+G  G      CG
Sbjct  37    GPESFAFDPTGKGFYTGVSGGKILKYTPENGFVDFAQMTKSSNSKWCNGALGFAFAGKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+  N +TGDLY+AD   GL  +   GGLA ++A  ++GK F F D + +D  TG  
Sbjct  97    RPSGIALNSKTGDLYVADAPLGLHVISPAGGLATKIADSLDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F   +        D SG+L KYE AT  VT+++ GL+G  G A+S D +F+ 
Sbjct  157   YFTSFSSKFGPREVLIAVGLKDASGKLFKYEPATKTVTQLMEGLSGGAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I +++I GPKA T+E    NL  NP+ ++R+ S +G FWV     +   P  
Sbjct  217   VSEFIKSNIKRYWITGPKAGTSED-FSNLVSNPDNIRRSAS-TGNFWVASVVNKVVVP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NG++L+T +L  ++   LL    E  G  Y G+L   F G+ +
Sbjct  273   -TDPKAVKIDSNGQVLQTISLKNEFGNTLLSEVNELNGNLYIGTLTGPFAGIMK  325



>ref|XP_006440860.1| hypothetical protein CICLE_v10023327mg, partial [Citrus clementina]
 gb|ESR54100.1| hypothetical protein CICLE_v10023327mg, partial [Citrus clementina]
Length=331

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 161/295 (55%), Gaps = 6/295 (2%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLSI  298
            AFG +  AF+P GG  YTGV DGRILK+   + F DFA T+P R+K  CDGT   +L  I
Sbjct  17   AFGGESIAFEPVGGAFYTGVADGRILKYQAPDGFTDFAFTTPTRSKAVCDGTTNLDLGPI  76

Query  299  CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTG  478
            CGR  GL  +  T  LYIAD + GLL  G NG LA QLA G  G+ F F D + +DQ TG
Sbjct  77   CGRTFGLALHYATRQLYIADAYSGLLVDGPNGRLATQLATGAEGQAFHFLDGLDVDQGTG  136

Query  479  DAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTF  658
              YF ++   +      ++  + D++GRLL Y   + QVT +L  L GPVG AIS D +F
Sbjct  137  IVYFTDASGAYDFRTIVKLNITNDSTGRLLSYNPRSSQVTVLLRNLTGPVGVAISVDSSF  196

Query  659  IFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQP  838
            + ++ F   + +K+++RGP+A + + +  N    P+ +KR   L   FW      R+   
Sbjct  197  LLVSEFTENRTLKYWLRGPRANSFDII--NFQAKPDNIKRNPGLLQTFWEAAIITRQPAG  254

Query  839  SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKA-YTGSLEADFVGVY  1000
            +P+   I  +    G +L+T +    Y     S  + FG A Y  S   DFVG Y
Sbjct  255  TPV--PIGQRISAFGAVLDTISFEAQYGTTPISEVQPFGGALYISSRSTDFVGGY  307



>emb|CBI18783.3| unnamed protein product [Vitis vinifera]
Length=312

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 149/260 (57%), Gaps = 19/260 (7%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLS  295
             FGP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR    CDG+    +  
Sbjct  37   VFGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPNFCDGSLNLAIEQ  96

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            +CGRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F +++ +DQ T
Sbjct  97   VCGRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNT  156

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            G  YF ++  IF    +A   Q GD +GRLLKY+  T +VT +L GL+   G A+SED  
Sbjct  157  GVVYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKD  216

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
            F+ +T     K+ +++               L G P+ ++R  +++G FWV  N      
Sbjct  217  FVLVTETTAAKVTRYW-----------TFTQLVGCPDNIQR--NINGEFWVAQNNCGR--  261

Query  836  PSPMTDSIAVKFDRNGKILE  895
              P      V+ ++ GKI+E
Sbjct  262  --PEVKVRPVRLNKEGKIVE  279



>emb|CDP12339.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 163/275 (59%), Gaps = 15/275 (5%)
 Frame = +2

Query  35   VSMLMFISSLCMIHS-HPERDLIAKLKLQN-------AFGPKDTAFDPRGGGPYTGVRDG  190
             ++L+F+ SL  +HS H  R  I++ K  +       A GP+  AFD  GGGPYTGV DG
Sbjct  16   TAILIFVGSLGTVHSGHEPRHPISQRKWSHEQFPIYGASGPESLAFDRHGGGPYTGVSDG  75

Query  191  RILKF--SNGNFVDFAITSPFRTKEKCDGT-NGTNLLSICGRPLGLDFNRRTGDLYIADI  361
            RI+K+  +   +++FA T+PFR  + CDG+ +  N  + CGRPLGL F+ +TGDLYIAD 
Sbjct  76   RIIKWDRNQSRWINFATTTPFR--DGCDGSADHANTEARCGRPLGLSFDHKTGDLYIADA  133

Query  362  HFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQ  541
            + GLL VGS GGLA  +A  ++G  F F + + +DQ +G  YF ++   F   +FA +  
Sbjct  134  YMGLLAVGSKGGLATPVAQEVDGFPFKFLNDLVIDQDSGAIYFTDTSTRFERREFANVMF  193

Query  542  SGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKA  721
            SGD SGRLLKY+    +VT +L  L  P G A+S+D  F+ +      +I+++++     
Sbjct  194  SGDNSGRLLKYDPRNNEVTVLLHNLMFPNGVALSKDGDFLLVAETTNSRILRYWLEPSSK  253

Query  722  KTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR  826
                 V  NL G P+ +KR  + +G FWV  N+ +
Sbjct  254  LGKVEVFANLPGRPDNIKR--NQNGEFWVAANSEK  286



>emb|CDY47728.1| BnaA02g16670D [Brassica napus]
Length=327

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 162/294 (55%), Gaps = 6/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G   YTGV  G+ILK++ +  FVDFA  +   T   C G  GT L   CG
Sbjct  37    GPESFAFDSTGKAFYTGVSGGKILKYTPDKGFVDFAQITKTSTSSWCKGVFGTALAKKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN +TGDLY+AD   GL  +   GG+A ++A  ++GK F F D + +D  TG  
Sbjct  97    RPAGIAFNPKTGDLYVADAPLGLHVIHPAGGVATKIADSVDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F  ++        D SG+L KY+ AT  VT ++  L+G  G A+S D +F+ 
Sbjct  157   YFTSFSSKFSPSEVFIAVGVKDASGKLFKYDPATKAVTVLMEDLSGAAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I +++I+GPKA +T+ +  +   NP+ ++R  S +G FWV     +   P  
Sbjct  217   VSEFIKSNIKRYWIKGPKAGSTDDIFSSSVSNPDNIRRIGS-TGNFWVASVINKVVMP--  273

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NGK+L+T  L  ++   LL    E  GK Y G+L   F GV +
Sbjct  274   -TDPSAVKIDSNGKVLQTIFLKNEFGNTLLSEANEVDGKLYIGTLTGPFAGVMK  326



>ref|XP_009128019.1| PREDICTED: strictosidine synthase 1-like [Brassica rapa]
Length=327

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 162/294 (55%), Gaps = 6/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G   YTGV  G+ILK++ +  FVDFA  +   T   C G  GT L   CG
Sbjct  37    GPESFAFDSTGKAFYTGVSGGKILKYTPDKGFVDFAQITKTSTSSWCKGVFGTALAKKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN +TGDLY+AD   GL  +   GG+A ++A  ++GK F F D + +D  TG  
Sbjct  97    RPAGIAFNPKTGDLYVADAPLGLHVIHPAGGVATKIADSVDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F  ++        D SG+L KY+ AT  VT ++  L+G  G A+S D +F+ 
Sbjct  157   YFTSFSSKFSPSEVFIAVGVKDASGKLFKYDPATKAVTVLMEDLSGAAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I +++I+GPKA +T+ +  +   NP+ ++R  S +G FWV     +   P  
Sbjct  217   VSEFIKSNIKRYWIKGPKAGSTDDIFSSSVSNPDNIRRIGS-TGNFWVASVINKVVMP--  273

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NGK+L+T  L  ++   LL    E  GK Y G+L   F GV +
Sbjct  274   -TDPSAVKIDSNGKVLQTIFLKNEFGNTLLSEANEVDGKLYIGTLTGPFAGVMK  326



>gb|KDO65594.1| hypothetical protein CISIN_1g048181mg [Citrus sinensis]
Length=310

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/311 (38%), Positives = 168/311 (54%), Gaps = 8/311 (3%)
 Frame = +2

Query  35   VSMLMFISSLC-MIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSN  211
            +S+ +F+ SL  M+ S P    I  L    AFG +  AF+P GG  YTGV DGRILK+  
Sbjct  5    LSLFVFVFSLPRMVFSIPTFTKI--LFPPKAFGGESIAFEPVGGAFYTGVADGRILKYQA  62

Query  212  GN-FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGS  388
             + F DFA T+P R+K  CDGT   +L  IC R  GL  +  T  LYIAD + GLL VG 
Sbjct  63   PDGFTDFAFTTPTRSKAVCDGTTNLDLGPICRRTFGLALHYATRQLYIADAYSGLLVVGP  122

Query  389  NGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLL  568
            NG LA QLA G  G+ F F D + +DQ TG  YF ++  ++      ++  + D++GRLL
Sbjct  123  NGRLATQLATGAEGQAFHFLDGLDVDQGTGVVYFTDASGVYDFRTIVKLNITNDSTGRLL  182

Query  569  KYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLEN  748
             Y   + QVT +L  L GP G AIS D +F+ ++ F G + +K+++RGP+A + + +  N
Sbjct  183  SYNPRSSQVTVLLRNLTGPAGVAISVDSSFLLVSEFTGNRTLKYWLRGPRANSFDII--N  240

Query  749  LGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKL  928
                P  +KR   L   FW      R+   +P+   I  +    G +L+T +    Y   
Sbjct  241  FQAKPHNIKRNPGLLQTFWEAAIITRQPAGTPV--PIGQRISAFGAVLDTISFEAQYSTT  298

Query  929  LGSYFEYFGKA  961
              S  + FG A
Sbjct  299  PISEVQPFGGA  309



>gb|AES91361.2| strictosidine synthase-like protein, putative [Medicago truncatula]
Length=336

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/345 (34%), Positives = 186/345 (54%), Gaps = 26/345 (8%)
 Frame = +2

Query  11   MKSLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRD  187
            M ++ M   +  + I  LC   S     L+ KL+L +   GP+  AFD  G GPY G  D
Sbjct  1    MLNMAMVVTATTLVILLLCSQSS--VAILLNKLQLPSPVTGPESLAFDKNGEGPYVGSSD  58

Query  188  GRILKFSNGN--FVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIAD  358
            GRI K++  +  F ++A TSP R K  CDG ++ + + + CGRPLGL FN +TGDLY+AD
Sbjct  59   GRIFKYNGPDVGFKEYAYTSPNRNKTVCDGLSDFSAVQATCGRPLGLGFNHQTGDLYVAD  118

Query  359  IHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIA  538
             + GL++V  +GG   QL       + +FAD + +D  TG  YF  +   F   D+  + 
Sbjct  119  AYLGLVKVSPDGGNVTQLVGPAQANSTMFADGLDVDPDTGIVYFTVASTNFQLKDYQTLV  178

Query  539  QSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPK  718
             SGD+SG LL+Y+ +T Q T +L+ L+ P G A+S+D +F+ +  ++  +I + +++GP+
Sbjct  179  TSGDSSGSLLRYDPSTNQTTVLLSNLSMPSGVAVSKDGSFVLVGEYLSNRIQRVWLKGPR  238

Query  719  AKTTETVLENLGGNPEFVKRATSLSGGFWV----------PVNTPREQQPSPMTDSIAVK  868
            A ++E  +  L G P  +KR +  +G FW+          P++  R   P        V+
Sbjct  239  ANSSELFML-LTGRPNNIKRNS--AGQFWISVHSVLGLGLPISPRRTALPR------GVR  289

Query  869  FDRNGKILETRNLTKDYPKLLGSYF-EYFGKAYTGSLEADFVGVY  1000
               N  IL+  +L  +Y     S   EY GK Y GSL A +  ++
Sbjct  290  VSENRIILQIASLVAEYGIEPASEVQEYNGKLYAGSLLASYASIF  334



>emb|CDP06823.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 121/306 (40%), Positives = 160/306 (52%), Gaps = 19/306 (6%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTK------EKCDGTN  277
            + GP+  A D    GPY G+ DGRILK+   N  FV FA TSP R +      E CD   
Sbjct  34   SIGPESIALDRFNQGPYIGISDGRILKYKGPNVGFVLFAYTSPNRYERMKGFYELCDDVT  93

Query  278  GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
              NL   CGRP G  FN   G LYI D   GL +VG  GGLA  +A    G  F F + +
Sbjct  94   DPNLGPTCGRPFGFSFNNFNGVLYIVDALLGLFKVGPEGGLATLIAKSAGGVPFKFLNGI  153

Query  458  SLDQLTGDAYFVESGEIFLTNDFARIAQSG---DTSGRLLKYEAATGQVTEVLTGLAGPV  628
             +DQLTGD Y   + + F   D   + Q     D++GRL+ Y   T ++  +L GL+ P 
Sbjct  154  DVDQLTGDVYLTVASQTF---DLRNVIQGNYVLDSTGRLITYNPITKELKVLLDGLSIPA  210

Query  629  GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
            G  +S D TF+  + F  + + K+ + G KA TTE +L NL GNP  +KRA    G FWV
Sbjct  211  GPVVSTDRTFVLFSEFSTKTVKKYCLTGLKANTTEALL-NLPGNPVKIKRAPE-PGKFWV  268

Query  809  PVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYF--GKAYTGSLEA  982
             VN   +QQP   T     KFD  G+IL  +NL   Y  ++ +  + +  G+   GS E 
Sbjct  269  AVNEIVQQQPRNAT-PFGYKFDSFGEILLIKNLEDHYSNIIVNLVQEYNGGRVVVGSREV  327

Query  983  DFVGVY  1000
             FVG+Y
Sbjct  328  KFVGMY  333



>ref|XP_004508606.1| PREDICTED: strictosidine synthase 1-like [Cicer arietinum]
Length=334

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 127/337 (38%), Positives = 189/337 (56%), Gaps = 12/337 (4%)
 Frame = +2

Query  11   MKSLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRD  187
            M ++ +  VS  +FI  LC   S      + +L+L +   GP+  AFD  G GPY    D
Sbjct  1    MLNINIIIVSATLFIFLLCSPSS--VAIFLNRLQLPSPVTGPESLAFDRNGEGPYVSSSD  58

Query  188  GRILKF--SNGNFVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIAD  358
            GRILK+   N  F ++A+TSP R K  CDG  + + + + CGRPLGL FN +T DLY+AD
Sbjct  59   GRILKYLGPNYGFKEYAVTSPNRNKTICDGLADFSAIQATCGRPLGLGFNHQTNDLYVAD  118

Query  359  IHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIA  538
             +FGL++VG NG    QL       +  F D + +DQ TG  YF E+   F   DF  + 
Sbjct  119  AYFGLIKVGPNGENVTQLVGPAKPNSTRFGDGLDVDQDTGIVYFTEASTNFQLKDFQTLL  178

Query  539  QSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPK  718
             SGD+SG LL Y+ +T Q T +L+ LA P G A+S D +F+ ++ ++  +I + +I+GP+
Sbjct  179  NSGDSSGSLLSYDPSTNQTTVLLSNLALPSGVAVSLDGSFVLVSEYLANRIQRVWIKGPR  238

Query  719  AKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT--PREQQPSPMTDSIAVKFDRNGKIL  892
            A T+E  ++ L G P+ +KR +   G FW+ VN+  P  + P   T    V+   NG +L
Sbjct  239  ANTSELFMQ-LPGRPDNIKRNS--RGQFWISVNSFIPPPRFPRRSTLPAGVRVGANGLVL  295

Query  893  ETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVY  1000
            +  +L  +Y  + +    E+ G  Y GSL A F  V+
Sbjct  296  QIVSLVPEYGTEPVSEVQEFNGTLYGGSLLASFASVF  332



>ref|XP_010471491.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=326

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 162/294 (55%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFDP G G YTGV  G+ILK++  N FVDFA  +     + C+G  G      CG
Sbjct  37    GPESFAFDPTGKGFYTGVSGGKILKYTPENGFVDFAQMTKSSNSKWCNGVLGAAFAGKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+  N +TGDLY+AD   GL  +   GGLA ++A  ++GK F F D + +D  TG  
Sbjct  97    RPSGIALNSKTGDLYVADAPLGLHVISPAGGLATKIADSLDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F   +        D SG+L KY+ AT  VT+++ GL+G  G A+S D +F+ 
Sbjct  157   YFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKTVTQLMDGLSGGAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I +++I GPKA T E    NL  NP+ ++R+ S +G FWV     +   P  
Sbjct  217   VSEFIKSNIKRYWITGPKAGTFED-FSNLVSNPDNIRRSAS-TGNFWVASVVNKVVVP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NGK+L+T +L  ++   LL    E  G  Y G+L   F G+ +
Sbjct  273   -TDPKAVKIDSNGKVLQTISLKNEFGNTLLSEVNELNGHLYIGTLTGPFAGIMK  325



>ref|XP_002888957.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65216.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 160/294 (54%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK+  +  +VDFA  +       C+G  GT     CG
Sbjct  37    GPESFAFDSTGNGFYTGVSGGKILKYVPDKGYVDFAQITESSNSAWCNGALGTAFAGKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+  N +TGDLY+AD   GL  +   GGLA +LA  ++GK F F D + +D  TG  
Sbjct  97    RPAGIALNSKTGDLYVADAPLGLHVIPPAGGLATKLADSVDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F   +        D SG+L KY+ AT  VTE++ GL+G  G A+S D +F+ 
Sbjct  157   YFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKAVTELMQGLSGAAGCAVSSDGSFVV  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I +++I+GPKA T E    +L  NP+ ++R  S +G FWV     +   P  
Sbjct  217   VSEFIKSNIKRYWIKGPKAGTIED-FSSLVSNPDNIRRVGS-TGNFWVASVVNKVVMP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NGK+L+T  L  ++   LL    E+ G  Y G+L   F GV +
Sbjct  273   -TDPKAVKLDANGKVLQTIFLKNEFGNTLLSEVNEFNGHLYIGTLTGPFAGVMK  325



>ref|XP_006436697.1| hypothetical protein CICLE_v10033295mg [Citrus clementina]
 gb|ESR49937.1| hypothetical protein CICLE_v10033295mg [Citrus clementina]
Length=338

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/308 (40%), Positives = 167/308 (54%), Gaps = 13/308 (4%)
 Frame = +2

Query  107   LKLQ---NAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEK-CD  268
             LKLQ      GP+  AFD  G GPY GV DGRILK+ +    + +FAIT+PFR   + CD
Sbjct  36    LKLQLPAGVVGPESLAFDCNGKGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICD  95

Query  269   GTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFA  448
             GT+ T L  +CGRPLG+ FN  T DLYIAD +FGL+ VG NGG AKQLA+      F F 
Sbjct  96    GTSSTILEPLCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFT  155

Query  449   DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             +++ +D  TG  YF +S   F    +  + +SGD SGRLLKY+    QVT +  GLA P 
Sbjct  156   NALDIDPNTGVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPN  215

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G  +S D +F+ +     R I++ ++ G     +      +   P+ ++  T  +G FWV
Sbjct  216   GVTLSNDKSFLLVAESDSRTILRFWVEGESVIYSPQPFAQVAQFPDNIE--TDRNGDFWV  273

Query  809   PVNTPREQQPSPMTDSIAVKFD-RNGKILETRNLTKDYP-KLLGSYFEYFGKAYTGSLEA  982
              +NT R       TD +AVK D  NG +L+     K      +    E+ G  Y GS   
Sbjct  274   ALNTKRGND---KTDLVAVKLDGSNGNVLDVLEGNKQNDLDSVSEVEEHGGYLYAGSPVQ  330

Query  983   DFVGVYRA  1006
              +V V +A
Sbjct  331   PYVVVIKA  338



>ref|XP_002321516.2| hypothetical protein POPTR_0015s04660g [Populus trichocarpa]
 gb|EEF05643.2| hypothetical protein POPTR_0015s04660g [Populus trichocarpa]
Length=336

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 183/337 (54%), Gaps = 19/337 (6%)
 Frame = +2

Query  2    TTNMKSLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGV  181
            T++  S    W+S    +  L  I   P             FGP+  AF+  GG  YTGV
Sbjct  13   TSHQYSSFQTWLSSAQALKQLWQIFLPP-----------TGFGPESLAFESPGGAFYTGV  61

Query  182  RDGRILKFS--NGNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIA  355
             DGR+L++    G++  FAITSP RT   CDGT   +   ICGRPLGL ++  T  LYIA
Sbjct  62   NDGRVLRYQPPTGSWTSFAITSPNRTIALCDGTTDPDKGPICGRPLGLAYSPSTKLLYIA  121

Query  356  DIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARI  535
            D ++GL    SNG LAKQ+A    G+ F+  +++ +D +TG+ YF ++  ++   + ++ 
Sbjct  122  DAYYGLFVADSNGRLAKQIATSAEGQRFVACNALDIDPITGNIYFTDASAVYDLRNSSKA  181

Query  536  AQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGP  715
              + D++GRL+KY+    QVT +L  L+  VG A+S+D  F+ ++ F+G +I ++++ G 
Sbjct  182  LLANDSTGRLMKYDVRKNQVTVLLRNLSVAVGVAVSKDGGFVLVSEFVGNRIRRYWLTGR  241

Query  716  KAKTTETVLENLG-GNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKIL  892
             A T++  L NL    P  +KR TSL G F +   T R  Q S     I V+ D +G+I 
Sbjct  242  DAGTSDIFLSNLNIVRPNNIKR-TSL-GDFRIAAATVR--QDSQTLVPIRVRVDEHGRIS  297

Query  893  ETRNLTKDYPKLLGSYFEYFGKA-YTGSLEADFVGVY  1000
            ET +L   Y     S  +  G + Y  S   +FVGVY
Sbjct  298  ETVSLEAQYGSTPISEVQQSGLSLYVSSRGVNFVGVY  334



>ref|NP_177541.1| strictosidine synthase-like protein [Arabidopsis thaliana]
 gb|AAG52516.1|AC016662_10 putative strictosidine synthase; 39161-40746 [Arabidopsis thaliana]
 gb|AAM62921.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AAN17441.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AAP42735.1| At1g74010 [Arabidopsis thaliana]
 gb|AEE35537.1| strictosidine synthase-like protein [Arabidopsis thaliana]
Length=325

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 160/294 (54%), Gaps = 8/294 (3%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  GG  YTGV  G+ILK+  G  +VDFA  +       C+G  GT     CG
Sbjct  37    GPESFAFDSTGGF-YTGVSGGKILKYVPGKGYVDFAQITDSSNSAWCNGALGTAFAGKCG  95

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+  N +TGDLY+AD   GL  +   GGLA +LA  ++GK F F D + +D  TG  
Sbjct  96    RPAGIALNSKTGDLYVADAPLGLHVISPAGGLATKLADSVDGKPFKFLDGLDVDPTTGVV  155

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F   +        D SG+L KY+ AT  VTE++ GL+G  G A+S D +F+ 
Sbjct  156   YFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKAVTELMEGLSGAAGCAVSSDGSFVL  215

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I K++I+GPKA T E    +L  NP+ ++R  S +G FWV     +   P  
Sbjct  216   VSEFIKSNIKKYWIKGPKAGTIED-FSSLVSNPDNIRRVGS-TGNFWVASVVNKVVMP--  271

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NGK+L+T  L  ++   LL    E+ G  Y G+L   F GV +
Sbjct  272   -TDPRAVKLDANGKVLQTIFLKNEFGNTLLSEVNEFNGHLYIGTLTGPFAGVMK  324



>ref|XP_003609164.1| Strictosidine synthase [Medicago truncatula]
Length=333

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/317 (36%), Positives = 176/317 (56%), Gaps = 24/317 (8%)
 Frame = +2

Query  95   LIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKC  265
            L+ KL+L +   GP+  AFD  G GPY G  DGRI K++  +  F ++A TSP R K  C
Sbjct  24   LLNKLQLPSPVTGPESLAFDKNGEGPYVGSSDGRIFKYNGPDVGFKEYAYTSPNRNKTVC  83

Query  266  DG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFI  442
            DG ++ + + + CGRPLGL FN +TGDLY+AD + GL++V  +GG   QL       + +
Sbjct  84   DGLSDFSAVQATCGRPLGLGFNHQTGDLYVADAYLGLVKVSPDGGNVTQLVGPAQANSTM  143

Query  443  FADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAG  622
            FAD + +D  TG  YF  +   F   D+  +  SGD+SG LL+Y+ +T Q T +L+ L+ 
Sbjct  144  FADGLDVDPDTGIVYFTVASTNFQLKDYQTLVTSGDSSGSLLRYDPSTNQTTVLLSNLSM  203

Query  623  PVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGF  802
            P G A+S+D +F+ +  ++  +I + +++GP+A ++E  +  L G P  +KR +  +G F
Sbjct  204  PSGVAVSKDGSFVLVGEYLSNRIQRVWLKGPRANSSELFML-LTGRPNNIKRNS--AGQF  260

Query  803  WV----------PVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF-EY  949
            W+          P++  R   P        V+   N  IL+  +L  +Y     S   EY
Sbjct  261  WISVHSVLGLGLPISPRRTALPR------GVRVSENRIILQIASLVAEYGIEPASEVQEY  314

Query  950  FGKAYTGSLEADFVGVY  1000
             GK Y GSL A +  ++
Sbjct  315  NGKLYAGSLLASYASIF  331



>ref|XP_006485738.1| PREDICTED: strictosidine synthase 1-like [Citrus sinensis]
Length=310

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 117/312 (38%), Positives = 168/312 (54%), Gaps = 10/312 (3%)
 Frame = +2

Query  35   VSMLMFISSLC-MIHSHPERDLIAKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDGRILKFS  208
            +S+ +F+ SL  M+ S P      K+     AFG +  AF+P GG  YTGV DGRILK+ 
Sbjct  5    LSLFVFVFSLPRMVFSIPT---FTKIPFPPKAFGGESIAFEPVGGAFYTGVADGRILKYQ  61

Query  209  NGN-FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVG  385
              + F DFA T+P R+K  CDGT   +L  IC R  GL  +  T  LYIAD + GLL VG
Sbjct  62   APDGFTDFAFTTPTRSKAVCDGTTNLDLGPICRRTFGLALHYATRQLYIADAYSGLLVVG  121

Query  386  SNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRL  565
             NG LA QLA G  G+ F F D + +DQ TG  YF ++  ++      ++  + D++GRL
Sbjct  122  PNGRLATQLATGAEGQAFHFLDGLDVDQGTGVVYFTDASGVYDFRTIVKLNITNDSTGRL  181

Query  566  LKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLE  745
            L Y   + QVT +L  L GP G AIS D +F+ ++ F G + +K+++RGP+A + + +  
Sbjct  182  LSYNPRSSQVTVLLRNLTGPAGVAISVDSSFLLVSEFTGNRTLKYWLRGPRANSFDII--  239

Query  746  NLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPK  925
            N    P  +KR   L   FW      R+   +P+   I  +    G +L+T +    Y  
Sbjct  240  NFQAKPHNIKRNPGLLQTFWEAAIITRQPAGTPV--PIGQRISAFGAVLDTISFEAQYST  297

Query  926  LLGSYFEYFGKA  961
               S  + FG A
Sbjct  298  TPISEVQPFGGA  309



>ref|XP_006436612.1| hypothetical protein CICLE_v10033527mg [Citrus clementina]
 gb|ESR49852.1| hypothetical protein CICLE_v10033527mg [Citrus clementina]
Length=338

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/308 (40%), Positives = 166/308 (54%), Gaps = 13/308 (4%)
 Frame = +2

Query  107   LKLQ---NAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEK-CD  268
             LKLQ      GP+  AFD  G GPY  V DGRILK+ +    + +FAIT+PFR   + CD
Sbjct  36    LKLQLPAGVVGPESLAFDCNGEGPYASVSDGRILKWQDSKLGWTEFAITTPFRRLRRICD  95

Query  269   GTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFA  448
             GT+ T L  +CGRPLG+ FN  T DLYIAD +FGL+ VG NGG AKQLA+      F F 
Sbjct  96    GTSSTILEPLCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFT  155

Query  449   DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             +++ +D  TG  YF +S   F    +  + +SGD SGRLLKY+    QVT +  GLA P 
Sbjct  156   NALDIDPNTGVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPN  215

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G  +S D +F+ +     R+I++ ++ G     +      +   P+ ++  T  +G FWV
Sbjct  216   GVTLSNDKSFLLVAESDSRRILRFWVEGESVVYSPQPFAQVAQFPDNIE--TDRNGDFWV  273

Query  809   PVNTPREQQPSPMTDSIAVKFD-RNGKILETRNLTKDYPKLLGSYFEYFGK-AYTGSLEA  982
              +NT R       TD +AVK D  NG +L+     K       S  E  G   Y GS   
Sbjct  274   ALNTKRGND---KTDLVAVKLDGSNGNVLDVLEGNKQNALDSVSEVEEHGAYLYAGSPVQ  330

Query  983   DFVGVYRA  1006
              +V V +A
Sbjct  331   PYVVVIKA  338



>ref|XP_006351273.1| PREDICTED: strictosidine synthase 1-like [Solanum tuberosum]
Length=372

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/340 (34%), Positives = 181/340 (53%), Gaps = 41/340 (12%)
 Frame = +2

Query  89    RDLIAK---LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN---FVDFAITSPFR  250
             +DL++K   + L+ A GP+  AFDP G GPYTGV DGRILK+ NG+   +VDFA+TS  R
Sbjct  37    KDLLSKSEVIHLKGAVGPESVAFDPNGEGPYTGVADGRILKW-NGDSDGWVDFAVTSSQR  95

Query  251   TKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGING  430
               ++C       +  +CGRPLGL F+ RTGDLY+AD + GL  VG +GGLA  L   + G
Sbjct  96    --KQCVHPFAPQMEHVCGRPLGLRFDTRTGDLYVADAYLGLHVVGPSGGLATSLVTEVEG  153

Query  431   KNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLT  610
             ++  F + + +D+     YF ++   F    F     SGD +GRL+KY+ +T  VT +L 
Sbjct  154   QHLRFTNDLDIDEQEDVIYFTDTSTQFQRRQFIASVVSGDKTGRLMKYDISTKAVTVLLR  213

Query  611   GLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSL  790
             GLA   G A+S+D +F+ +      ++++H+++GP A   +T   +L G P+ ++R +  
Sbjct  214   GLAFANGVALSKDKSFVLVAETTTCRVVRHWLKGPHAGKHDT-FADLPGYPDNIRRNS--  270

Query  791   SGGFWVPVNTPREQQPSPMTD----------------------------SIAVKFDRNGK  886
              G FWV +++ R      +T                             + A+K   +G+
Sbjct  271   RGEFWVGLHSKRSLLAKLVTSNSWLGKTILKLPFTFQQLHFLLVGGQPHATAIKLSEDGQ  330

Query  887   ILET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             +LE   +L     K +    E  GK + GS+   F+GV+ 
Sbjct  331   VLEVLEDLESKTLKFISEVEEKNGKLWIGSVLVPFIGVHE  370



>ref|XP_004963976.1| PREDICTED: strictosidine synthase-like [Setaria italica]
Length=352

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 165/294 (56%), Gaps = 10/294 (3%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT--NGTNLLS  295
            G +  AFD RG GPYTGV DGRIL++  S+ ++  FA  + ++ K  C        ++ S
Sbjct  61   GAESLAFDRRGQGPYTGVSDGRILRWDGSSNSWTTFAYNANYKNKPICTAPARRQEDVES  120

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            ICGRPLGL F  +TGDLYIAD + GL++VGSNGG A+ LAA  +G  F F + + +DQ+T
Sbjct  121  ICGRPLGLQFYAKTGDLYIADAYLGLMKVGSNGGEAEVLAAEADGVPFTFTNGIDVDQVT  180

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            GD YF +S   +      +I    D +GRLL+Y A  G+VT +  GL  P G A+S D T
Sbjct  181  GDIYFTDSSTTYTRARNTQIMIHRDVTGRLLRYNARAGRVTVLKAGLPYPNGVALSTDRT  240

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
             + +      +  +++IRGPKA   E +L +L G  + ++R T   GG+W  +N  +   
Sbjct  241  HVVVAHTGPCQAFRYWIRGPKAGRYE-LLADLPGYADNIRRDT--RGGYWFALNREKINA  297

Query  836  PSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
             +P    + V+ D  G  LE     K     L    E  GK + GS+E D+VG+
Sbjct  298  TAP-EHLVGVRVDSKGAELEVMTAAKGV--TLSDIAEKDGKLWLGSVELDYVGL  348



>ref|XP_006390480.1| hypothetical protein EUTSA_v10018852mg [Eutrema salsugineum]
 gb|ESQ27766.1| hypothetical protein EUTSA_v10018852mg [Eutrema salsugineum]
Length=328

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 160/292 (55%), Gaps = 8/292 (3%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  GGGPYTGV  G+ILK+      F +FA  SP   K  CD   G+ L +IC
Sbjct  40   GPEAFAFDSHGGGPYTGVSGGKILKYQGPKLGFAEFAYISPTANKSLCDKAIGSFLGNIC  99

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRP+GL FN +TGDLYIAD   GL  V   GG AK+LA    G  F F D + +D +TG 
Sbjct  100  GRPVGLAFNEKTGDLYIADAFLGLYMVSHRGGQAKRLADSAGGFPFRFLDGLDVDPVTGL  159

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF      F  +         D +GRL +Y+     VT +L+GL+G  G A+S D  F+
Sbjct  160  VYFTSFSTRFGPSQLVLAVAVKDATGRLFRYDPKMKTVTVLLSGLSGSAGCAVSSDGEFV  219

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
             +  F+  +I+K++I+GPKA T E ++ ++ G P+ ++R     G FWV  N+ +     
Sbjct  220  LVGEFLRNRILKYWIKGPKANTWEILVPSIPG-PDNIRRTD--GGDFWVASNSVKLIVVP  276

Query  842  PMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVG  994
              T+  AVK   +G+IL   +L + Y   L+    EY    Y G+L  +FVG
Sbjct  277  --TEPTAVKISSDGEILRRISLGEYYGDTLVSEVNEYKNIVYMGTLTTNFVG  326



>gb|EYU18642.1| hypothetical protein MIMGU_mgv1a008518mg [Erythranthe guttata]
Length=371

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/248 (39%), Positives = 152/248 (61%), Gaps = 5/248 (2%)
 Frame = +2

Query  77   SHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTK  256
            SH    L  ++ L  A GP+   FDP GGGPYTGV DGRILK++  N+++F++TS  R  
Sbjct  37   SHDVLHLAERIHLPGAVGPESLVFDPSGGGPYTGVADGRILKWNGKNWLEFSVTSSQR--  94

Query  257  EKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKN  436
            E+C       +  +CGRPLGL F+R++GDLYIAD + GL  VG  GG+A  L   ++G  
Sbjct  95   EECSEAFNPTMEHVCGRPLGLRFHRKSGDLYIADAYLGLQVVGPRGGMASPLVTHVHGNK  154

Query  437  FIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGL  616
            F+F + + +D+     YF +S  +F   +F     + D +G+L+KY+ ++ QVT +L GL
Sbjct  155  FLFTNDIDIDEEDNAIYFTDSSTVFHRREFMPSILTMDKTGKLMKYDISSKQVTILLQGL  214

Query  617  AGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSG  796
            A   G A+S+D +F+ +     R+I++++++GP     +T +E L G P+ V+R  +  G
Sbjct  215  AFANGVALSKDRSFVLVAETTNRRILRYWLQGPNIGKHDTFVE-LPGLPDNVRR--NQEG  271

Query  797  GFWVPVNT  820
             FWV +++
Sbjct  272  EFWVALHS  279



>ref|XP_009799719.1| PREDICTED: strictosidine synthase 1-like [Nicotiana sylvestris]
Length=337

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 181/331 (55%), Gaps = 22/331 (7%)
 Frame = +2

Query  35   VSMLMFISSLCMIHSHP---ERDLIAK---LKLQNAFGPKDTAFDPRGGGPYTGVRDGRI  196
            +S+++  +S  M+   P    ++L+ K   ++L+ A GP+  AFDP G GPYTGV DGRI
Sbjct  17   ISVILAFNSENMLKQPPIPSTQNLLRKAEIIQLKGAVGPESIAFDPNGEGPYTGVADGRI  76

Query  197  LKFSNG--NFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFG  370
            LK+      + +FA+TS  R    C   +   +  ICGRPLGL F+++TGDLYIAD +FG
Sbjct  77   LKWQEQAQTWANFAVTSSERNN--CTRPSAPEMEHICGRPLGLRFDKKTGDLYIADAYFG  134

Query  371  LLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGD  550
            L  VG  GGLA  L     GK  IF + + +D      YF +S   +    +     SGD
Sbjct  135  LQVVGPKGGLATPLVHEFEGKPLIFTNDMDIDDQNNVIYFTDSSTKYQRRQYFAAFVSGD  194

Query  551  TSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTT  730
            T+GRL+KY+ +T +VT +L GLA   G A+++D +F+ ++     +II+++I+GP  K  
Sbjct  195  TTGRLMKYDKSTKKVTVLLRGLAFANGVALNKDQSFLLVSETANCRIIRYWIKGP-YKGR  253

Query  731  ETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILET-RNL  907
              +  ++ G P+ ++   +  G FWV +N          T + A+K    G++LE   + 
Sbjct  254  HDIFADVPGFPDNIR--INSRGEFWVALNA--------KTSATAIKLSAEGQMLEVLEDE  303

Query  908  TKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
                 + +    E  GK + GS+   F+GVY
Sbjct  304  EGKTLRYISQVEEKHGKLWFGSVTMPFLGVY  334



>emb|CDX73037.1| BnaC06g34850D [Brassica napus]
Length=328

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/296 (39%), Positives = 160/296 (54%), Gaps = 16/296 (5%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  GGGPYTGV  G+ILK+  S   F +FA  +P   K  CD   GT L +IC
Sbjct  40   GPEAFAFDSHGGGPYTGVSGGKILKYQGSELGFTEFAYITPLANKSLCDKAVGTFLGNIC  99

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRP+GL FN  TGDLYIAD   GL  V   GG AK+LA    G  F F D + +D +TG 
Sbjct  100  GRPVGLAFNEITGDLYIADAFLGLYVVSGRGGQAKRLADSAGGSPFKFLDGLDVDPVTGS  159

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF      F  +         D +GR  +Y+  T  VT +L+GL+G  G A+S D  F+
Sbjct  160  VYFTSFSTRFGPSQLVLAVAVNDATGRFFRYDPKTKSVTVLLSGLSGSAGCAVSSDGEFV  219

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR----E  829
             +  F+  +I++++I+GPKA T E  + ++ G P+ ++R     G FW+  N+ +     
Sbjct  220  LVGEFLRNRILRYWIKGPKANTWEIFVPSIPG-PDNIRRTD--GGDFWIASNSLKLIVLP  276

Query  830  QQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVG  994
             +PS      AVK +  G+I+   +L + Y   L+    EY    Y G+L  +FVG
Sbjct  277  TKPS------AVKINAGGEIIRRMSLGEYYGDTLVSEVNEYKSVVYVGTLTTNFVG  326



>ref|XP_002454704.1| hypothetical protein SORBIDRAFT_04g035910 [Sorghum bicolor]
 gb|EES07680.1| hypothetical protein SORBIDRAFT_04g035910 [Sorghum bicolor]
Length=346

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 172/299 (58%), Gaps = 13/299 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNG---NFVDFAITSPFRTKEKCDGTNGTNLL--  292
             GP+  AFD  G GPY+GV DGR+LK+ NG    +  +A  SP    E C  +        
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAY-SPGYDAEACTASRARPAELT  109

Query  293   -SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              S CGRPLGL F+RR+G+LYIAD + GL+RVG  GG A  LAA ++G    F + V +DQ
Sbjct  110   ESKCGRPLGLRFHRRSGNLYIADAYKGLMRVGPGGGEATVLAAEVDGVPLRFTNGVDVDQ  169

Query  470   LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
             +TGD +F +S   +  +   R+  +GD+SGRL+KY+  TGQVT +  G+  P G AIS D
Sbjct  170   VTGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPRTGQVTVLQAGITYPNGLAISAD  229

Query  650   HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
              T + + L    K+++++I+GPKA T+E  L +L G P+ V+      GGFWV ++  + 
Sbjct  230   RTHLVVALTGPCKLMRYWIKGPKAGTSEH-LADLPGYPDNVR--ADGRGGFWVALHREKM  286

Query  830   QQP-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             + P  P +  +AV+   +G++++     K   +         GK Y GS+E  +V V R
Sbjct  287   ELPFGPDSHLLAVRVGADGQVVQVMRGPKSV-RPTEVVEREGGKLYMGSVELPYVAVVR  344



>ref|XP_009631158.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=337

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 115/331 (35%), Positives = 179/331 (54%), Gaps = 22/331 (7%)
 Frame = +2

Query  35   VSMLMFISSLCMIHSHP---ERDLIAK---LKLQNAFGPKDTAFDPRGGGPYTGVRDGRI  196
            +S+++  +S  M+   P     +L+ K   ++L+ A GP+  AFDP G GPYTGV DGRI
Sbjct  17   ISVILAFNSENMLEPSPIPSSENLLPKAEIIQLKGAVGPESIAFDPNGEGPYTGVADGRI  76

Query  197  LKFSNG--NFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFG  370
            LK+      + DFA+TS  R    C   +   +  ICGRPLG+ F+++TGDLYIAD + G
Sbjct  77   LKWQEQAQTWADFAVTSSERNN--CTQPSAPEMEHICGRPLGIRFDKKTGDLYIADAYLG  134

Query  371  LLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGD  550
            L  VG  GGL   L     GK  IF + + +D      YF +S   +    +     SGD
Sbjct  135  LQVVGPKGGLTTPLVQKFEGKPLIFTNDMDIDNQNNVIYFTDSSTKYQRRQYFAAFVSGD  194

Query  551  TSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTT  730
            T+GRL+KY+ +T +VT VL GLA   G A+++D +F+ +      +II+++I+GP A   
Sbjct  195  TTGRLMKYDKSTKKVTVVLRGLAFANGVALNKDRSFVLVAETANCRIIRYWIKGPYAGRH  254

Query  731  ETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILET-RNL  907
            + +  ++ G P+ ++   +  G FWV ++          T + A+K   NG++LE   + 
Sbjct  255  D-IFADVPGFPDNIR--INSRGEFWVALHA--------KTSATAIKLSANGRMLEVLEDE  303

Query  908  TKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
                 + +    E  GK + GS+   F+GVY
Sbjct  304  DGKTLRYISEVEEKHGKLWFGSVMMPFLGVY  334



>emb|CDP12401.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 158/297 (53%), Gaps = 8/297 (3%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLS  295
            + GP+  A D    GPY GV DG ILK+   N  FV  A TS  RT+E CD T   NL  
Sbjct  34   SIGPESVALDRFNQGPYVGVLDGTILKYKGPNIGFVFLAYTSRNRTRELCDVTTDPNLGP  93

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            ICG P G  FN  TG LY+ D+  GL +VG+ GG A  +A    G  F F + V +DQ T
Sbjct  94   ICGWPFGFSFNVVTGFLYVVDVFLGLSKVGTEGGNATLIANSAGGVPFQFLNGVDVDQFT  153

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            GD YF ++ +     +        D++GRLLKY   TG+V  +  G + P G  IS D  
Sbjct  154  GDVYFTDASQTIDIRNITSGNYVPDSTGRLLKYSPITGEVKVLAGGFSLPGGPVISVDRK  213

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
            F+    F  R+I+K+++ G KA T E VL  L GNP  +K+A    G FWV V+    QQ
Sbjct  214  FVLFAEFSNRRIMKYWLTGNKANTVE-VLLYLPGNPIKIKKAPE-PGEFWVAVDI-IAQQ  270

Query  836  PSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYF--GKAYTGSLEADFVGVY  1000
            PS +T  +  KF+  G IL  +     Y  +  +  + +  GK Y GS EA FVG+Y
Sbjct  271  PSSVT-PLGYKFNSTGGILLIKEFEGQYNNIRVNVVQEYIGGKLYIGSREAKFVGIY  326



>ref|XP_006301702.1| hypothetical protein CARUB_v10022158mg, partial [Capsella rubella]
 gb|EOA34600.1| hypothetical protein CARUB_v10022158mg, partial [Capsella rubella]
Length=575

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 163/294 (55%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFDP G G YTGV  G+ILK++    +VDFA  +       C G  GT     CG
Sbjct  286   GPESFAFDPTGKGFYTGVSGGKILKWTPEKGYVDFAQITESSNSGWCKGALGTAFAGKCG  345

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+  N +TGDLY+AD   GL  +   GGLA +LA  ++GK F F D + +D  TG  
Sbjct  346   RPAGIALNSKTGDLYVADAPLGLHVISPAGGLATKLADSVDGKPFKFLDGLDVDPTTGVV  405

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F   +        D SG+L KY+ AT  V++++ GL+G  G ++S D +F+ 
Sbjct  406   YFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKAVSQLMEGLSGAAGCSVSSDGSFVL  465

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I +++I+GPKA T E    NL  NP+ ++RA+S +G FWV     +   P  
Sbjct  466   VSEFIKSNIKRYWIKGPKAGTMED-FSNLVSNPDNIRRASS-NGDFWVASVVNKVVVP--  521

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NGK+L+T +L  ++   LL    E+ G  Y G+L   F G+ +
Sbjct  522   -TDPKAVKIDSNGKVLQTISLKNEFGNTLLSEVNEHNGHLYIGTLTGPFAGIMK  574


 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/265 (37%), Positives = 145/265 (55%), Gaps = 6/265 (2%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
            GP+  AFD  G G YTGV  G+ILK+     +V+FA  +       CDG  GT L   CG
Sbjct  10   GPEAFAFDSTGKGFYTGVSGGKILKWLPETGYVNFAQITESSNSSWCDGNIGTALAGRCG  69

Query  305  RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
            RP G+ FN +TGDLY+AD   GL  +   GGLA ++A  ++GK F F D + +D  TG  
Sbjct  70   RPAGIAFNEKTGDLYVADAPLGLHVISPAGGLATKIADSVDGKPFKFLDGLDVDPTTGVV  129

Query  485  YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
            YF      F            D +G+L KY+ +T  V+ ++ GL+G  G A+S D +F+ 
Sbjct  130  YFTSFSSRFTPIQVLIALGLKDATGKLYKYDPSTKVVSVLMEGLSGSAGCAVSSDGSFVL  189

Query  665  ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
            ++ F    I +++I+GPKA ++E    ++  NP+ +KR  S +G FWV     +   P  
Sbjct  190  VSQFTKSNIKRYWIKGPKAGSSEDFTNSV-SNPDNIKRIGS-TGNFWVASVVNKIIVP--  245

Query  845  MTDSIAVKFDRNGKILETRNLTKDY  919
             T+  AVK + +G++L+T  L   +
Sbjct  246  -TNPSAVKVNSDGEVLQTIPLKDKF  269



>ref|XP_009627580.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=372

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 121/360 (34%), Positives = 187/360 (52%), Gaps = 42/360 (12%)
 Frame = +2

Query  35    VSMLMFISSLCMIHSHP---ERDLIAKLK---LQNAFGPKDTAFDPRGGGPYTGVRDGRI  196
             +++++ +SS  +   H     +DL+ K K   L+ A GP+  AFDP G GPYTGV DGRI
Sbjct  16    ITVILTLSSKNVYRPHSIAGSKDLLPKAKVIQLKGAVGPESLAFDPNGEGPYTGVADGRI  75

Query  197   LKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFG  370
             LK+   +  +VDFA+TS  R  ++C      ++  +CGRPLGL F+ RTGDLYIAD + G
Sbjct  76    LKWQGDSEGWVDFAVTSSQR--KECVRHFAPHMEHVCGRPLGLRFDTRTGDLYIADAYLG  133

Query  371   LLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGD  550
             L  VG +GGLA  L   + G+   F + + LD+     YF ++   F    F     SGD
Sbjct  134   LQVVGPSGGLATPLVTEVEGQPLHFTNDMDLDEQEDIIYFTDTSTQFQRRQFIASVVSGD  193

Query  551   TSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTT  730
              +GRL+KY+ +T  VT +L GLA   G A+S+D +F+ +      +I++++++GP A   
Sbjct  194   KTGRLMKYDKSTKAVTVLLRGLAFANGVALSKDKSFVLVAETSTGRIVRYWLKGPDAGKH  253

Query  731   ETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTD-------------------  853
             +T   +L G P+ ++R +   G FWV +++ R      +T                    
Sbjct  254   DT-FADLPGYPDNIRRNS--RGEFWVALHSKRSLLAQLVTSNSWLGRTLLKLPFTFQQLH  310

Query  854   ---------SIAVKFDRNGKILET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
                      + A+K    G++LE   ++     K L    E  G+ + GS+   FVGVY 
Sbjct  311   YLLVGGQPHATAIKLSEEGQVLEVLEDVESKTLKFLSEVEEKNGRLWIGSVLVPFVGVYE  370



>ref|XP_002438841.1| hypothetical protein SORBIDRAFT_10g027060 [Sorghum bicolor]
 gb|EER90208.1| hypothetical protein SORBIDRAFT_10g027060 [Sorghum bicolor]
Length=346

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 172/299 (58%), Gaps = 13/299 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNG---NFVDFAITSPFRTKEKCDGTNGTNLL--  292
             GP+  AFD  G GPY+GV DGR+LK+ NG    +  +A  SP    E C  +        
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAY-SPGYDAEACTASRARPAELT  109

Query  293   -SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              S CGRPLGL F+RR+G+LYIAD + GL+RVG  GG A  LAA ++G    F + V +DQ
Sbjct  110   ESKCGRPLGLRFHRRSGNLYIADAYKGLMRVGPGGGEATVLAAEVDGVPLRFTNGVDVDQ  169

Query  470   LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
             +TGD +F +S   +  +   R+  +GD+SGRL+KY+  TGQVT +  G+  P G AIS D
Sbjct  170   VTGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPKTGQVTVLQAGITYPNGLAISAD  229

Query  650   HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
              T + + L    K+++++I+GPKA T+E  L +L G P+ V+      GGFWV ++  + 
Sbjct  230   RTHLVVALTGPCKLMRYWIKGPKAGTSEH-LADLPGYPDNVR--FDGRGGFWVALHREKM  286

Query  830   QQP-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             + P  P +  +AV+   +G++++     K   +         GK Y GS+E  +V V R
Sbjct  287   ELPFGPDSHLLAVRVGADGQVVQVMRGPKSV-RPTEVVEREGGKLYMGSVELPYVAVVR  344



>ref|XP_004978210.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=346

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 176/308 (57%), Gaps = 13/308 (4%)
 Frame = +2

Query  107   LKLQNAF--GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAIT--SPFRTKEKCDGT  274
             LKL+ +F  GP+  AFD  G GPY+GV DGR+LK+ NG+   ++    SP    + C  +
Sbjct  44    LKLRGSFLRGPESVAFDGAGAGPYSGVSDGRVLKW-NGHARGWSTYAYSPGYNAKACTAS  102

Query  275   N---GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
                      S+CGRPLGL F+  +GDLYIAD + GL+RVG  GG A  +A  ++GK   F
Sbjct  103   RVRPAEVTESMCGRPLGLRFHYGSGDLYIADAYKGLMRVGPGGGEATVVATMVDGKPLRF  162

Query  446   ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
              + V +DQ+TG+ YF +S   +  +   R+  +GD++GRL+KY+  T  VT + +G+  P
Sbjct  163   TNGVDVDQVTGEVYFTDSSMKYSRSQHERVTATGDSTGRLMKYDPKTDHVTVLQSGITYP  222

Query  626   VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
              G AIS D T + + L    K+++++I GPK  T+ET L +L G P+ V+      GGFW
Sbjct  223   NGLAISADRTHLVVALTGPCKLMRYWITGPKVGTSET-LADLPGYPDNVR--PDGRGGFW  279

Query  806   VPVNTPREQQP-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEA  982
             V ++  + + P  P    +AV+ D +GK+L+     K+  +         GK Y GS+E 
Sbjct  280   VALHREKMELPFGPDRHLLAVRIDADGKVLQVMRGPKNV-RPTEVVERKGGKLYMGSVEL  338

Query  983   DFVGVYRA  1006
              +V V  A
Sbjct  339   PYVAVVSA  346



>ref|XP_004249227.1| PREDICTED: strictosidine synthase 1 [Solanum lycopersicum]
Length=372

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 123/376 (33%), Positives = 195/376 (52%), Gaps = 51/376 (14%)
 Frame = +2

Query  11    MKSLTMFWVSMLMFISSLCM------IHSHPE----RDLIAK---LKLQNAFGPKDTAFD  151
             M +L +F  +  + I ++ +      ++S P     +DL++K   + L+ A GP+  AFD
Sbjct  1     MNALKLFLSAAALAIMAVLLTLSSKNVYSPPSIPGSKDLLSKSEVIHLKGAVGPESIAFD  60

Query  152   PRGGGPYTGVRDGRILKFSNGN---FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLD  322
             P G GPYTGV DGRILK+ NG+   +VDFA+TS  R  ++C       +  +CGRPLGL 
Sbjct  61    PNGEGPYTGVADGRILKW-NGDSDGWVDFAVTSSQR--KECVHPFAPQMEHVCGRPLGLR  117

Query  323   FNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESG  502
             F+ RTGDLYIAD + GL  VG +GGLA  L   + G+   F + + +D+     YF ++ 
Sbjct  118   FDTRTGDLYIADAYLGLHVVGPSGGLATPLVTEVEGQPLRFTNDLDIDEQEDVIYFTDTS  177

Query  503   EIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIG  682
               F    F     SGD +GRL+KY+ +T  VT +L GLA   G A+S+D +F+ +     
Sbjct  178   TQFQRRQFVASVVSGDKTGRLMKYDKSTKSVTVLLRGLAFANGVALSKDKSFVLVAETST  237

Query  683   RKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTD---  853
              ++++H+++GP A   +T   +L G P+ ++R +   G FWV +++ R      +T    
Sbjct  238   CRVVRHWLKGPHAGKHDT-FADLPGYPDNIRRNS--RGEFWVGLHSKRSLLAKLVTSYSW  294

Query  854   -------------------------SIAVKFDRNGKILET-RNLTKDYPKLLGSYFEYFG  955
                                      + A+K   +G++L+   +L     K +    E  G
Sbjct  295   FGKTTLKLPFTFQQLHFLLVGGQPHATAIKLSEDGQVLDVLEDLESKTLKFISEVEEKNG  354

Query  956   KAYTGSLEADFVGVYR  1003
             K + GS+   FVGV+ 
Sbjct  355   KLWIGSVLVPFVGVHE  370



>ref|XP_002273764.1| PREDICTED: strictosidine synthase 1 [Vitis vinifera]
Length=370

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/328 (34%), Positives = 176/328 (54%), Gaps = 35/328 (11%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNG  280
            +++  AFGP+  AFDP+G GPYTGV DGR+LK+      + DFA+T+  R  ++C     
Sbjct  45   IQVTGAFGPESIAFDPKGEGPYTGVADGRVLKWEGDGRGWTDFAVTTSER--KECVRPFA  102

Query  281  TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
              +  ICGRPLGL F+++TGDLYIAD +FGL  V  NGGLA  L   + G+  +F + + 
Sbjct  103  PEMEHICGRPLGLRFDKKTGDLYIADAYFGLQVVEPNGGLATPLVTEVEGRRLLFTNDMD  162

Query  461  LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
            +D++    YF ++   F    F     SGD +GRL+KY+ ++ +VT +L GLA   G A+
Sbjct  163  IDEVEDVIYFTDTSTDFHRRQFMAALLSGDNTGRLMKYDKSSKEVTVLLRGLAFANGVAM  222

Query  641  SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
            S+D +F+ +      KII+++++GP A  ++ V   + G P+ V+R +   G FWV ++ 
Sbjct  223  SKDRSFVLVAETTTGKIIRYWLKGPNAGKSD-VFAEVPGYPDNVRRNS--KGEFWVALHA  279

Query  821  PREQQPS---------------PMT------------DSIAVKFDRNGKILET-RNLTKD  916
             +    +               P+T             + A+K    G++LE   +    
Sbjct  280  KKGPHANWITSNSWVGKTLLKLPLTFKQLHKLIVVEAHATAIKLSEEGQVLEVLEDCEGK  339

Query  917  YPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
              + +    E+ GK + GS+   F+GVY
Sbjct  340  SMRFISEVEEHNGKLWLGSVMMPFIGVY  367



>ref|XP_006485325.1| PREDICTED: strictosidine synthase 3-like [Citrus sinensis]
Length=473

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/307 (40%), Positives = 167/307 (54%), Gaps = 14/307 (5%)
 Frame = +2

Query  107   LKLQ---NAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDG  271
             LKLQ      GP+  AFD  G GPY GV DGRILK+ +    + +FAIT+PFR    CDG
Sbjct  174   LKLQLPAGVVGPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFR--RICDG  231

Query  272   TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFAD  451
             T+ T L  +CGRPLG+ FN  T DLYIAD +FGL+ VG NGG AKQLA+      F F +
Sbjct  232   TSSTILEPLCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFTN  291

Query  452   SVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVG  631
             ++ +D  TG  YF +S   F    +  + +SGD SGRLLKY+    QVT +  GLA P G
Sbjct  292   ALDIDPNTGVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNG  351

Query  632   NAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVP  811
               +S D +F+ +     R+I++ ++ G     +      +   P+ ++  T  +G FWV 
Sbjct  352   VTLSNDKSFLLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIE--TDRNGDFWVA  409

Query  812   VNTPREQQPSPMTDSIAVKFD-RNGKILETRNLTKDYP-KLLGSYFEYFGKAYTGSLEAD  985
             +NT R       TD +AVK D  NG +L+     K      +    E+ G  Y GS    
Sbjct  410   LNTKRGND---KTDLVAVKLDGSNGNVLDVLEGNKQNDLDSVSEVEEHGGYLYAGSPVQP  466

Query  986   FVGVYRA  1006
             +V V +A
Sbjct  467   YVVVIKA  473



>gb|KDP29321.1| hypothetical protein JCGZ_18242 [Jatropha curcas]
Length=319

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/314 (39%), Positives = 173/314 (55%), Gaps = 21/314 (7%)
 Frame = +2

Query  104  KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTN  277
            +L L    GP+  AFD  G GPY GV DGRILK+  SN +++DFA++SP R K++CDG+ 
Sbjct  6    QLDLPGVIGPESLAFDCNGNGPYVGVSDGRILKWHQSNQSWLDFAVSSPNRDKKECDGST  65

Query  278  GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
              N    CGR LGL FN  T DLYIAD ++GLL VG  GG+  QLAA   G  F FA+ +
Sbjct  66   DPNKEPECGRALGLKFNPATCDLYIADAYYGLLVVGPMGGVPTQLAASAEGVPFRFANGL  125

Query  458  SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
             +D  TG  YF +S   F   ++ R   S D SGRLLKY+  + +VT +  GLA P G A
Sbjct  126  DIDPKTGAVYFTDSSIFFQRREYLRAILSSDRSGRLLKYDPNSKKVTVLFKGLAFPNGVA  185

Query  638  ISEDHTFIFITLFIGRKIIKHYI--RGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVP  811
            +S D++F+ +      +I+K  +       +  E V   LG  P+ +KR    +G FWV 
Sbjct  186  LSNDNSFVLVAEEGMLRILKFKLLNNDNHNEMQEEVFAELGRLPDNIKRND--NGEFWVA  243

Query  812  VNTPR---EQQPSPM-------TDSIAVKFDRNGKILETRNLTKDYPKLLGS---YFEYF  952
            +N+ R   ++    M        D++ +KF  +GK+++   L  +  ++L S     EY 
Sbjct  244  LNSGRGKIQKYKEEMINEGWVFNDTVGIKFSEDGKVVKM--LDGNGGEILDSVSEVAEYD  301

Query  953  GKAYTGSLEADFVG  994
            G  + GS    +VG
Sbjct  302  GGLWFGSSVQPYVG  315



>gb|EMT31336.1| Strictosidine synthase 1 [Aegilops tauschii]
Length=359

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 13/305 (4%)
 Frame = +2

Query  122   AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN-----FVDFAITSPFRTKEKCDGTNG-T  283
             AFGP+  AFD RGGGPYTGV +GRIL++  GN     + +FA     RT  +C       
Sbjct  53    AFGPESLAFDHRGGGPYTGVSNGRILQW-KGNRRHLGWTEFAHNYKHRTVVECAAKKKLV  111

Query  284   NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
                  CGRPLGL F+R +GD+YIAD + GL+RVG  GGLA+ +A    G  F F + V +
Sbjct  112   EPDGSCGRPLGLQFHRASGDMYIADAYLGLMRVGRGGGLAEVVATEAGGVPFKFLNGVDI  171

Query  464   DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
             DQ TGD YF +S  I+  +++  +  SGD +GRL++Y+  TG +T + +GLA P G AIS
Sbjct  172   DQETGDVYFTDSSTIYQRSEYLLVVLSGDATGRLMRYDPRTGDITVLRSGLAFPNGVAIS  231

Query  644   EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTP  823
              D T + +      ++++H++ GP A  TE ++E L G P+ V+      GG+WV  N  
Sbjct  232   TDRTHLIVAETSPCRLLRHWLHGPMAGETEVLVE-LPGYPDNVRPDGGDRGGYWVGFNRD  290

Query  824   REQQPSPMT----DSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADF  988
             ++ + +  T     ++ V   R+ K        + Y    +    E  G  + GS++  +
Sbjct  291   KQWEENGTTANSMSAVRVDVTRDAKNGTVAVALRGYGDATVSEVVERNGSLWIGSIDTPY  350

Query  989   VGVYR  1003
             +G+ +
Sbjct  351   IGLLK  355



>emb|CDY47729.1| BnaA02g16660D [Brassica napus]
Length=325

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/292 (38%), Positives = 160/292 (55%), Gaps = 7/292 (2%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLSICG  304
            GP+  AFD  G G YTGV  G+I K+  G  +VDF   +     + CDG  G   +S CG
Sbjct  36   GPEAFAFDSTGKGFYTGVSGGKIFKYLPGKGYVDFGYITVSSKSQWCDGALGIAYMSKCG  95

Query  305  RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
            RP G+ FN +TG+LY+AD   GL  + S GG AK++A   +GK F+F D + +D  TG  
Sbjct  96   RPAGIAFNNKTGELYVADAPLGLHVIPSGGGYAKKIADSADGKPFLFLDGLDVDPTTGVV  155

Query  485  YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
            YF      F   D  +   S D SG+L KY+ +   VT +L GL+GP G A+S D +F+ 
Sbjct  156  YFTSFSSKFSPGDVLKAVASKDASGKLFKYDPSKRVVTVLLEGLSGPAGCAVSSDGSFVL  215

Query  665  ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
            ++ F    I +++I+G KA T+E    N   NP+ +KR  S SG FWV         P  
Sbjct  216  VSQFTKSNIKRYWIKGSKAGTSED-FTNAVSNPDNIKRIGS-SGNFWVASVVNTATGP--  271

Query  845  MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGV  997
             T+  AVK + +G++L+T ++   +   L+    E+ G+ Y G+L   F G+
Sbjct  272  -TNPSAVKINSDGRVLQTISVKDKFGDTLVSEVNEFEGRLYVGTLSGPFAGI  322



>gb|EMT14932.1| Strictosidine synthase 3 [Aegilops tauschii]
Length=364

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/307 (36%), Positives = 172/307 (56%), Gaps = 17/307 (6%)
 Frame = +2

Query  122   AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN-----FVDFAITSPFRTKEKCDGTNGT-  283
             AFGP+   FD RGGGPYTGV +GR+L++  GN     + +FA     +T  +C       
Sbjct  53    AFGPESIVFDHRGGGPYTGVSNGRVLRW-RGNRRHRGWTEFAHNYKHKTVAECAAKKKVV  111

Query  284   NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
                S CGRPLGL F+  +GD+YIAD + GL+RVG  GGLA+ +A   +G  F F + V +
Sbjct  112   EPESACGRPLGLQFHHASGDMYIADAYLGLMRVGRCGGLAEVVATEADGLPFNFLNGVDV  171

Query  464   DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
             DQ TG+ YF +S  ++  +++  +  +GD +GRL++Y+  TG VT + +GLA P G A+S
Sbjct  172   DQETGEVYFTDSSTVYQRSEYMLVVLTGDATGRLMRYDPRTGNVTVLRSGLAFPNGVALS  231

Query  644   EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTP  823
              D T + +      ++++H++RGP A  TE VL +L G P+ V+      GG+WV +N  
Sbjct  232   ADRTHLVVAETSSCRLLRHWLRGPAAGETE-VLADLPGYPDNVRHDGGGRGGYWVGMNRD  290

Query  824   REQQPSPMTDS-------IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEA  982
             ++   S  T +       +A     NG ++E      D    +    E  G  + GS++ 
Sbjct  291   KQWAESGTTANSMSAVRVVAAGDATNGTVVEALRGFGD--ATVSEVVERNGSLWIGSVDT  348

Query  983   DFVGVYR  1003
              +VG+++
Sbjct  349   PYVGLFK  355



>ref|XP_006421116.1| hypothetical protein CICLE_v10005245mg [Citrus clementina]
 gb|ESR34356.1| hypothetical protein CICLE_v10005245mg [Citrus clementina]
Length=360

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/279 (41%), Positives = 167/279 (60%), Gaps = 16/279 (6%)
 Frame = +2

Query  8    NMKSLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRD  187
            N  SL+    S+++F+     I+S  +   + + +++ A GP+  AFD  G GPYTGV D
Sbjct  2    NSTSLSFIAKSIVIFL----FINSSTQG--VVQYQIEGAIGPESFAFDALGEGPYTGVSD  55

Query  188  GRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLS---ICGRPLGLDFNRRTGDLYI  352
            GRI+K+      ++ FA+TSP R  + C+G    +  +   ICGRPLGL FN+  GDLYI
Sbjct  56   GRIIKWHQDQRRWLHFALTSPNR--DGCEGAYEYDHAAKEHICGRPLGLCFNKTNGDLYI  113

Query  353  ADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFAR  532
            AD +FGLL+VG  GGLA  +A    G  F F +S+ +DQ TG  YF +S   F   +   
Sbjct  114  ADAYFGLLKVGPEGGLATAVATQSEGIPFRFCNSLDIDQSTGIVYFTDSSSQFQRRNHIS  173

Query  533  IAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRG  712
            +  SGD +GRL+KY+ AT QVT +L  L+ P G A+SED  +I +      +I++++++ 
Sbjct  174  VILSGDKTGRLMKYDPATKQVTVLLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLKT  233

Query  713  PKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
             KA T E V + L G P+ VKR  S  GGFWV +++ R+
Sbjct  234  SKAGTIEIVAQ-LPGFPDNVKR--SPRGGFWVGIHSRRK  269



>ref|XP_010246302.1| PREDICTED: strictosidine synthase 3-like [Nelumbo nucifera]
Length=360

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/264 (40%), Positives = 158/264 (60%), Gaps = 12/264 (5%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTNGTNLLSICGR  307
            GP+  AFD RG GPY G+ DGRI+K++   + ++ ITS FR    CDG+N   L +ICGR
Sbjct  19   GPESLAFDCRGEGPYVGISDGRIIKWNGFVWTNYVITSRFRRNYICDGSNDPRLENICGR  78

Query  308  PLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAY  487
            PLGL FN +T DLY+AD ++GL+ VG    +  QLA    G  F F + + +DQ  G  Y
Sbjct  79   PLGLQFNMKTCDLYVADAYYGLIVVGPEQKIPMQLATSAEGIPFYFTNGLDIDQRMGIVY  138

Query  488  FVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFI  667
            F +S   +   D+A    SGD +GRL++Y+    +VT +LTGLA   G AIS+D +F+ +
Sbjct  139  FTDSSTKYQRRDYAGSILSGDKTGRLMRYDPRNREVTVLLTGLAFANGVAISDDGSFVLV  198

Query  668  TLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPM  847
            T     +I++ +++G +A T++  ++ L G P+ +K  T+  G FWV VN P E  P  M
Sbjct  199  TETGTGRILRFWLQGGRAMTSDLFIQ-LPGQPDNIK--TNARGEFWVAVN-PFEGGPRFM  254

Query  848  --------TDSIAVKFDRNGKILE  895
                    T+S A++ ++ G +LE
Sbjct  255  PNTSSMSITNSQAMRINKYGIVLE  278



>emb|CDP16919.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 163/296 (55%), Gaps = 12/296 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEK---CDGTNGTNLLSI  298
             GP+  AFD  G GPY  + DGR+ ++  G  V F     F++++    CDGTN T++  I
Sbjct  81    GPESYAFDSAGRGPYASLADGRVFRYL-GPAVGFRCIHFFKSRKPRRFCDGTNRTDISQI  139

Query  299   CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTG  478
             CGRP GL F  +TG+L++ D   GL+ + S GG   QLA+   G  F F D + +DQ TG
Sbjct  140   CGRPTGLGFYYKTGELFLGDADLGLVVIPSGGGPGIQLASSAEGVRFGFPDGLEVDQATG  199

Query  479   DAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTF  658
               YF ++   +  +    I  + D +GRLLKY+  T  VT +L GL+G  G AISED ++
Sbjct  200   IVYFTDASSRYNLSQINNIVSNRDATGRLLKYDPRTKNVTVLLRGLSGAAGVAISEDGSY  259

Query  659   IFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQP  838
             + +T F+  ++ K++++GP A T E VL N+ G P+ +KR T   G +W+ V    +   
Sbjct  260   LLVTQFVIGQVSKYWLKGPLANTAE-VLVNMTGMPDKIKRNT--KGEYWIAVTVTSKNS-  315

Query  839   SPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
                T     + D +G  LET   + D+   L+    EY G  Y  SL   +VGVYR
Sbjct  316   ---TQLQGQRIDGDGNSLETLTFSPDFDSSLITEVQEYKGALYLASLYVGYVGVYR  368



>ref|XP_009106059.1| PREDICTED: strictosidine synthase 1-like [Brassica rapa]
 emb|CDX96507.1| BnaA07g31180D [Brassica napus]
Length=326

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 163/294 (55%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G   +TGV  G+ILK+ ++  F DFA  +       C+G  GT L   CG
Sbjct  37    GPEAFAFDTIGKAFFTGVSGGKILKYTADKGFEDFAEITTTSNSSWCNGIIGTALAGKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN +TGDLY+AD   GL  +   GGLA ++A  ++GK F F D + +D  TG  
Sbjct  97    RPAGIAFNPKTGDLYVADAPLGLHVIPPAGGLATKIADSVDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F  ++        D SG+L KY+ AT  VT ++ G++G  G A+S D +F+ 
Sbjct  157   YFTSFSSKFSPSEVLIAVGLKDASGKLFKYDPATKAVTVLMEGISGGAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             +T FI   I +++I GPKA +TE V  ++  NP+ +KR  + +G FWV     +   P  
Sbjct  217   VTEFIKSNIKRYWITGPKAGSTEDVTSSV-SNPDNIKRIGA-TGNFWVASVKNKVVVP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D NGK+L+T +L  ++   LL    E  GK Y G+L   F G+ +
Sbjct  273   -TDPSAVKIDYNGKVLQTISLKNEFGDTLLSEANELDGKLYIGTLTGPFAGIMK  325



>ref|XP_010257835.1| PREDICTED: strictosidine synthase 3-like [Nelumbo nucifera]
Length=340

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 162/275 (59%), Gaps = 13/275 (5%)
 Frame = +2

Query  104  KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRTKEKC-DGT  274
            +L + +A GP+  AFD  G GPYTGV  GRILK+      + +FA TSP R  + C +G 
Sbjct  35   RLPIPSAVGPESFAFDCNGEGPYTGVSGGRILKWQGAARGWAEFASTSPPR--DICFNGA  92

Query  275  NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADS  454
            N      +CGRPLGL FN+ T +LYIAD  FGL+ VG +GG+AK LA    G  F F ++
Sbjct  93   NDPETELVCGRPLGLQFNKATCELYIADSSFGLMVVGRDGGVAKLLANSAEGVPFRFTNA  152

Query  455  VSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGN  634
            +  DQ  G  YF +S       +F   A SGD +GRL+KY+  T ++T +  GL+ P G 
Sbjct  153  LDFDQDNGIVYFTDSSIWIPRWEFLIEALSGDETGRLMKYDPKTEKLTVLWRGLSFPNGA  212

Query  635  AISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPV  814
            A+S+D++FI I      +I+++++RGPKA+T E  L+ L G P+ VK  ++  G FWV +
Sbjct  213  ALSKDNSFILIAETSKARILRYWLRGPKAQTLEFFLQ-LPGFPDNVK--SNGRGEFWVAL  269

Query  815  NTPREQ-----QPSPMTDSIAVKFDRNGKILETRN  904
            N  +       QP    + +A++FD  G ILE  N
Sbjct  270  NPGKPSMGATFQPRFDGEIVALRFDEEGNILEVLN  304



>ref|XP_004298326.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=346

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 115/303 (38%), Positives = 170/303 (56%), Gaps = 17/303 (6%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSIC  301
             GP+  AFD  G GPY GV DGRILK+   +  + +FA TSP  T++ CD +       IC
Sbjct  45    GPESVAFDCAGKGPYVGVSDGRILKWQGPHRGWKEFAFTSP--TRKICDRSTDNATEPIC  102

Query  302   GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
             GRPLGL F+ +T +LYIAD +FG+L++G NGG  +QLA  +NG  F F +++ +D  TG 
Sbjct  103   GRPLGLKFHPKTCELYIADAYFGILKIGRNGGHPQQLATSLNGVPFRFTNALEIDSHTGI  162

Query  482   AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
              YF ++  IF    +     +GD +GRLL+Y+  T +VT +L  LA   G A+S+D +F+
Sbjct  163   VYFTDTSTIFQRRFWPLSIATGDKTGRLLQYDPCTKKVTVLLDKLAFANGVALSKDSSFL  222

Query  662   FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS  841
              +      KI K ++RGP A   E +   L    + +KR    +G FWV +N+ R  Q +
Sbjct  223   LVAESATSKIFKLWLRGPNAGDVE-LFTQLKRPADNIKRTD--NGEFWVALNSRRALQGN  279

Query  842   PMT-------DSIAVKFDRNGKILETRNLTKDYPKL--LGSYFEYFGKAYTGSLEADFVG  994
               +       D + VKFD  G I++  +  +  P L  +    E+ GK + GS+   +VG
Sbjct  280   QTSSAFWLTKDPVGVKFDEQGNIVKVLD-GEGGPTLESVSEVEEHNGKLWIGSVVKPYVG  338

Query  995   VYR  1003
             V R
Sbjct  339   VLR  341



>ref|XP_011000464.1| PREDICTED: strictosidine synthase 3-like, partial [Populus euphratica]
Length=352

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 149/245 (61%), Gaps = 8/245 (3%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNG  280
            L L  A GP+  AFDP G GPY G+ DGRI+K+      +++FAITS  + ++ C G + 
Sbjct  46   LSLDGATGPESFAFDPLGQGPYAGISDGRIIKWEEHERRWINFAITS--QKRDGCGGPHD  103

Query  281  TNLLS-ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
             + +  +CGRPLG  F+   GDLYIAD + GLLRVG  GGLA ++A    G  F F +S+
Sbjct  104  HHRMEHVCGRPLGSCFDETRGDLYIADAYMGLLRVGPQGGLATKIATHAQGIPFRFTNSL  163

Query  458  SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
             +DQ  G  YF +S   +   D+  +  SGD SGRL+KY+AA+ QVT +L  L  P G A
Sbjct  164  DIDQSGGAIYFTDSSTQYQRRDYLSVVLSGDKSGRLMKYDAASKQVTVLLKNLTFPNGVA  223

Query  638  ISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVN  817
            +S+D +F+ +      +I++++I+  KA   E V   L G P+ +KR  S  GG+WV +N
Sbjct  224  LSKDGSFVLLAETTSCRILRYWIKTSKAGALE-VFAQLQGFPDNIKR--SPRGGYWVGIN  280

Query  818  TPREQ  832
            + RE+
Sbjct  281  SKREK  285



>ref|XP_002452919.1| hypothetical protein SORBIDRAFT_04g034960 [Sorghum bicolor]
 gb|EES05895.1| hypothetical protein SORBIDRAFT_04g034960 [Sorghum bicolor]
Length=346

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 172/299 (58%), Gaps = 13/299 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNG---NFVDFAITSPFRTKEKCDG--TNGTNLL  292
             GP+  AFD  G GPY+GV DGR+LK+ NG    +  +A  SP    E C    T    L 
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAY-SPGYDAEACTASRTRPAELT  109

Query  293   -SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              S CGRPLGL F+ R+G+LYIAD + GL+RVG  GG A  LAA ++G    F + V +DQ
Sbjct  110   ESRCGRPLGLRFHHRSGNLYIADAYKGLMRVGPGGGEATVLAAEVDGVPLRFTNGVDVDQ  169

Query  470   LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
             +TGD +F +S   +  +   R+  +GD+SGRL+KY+  TGQVT +  G+  P G AIS D
Sbjct  170   VTGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPKTGQVTVLQAGVTYPNGLAISAD  229

Query  650   HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
              T + + L    K+++++I+GPKA T+E  L +L G P+ V+      GGFWV ++  + 
Sbjct  230   RTHLVVALTGPCKLLRYWIKGPKAGTSEH-LADLPGYPDNVR--ADGRGGFWVALHREKM  286

Query  830   QQP-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             + P  P +  +AV+   +G++++     K   +         GK Y GS+E  +V V R
Sbjct  287   ELPFGPDSHLLAVRIGADGQVVQVMKGPKSV-RPTEVVERDGGKLYMGSVELPYVAVVR  344



>ref|XP_003576476.1| PREDICTED: strictosidine synthase 3-like [Brachypodium distachyon]
Length=366

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 144/239 (60%), Gaps = 6/239 (3%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSN--GNFVDFAITSPFRTKEKCDGTN-GTNLL  292
            AFGP+  AFD RG GPYTGV +GR+L++      + +FA      T E+C          
Sbjct  60   AFGPESLAFDHRGRGPYTGVSNGRVLRWRGRPSGWTEFAHNHKHATVEECAAKKKAVEPE  119

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
            S CGRPLGL F+R+TGD+YIAD + GL+RVG  GGLA+ +A    G  F F + V +DQ 
Sbjct  120  SACGRPLGLQFHRKTGDMYIADAYLGLMRVGRRGGLAEVVATEAAGGPFNFLNGVDVDQD  179

Query  473  TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
            TG  YF +S  ++  +D+  +  +GD +GRL++YE  TG VT + + LA P G A+S D 
Sbjct  180  TGHVYFTDSSTVYQRSDYMLVVLTGDATGRLMRYEPRTGNVTVLRSRLAFPNGVAVSADG  239

Query  653  TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
            T + +      ++++H++RGP+A  TE V+  L G P+ V+      GG+WV VN  +E
Sbjct  240  THLVVAETSSCRLLRHWLRGPRAGETE-VMAELPGYPDNVR--PDGRGGYWVGVNRDKE  295



>ref|XP_006390479.1| hypothetical protein EUTSA_v10018851mg [Eutrema salsugineum]
 gb|ESQ27765.1| hypothetical protein EUTSA_v10018851mg [Eutrema salsugineum]
Length=329

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 162/294 (55%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK+     +VDF   +     + CDG  GT  +  CG
Sbjct  38    GPEAFAFDSTGKGFYTGVSGGKILKYLPQKGYVDFGYITESSKSQSCDGALGTANIGKCG  97

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN +TG+LY+AD   GL  +   GGLAK++A  I+GK F+F D + +D  TG  
Sbjct  98    RPAGIAFNDKTGELYVADAPLGLHVISRGGGLAKKIADNIDGKPFLFLDGLDVDPTTGVV  157

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F   D  +   S D +G+L KY+ +   VT ++ GL+G  G A+S D +F+ 
Sbjct  158   YFTSFSSKFSPGDVLKAVASKDATGKLFKYDPSKKVVTVLMEGLSGSAGCAVSSDGSFVL  217

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ F    I +++I+GPKA ++E    ++  NP+ +KR  S SG FWV         P  
Sbjct  218   VSQFTKSNIKRYWIKGPKAGSSEDFTNSV-SNPDNIKRIGS-SGNFWVASVVNTATGP--  273

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              T+  AVK + +GK+L T ++   +   L+    E+ G+ Y G+L   F G+ +
Sbjct  274   -TNPSAVKVNSDGKVLHTISVKDKFGDTLVSEVNEFKGQLYVGTLFGPFAGILK  326



>gb|KEH23600.1| strictosidine synthase family protein [Medicago truncatula]
Length=325

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 166/301 (55%), Gaps = 20/301 (7%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNG  280
            L +  A GP+   FD  GGGPYTGV DGRILK+      + +FA+TS  R++  C     
Sbjct  40   LHVTRAIGPESLVFDSHGGGPYTGVADGRILKWKGKKRGWTEFAVTSSNRSQ--CVRPFA  97

Query  281  TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
              L  ICGRPLGL F+++ GDLYIAD + GL  VG+ GGLA Q+A    G  F F + + 
Sbjct  98   PKLEHICGRPLGLRFDKKNGDLYIADAYLGLKVVGAAGGLATQVATEAEGHPFHFTNDLD  157

Query  461  LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
            +D+  G  YF +S  ++    +  +  SGD +GRL+KY+ +T +V  +L GLA P G A+
Sbjct  158  IDENEGVIYFTDSSTVYERTQYTLLLVSGDKTGRLMKYDKSTKEVKVLLRGLAFPNGVAL  217

Query  641  SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
            S+D +F+ +      +I++ ++ GPKA    T + +L G P+ ++R +   G FWV +  
Sbjct  218  SKDGSFLLVAETSNCRILRLWLHGPKAGKVSTFV-DLPGFPDNIRRNS--YGQFWVALY-  273

Query  821  PREQQPSPMTDSIAVKFDRNGKILET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
                       S AVK    G+ILET  +  +   K +    E  GK +  S+   ++GV
Sbjct  274  -----------SSAVKLSDEGEILETLEDFERKTMKNISEVEEKDGKLWIASIVTPYIGV  322

Query  998  Y  1000
            Y
Sbjct  323  Y  323



>ref|XP_009797408.1| PREDICTED: strictosidine synthase 1-like [Nicotiana sylvestris]
Length=372

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/339 (35%), Positives = 177/339 (52%), Gaps = 39/339 (12%)
 Frame = +2

Query  89    RDLIAK---LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRT  253
             +DL++K   ++L+ A GP+  AFDP G GPYTGV DGRILK+   +  +VDFA+TS  R 
Sbjct  37    KDLLSKAEVIQLKGAVGPESLAFDPNGEGPYTGVADGRILKWQGDSQGWVDFAVTSSQR-  95

Query  254   KEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGK  433
              ++C      ++  +CGRPLGL F+ RTGDLYIAD + GL  VG +GGLA  L   + G+
Sbjct  96    -KECVRPFAPHMEHVCGRPLGLRFDTRTGDLYIADAYLGLQVVGPSGGLATPLVTEVEGQ  154

Query  434   NFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTG  613
                F + + LD+     YF ++   F    F      GD +GRL+KY+ +T  VT +L G
Sbjct  155   PLRFTNDMDLDEQEDIIYFTDTSTQFQRRQFIASVVIGDKTGRLMKYDKSTKAVTVLLRG  214

Query  614   LAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLS  793
             LA   G A+S+D +F+ +      +I+K++++GP A    T   +L G P+ ++R +   
Sbjct  215   LAFANGVALSKDKSFVLVAETSTGRIVKYWLKGPDAGKHAT-FADLPGYPDNIRRNS--R  271

Query  794   GGFWVPVNTPREQQPSPMTD----------------------------SIAVKFDRNGKI  889
             G FWV +++ R      +T                             + A+K    G++
Sbjct  272   GEFWVALHSKRSLLARLVTSNSWLGRTLLKLPFTFQQLHYLLVGGQPHATAIKLSEEGQV  331

Query  890   LET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             LE   ++     K L    E  GK + GS+   F+GVY 
Sbjct  332   LEVLEDVESKTLKFLSEVEEKNGKLWIGSVLVPFIGVYE  370



>gb|KHG17610.1| Strictosidine synthase 1 -like protein [Gossypium arboreum]
Length=332

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 179/328 (55%), Gaps = 15/328 (5%)
 Frame = +2

Query  35    VSMLMFISSLC-MIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSN  211
             V + +F+S    ++ S   R L    K+    GP+  AF+      Y GV DGRIL++ N
Sbjct  14    VPIFIFVSCFPPLMLSQSFRSLQLPPKVT---GPESIAFEFGTSRFYVGVADGRILQY-N  69

Query  212   G---NFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRV  382
             G    F DF  T P R+K  CDGT+  NL  ICGRPLGL F+     LYI D +FGL+ +
Sbjct  70    GPRVGFRDFGFTGPNRSKRMCDGTSDPNLGPICGRPLGLAFHYSLNKLYICDAYFGLMVL  129

Query  383   GSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGR  562
             GS+G  A Q++A  +G+ +   D++ + Q +G+  F +S   +   + ++   + D++GR
Sbjct  130   GSSGKQATQVSAAADGEPYRLCDALDVHQPSGNVIFADSSANYDLRNISKAVNANDSTGR  189

Query  563   LLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVL  742
             LL Y   T +VT ++  L+GP G A+S+D  ++ ++ FI    I++++RGP A T + + 
Sbjct  190   LLMYNPDTDRVTVLIKNLSGPAGVAVSQDGAYVLVSNFINNSTIRYWLRGPGANTYDVI-  248

Query  743   ENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY-  919
              NL   P+ +KR     G FW        +QP+     I  + +  G++L T N    Y 
Sbjct  249   -NLQERPDNIKRTA--FGDFWRAAAL--VKQPTRSLVPIGQRINEFGRVLRTVNFEAWYG  303

Query  920   PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              +L+    E+ G+ Y GSL A FVGV+R
Sbjct  304   NQLISEVQEFGGELYLGSLSAPFVGVFR  331



>emb|CDY45861.1| BnaC02g22590D [Brassica napus]
Length=330

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/299 (38%), Positives = 162/299 (54%), Gaps = 7/299 (2%)
 Frame = +2

Query  116   QNAFGPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGTNLL  292
             +N  GP+  AFD  G G YTGV  G+ILK++    +VDFA  +       CDG  GT L 
Sbjct  35    ENRSGPEAFAFDSTGKGFYTGVSGGKILKYTPETGYVDFAQITESSNSSWCDGVVGTALA  94

Query  293   SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
               CGRP G+ FN +TG+LY+AD   GL  V   GGLA ++A  ++GK F F D + +D  
Sbjct  95    GRCGRPAGIAFNEKTGELYVADAPLGLHVVSPAGGLAVKIADSVDGKPFKFLDGLDVDPT  154

Query  473   TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
             TG  YF      +            D +G+L KY+ +T  VT ++ GL+G  G A+S D 
Sbjct  155   TGVVYFTSFSSRYTPIQVLIALGLKDATGKLFKYDPSTKVVTVLMEGLSGSAGCAVSSDG  214

Query  653   TFIFITLFIGRKIIKHYIRGPKAK-TTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
             +F+ ++ F    I +++I+GPKA  +T+ +  +   NP+ ++R  S +G FWV     + 
Sbjct  215   SFVLVSQFTKSNIKRYWIKGPKAAGSTDDIFSSSVSNPDNIRRIGS-TGNFWVASVINKV  273

Query  830   QQPSPMTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
               P   TD  AVK D NGK+L+T  L  ++   LL    E  GK Y G+L   F GV +
Sbjct  274   VMP---TDPSAVKIDSNGKVLQTIFLKNEFGNTLLSEANEVDGKLYIGTLTGPFAGVMK  329



>emb|CDY45863.1| BnaC02g22570D [Brassica napus]
Length=325

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 160/292 (55%), Gaps = 7/292 (2%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLSICG  304
            GP+  AFD  G G YTGV  G+I K+  G  FVDF   +     + CDG  G   +S CG
Sbjct  36   GPEAFAFDSTGKGFYTGVSGGKIFKYLPGKGFVDFGYITVSSKSQWCDGALGIAYMSKCG  95

Query  305  RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
            RP G+ FN +TG+LY+AD   GL  + S GG AK++A   +GK+F+F D + +D  TG  
Sbjct  96   RPAGIAFNNKTGELYVADAPLGLHVIPSGGGYAKKIADRADGKSFLFLDGLDVDPTTGVV  155

Query  485  YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
            YF      F   D  +   S D SG+L KY+ +   VT +L GL+G  G A+S D +F+ 
Sbjct  156  YFTSFSSKFSPGDVLKAVASKDASGKLFKYDPSKRVVTVLLEGLSGSAGCAVSSDGSFVL  215

Query  665  ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
            ++ F    I +++I+G KA T+E    N   NP+ +KR  S SG FWV         P  
Sbjct  216  VSQFTKSNIKRYWIKGSKAGTSED-FTNAVSNPDNIKRIGS-SGNFWVASVVNTATGP--  271

Query  845  MTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF-EYFGKAYTGSLEADFVGV  997
             T+  AVK + +G++L+T ++   +   L S   E+ G+ Y G+L   F G+
Sbjct  272  -TNPSAVKINSDGRVLQTISVKDKFGDTLVSEVNEFEGRLYVGTLSGPFAGI  322



>ref|XP_003524502.1| PREDICTED: strictosidine synthase 1-like [Glycine max]
Length=342

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/338 (35%), Positives = 180/338 (53%), Gaps = 19/338 (6%)
 Frame = +2

Query  23   TMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRIL  199
            TM  +S +  I  LC   S     LI++L L +   GP+  AFD  GGGPY GV DGRIL
Sbjct  7    TMIAISAIFMIFFLC---SPSVAILISRLPLPSPVTGPESVAFDRNGGGPYVGVSDGRIL  63

Query  200  KFSNGN--FVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFG  370
            K++     F ++A TSP R K  CDG  + + L + CGRPLGL FN +T +LY+AD + G
Sbjct  64   KYAGPGEGFKEYAFTSPNRNKTICDGLADFSELQATCGRPLGLRFNHQTNELYVADAYSG  123

Query  371  LLRVGSNGGLAKQLAAGINGKN------FIFADSVSLDQLTGDAYFVESGEIFLTNDFAR  532
            L+++G NGG   Q    I  +         F D + +D  TG  YF ++   +   D   
Sbjct  124  LIKIGPNGGAPTQCFKDIQPQQENVNTTLQFLDGLDVDVNTGIVYFTQASANYGFKDAQA  183

Query  533  IAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRG  712
            +  S D SG L   +  T Q   ++ GLA   G A+S D +F+ ++ ++  +I + ++RG
Sbjct  184  LQSSRDQSGSLFSLDPKTNQTRVLMRGLALASGVAVSRDGSFVLVSEYLANRIQRFWLRG  243

Query  713  PKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSI--AVKFDRNGK  886
            P+A ++E  L+ L G P+ ++  ++  G FWV VN      P P    +   V+   NG 
Sbjct  244  PRANSSELFLQ-LTGRPDNIR--SNQRGQFWVAVNGVLGPNPPPRPTILPAGVRISENGI  300

Query  887  ILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGV  997
            IL   +L +++  + +    E+ G  Y+GSL+A +V +
Sbjct  301  ILRIVSLVQEFGSEAVSEIHEHNGTLYSGSLQASYVPI  338



>ref|XP_008243874.1| PREDICTED: strictosidine synthase 3-like [Prunus mume]
Length=357

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 116/315 (37%), Positives = 176/315 (56%), Gaps = 20/315 (6%)
 Frame = +2

Query  104   KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDG-T  274
             +++L    GP+  AFD  G GPY GV DG ILK+   +  +++FA TSP R ++ CDG T
Sbjct  47    QIELARVVGPESIAFDCHGQGPYVGVSDGTILKWQGPSLGWIEFAFTSPDRPRKLCDGST  106

Query  275   NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADS  454
             N TN   ICGRPLGL FN +T DLYIAD +FGLL+ G NGG  + LA+ + G   +F ++
Sbjct  107   NATNE-PICGRPLGLKFNPKTCDLYIADAYFGLLKTGPNGGKPEVLASSLGGVPLMFTNA  165

Query  455   VSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGN  634
             + +D+ TG  YF ++  +F    + +   +GD +GRLLKY+  T +VT +L  LA   G 
Sbjct  166   LDVDEETGIVYFTDTSTVFQRRVWMQSILAGDKTGRLLKYDPCTKEVTVLLHDLAFANGV  225

Query  635   AISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPV  814
             A+S+D +FI +       I + ++RGPKA   E +   L   P+ +K  ++  G FWV +
Sbjct  226   ALSKDKSFILVAESAPFTIHRLWLRGPKAPAFE-LFAQLERPPDNIK--SNNRGEFWVAL  282

Query  815   NTPR----------EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKL--LGSYFEYFGK  958
             N+ R            +   + D +A KFD  G +++  +  +  P L  +    E  G 
Sbjct  283   NSGRGVKEVVNIATSDKWLNVNDPVAAKFDEQGTVVQVLD-GEGGPALESVSEVEEQNGN  341

Query  959   AYTGSLEADFVGVYR  1003
              + GS+   +VGV +
Sbjct  342   LWVGSVVKPYVGVVK  356



>ref|XP_006494389.1| PREDICTED: strictosidine synthase 1-like [Citrus sinensis]
 gb|KDO41713.1| hypothetical protein CISIN_1g018242mg [Citrus sinensis]
Length=359

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 152/249 (61%), Gaps = 10/249 (4%)
 Frame = +2

Query  98   IAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDG  271
            + + +++ A GP+  AFD  G GPYTGV DGRI+K+      ++ FA TSP R  + C+G
Sbjct  25   VVQYQIEGAIGPESLAFDALGEGPYTGVSDGRIIKWHQDQRRWLHFARTSPNR--DGCEG  82

Query  272  TNGTNLLS---ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFI  442
                +  +   ICGRPLGL FN+  GDLYIAD +FGLL+VG  GGLA  +A    G  F 
Sbjct  83   AYEYDHAAKEHICGRPLGLCFNKTNGDLYIADAYFGLLKVGPEGGLATAVATQSEGIPFR  142

Query  443  FADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAG  622
            F +S+ +DQ TG  YF +S   F   +   +  SGD +GRL+KY+ AT QVT +L  L+ 
Sbjct  143  FCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVLLGNLSF  202

Query  623  PVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGF  802
            P G A+SED  +I +      +I++++++  KA T E V + L G P+ +KR  S  GGF
Sbjct  203  PNGVALSEDGNYILLAETTSCRILRYWLKTSKAGTIEIVAQ-LPGFPDNIKR--SPRGGF  259

Query  803  WVPVNTPRE  829
            WV +++ R+
Sbjct  260  WVGIHSRRK  268



>ref|XP_003609161.1| Strictosidine synthase [Medicago truncatula]
 gb|AES91358.1| SMP-30/gluconolaconase/LRE-like region protein [Medicago truncatula]
Length=326

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 181/336 (54%), Gaps = 21/336 (6%)
 Frame = +2

Query  17   SLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQN-AFGPKDTAFDPRGGGPYTGVRDGR  193
            S +M    +L+ I  LC   S     L+ KL+L     GP+  AFD  GGGPY    DGR
Sbjct  2    SKSMVVTVILLAIFLLCSPSS--VAILLNKLQLPPPVIGPEALAFDRNGGGPYVTSSDGR  59

Query  194  ILKF--SNGNFVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIH  364
            I K+   +  F ++A TSP R +  CDG ++ +N+ +ICGRPLGL FN +TGDLY AD +
Sbjct  60   IFKYVGPSEGFKEYAYTSPNRNRTICDGFSDFSNIQAICGRPLGLGFNHQTGDLYAADGY  119

Query  365  FGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQS  544
            +GL++VG NGG A QL       + +FA+ + +D  TG  YF  +   F   DF     +
Sbjct  120  YGLVKVGPNGGKATQLVGPAQSNSTVFANGLDVDSNTGIVYFTIASTKFQPKDFPTALLT  179

Query  545  ---GDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGP  715
               GD SG LL Y+ +  Q T  L  L    G A+S D +F+ ++ +   +I + +++GP
Sbjct  180  GGIGDNSGSLLSYDPSNNQTTVFLRNLTFASGVAVSGDGSFVLVSEYFANRIRRVWLKGP  239

Query  716  KAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILE  895
            KA +++  +  L G P+ +KR +   G FW+ VNT        +T S  V+   NG +L+
Sbjct  240  KANSSDLFML-LAGRPDNIKRNS--RGQFWIAVNT--------VTLSSGVRVTENGIVLQ  288

Query  896  TRNLTKDYPKLLGSYF-EYFGKAYTGSLEADFVGVY  1000
              +L ++Y     S   EY G  Y GSL A +  ++
Sbjct  289  IVSLVEEYGLEAASEVQEYNGTLYGGSLLASYAIIF  324



>ref|XP_009106057.1| PREDICTED: strictosidine synthase 1-like [Brassica rapa]
 emb|CDX96505.1| BnaA07g31160D [Brassica napus]
Length=328

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/298 (38%), Positives = 159/298 (53%), Gaps = 16/298 (5%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLS  295
            A GP+  AFD  GGGPYTGV  G+ILK+      F +FA  +    K  CD   GT L +
Sbjct  38   ASGPEAFAFDSHGGGPYTGVSGGKILKYQGPKLGFTEFAYITSIANKSLCDKAVGTFLGN  97

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            ICGRP+GL FN  TGDLYIAD   GL  V   GG AK+LA    G  F F D + +D +T
Sbjct  98   ICGRPVGLAFNEITGDLYIADAFLGLYLVSRRGGQAKRLADSAGGSPFKFLDGLDVDPVT  157

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            G  YF      F  +         D +GR  +Y+  T  VT +L+GL+G  G A+S D  
Sbjct  158  GSVYFTSFSTRFGPSQLVLAVAVNDATGRFFRYDPKTKSVTVLLSGLSGSAGCAVSSDGE  217

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR---  826
            F+ +  F+  +I++++I+GPKA T E  + ++ G P+ +++     G FW+  N+ +   
Sbjct  218  FVLVGEFLRNRILRYWIKGPKANTWEIFVPSIPG-PDNIRKTD--GGDFWIASNSVKLIV  274

Query  827  -EQQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVG  994
               +PS      AVK +  G+I+   +L + Y   L+    EY    Y G+L  +FVG
Sbjct  275  VPTEPS------AVKVNAGGEIIRRMSLGEYYGDTLVSEVNEYKSVVYVGTLTTNFVG  326



>ref|XP_009128018.1| PREDICTED: strictosidine synthase 3-like [Brassica rapa]
Length=325

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/292 (38%), Positives = 159/292 (54%), Gaps = 7/292 (2%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLSICG  304
            GP+  AFD  G G YTGV  G+I K+  G  +VDF   +     + CDG  G   +S CG
Sbjct  36   GPEAFAFDSTGKGFYTGVSGGKIFKYLPGKGYVDFGYITVSSKSQWCDGALGIAYMSKCG  95

Query  305  RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
            RP G+ FN +TG+LY+AD   GL  + S GG AK++A   +GK F+F D + +D  TG  
Sbjct  96   RPAGIAFNNKTGELYVADAPLGLHVIPSGGGYAKKIADSADGKPFLFLDGLDVDPTTGVV  155

Query  485  YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
            YF      F   D  +   S D SG+L KY+ +   VT +L GL+G  G A+S D +F+ 
Sbjct  156  YFTSFSSKFSPGDVLKAVASKDASGKLFKYDPSKRVVTVLLEGLSGSAGCAVSSDGSFVL  215

Query  665  ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
            ++ F    I +++I+G KA T+E    N   NP+ +KR  S SG FWV         P  
Sbjct  216  VSQFTKSNIKRYWIKGSKAGTSED-FTNAVSNPDNIKRIGS-SGNFWVASVVNTATGP--  271

Query  845  MTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF-EYFGKAYTGSLEADFVGV  997
             T+  AVK + +G++L+T ++   +   L S   E+ G+ Y G+L   F G+
Sbjct  272  -TNPSAVKINSDGRVLQTISVKDKFGDTLVSEVNEFEGRLYVGTLSGPFAGI  322



>ref|XP_002452976.1| hypothetical protein SORBIDRAFT_04g035870 [Sorghum bicolor]
 gb|EES05952.1| hypothetical protein SORBIDRAFT_04g035870 [Sorghum bicolor]
Length=346

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/299 (39%), Positives = 170/299 (57%), Gaps = 13/299 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNG---NFVDFAITSPFRTKEKCDGTNGTNLL--  292
             GP+  AFD  G GPY+GV DGR+LK+ NG    +  +A  SP    E C  +        
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAY-SPGYDAEACTASRARPAELT  109

Query  293   -SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              S CGRPLGL F+RR+G+LYIAD + GL+RV   GG A  LAA ++G    F + V +DQ
Sbjct  110   ESKCGRPLGLRFHRRSGNLYIADAYKGLMRVRPGGGEATVLAAEVDGVPLRFTNGVDVDQ  169

Query  470   LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
             +TGD +F +S   +  +   R+  +GD+SGRL+KY+  TGQVT +  G+  P G AIS D
Sbjct  170   VTGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPRTGQVTVLQAGITYPNGLAISAD  229

Query  650   HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
              T + + L    K+++++I GPKA T+E  L +L G P+ V+      GGFWV ++  + 
Sbjct  230   RTHLVVALTGPCKLMRYWIEGPKAGTSEH-LADLPGYPDNVR--ADGRGGFWVALHREKM  286

Query  830   QQP-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             + P  P +  +AV+   +G++++     K   +         GK Y GS+E  +V V R
Sbjct  287   ELPFGPDSHLLAVRVGADGQMVQVMKGPKSV-RPTEVVERDGGKLYMGSVELPYVAVVR  344



>ref|XP_009400113.1| PREDICTED: strictosidine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=359

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 121/357 (34%), Positives = 190/357 (53%), Gaps = 29/357 (8%)
 Frame = +2

Query  2     TTNMK-SLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTG  178
             TT+++ +L    +++L+  SS     +  + + + +L L    GP+  AFD RG GPYTG
Sbjct  8     TTSLRPALLSIMLAVLLPFSSCHEEKAIDKLESVERLVLTTVAGPESLAFDRRGEGPYTG  67

Query  179   VRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYI  352
             V  GRILK+      +  FA+ +  R KE CD T+  +L S+CGRPLGL F++ TG LY+
Sbjct  68    VSGGRILKWQGKGRGWTGFAVNAGNR-KECCD-TSDVSLESMCGRPLGLQFHKATGVLYV  125

Query  353   ADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFAR  532
             AD +FGLL VG  GG A++LAA  +G  F F + V +DQ TG+ YF +S   +   D+  
Sbjct  126   ADAYFGLLAVGPKGGAARRLAASADGGRFNFTNGVDVDQGTGEVYFTDSSTRYQRPDYIL  185

Query  533   IAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRG  712
                +GD++GRL+KY+  T +VT +  GL  P G A+S D +F+        +++KH++RG
Sbjct  186   SVITGDSTGRLMKYDPRTRKVTVLRRGLPFPNGVALSGDGSFLLFAETGSCRVLKHWLRG  245

Query  713   PKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR--------------------EQ  832
             P+    E V   L G P+ ++R  +  G +W+ +N  +                    + 
Sbjct  246   PRTGAME-VFAELPGYPDNIRR--TARGEYWIALNREKINLNDGVGVGVGVTEDEKATKG  302

Query  833   QPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             + +     +AV+    GK+LE   L       +    E  G  + GS+E  +V VY+
Sbjct  303   KAAATEHPVAVRLSGEGKVLEVL-LDGGELASVSEVAEENGAIWIGSVELPYVEVYK  358



>ref|XP_002323253.2| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEF05014.2| strictosidine synthase family protein [Populus trichocarpa]
Length=349

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/334 (35%), Positives = 176/334 (53%), Gaps = 37/334 (11%)
 Frame = +2

Query  98    IAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDG  271
             + ++ +  A GP+  AFD  G GPYT + DGRI+K+      ++DFA+TSP R  + C G
Sbjct  20    LNEIPIVGAIGPESFAFDSLGEGPYTSLSDGRIIKWQGDKKRWIDFAVTSPNR--DGCGG  77

Query  272   TNGTNLLS-ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFA  448
              +  + +  +CGRPLG  F+   GDLYIAD + GL RVG  GGLA ++A    G  F F 
Sbjct  78    PHDHHQMEHVCGRPLGSCFDETHGDLYIADAYMGLFRVGPEGGLATKIATHAQGIPFRFT  137

Query  449   DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             +S+ +DQ +G  YF +S   +   D+  +  SGD SGRL+KY+ A+ QVT +L  L  P 
Sbjct  138   NSLDIDQSSGAIYFTDSSTQYQRRDYLSVVLSGDKSGRLMKYDTASKQVTVLLKNLTFPN  197

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G A+S D +F+ +      +I++++I+  KA   E V   L G P+ +KR  S  GG+WV
Sbjct  198   GVALSTDGSFVLLAETTSCRILRYWIKTSKAGALE-VFAQLQGFPDNIKR--SPRGGYWV  254

Query  809   PVNTPRE-----------------QQPSPMTD-----------SIAVKFDRNGKILET-R  901
              +N+ RE                 + P  +T             +AV+   NG I+E   
Sbjct  255   GINSKREKLSELLFSYPWIGKVLLKLPLDITKFQTALAKYRGGGLAVRLSENGDIVEVFE  314

Query  902   NLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             +   +  K +    E  GK + GS++  F G ++
Sbjct  315   DRDGNRLKSISEVMEKDGKLWIGSIDLPFAGRFK  348



>ref|XP_003547789.1| PREDICTED: strictosidine synthase-like [Glycine max]
 gb|KHN15543.1| Strictosidine synthase [Glycine soja]
Length=347

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 176/315 (56%), Gaps = 24/315 (8%)
 Frame = +2

Query  116   QNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNL  289
              + FG +  AFD  G GPY GV DGRILK+  +   ++DFA+TSP R K+ CDG     +
Sbjct  39    HSVFGSESVAFDCHGKGPYVGVSDGRILKWHETKREWIDFAVTSPHRNKKLCDGLTNDKM  98

Query  290   LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              S+CGRPLGL FN  T +LYIAD +FGLL VG  GG+AKQLA    G  F F +++ +D 
Sbjct  99    ESMCGRPLGLKFNTLTCELYIADAYFGLLVVGPGGGVAKQLATSAEGVPFRFTNALDIDT  158

Query  470   LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
              TG+ YF +S  +F    +  I  SGD +GRLLKY  +T  V  ++ GLA P G A+S+D
Sbjct  159   KTGEVYFTDSSIMFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGVALSKD  218

Query  650   HTFIFITLFIGRKIIKHYIRGPKAKTTETVLE---NLGGNPEFVKRATSLSGGFWVPVNT  820
             ++FI +      KI+K  +R   +KT    +E    +  +P+ +KR  +  G FWV +N+
Sbjct  219   NSFIIVAESTTFKILKIQVR--DSKTNNNNIEPFAQVPRSPDNIKR--NAKGEFWVALNS  274

Query  821   PR----------EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF---EYFGKA  961
              R          E       D +A+KFD  G+ +E   L  +Y + L S     E+ G  
Sbjct  275   GRGLIQKLENEIETTLPWNADPVAIKFDEKGRAIEV--LDGEYGRQLDSVSEVEEHEGSL  332

Query  962   YTGSLEADFVGVYRA  1006
             + GS    ++G+ +A
Sbjct  333   WIGSAVQPYIGLIKA  347



>gb|KHN15177.1| Strictosidine synthase 1 [Glycine soja]
Length=335

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 116/337 (34%), Positives = 179/337 (53%), Gaps = 19/337 (6%)
 Frame = +2

Query  26   MFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILK  202
            M  +S +  I  LC   S     LI++L L +   GP+  AFD  GGGPY GV DGRILK
Sbjct  1    MIAISAIFMIFFLC---SPSVAILISRLPLPSPVTGPESVAFDRNGGGPYVGVSDGRILK  57

Query  203  FSNGN--FVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGL  373
            ++     F ++A TSP R K  CDG  + + L + CGRPLGL FN +T +LY+AD + GL
Sbjct  58   YAGPGEGFKEYAFTSPNRNKTICDGLADFSELQATCGRPLGLRFNHQTNELYVADAYSGL  117

Query  374  LRVGSNGGLAKQLAAGINGKN------FIFADSVSLDQLTGDAYFVESGEIFLTNDFARI  535
            +++G NGG   Q    I  +         F D + +D  TG  YF ++   +   D   +
Sbjct  118  IKIGPNGGAPTQCFKDIQPQQENVNTTLQFLDGLDVDVNTGIVYFTQASANYGFKDAQAL  177

Query  536  AQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGP  715
              S D SG L   +  T Q   ++ GLA   G A+S D +F+ ++ ++  +I + ++RGP
Sbjct  178  QSSRDQSGSLFSLDPKTNQTRVLMRGLALASGVAVSRDGSFVLVSEYLANRIQRFWLRGP  237

Query  716  KAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSI--AVKFDRNGKI  889
            +A ++E  L+ L G P+ ++  ++  G FWV VN      P P    +   V+   NG I
Sbjct  238  RANSSELFLQ-LTGRPDNIR--SNQRGQFWVAVNGVLGPNPPPRPTILPAGVRISENGII  294

Query  890  LETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGV  997
            L   +L +++  + +    E+ G  Y+GSL+A +V +
Sbjct  295  LRIVSLVQEFGSEAVSEIHEHNGTLYSGSLQASYVPI  331



>ref|XP_008244837.1| PREDICTED: strictosidine synthase 1 [Prunus mume]
Length=375

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 115/330 (35%), Positives = 171/330 (52%), Gaps = 36/330 (11%)
 Frame = +2

Query  107   LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNG  280
             +++  A GP+  AFDP GGGPYTGV DGRILK+   +  + DFA+TS  R  ++C     
Sbjct  50    IQVPGALGPESLAFDPNGGGPYTGVADGRILKWDQNDRRWTDFAVTSSQR--KECIRPFA  107

Query  281   TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
               L  +CGRPLGL F+ +TGDLYIAD + GL  VG  GGLA Q+   + G+   F + + 
Sbjct  108   PELEHVCGRPLGLKFDTKTGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLRFTNDMD  167

Query  461   LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
             +D+     YF +S  IF    F     +GD +GRLLKY  +  +VT +L GLA   G A+
Sbjct  168   IDEHKDVIYFTDSSTIFHRRQFMSSVLNGDRTGRLLKYNKSNKEVTVLLRGLAFANGVAL  227

Query  641   SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
             S+DH+F+ +      +I++ ++ GP A  T+T  E L G P+ ++R +   G FWV ++ 
Sbjct  228   SKDHSFVLVAETTTCRILRLWLHGPNAGNTDTFAE-LPGFPDNIRRNS--KGEFWVALHA  284

Query  821   PR------------------------EQQPSPMT----DSIAVKFDRNGKILET-RNLTK  913
              R                        +Q  S +      + A+K    G+ILE   +   
Sbjct  285   KRGFFAKWFVSNKLVGKSLLKLPLDFKQLHSLLVGGKAHATAIKLSERGEILEVLEDCEG  344

Query  914   DYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
                + +    E  GK + GS+   F+G+Y 
Sbjct  345   KNMRFISEVEEKDGKLWIGSVLMPFLGIYE  374



>ref|XP_003576994.1| PREDICTED: LOW QUALITY PROTEIN: strictosidine synthase 3-like 
[Brachypodium distachyon]
Length=344

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 177/342 (52%), Gaps = 22/342 (6%)
 Frame = +2

Query  23   TMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAF---------GPKDTAFDPRGGGPYT  175
            T  W+ + + + ++ +  SH     I     ++ F         G +  AFD +G GPY 
Sbjct  7    TSTWLVLFVGLLAVFLAPSHTSAAEIKTSPTEHGFRLPLPNGVTGAESLAFDAQGKGPYA  66

Query  176  GVRDGRILKF--SNGNFVDFAITSPFRTKEKCD--GTNGTNLLSICGRPLGLDFNRRTGD  343
            GV DGR+L++  S   +  FA    +R    C           SICGRPLGL F++++GD
Sbjct  67   GVSDGRVLRWDGSATGWTTFAHHEDYRRIPLCTVPMAPSHETESICGRPLGLAFHQKSGD  126

Query  344  LYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTND  523
            LYIAD + GLLRVGS+GG A+ L  G++G  F F + + +DQ TGD YF +S   +    
Sbjct  127  LYIADAYKGLLRVGSDGGEAEVLVTGVDGVPFRFVNGIDVDQATGDVYFTDSSLTYPRRF  186

Query  524  FARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHY  703
               I  + D +GR LKYEA T QV  +  GL  P G A+S D T++ +   +  +  ++Y
Sbjct  187  NTEIMMNADATGRXLKYEARTKQVMVLKDGLPYPNGVAVSHDRTYVVVAHTVSCQAHRYY  246

Query  704  IRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT----PREQQPSPMTDSIAVKF  871
            ++G KA   E ++ +L G P+ V+R     GG+WV +N     P      P+   + V+ 
Sbjct  247  LQGAKAGQYE-LMADLPGYPDNVRRDG--KGGYWVALNQEKARPDMASMGPVKHLVGVRL  303

Query  872  DRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            D NG  +E   LT      L    E  G+ + GS+E D++G+
Sbjct  304  DENGVQVEV--LTAAKGVTLSEVSERNGRLWLGSVELDYIGL  343



>ref|XP_010655934.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
 emb|CBI28989.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 139/219 (63%), Gaps = 3/219 (1%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            GP+  AFD  G GPYTG+ DG+ILK+  S   + +FAITSP R  + CDG+    +  +C
Sbjct  39   GPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPLRIPKFCDGSANPAMEQVC  98

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRPLGL FN  T DLYIAD +FGLL V  NGG+AKQ+A    G  F F +++ +DQ TG 
Sbjct  99   GRPLGLKFNEATCDLYIADAYFGLLVVRRNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  158

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  IF    +A   Q+GD + RLLKY+  + +VT +L GL+   G A+S+D+ F+
Sbjct  159  VYFTDTSTIFQRWAYAIAMQTGDKTRRLLKYDPRSKEVTMLLRGLSFSNGVALSQDNDFV  218

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKR  778
             +T     K+ +++++G K++ ++T    L G P+ ++R
Sbjct  219  LVTETTAAKVTRYWLQGQKSQLSDT-FTRLVGCPDNIQR  256



>dbj|BAK06958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 170/308 (55%), Gaps = 18/308 (6%)
 Frame = +2

Query  122   AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN-----FVDFAITSPFRTKEKCDGTNG-T  283
             AFGP+   FD RGGGPYTGV +G +L++  GN     + +FA     +T  +C       
Sbjct  55    AFGPESIVFDHRGGGPYTGVSNGHVLRW-RGNRRHHGWTEFAHNYKHKTVAECAAKKKLV  113

Query  284   NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
                S CGRPLGL F+  +GD+YIAD + GL+RVG  GGLA+ +A    G  F F + V +
Sbjct  114   EPESACGRPLGLQFHHASGDMYIADAYLGLMRVGRCGGLAEVVATETGGVPFNFLNGVDV  173

Query  464   DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
             DQ TGD YF +S  ++  +++  +  +GD +GRL++Y+  TG VT + +GLA P G A+S
Sbjct  174   DQETGDVYFTDSSTVYPRSEYMMVVLTGDATGRLMRYDPRTGNVTVLRSGLAFPNGVAVS  233

Query  644   EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTP  823
              D T + +      ++++H++RGP A TTE VL +L G P+ V+      GG+WV +N  
Sbjct  234   ADRTHLVVAETSSCRLLRHWLRGPAAGTTE-VLADLPGYPDNVRPDGGGRGGYWVGMNRD  292

Query  824   REQQPSPMT----DSIAVKFD----RNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLE  979
             ++   S  T     ++ V  D     NG + E      D    +    E  G  + GS++
Sbjct  293   KQWAESGTTANSMSAVRVVVDGGATTNGTVAEALRGFGD--ATVSEVVERNGSLWIGSVD  350

Query  980   ADFVGVYR  1003
               +V +++
Sbjct  351   TPYVRLFK  358



>ref|XP_010537421.1| PREDICTED: strictosidine synthase 1-like [Tarenaya hassleriana]
Length=333

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 163/295 (55%), Gaps = 10/295 (3%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNG---NFVDFAITSPFRTKEKCDGTNGTNLLSI  298
            GP+  AFDPRG GPYTGV  G+ILK+ NG    FV F+ TSP      CD   GT L  +
Sbjct  44   GPEAFAFDPRGEGPYTGVSGGKILKY-NGPLLGFVHFSFTSPLANTSVCDKAVGTFLGKV  102

Query  299  CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTG  478
            CGRP+G+ FN RTG LYIAD + GL      GG AK+LA    G  F F D + +D +TG
Sbjct  103  CGRPVGIAFNPRTGYLYIADAYLGLYVASPRGGRAKRLADSAEGSPFRFLDGLDVDPVTG  162

Query  479  DAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTF  658
            + YF      F  ++        D +G+L +Y+  T  V  ++TGL+G  G A+S D +F
Sbjct  163  NVYFTSFSSRFGPSELLLAVAVKDATGKLFRYDPKTKNVAVLMTGLSGSAGCAVSSDGSF  222

Query  659  IFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQP  838
            + +   +  +I++++I+G KA T E  +  + G P+ ++R     G FWV  +   +   
Sbjct  223  VLVGEVLRNRILRYWIKGSKAATWEVFVPWIPG-PDNIRRTD--GGDFWV-ASVVMKLAV  278

Query  839  SPMTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVY  1000
             P T+  AVK + +G I+    L + Y   L+    E+ G  Y G+L +DF+GVY
Sbjct  279  VP-TEPSAVKLNTSGGIVRRIPLGEYYGNTLVSEANEHNGVIYFGTLTSDFIGVY  332



>ref|XP_006291448.1| hypothetical protein CARUB_v10017585mg [Capsella rubella]
 gb|EOA24346.1| hypothetical protein CARUB_v10017585mg [Capsella rubella]
Length=339

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 163/300 (54%), Gaps = 9/300 (3%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNG  280
            + L  A GP+  AFDP GGGPY GV DGR+LK+      + DFA T+  R  + C  +  
Sbjct  45   VNLTRASGPESIAFDPSGGGPYVGVSDGRVLKWRGKKLGWTDFAYTAANR--KMCVRSFA  102

Query  281  TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
              L  +CGRPLGL F+++TGDLYIAD +FGLL VG  GG+AK L     GK   F + + 
Sbjct  103  PELEHVCGRPLGLRFHKKTGDLYIADAYFGLLVVGPAGGVAKPLVTEAEGKPIRFTNDLD  162

Query  461  LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
            +D+     YF +S   F   D+     + D +GR +KY+ ++ + T +L GL+ P G  +
Sbjct  163  IDEQNDVIYFTDSSSRFQRWDYFGSFMTVDKTGRFIKYDRSSKKATVLLHGLSFPNGVTL  222

Query  641  SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
            S+D +F+ +      KI++ ++ GPKA  T+ V   L G P+ ++R +  +G FWV +N 
Sbjct  223  SKDRSFVLVDETTNFKILRLWLSGPKA-GTQDVFAVLPGYPDNIRRNS--NGEFWVAINY  279

Query  821  PREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
                   P T   AVK   +G++LE         + +    E  GK + GS    FVGVY
Sbjct  280  SIFNGERPHTK--AVKLSESGEVLEVLEDKGKRLRYISEVEEKDGKLWIGSSVMPFVGVY  337



>ref|XP_010110077.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25144.1| Strictosidine synthase 1 [Morus notabilis]
Length=331

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 123/333 (37%), Positives = 179/333 (54%), Gaps = 19/333 (6%)
 Frame = +2

Query  35   VSMLMFISSL-CMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFS-  208
            +S+++F+ S+  ++   P  +         A GP   AFD  G GP+TG+ DGR+L++  
Sbjct  2    LSIVIFLFSVPSLVFCQPFSNFQKYDLPSAAVGPFSIAFDSSGRGPFTGISDGRVLRYDP  61

Query  209  -NGNFVDFAITSPFRTKEKCDGTNGTNLL---SICGRPLGLDFNRRTGDLYIADIHFGLL  376
               +F DFA TSP R+K  CDGT+  +     +ICGRPLG+ F+ RT  LY+ D + GLL
Sbjct  62   VQNSFFDFAFTSPNRSKAVCDGTDNNDNPTRGAICGRPLGVSFHFRTNQLYVTDAYKGLL  121

Query  377  RVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTS  556
             V  NG LA+ +A G  G  F F   + +DQ+TGD YF E    F  +         D++
Sbjct  122  VVPPNGRLAENVATGAEGVPFKFPFLLDVDQVTGDVYFTEFSSQFQLSQVQHAIDVRDST  181

Query  557  GRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTET  736
            GRLLKY   TG+ T +L GL+G  G A+S D T++ I      ++ K ++ GP A TT  
Sbjct  182  GRLLKYNPNTGETTVLLRGLSGAAGIALSYDRTYLLIAEMTANRVKKLWLSGPNAFTTVD  241

Query  737  VLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSI-----AVKFD-RNGKILET  898
            ++  + G P  +K+  SL+  FWV VNT     P P   S+     A++     G IL+T
Sbjct  242  LI-TVRGRPSNIKK-NSLA-DFWVAVNT---WIPGPTVGSMIRVPSAIRISGTGGAILQT  295

Query  899  RNLTKDYPKLLGSYFEYFG-KAYTGSLEADFVG  994
             +L+  Y     S F+ FG   Y G+L A  +G
Sbjct  296  VDLSSYYTNTSISEFQPFGLGGYIGALRAASLG  328



>ref|XP_002467870.1| hypothetical protein SORBIDRAFT_01g035660 [Sorghum bicolor]
 gb|EER94868.1| hypothetical protein SORBIDRAFT_01g035660 [Sorghum bicolor]
Length=341

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 160/292 (55%), Gaps = 12/292 (4%)
 Frame = +2

Query  143  AFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT--NGTNLLSICGRP  310
            AFD RG GPY GV DGR+LK+  S   +  FA ++ +R    C  +        S+CGRP
Sbjct  54   AFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAHSANYRKMPLCTASVVPSEQTESMCGRP  113

Query  311  LGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYF  490
            LGL F   TGDLYIAD + GL++VG NGG A+ LA   +G  F FA+ + +DQ TGD YF
Sbjct  114  LGLQFYAMTGDLYIADAYMGLMKVGPNGGEAQVLATQADGAPFRFANGLDVDQGTGDVYF  173

Query  491  VESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFIT  670
             +S   +     A I  + D +GRLLKY+A T +VT +   L  P G A+S D T + + 
Sbjct  174  TDSSATYPRRFNAEIMMNADATGRLLKYDARTKRVTVLKADLPYPNGVAVSSDRTHVVVA  233

Query  671  LFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR---EQQPS  841
              +  +  ++++RGPKA   E +L +L G P+ V+R     GG+WV +N  R   +    
Sbjct  234  HTVPCQAFRYWLRGPKAGQYE-LLADLPGYPDNVRR--DARGGYWVALNQERARLDATAP  290

Query  842  PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            P    + V+   +G  +E   LT      L    E  G+ + GS+E D+VG+
Sbjct  291  PAKHLVGVRLGVDGDAVE--ELTAAKGVTLSDVAEKDGQLWLGSVELDYVGL  340



>ref|XP_010647214.1| PREDICTED: strictosidine synthase 1 [Vitis vinifera]
Length=362

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 124/195 (64%), Gaps = 2/195 (1%)
 Frame = +2

Query  125  FGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLLSI  298
            FGP+  AFD  G GPYTG+ DGRILK+  S   + +FAITSPFR    CDG+    +  +
Sbjct  38   FGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPNFCDGSLNLAIEQV  97

Query  299  CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTG  478
            CGRPLGL FN  T DLYIAD +FGLL VG NGG+AKQ+A    G  F F +++ +DQ TG
Sbjct  98   CGRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTG  157

Query  479  DAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTF  658
              YF ++  IF    +A   Q GD +GRLLKY+  T +VT +L GL+   G A+SED  F
Sbjct  158  VVYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDF  217

Query  659  IFITLFIGRKIIKHY  703
            + +T     K+ +++
Sbjct  218  VLVTETTAAKVTRYW  232



>emb|CDX73039.1| BnaC06g34870D [Brassica napus]
Length=326

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 159/294 (54%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G   +TGV  G+ILK+ ++  F DFA  +       CDG  GT L   CG
Sbjct  37    GPEAFAFDTTGKAFFTGVSGGKILKYTADKGFEDFAEITTTSNSSWCDGIAGTALAGKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN +TGDLY+AD   GL  +   GGLA ++A  ++G  F F D + +D  TG  
Sbjct  97    RPAGIAFNPKTGDLYVADAPLGLHVIPPAGGLATKIADSVDGTPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F  ++        D SG+L KY+ AT  VT ++ G++G  G A+S D +F+ 
Sbjct  157   YFTSFSSKFSPSEVLIAVGLKDASGKLFKYDPATKAVTVLMEGISGGAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             +T FI   I K++I GPKA +TE    ++  NP+ +KR    +G FWV     +   P  
Sbjct  217   VTEFIKSNIKKYWITGPKAGSTEDFTSSV-SNPDNIKR-IGATGNFWVASVKNKVVVP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK D +GK+L+  +L  ++   LL    E  GK Y G+L   F G+ +
Sbjct  273   -TDPSAVKIDYSGKVLQAISLKNEFGDTLLSEANELDGKLYIGTLTGPFAGIMK  325



>ref|XP_010416233.1| PREDICTED: strictosidine synthase 3 [Camelina sativa]
Length=327

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 162/297 (55%), Gaps = 7/297 (2%)
 Frame = +2

Query  119   NAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLS  295
             N  GP+  AFD  G G YTGV  G+ILK+  G  +VDFA  +       CDG  GT    
Sbjct  35    NRTGPEAFAFDSTGKGFYTGVSGGKILKWLPGKGYVDFAQITGSSKSSLCDGALGTVNAG  94

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
              CGRP G+ FN +TGDLY++D   GL  + S GGLAK++A  +NGK F+F D + +D  T
Sbjct  95    KCGRPAGIAFNGKTGDLYVSDAPLGLHVISSGGGLAKKIADSVNGKPFLFLDGLDIDPTT  154

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             G  YF      F   D  +   + D++G+L KY+ +   VT ++ GL+G  G A+S D +
Sbjct  155   GVVYFTSFSSTFGPRDVLKAVATKDSTGKLFKYDPSKKVVTVLMEGLSGSAGCAVSSDGS  214

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
             F+ ++ F    I +++I+G KA T+E    ++  +P+ +KR  S SG FWV         
Sbjct  215   FVLVSQFTKSNIKRYWIKGSKAGTSEDFTNSV-SSPDNIKRIGS-SGNFWVASVVNSATG  272

Query  836   PSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF-EYFGKAYTGSLEADFVGVYR  1003
             P   T+  AVK   +GK+L+T      +   L S   E+ GK Y G+L   F G+ +
Sbjct  273   P---TNPSAVKVRSDGKVLQTIPFKDKFGDTLVSEVNEFNGKIYIGALFGPFAGILK  326



>ref|XP_004308613.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/291 (38%), Positives = 160/291 (55%), Gaps = 18/291 (6%)
 Frame = +2

Query  131  PKDTAFDPRGGGPYTGVRDGRILKFSNGNF--VDFAITSPFRTKEKCDGTNGTNLLSICG  304
            P+  AFD  G  PY GV DGRI K+    F   +F +T+P R +E CD +       ICG
Sbjct  42   PESIAFDCNGA-PYVGVADGRIFKWLGRPFGWTEFTVTAPNRPREVCDLSTSKGSEPICG  100

Query  305  RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
            RPLGL F+  T +LYIAD +FGLL+ G NGG+A+ LA    G  F F + V +DQ TG  
Sbjct  101  RPLGLKFDLNTCELYIADAYFGLLKTGPNGGVAQTLATSAEGFPFRFLNGVDVDQETGMV  160

Query  485  YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
            YF ++  I+   ++     +GD +GRL+ Y+ +T  VT +L GLA   G A+S+D  F+ 
Sbjct  161  YFTDTSAIYQRRNWELSVSTGDKTGRLMLYDPSTKNVTVLLHGLAFANGVALSKDGDFVL  220

Query  665  ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
            +T    + I+++++RGP+A T +T   NL G P+ + R  +L+G FWV  N+    +   
Sbjct  221  VTQTTAKNILRYWLRGPRANTVDTFF-NLQGAPDNINR--NLNGEFWVAENSAGRGK---  274

Query  845  MTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
                 AVK D  G  L+      D    +    +  G  + GS+  +FVGV
Sbjct  275  -----AVKLDAQGNFLD----VVDGLNPVSHVEQRHGNLWIGSVVNNFVGV  316



>ref|XP_006301859.1| hypothetical protein CARUB_v10022329mg [Capsella rubella]
 gb|EOA34757.1| hypothetical protein CARUB_v10022329mg [Capsella rubella]
Length=311

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 161/297 (54%), Gaps = 7/297 (2%)
 Frame = +2

Query  119   NAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGTNLLS  295
             N  GP+  AFD  G G YTGV  G+ILK+  G  +VDFA  +   T   CDG   T    
Sbjct  19    NRTGPEAFAFDSTGKGFYTGVSGGKILKWLPGKGYVDFAHITNSSTSSLCDGALATANAE  78

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
              CGRP G+ FN +TGDLY+AD   GL  +   GGLAK++A  ++GK F+F D + +D  T
Sbjct  79    KCGRPAGIAFNGKTGDLYVADAPLGLHVISRGGGLAKKIADSVDGKPFLFLDGLDIDPTT  138

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             G  YF      F   D  +   S D++G+L +Y+ +   V  ++ GL+G  G A+S D +
Sbjct  139   GVVYFTSFSSAFGPRDVLKAVASKDSTGKLFRYDPSKKVVNVLMEGLSGSAGCAVSSDGS  198

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
             F+ ++ F    I +++I+G KA ++E    ++  NP+ +KR  S SG FWV         
Sbjct  199   FVLVSQFTKSNIKRYWIKGSKAGSSEDFTNSV-SNPDNIKRIGS-SGNFWVASVVNSATG  256

Query  836   PSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             P   T+  AVK   +GK+L+T  L   +   L+    E+ GK Y G+L   F G+ +
Sbjct  257   P---TNPSAVKVSSDGKVLQTIPLKDKFGDTLVSEVNEFKGKLYIGALFGPFAGILK  310



>ref|XP_002888956.1| hypothetical protein ARALYDRAFT_476540 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65215.1| hypothetical protein ARALYDRAFT_476540 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 163/297 (55%), Gaps = 7/297 (2%)
 Frame = +2

Query  119   NAFGPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLS  295
             N  GP+  AFD  G G YTGV  G+ILK+     +VDFA  +       CDG  GT  + 
Sbjct  35    NRTGPEAFAFDSTGKGFYTGVSGGKILKYLPRKGYVDFAQITNSSKSSLCDGALGTTNVG  94

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
              CGRP G+ FNR+TGDLY+AD   GL  V   GGLAK++A  ++GK F+F D + +D  T
Sbjct  95    KCGRPAGIAFNRKTGDLYVADAPLGLHVVSRGGGLAKKIADSVDGKPFLFLDGLDVDPTT  154

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             G  YF      F  +D  +   + D++G+L KY+ +   VT ++ GL+G  G A+S D +
Sbjct  155   GVVYFTSFSSTFGPSDVLKAVATKDSTGKLFKYDPSKKVVTVLMEGLSGSAGCAVSSDGS  214

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
             F+ ++ F    I +++I+G KA + E    ++  +P+ +KR  S SG FWV         
Sbjct  215   FVLVSQFTKSNIKRYWIKGAKAGSFEDFTNSV-SSPDNIKRIGS-SGNFWVASVVNSATG  272

Query  836   PSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYF-EYFGKAYTGSLEADFVGVYR  1003
             P   T+  AVK   +GK+++T  L   +   L S   E+ G+ Y G+L   F G+ +
Sbjct  273   P---TNPSAVKVSSDGKVIQTIPLKDKFGDTLVSEVNEFRGRLYIGALFGPFAGILK  326



>ref|XP_010412433.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=340

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/309 (38%), Positives = 171/309 (55%), Gaps = 13/309 (4%)
 Frame = +2

Query  89   RDLIAKLKLQN---AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRT  253
            RD+ +  K+ N   A GP+  AFDP G GPY GV DGR+LK+   +  + DFA TS  R 
Sbjct  38   RDVFSLAKVVNLAGASGPESIAFDPAGEGPYVGVADGRVLKWRGKSLGWTDFAYTSANR-  96

Query  254  KEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGK  433
             + C       L  +CGRPLGL F+++TGDLYIAD +FGLL VG  GGLAK L     G+
Sbjct  97   -QFCVRPFAPLLEPVCGRPLGLRFHKKTGDLYIADAYFGLLIVGPAGGLAKPLVTEAEGQ  155

Query  434  NFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTG  613
             F F + + +D      YF ++   F   ++     +GD +GR +KY+ ++ + T +L G
Sbjct  156  PFRFTNDLDIDDQNDVIYFTDASSKFQRWEYIGSFLTGDKTGRFMKYDRSSKKATVLLHG  215

Query  614  LAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLS  793
            L+   G A+S+D +F+ +      KI++ ++ GPKA  T+ V   L G P+ ++R +   
Sbjct  216  LSFANGVALSKDQSFVLVAETTNCKILRLWLSGPKA-GTQDVFVVLPGYPDNIRRNS--K  272

Query  794  GGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGS  973
            G FWV +N+   ++   +  + AVK   +GKILE         + +    E  GK + GS
Sbjct  273  GEFWVALNSLFNEE---IRYTKAVKLSESGKILEVLGDKAKRLRFISDVEEKDGKLWIGS  329

Query  974  LEADFVGVY  1000
              A FVGVY
Sbjct  330  SVAPFVGVY  338



>ref|XP_004307669.1| PREDICTED: strictosidine synthase 1-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=364

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/329 (33%), Positives = 168/329 (51%), Gaps = 36/329 (11%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNG  280
            L+L  A GP+  AFDP G GPYTGV DGRILK+  ++  + DFA+T+  R  ++C     
Sbjct  39   LQLTGAVGPESLAFDPNGDGPYTGVADGRILKWDPNHHRWTDFAVTTSQR--KECVRPFA  96

Query  281  TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
              L  +CGRPLGL FN++TGDLYIAD + GL  VG  GGLA Q+   + G+   F + + 
Sbjct  97   PELEHVCGRPLGLRFNKKTGDLYIADAYLGLQVVGPAGGLASQVVKEVEGQQLHFTNDID  156

Query  461  LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
            +D+     YF +S  +F    F     +GD +GRLLKY  ++ +V  +L GLA   G A+
Sbjct  157  IDEKKDVIYFTDSSTVFHRRQFMSSILNGDKTGRLLKYNISSQEVVVLLQGLAFANGVAL  216

Query  641  SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
            S+DH+F+ +      +I++H++ GP A  T+ +   L G P+ ++R +   G FWV ++ 
Sbjct  217  SKDHSFVLVAETTNCRILRHWLYGPNAGDTD-IFTKLPGFPDNIRRNS--KGEFWVALHA  273

Query  821  PREQQPSPMTD----------------------------SIAVKFDRNGKILET-RNLTK  913
             +      +                              + A+K    G +L+   +   
Sbjct  274  KKGLFAKWLVSNTWAGKSLLKLPLGFKRLHSLLVGGKAYATAIKLSEKGDVLQVLEDCEG  333

Query  914  DYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
               + +    E  GK + GS+   F+G+Y
Sbjct  334  KSMRFISEVEEKDGKLWMGSVLMPFIGIY  362



>ref|XP_007204530.1| hypothetical protein PRUPE_ppa017675mg, partial [Prunus persica]
 gb|EMJ05729.1| hypothetical protein PRUPE_ppa017675mg, partial [Prunus persica]
Length=340

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/330 (35%), Positives = 170/330 (52%), Gaps = 36/330 (11%)
 Frame = +2

Query  107   LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNG  280
             +++  A GP+  AFDP GGGPYTGV DGRILK+   +  + DFA+TS  R  ++C     
Sbjct  15    IQVPGALGPESLAFDPNGGGPYTGVADGRILKWDQNDRRWTDFAVTSSQR--KECIRPFA  72

Query  281   TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
               L  +CGRPLGL F+  TGDLYIAD + GL  VG  GGLA Q+   + G+   F + + 
Sbjct  73    PELEHVCGRPLGLKFDTETGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLRFTNDMD  132

Query  461   LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
             +D+     YF +S  +F    F     +GD +GRLLKY  +  +VT +L GLA   G A+
Sbjct  133   IDEHKDVIYFTDSSTVFHRRQFMSSILNGDRTGRLLKYNKSNKEVTVLLRGLAFANGVAL  192

Query  641   SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
             S+DH+F+ +      +I++ ++ GP A  T+T  E L G P+ ++R +   G FWV ++ 
Sbjct  193   SKDHSFVLVAETTTCRILRLWLHGPNAGNTDTFAE-LPGFPDNIRRNS--KGEFWVALHA  249

Query  821   PR------------------------EQQPSPMT----DSIAVKFDRNGKILET-RNLTK  913
              R                        +Q  S +      + A+K    G+ILE   +   
Sbjct  250   KRGFFAKWFVSNRLVGKSLLKLPLDFKQLHSLLVGGKAHATAIKLSETGEILEVLEDCEG  309

Query  914   DYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
                + +    E  GK + GS+   F+G+Y 
Sbjct  310   KNMRFISEVEEKDGKLWIGSVLMPFLGIYE  339



>ref|XP_003549591.1| PREDICTED: strictosidine synthase 1-like [Glycine max]
Length=336

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/335 (35%), Positives = 178/335 (53%), Gaps = 19/335 (6%)
 Frame = +2

Query  41   MLMFISSLCMIH---SHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFS  208
            M++ IS+  MI    S     LI +L L +   GP+  AFD  GGGPY GV DGRILK++
Sbjct  1    MMIAISATFMIFFLCSPSVAILITRLPLPSPVTGPESVAFDRNGGGPYVGVSDGRILKYA  60

Query  209  NGN--FVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLR  379
                 F ++A TSP R K  CDG  + + L + CGRPLGL FN +T +LY+AD + GL++
Sbjct  61   GPTEGFKEYAFTSPNRNKTICDGLADFSELQATCGRPLGLRFNHQTNELYVADAYSGLIK  120

Query  380  VGSNGGLAKQLAAGINGKN------FIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQ  541
            +G NGG   Q    I  +         F D + +D  +G  YF ++   +   D   +  
Sbjct  121  IGPNGGAPTQCFKDIQPQQENVNTTLGFLDGLDVDVNSGVVYFTQASANYRFKDAQALQS  180

Query  542  SGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKA  721
            S D SG L   +  T Q   ++ GLA   G A+S D +F+ ++ ++  +I + ++RGP+A
Sbjct  181  SRDQSGSLFSLDPKTNQTRVLMRGLALASGVAVSRDGSFVLVSEYLANRIQRFWLRGPRA  240

Query  722  KTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSI--AVKFDRNGKILE  895
             ++E  L+ L G P+ ++  ++  G FWV VN      P P    +   ++   NG IL+
Sbjct  241  NSSELFLQ-LTGRPDNIR--SNQRGQFWVAVNGALGPNPPPRPTILPGGLRISENGVILQ  297

Query  896  TRNLTKDYPKLLGS-YFEYFGKAYTGSLEADFVGV  997
              +L K++     S   E+ G  Y+GSL A +V +
Sbjct  298  ILSLVKEFGSEAASEVHEHNGTLYSGSLRASYVPI  332



>ref|XP_007045664.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY01496.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=376

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 150/271 (55%), Gaps = 9/271 (3%)
 Frame = +2

Query  104  KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTN  277
            +L L    GP+  AFD +  GPY GV DGRILK+   +  + +FAI SP R ++ CDG+ 
Sbjct  70   QLDLPQVTGPESIAFDCKNQGPYVGVSDGRILKWHGPHLGWKEFAIPSPVRDRKLCDGST  129

Query  278  GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
              NL  ICGRPLGL FN  T DLYIAD +FGLL VG NGG+A+QLA    G  F F + +
Sbjct  130  NPNLEPICGRPLGLKFNYATCDLYIADAYFGLLVVGPNGGVAQQLATSAEGVPFRFTNGL  189

Query  458  SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
             +D  TG  YF +S   F       +  + D SGRLLKY+  T  VT +  GL  P G A
Sbjct  190  DIDSKTGMVYFTDSSIFFQRRYHLLLRITSDRSGRLLKYDPRTKDVTVMSRGLMFPNGVA  249

Query  638  ISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVN  817
            ++ D++++ +      +I+K  + G        +   L   P+ ++R    +G FWV +N
Sbjct  250  LNADNSYLLVAESTTMRILKFRLEGEANSYIPELFVQLSRTPDNIQRNK--NGEFWVGLN  307

Query  818  TPR-----EQQPSPMTDSIAVKFDRNGKILE  895
            + R     +   + + D + VK ++ GKIL+
Sbjct  308  SGRSGRIQDDAYAKLPDPVGVKLNQEGKILK  338



>ref|XP_009356499.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=357

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/321 (35%), Positives = 170/321 (53%), Gaps = 24/321 (7%)
 Frame = +2

Query  104   KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTN  277
             +++L    GP+  AFD RG GPY GV DG ILK+      + +FA TSP R +++CDG+ 
Sbjct  39    EIELARVVGPESIAFDCRGKGPYVGVSDGTILKWQGPRLGWTEFAFTSPNRARKQCDGST  98

Query  278   GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
                   ICGRPLG+ F+ +T DLY AD +FGL++ G NGG A+ LA  I G  F+F +S+
Sbjct  99    NVTNEPICGRPLGMMFHPKTCDLYFADAYFGLMKTGPNGGKAEVLANSIGGVPFLFVNSL  158

Query  458   SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
              +D+ TG  YF ++  +F    + +   +GD +GRLL+Y+  T +V  +L GL    G A
Sbjct  159   DIDEETGIVYFTDTSTVFQRRVWVQSVLAGDKTGRLLQYDPRTKKVKVLLHGLGFANGVA  218

Query  638   ISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVN  817
             +S D +F+ +      +I + ++RGPKA   E +   L   P+ +KR     G FWV +N
Sbjct  219   LSGDKSFVLVVESAEFRIHRLWLRGPKAHVLE-LFTQLQRPPDNIKRTK--KGEFWVGLN  275

Query  818   TPR-----EQQPSPM-------------TDSIAVKFDRNGKILETRNLTKDYP-KLLGSY  940
             + R     + +   M              D + VK D  G +L+  +       + +   
Sbjct  276   SGRGVKGVQNKVQNMMNNNESSGELLNVNDPVGVKLDEQGGVLQVLDGEGGKSLQAVSEV  335

Query  941   FEYFGKAYTGSLEADFVGVYR  1003
              E+ G  + GS  A +VGV +
Sbjct  336   EEHNGILWIGSAVAPYVGVIK  356



>ref|NP_001063033.1| Os09g0374900 [Oryza sativa Japonica Group]
 dbj|BAF24947.1| Os09g0374900 [Oryza sativa Japonica Group]
Length=362

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 144/241 (60%), Gaps = 10/241 (4%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFS----NGNFVDFAITSPFRT--KEKCDGTNGT  283
            AFGP+  AFD RGGGPYTGV +GR+L++        + +FA      T  +         
Sbjct  54   AFGPESLAFDHRGGGPYTGVSNGRVLRWRADRRRPGWTEFAHNYKHATVAECAARKKAAA  113

Query  284  NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
               S+CGRPLG+ F+RRTG++YIAD + GL+RVG  GG+A+ +AA   G    FA+ V +
Sbjct  114  AAESVCGRPLGVQFDRRTGEMYIADAYLGLMRVGRRGGMAEVVAAEAGGVALNFANGVDV  173

Query  464  DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
            DQ TGD YF +S   +  +D+  +  SGD +GRLL+YE  TG VT + +GLA P G A+S
Sbjct  174  DQATGDVYFTDSSTTYKRSDYLLVVLSGDATGRLLRYEPRTGNVTVLESGLAFPNGVAVS  233

Query  644  EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSG---GFWVPV  814
             D T + +      ++++H++RG  A  TE VL +L G P+ V+ A +  G    +WV +
Sbjct  234  ADGTHLVVAETASCRLLRHWLRGSNAGATE-VLADLPGYPDNVRHAAADGGRGASYWVAL  292

Query  815  N  817
            N
Sbjct  293  N  293



>emb|CDP07817.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 117/285 (41%), Positives = 163/285 (57%), Gaps = 19/285 (7%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKF-SNGN-FVDFAITSPFRTKEKCDGTNGTNLLS  295
            A GP+  AFD  GGGPYTGV DGRI+K+ +N N +VDFA T+P+R    C G     L  
Sbjct  41   ATGPESLAFDRNGGGPYTGVSDGRIIKWQANVNRWVDFATTTPYRFG--CQGPFDHVLTE  98

Query  296  I-CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
              CGRPLGL FN RTGDLYIAD + GLL VG  GGLA+ LA    G  F F + V +DQ 
Sbjct  99   ARCGRPLGLSFNHRTGDLYIADAYMGLLVVGPEGGLARPLAKEAGGVPFRFTNDVVVDQN  158

Query  473  TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
            +G  YF ++      + +A +  SGD SGRLLKY+  T QVT ++  L  P G A+S++ 
Sbjct  159  SGIVYFTDTSTRLPRSAYAYVILSGDNSGRLLKYDLRTNQVTVLMDHLMFPNGVALSKNG  218

Query  653  TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ  832
             F+ +T     +++++++   +  T + V   L G P+ +KR  +  G FWV  N+ R+ 
Sbjct  219  DFLLVTETTNSRVLRYWLEPSRVGTVD-VFAELPGRPDNIKR--NQQGEFWVAANS-RDG  274

Query  833  QPSPMTDSIAVKFDRNGKIL--------ETRNLTKDYPKLLGSYF  943
              +P+   + VK  +NG IL        ET  L+ D  +  GS +
Sbjct  275  IYNPL--GMIVKLSQNGDILKVLEAGNGETWQLSSDVNEQNGSLW  317



>gb|KHN18404.1| Strictosidine synthase 1 [Glycine soja]
Length=327

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 169/314 (54%), Gaps = 16/314 (5%)
 Frame = +2

Query  95   LIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKC  265
            LI +L L +   GP+  AFD  GGGPY GV DGRILK++     F ++A TSP R K  C
Sbjct  13   LITRLPLPSPVTGPESVAFDRNGGGPYVGVSDGRILKYAGPTEGFKEYAFTSPNRNKTIC  72

Query  266  DG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKN--  436
            DG  + + L + CGRPLGL FN +T +LY+AD + GL+++G NGG   Q    I  +   
Sbjct  73   DGLADFSELQATCGRPLGLRFNHQTNELYVADAYSGLIKIGPNGGAPTQCFKDIQPQQEN  132

Query  437  ----FIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEV  604
                  F D + +D  +G  YF ++   +   D   +  S D SG L   +  T Q   +
Sbjct  133  VNTTLGFLDGLDVDVNSGVVYFTQASANYRFKDAQALQSSRDQSGSLFSLDPKTNQTRVL  192

Query  605  LTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRAT  784
            + GLA   G A+S D +F+ ++ ++  +I + ++RGP+A ++E  L+ L G P+ ++  +
Sbjct  193  MRGLALASGVAVSRDGSFVLVSEYLANRIQRFWLRGPRANSSELFLQ-LTGRPDNIR--S  249

Query  785  SLSGGFWVPVNTPREQQPSPMTDSI--AVKFDRNGKILETRNLTKDYPKLLGS-YFEYFG  955
            +  G FWV VN      P P    +   ++   NG IL+  +L K++     S   E+ G
Sbjct  250  NQRGQFWVAVNGALGPNPPPRPTILPGGLRISENGVILQILSLVKEFGSEAASEVHEHNG  309

Query  956  KAYTGSLEADFVGV  997
              Y+GSL A +V +
Sbjct  310  TLYSGSLRASYVPI  323



>ref|XP_004974473.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=341

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 113/299 (38%), Positives = 165/299 (55%), Gaps = 15/299 (5%)
 Frame = +2

Query  125  FGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTN---GTNL  289
             GP+  AFD RG GPY  + DGRILK++  +  F  FA  SP   K  CD  +       
Sbjct  46   IGPESVAFDRRGAGPYVSISDGRILKYAGKSVGFTTFAY-SPSYIKNNCDAPSELPSVAT  104

Query  290  LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
             S CGRPLGL F+  +GDLYIAD + GL+RVG NGG A  LA    G    F + V +DQ
Sbjct  105  ESSCGRPLGLRFHNNSGDLYIADAYMGLMRVGPNGGEATVLATEAGGAPLRFTNGVDVDQ  164

Query  470  LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
            +TGD YF +S   +       +  SGD++GR+++Y   T +VT + +G+  P G AIS D
Sbjct  165  VTGDVYFTDSSTTYTRAQHQMVTASGDSTGRIMRYNRRTNKVTVLQSGVTYPNGIAISAD  224

Query  650  HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
             + + + L    K+++++IRGPKA T+E +  +L G P+ V+      GG+WV ++  RE
Sbjct  225  RSHLIVALTGPCKLMRYWIRGPKAGTSE-LFADLPGYPDNVR--PDGKGGYWVALH--RE  279

Query  830  QQPSPM-TDS--IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            +   P   DS  +A++    G+ L+     KD  +   +     GK Y GS+E  +V +
Sbjct  280  KYELPFGKDSHLVAIRIGAEGEKLQEMRGPKDV-RPTEAVERGDGKIYLGSVELSYVSI  337



>gb|KFK41838.1| hypothetical protein AALP_AA2G178000 [Arabis alpina]
Length=326

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 158/294 (54%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK++    FVDFA  +   +   C+G  GT L   CG
Sbjct  37    GPEAFAFDSTGNGFYTGVSGGKILKYTPEKGFVDFAQITKTSSTSWCNGVFGTALAGKCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ F+ +TG+LY+AD   G       GGLA +LA  ++GK F F D + +D  TG  
Sbjct  97    RPAGIAFSSKTGELYVADAPLGXXXXXXXGGLATKLADSVDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F   +        D +G+L KY+  T  VTE++ GL+G  G A+S D +FI 
Sbjct  157   YFTSFSSKFGPREVLVAVGLKDATGKLFKYDPTTKTVTELMDGLSGAAGCAVSSDGSFIL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ FI   I +++I+GPKA T E    +L  NP+ +KR  S +G FWV     +   P  
Sbjct  217   VSEFIKSNIKRYWIKGPKAGTIED-FTSLVSNPDNIKRVGS-TGDFWVASVVNKVVVP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDYPK-LLGSYFEYFGKAYTGSLEADFVGVYR  1003
              TD  AVK +  GK++ T  L  ++   LL    E+ G  Y G+L   F GV +
Sbjct  273   -TDPRAVKVNSEGKVVRTIFLKNEFGNTLLSEVNEFNGNLYIGTLTGPFAGVMK  325



>ref|XP_010672985.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=377

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 116/333 (35%), Positives = 170/333 (51%), Gaps = 35/333 (11%)
 Frame = +2

Query  95   LIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKCD  268
            L   ++LQ AFGP+  AFDP GGGPYTGV DGRILK+   + +++DFA TS    KE C 
Sbjct  46   LARPIQLQAAFGPESLAFDPSGGGPYTGVADGRILKWDPDSNSWLDFAFTSSSSRKE-CT  104

Query  269  GTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFA  448
                  L  +CGRPLGL F +++GDLYIAD +FGL RVG  GGLA  +A    G    F 
Sbjct  105  RAFAPELEHVCGRPLGLRFEQKSGDLYIADAYFGLQRVGPEGGLASNVATQAEGVPLYFT  164

Query  449  DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
            + + +D+     YF ++   F    F     SGD +GR +KY   T +VT +L GLA   
Sbjct  165  NDMDIDEENDIIYFTDTSTKFRRRHFMPSILSGDQTGRFIKYNKLTKEVTVLLRGLAFAN  224

Query  629  GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
            G A+S+D +F+ +      +I++++++GP A   ET +  L G P+ ++R +   G FWV
Sbjct  225  GVALSKDRSFVLVAETSTCRILRYWLQGPNAGQVETFVV-LPGFPDNIRRNS--KGEFWV  281

Query  809  PVNTPREQQPS---------------PMTD-------------SIAVKFDRNGKILET-R  901
             ++  + +                  P++              +IAVK +  GK +E   
Sbjct  282  ALHAKKTRLADWLLKNSWVGNVLLKLPLSSAQRLHALFMGGHHAIAVKLNEEGKTVEVLE  341

Query  902  NLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
            +      +      E  GK + GS+    V VY
Sbjct  342  DAQGKQVRYASEVEERNGKLWIGSVMMPSVWVY  374



>ref|XP_006390477.1| hypothetical protein EUTSA_v10018854mg [Eutrema salsugineum]
 dbj|BAJ34366.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27763.1| hypothetical protein EUTSA_v10018854mg [Eutrema salsugineum]
Length=328

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 163/303 (54%), Gaps = 8/303 (3%)
 Frame = +2

Query  104   KLKL-QNAFGPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTN  277
             KL L +N  GP+  AFD  G G YT V  G+ILK++    +VDFA  +       CDG  
Sbjct  30    KLPLPENRSGPEAFAFDSTGKGFYTSVSGGKILKYTPETGYVDFAQITESSNSSWCDGVL  89

Query  278   GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
             GT L   CGRP G+ FN +TGDLY+AD   GL  V  NGGLA ++A  ++GK F F D +
Sbjct  90    GTALAGRCGRPAGIAFNEKTGDLYVADAPLGLHVVSPNGGLAVKIADSVDGKPFKFLDGL  149

Query  458   SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
              +D  TG  YF      F            D +G+L KY+ +T  VT ++ GL+G  G A
Sbjct  150   DVDPTTGVVYFTSFSSRFTPLQVVIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCA  209

Query  638   ISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVN  817
             +S D +F+ ++ F    I +++I+GPKA ++E    N   NP+ ++R  S +G FWV   
Sbjct  210   VSSDGSFVLVSQFTKSNIKRYWIKGPKAGSSED-FTNSVSNPDNIRRIGS-TGNFWVASV  267

Query  818   TPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVG  994
               +   P   T+  AVK + +G++L+T  L   +   LL    E+ G  Y G+L   F G
Sbjct  268   VNKIVVP---TNPSAVKVNSDGEVLQTIPLKDQFGDTLLSEVNEFDGSLYIGTLTGPFAG  324

Query  995   VYR  1003
             + +
Sbjct  325   ILK  327



>ref|XP_004986991.1| PREDICTED: strictosidine synthase 3-like [Setaria italica]
Length=346

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/310 (37%), Positives = 167/310 (54%), Gaps = 16/310 (5%)
 Frame = +2

Query  107   LKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT-  274
             L L N   G +  AFD RG GPY GV DGR+LK+  S   +  FA +  +R    C  + 
Sbjct  42    LPLPNGVTGAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAYSPNYRKIPLCTASV  101

Query  275   -NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAA-GINGKNFIFA  448
                    SICGRPLGL F  +TGDLYIAD + GL++VG +GG A+ LA    +G  F F 
Sbjct  102   VPSEETESICGRPLGLQFFAKTGDLYIADAYHGLMKVGPDGGEAEVLATQADDGVTFHFV  161

Query  449   DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             + + +DQ TGD YF +S   +       I  + D +GRLLKY+A T QVT +  GL  P 
Sbjct  162   NGLDVDQATGDVYFTDSSTTYPRRFNTEIMMNADATGRLLKYDARTKQVTVLKAGLPYPN  221

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G A+S D T + +   +  +  +++++GPKA   E ++ +L G P+ V+R     GG+WV
Sbjct  222   GVAVSNDRTHVVVAHTVPCQTFRYWLKGPKAGQYE-LMADLPGYPDNVRR--DAKGGYWV  278

Query  809   PVNTPREQ-----QPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGS  973
              +N  + +       +P+   + V+   +G  +E   LT      L    E  G+ + GS
Sbjct  279   ALNQEKARLDVAASAAPVKHLVGVRLSVDG--VEVEELTAAKGVTLSDVAEKDGQLWLGS  336

Query  974   LEADFVGVYR  1003
             +E D+VG+ R
Sbjct  337   VELDYVGLVR  346



>ref|XP_007028511.1| Calcium-dependent phosphotriesterase superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY09013.1| Calcium-dependent phosphotriesterase superfamily protein isoform 
1 [Theobroma cacao]
Length=369

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 169/330 (51%), Gaps = 36/330 (11%)
 Frame = +2

Query  107   LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRTKEKCDGTNG  280
             ++L +AFGP+  AFD  G GPY+GV DGRILK+      + DFA TS  R  E C     
Sbjct  44    IRLDSAFGPESLAFDANGDGPYSGVADGRILKWQGDAVGWTDFAFTSSHR--EDCVRPFA  101

Query  281   TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
               +  ICGRPLGL F+++TGDLYIAD +FGL  VG  GGLA QL     G+   F + + 
Sbjct  102   PEMEHICGRPLGLRFDKKTGDLYIADAYFGLQVVGPAGGLATQLITEAEGQPLYFTNDMD  161

Query  461   LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
             +D+L    YF ++   F    F     + D +GRLLKY  ++ +VT +L GLA   G A+
Sbjct  162   IDELDDVIYFTDTSTSFRRRQFLPSIFTTDKTGRLLKYNKSSKEVTVLLRGLAFANGVAL  221

Query  641   SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
             S+D +F+ +      +I++ ++RGP A   E V   L G P+ ++R  +  G FWV ++ 
Sbjct  222   SKDSSFVLVAETTTCRILRLWLRGPNAGNVE-VFSELPGFPDNIRR--NKKGEFWVALHA  278

Query  821   PREQQPS---------------PMT-------------DSIAVKFDRNGKILETRNLTKD  916
              +                    P++              +IAVK   NG+ILE    T+ 
Sbjct  279   KKGLVAKLALSYSLFGNTVLKLPLSFKQLHSLFIGGKPHAIAVKLSENGEILEVLEDTEG  338

Query  917   YP-KLLGSYFEYFGKAYTGSLEADFVGVYR  1003
                + +    E  GK + GS+   FVG+Y 
Sbjct  339   KTMRFISEVEEKDGKLWIGSVMMPFVGIYH  368



>ref|XP_004970743.1| PREDICTED: strictosidine synthase 3-like [Setaria italica]
Length=342

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 163/299 (55%), Gaps = 14/299 (5%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDG--TNGTNLLS  295
            G +  AFD +G GPY GV DGR+LK+  S   +  FA ++ +R    C           S
Sbjct  47   GAESLAFDGKGEGPYAGVSDGRVLKWGGSAAGWTTFAHSANYRKIPLCTAGVVPSEETES  106

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            +CGRPLGL F+ +TGDLYIAD + GL+RVG  GG A+ LA G +G  F F + + +DQ T
Sbjct  107  MCGRPLGLQFHAKTGDLYIADAYLGLMRVGPGGGEAEVLATGADGAPFNFVNGLDVDQAT  166

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            GD YF +S   +       I  + D +GRLLKY+A +G+VT +  GL  P G A+S D  
Sbjct  167  GDVYFTDSSATYPRRFNTEIMMNADATGRLLKYDARSGRVTVLKAGLPYPNGVAVSPDGA  226

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ-  832
             + +   +  +  ++ +RG KA   E +L  L G P+ V+R     GG+WV +N  +++ 
Sbjct  227  HVVVAHTVPCQAFRYTLRGSKAGQYE-LLAELPGYPDNVRR--DGKGGYWVSLNQEKQRL  283

Query  833  ----QPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
                  +P+   + V+ D +G  +E   LT      L    E  G+ + GS+E ++VG+
Sbjct  284  DAAPGAAPVKHLVGVRLDADG--VEVEELTAAKGVTLSDVAERKGQLWLGSVELEYVGL  340



>ref|XP_006376714.1| hypothetical protein POPTR_0012s04360g, partial [Populus trichocarpa]
 gb|ERP54511.1| hypothetical protein POPTR_0012s04360g, partial [Populus trichocarpa]
Length=303

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 139/230 (60%), Gaps = 12/230 (5%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTNGTNLLSIC  301
            AFGP+  AF+  GG  YTGV DG I K+         I++ +     CDGT   N   IC
Sbjct  62   AFGPESIAFESPGGAFYTGVSDGHIFKY---------ISTTYWVDTFCDGTTDPNKGPIC  112

Query  302  GRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGD  481
            GRP GL +N  T  LYIAD ++GLL   SNG LAKQ+A    G+ F+F +++ +D +TG+
Sbjct  113  GRPFGLAYNSFTRLLYIADAYYGLLVADSNGRLAKQIATSAEGQPFVFHNAIDIDPVTGN  172

Query  482  AYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFI  661
             YF ++  ++   + ++ AQ  D++ RLLKY+  T QVT +L  L+  VG A+S D +F+
Sbjct  173  VYFTDASAVYDLRNSSKAAQVNDSTARLLKYDPRTSQVTVLLRNLSRAVGLAVSPDGSFL  232

Query  662  FITLFIGRKIIKHYIRGPKAKTTETVLENLG-GNPEFVKRATSLSGGFWV  808
             ++  IG +I ++++ GPKA T E  L N+    P+ +KR  + SGGFW+
Sbjct  233  LVSEAIGNRIRRYWLTGPKANTAEIFLSNINVVRPQNIKR--TPSGGFWI  280



>ref|XP_007156378.1| hypothetical protein PHAVU_003G281200g [Phaseolus vulgaris]
 gb|ESW28372.1| hypothetical protein PHAVU_003G281200g [Phaseolus vulgaris]
Length=344

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 161/273 (59%), Gaps = 19/273 (7%)
 Frame = +2

Query  119  NAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNGTNLL  292
            + FG +  AFD  G GPY GV DGRILK+  +N +++DFA+TSP R K+ CDG    ++ 
Sbjct  39   SVFGSESAAFDCHGKGPYVGVSDGRILKWHPTNKHWIDFAVTSPHRDKKVCDGLTDESME  98

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
            S+CGRPLGL FN  T DLYIAD +FGLL VG  GG+AKQLA    G  F F +++ +   
Sbjct  99   SMCGRPLGLKFNNVTCDLYIADAYFGLLVVGPGGGVAKQLATSAEGVPFRFTNALDIHPQ  158

Query  473  TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
            TG+ YF +S  +F    +  I  SGD +GRLLKY  ++ +V  ++ GLA P G A+S+D+
Sbjct  159  TGEVYFTDSSILFQRRVYLSIILSGDRTGRLLKYVPSSQRVYVMVKGLAFPNGVALSKDN  218

Query  653  TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR--  826
            +F+ +      K++K  +RG   + T      +  +P+ +K  ++  G FWV +N+ R  
Sbjct  219  SFLLLAESTTFKVLKVSLRG---RNTIQTFAEVPRSPDNIK--SNSKGEFWVALNSGRGR  273

Query  827  ----------EQQPSPMTDSIAVKFDRNGKILE  895
                      E      TD +A+KFD  GK++E
Sbjct  274  INGFEKEREVETTVPWTTDPVAIKFDSEGKVVE  306



>gb|EAZ01725.1| hypothetical protein OsI_23751 [Oryza sativa Indica Group]
Length=350

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 169/299 (57%), Gaps = 12/299 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAIT--SPFRTKEKCDGTN--GTNLLS  295
             GP+  AFD +G GPY+GV DGRI+++ NG    ++    SP  TK KC  +        S
Sbjct  57    GPESVAFDGKGRGPYSGVSDGRIMRW-NGEAAGWSTYTYSPSYTKNKCAASTLPTVQTES  115

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
              CGRPLGL F+ +TG+LYIAD + GL+RVG  GG A  LA   +G    F + V +DQ+T
Sbjct  116   KCGRPLGLRFHYKTGNLYIADAYMGLMRVGPKGGEATVLATKADGVPLRFTNGVDIDQVT  175

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             GD YF +S   +  +   ++  + D++GRL+KY+  T QVT + + +  P G AIS D T
Sbjct  176   GDVYFTDSSMNYQRSQHEQVTATKDSTGRLMKYDPRTNQVTVLQSNITYPNGVAISADRT  235

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
              + + L    K+++H+IRGPK   +E    +L G P+ V+      GG+W+ ++  + + 
Sbjct  236   HLIVALTGPCKLMRHWIRGPKTGKSEP-FADLPGYPDNVR--PDGKGGYWIALHREKYEL  292

Query  836   P-SPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
             P  P +  +A++    GK+++     K   P  +    +  GK Y G++E  +VGV ++
Sbjct  293   PFGPDSHLVAMRVSAGGKLVQQMRGPKSLRPTEVMDRKD--GKIYMGNVELPYVGVVKS  349



>gb|ACU19372.1| unknown [Glycine max]
Length=336

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/335 (35%), Positives = 177/335 (53%), Gaps = 19/335 (6%)
 Frame = +2

Query  41   MLMFISSLCMIH---SHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFS  208
            M++ IS+  MI    S     LI +L L +   GP+  AFD  GGGPY GV DGRILK++
Sbjct  1    MMIAISATFMIFFLCSPSVAILITRLPLPSPVTGPESVAFDRNGGGPYVGVSDGRILKYA  60

Query  209  NGN--FVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLR  379
                 F ++A TSP R K  CDG  + + L + CGRPLGL FN +T +LY+AD + GL++
Sbjct  61   GPTEGFKEYAFTSPNRNKTICDGLADFSELQATCGRPLGLRFNHQTNELYVADAYSGLIK  120

Query  380  VGSNGGLAKQLAAGINGKN------FIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQ  541
            +G NGG   Q    I  +         F D + +D  +G  YF ++   +   D   +  
Sbjct  121  IGPNGGAPTQCFKDIQPQQENVNTTLGFLDGLDVDVNSGVVYFTQASANYRFKDAQALQS  180

Query  542  SGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKA  721
            S D SG L   +  T Q   ++ GLA   G A+S D +F+ ++ ++  +I + ++RGP+A
Sbjct  181  SRDQSGSLFSLDPKTNQTRVLMRGLALASGVAVSRDGSFVLVSEYLANRIQRFWLRGPRA  240

Query  722  KTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSI--AVKFDRNGKILE  895
             + E  L+ L G P+ ++  ++  G FWV VN      P P    +   ++   NG IL+
Sbjct  241  NSFELFLQ-LTGRPDNIR--SNPRGQFWVAVNGALGPNPPPRPTILPGGLRISENGVILQ  297

Query  896  TRNLTKDYPKLLGS-YFEYFGKAYTGSLEADFVGV  997
              +L K++     S   E+ G  Y+GSL A +V +
Sbjct  298  ILSLVKEFGSEAASEVHEHNGTLYSGSLRASYVPI  332



>ref|NP_177540.3| strictosidine synthase 3 [Arabidopsis thaliana]
 sp|P92976.2|SSL11_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 11; Short=AtSSL11; 
AltName: Full=Strictosidine synthase 12; Short=AtSS12; 
AltName: Full=Strictosidine synthase 3; Short=SS-3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52519.1|AC016662_13 putative strictosidine synthase; 41777-43912 [Arabidopsis thaliana]
 dbj|BAF02041.1| strictosidine synthase AtSS-3 [Arabidopsis thaliana]
 gb|AEE35536.1| strictosidine synthase 3 [Arabidopsis thaliana]
Length=329

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 158/297 (53%), Gaps = 7/297 (2%)
 Frame = +2

Query  119   NAFGPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLS  295
             N  GP+  AFD  G G YTGV  G+ILK+     +VDFA  +       CDG  GT  + 
Sbjct  37    NRTGPEAFAFDSTGKGFYTGVTGGKILKYLPKKGYVDFAQITNSSKSSLCDGALGTTNVE  96

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
              CGRP G+ FN +TGDLY+AD   GL  +   GGLAK++A  + GK F+F D + +D  T
Sbjct  97    KCGRPAGIAFNTKTGDLYVADAALGLHVIPRRGGLAKKIADSVGGKPFLFLDGLDVDPTT  156

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             G  YF      F   D  +   + D++G+  KY+ +   VT ++ GL+G  G A+S D +
Sbjct  157   GVVYFTSFSSTFGPRDVLKAVATKDSTGKFFKYDPSKKVVTVLMEGLSGSAGCAVSSDGS  216

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
             F+ +  F    I +++I+G KA T+E    ++  NP+ +KR  S +G FWV         
Sbjct  217   FVLVGQFTKSNIKRYWIKGSKAGTSEDFTNSV-SNPDNIKRIGS-TGNFWVASVVNSATG  274

Query  836   PSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             P   T+  AVK    GK+L+T  L   +   L+    EY G+ Y G+L   F G+ +
Sbjct  275   P---TNPSAVKVSSAGKVLQTIPLKDKFGDTLVSEVNEYKGQLYIGALFGPFAGILK  328



>ref|XP_009128020.1| PREDICTED: strictosidine synthase 1 isoform X1 [Brassica rapa]
Length=328

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/298 (37%), Positives = 160/298 (54%), Gaps = 7/298 (2%)
 Frame = +2

Query  116   QNAFGPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGTNLL  292
             +N  GP+  AFD  G G YTGV  G+ILK++    +VDFA  +       CDG  GT L 
Sbjct  35    ENRSGPEAFAFDSTGKGFYTGVSGGKILKYTPETGYVDFAQITESSNSSWCDGVVGTALA  94

Query  293   SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
               CGRP G+ FN +TG+LY+AD   GL  V   GGLA ++A  ++GK F F D + +D  
Sbjct  95    GRCGRPAGIAFNEKTGELYVADAPLGLHVVSPAGGLAVKIADSVDGKPFKFLDGLDVDPT  154

Query  473   TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
             TG  YF      +            D +G+L KY+ +T  VT ++ GL+G  G A+S D 
Sbjct  155   TGVVYFTSFSSRYTPIQVLIALGLKDATGKLFKYDPSTKVVTVLMEGLSGSAGCAVSSDG  214

Query  653   TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ  832
             +F+ ++ F    I +++I+GPKA ++E    N   NP+ +KR  S +G FW+     +  
Sbjct  215   SFVLVSQFTKSNIKRYWIKGPKAGSSED-FTNSVSNPDNIKRIGS-TGNFWIASVVNKIV  272

Query  833   QPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              P   T+  AVK + NG++L+T  L   +   LL    E+ G  Y G+L   F GV +
Sbjct  273   VP---TNPSAVKVNSNGEVLQTIPLKDQFGDTLLSEVNEFDGSLYIGTLTGPFAGVLK  327



>ref|XP_004974468.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=341

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/311 (37%), Positives = 171/311 (55%), Gaps = 17/311 (5%)
 Frame = +2

Query  104   KLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAI--TSPFRTKEKCDGT  274
             +L+L +   GP+  AFD RG GPY  V DGRILK++ G  V FA    SP   K  CD  
Sbjct  37    RLELPDGLIGPESVAFDRRGAGPYVSVSDGRILKYA-GKSVGFATFAYSPSYIKNGCDAP  95

Query  275   N----GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFI  442
             +         S CGRPLGL F+  +G+LYIAD + GL+RVG NGG A  LA    G    
Sbjct  96    SSELPAVARESSCGRPLGLRFHNNSGNLYIADAYMGLMRVGPNGGEATVLATEAGGAPLR  155

Query  443   FADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAG  622
             F + V +DQ+TGD YF +S   +       +  SGD++GR+++Y   T +VT + +G+  
Sbjct  156   FTNGVDVDQVTGDVYFTDSSTTYTRAQHQMVTTSGDSTGRIMRYNQRTNKVTVLQSGVTY  215

Query  623   PVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGF  802
             P G AIS D + + + L    K+++++IRGPKA T+E +  +L G P+ V+      GG+
Sbjct  216   PNGIAISADRSHLIVALTGPCKLMRYWIRGPKAGTSE-LFTDLPGYPDNVR--PDGKGGY  272

Query  803   WVPVNTPREQQPSPM-TDS--IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGS  973
             WV ++  RE+   P   DS  +A++    G+ L+     KD  +         GK Y GS
Sbjct  273   WVALH--REKYELPFGKDSHLVAIRIGSEGEKLQEMRGPKDV-RPTEVVEREDGKIYLGS  329

Query  974   LEADFVGVYRA  1006
             +E  +V + ++
Sbjct  330   VELSYVSMVKS  340



>emb|CBI24410.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 176/319 (55%), Gaps = 18/319 (6%)
 Frame = +2

Query  86    ERDLIAKLK---LQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTK  256
             +R+L+ K +   L    GP+  AFDP G GPYTGV DGRIL ++   + DFA TSP R+ 
Sbjct  13    DRNLLQKAEIKFLNQVQGPESVAFDPLGRGPYTGVADGRILFWNGEAWSDFAYTSPNRS-  71

Query  257   EKCDGTNGT----NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGI  424
             E CD             ICGRPLGL FN+RTGDLYIAD + GL++VG  GGLA  L    
Sbjct  72    ELCDPKPSPLSYLKNEHICGRPLGLRFNKRTGDLYIADSYLGLMKVGPEGGLATSLVTEA  131

Query  425   NGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEV  604
             +G    F + + +D   G+ YF +S   +   +F ++  S + SGRLLKY+  T + T +
Sbjct  132   DGVPLRFTNDLDIDD-AGNIYFTDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVL  190

Query  605   LTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRAT  784
             L GL  P G ++S+D +F+ +      +++K++++G KA T+E V   L G P+ V+  T
Sbjct  191   LRGLQFPNGVSLSKDGSFLVLCEGSPGRLVKYWLKGDKAGTSE-VFAILPGYPDNVR--T  247

Query  785   SLSGGFWVPVNTPREQQPSPM-----TDSIAVKFDRNGKILETRNLTK-DYPKLLGSYFE  946
             +  G FWV ++  R      +       ++ VK+   GK+++    ++    + +    E
Sbjct  248   NEKGEFWVAIHCRRTMYQYLLHIGGRLHAVVVKYSPEGKLVKILEDSEGKVVRAVSEVEE  307

Query  947   YFGKAYTGSLEADFVGVYR  1003
               GK + GS+   FV VY+
Sbjct  308   REGKLWMGSVLMPFVAVYQ  326



>gb|EAZ01726.1| hypothetical protein OsI_23752 [Oryza sativa Indica Group]
Length=350

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/298 (36%), Positives = 168/298 (56%), Gaps = 10/298 (3%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAIT--SPFRTKEKCDGTN--GTNLLS  295
             GP+  AFD +G GPY+GV DGRI+++ NG    ++    SP  TK KC  +        S
Sbjct  57    GPESVAFDGKGRGPYSGVSDGRIMRW-NGEAAGWSTYTYSPSYTKNKCAASTLPTVQTES  115

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
              CGRPLGL F+ +TG+LYIAD + GL+RVG  GG A  LA   +G    F + V +DQ+T
Sbjct  116   KCGRPLGLRFHYKTGNLYIADAYMGLMRVGPKGGEATVLAMKADGVPLRFTNGVDIDQVT  175

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             GD YF +S   +  +   ++  + D++GRL+KY+  T QVT + + +  P G A+S D T
Sbjct  176   GDVYFTDSSMNYQRSQHEQVTATKDSTGRLMKYDPRTNQVTVLQSNITYPNGVAMSADRT  235

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
              + + L    K+++H+IRGPK   +E  ++ L G P+ V+      GG+W+ ++  + + 
Sbjct  236   HLIVALTGPCKLMRHWIRGPKTGKSEPFVD-LPGYPDNVR--PDGKGGYWIALHREKYEL  292

Query  836   P-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
             P  P +  +A++    GK+++     K   +         GK Y G++E  +VGV ++
Sbjct  293   PFGPDSHLVAMRVSAGGKLVQQMRGPKSL-RPTEVMERKDGKIYMGNVELPYVGVVKS  349



>ref|XP_010425613.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=340

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 171/309 (55%), Gaps = 13/309 (4%)
 Frame = +2

Query  89   RDLIAKLKLQNAFG---PKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRT  253
            RD+ +  K+ N  G   P+  AFDP G GPY GV DGR+LK+      + DFA T+  R 
Sbjct  38   RDVFSLAKVVNLVGTSGPESIAFDPAGEGPYVGVADGRVLKWRGKLLGWTDFAYTTANR-  96

Query  254  KEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGK  433
             + C       L  +CGRPLGL F+++TGDLYIAD +FGLL VG  GGLAK L     G+
Sbjct  97   -QICVLPFAPELEHVCGRPLGLRFHKKTGDLYIADAYFGLLIVGPAGGLAKPLVTEAEGQ  155

Query  434  NFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTG  613
             F F + + +D+     YF ++   F   ++ R   + D +GR +KY+ ++ + T +L G
Sbjct  156  PFRFTNDLDIDEQNDVVYFTDASSKFQRWEYFRSFLNVDKTGRFIKYDRSSKKATVLLHG  215

Query  614  LAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLS  793
            ++   G A+S+D +F+ +      KI++ ++ GPKA T + V   L G P+ ++R +   
Sbjct  216  ISFANGVALSKDWSFVLVAETTNCKILRLWLSGPKAGTQD-VFVVLPGYPDNIRRNS--K  272

Query  794  GGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGS  973
            G FWV +N+   ++   +  + AVK   +GK+LE      +  + +    E  GK + GS
Sbjct  273  GEFWVALNSLINEE---IRYTKAVKLSESGKVLEVLGDKANRLQFISDVEEKDGKLWIGS  329

Query  974  LEADFVGVY  1000
              A FVGVY
Sbjct  330  SVAPFVGVY  338



>ref|XP_002308895.2| hypothetical protein POPTR_0006s03930g [Populus trichocarpa]
 gb|EEE92418.2| hypothetical protein POPTR_0006s03930g [Populus trichocarpa]
Length=387

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 168/334 (50%), Gaps = 38/334 (11%)
 Frame = +2

Query  98    IAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN---FVDFAITSPFRTKEKCD  268
             + K+ +  AFGP+  AFD  G GPY  + DGRI+K+  GN   + DFA+ SP R    C 
Sbjct  59    LKKVPIVGAFGPESFAFDSLGKGPYASLSDGRIVKW-QGNRKGWTDFAVASPNRYA--CK  115

Query  269   GTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFA  448
                  +   ICGRPLGL F+   GDLYIAD + GLLRVG+ GGLA ++     G    F 
Sbjct  116   QQPFAHTEHICGRPLGLCFDETHGDLYIADAYMGLLRVGTQGGLATKIVTHAQGIPLRFT  175

Query  449   DSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPV  628
             + + +DQ +G  YF +S   +    +  +  SGD SGRL+KY+    QV  +L+ L  P 
Sbjct  176   NGLDIDQSSGAIYFTDSSSQYQRRQYLSVVLSGDKSGRLMKYDPVNKQVRVLLSNLTFPN  235

Query  629   GNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWV  808
             G A+S+D  FI +      +I++++I+  KA T E V   L G P+ +KR  S  GG+WV
Sbjct  236   GVALSKDGNFILLAETTRCRILRYWIKTSKAGTVE-VFAQLQGFPDNIKR--SPRGGYWV  292

Query  809   PVNTPREQQPS---------------PMT-------------DSIAVKFDRNGKILET-R  901
              +N+ RE+                  P+                +AV+   NG ILE   
Sbjct  293   GMNSRREKLSELLFSYPWIGNVLLKLPLDIAMLQSTLSKYRGSGLAVRLSENGDILEVFE  352

Query  902   NLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             +   D  K +    E  G+ + GS+   F G YR
Sbjct  353   DNDGDGLKSISEVMEKDGRLWIGSIALPFAGRYR  386



>dbj|BAD35676.1| putative strictosidine synthase precursor [Oryza sativa Japonica 
Group]
 gb|EAZ37683.1| hypothetical protein OsJ_22021 [Oryza sativa Japonica Group]
 dbj|BAN15820.1| hypothetical protein [Oryza sativa Japonica Group]
Length=350

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 106/298 (36%), Positives = 168/298 (56%), Gaps = 10/298 (3%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAIT--SPFRTKEKCDGTN--GTNLLS  295
             GP+  AFD +G GPY+GV DGRI+++ NG    ++    SP  TK KC  +        S
Sbjct  57    GPESVAFDGKGRGPYSGVSDGRIMRW-NGEAAGWSTYTYSPSYTKNKCAASTLPTVQTES  115

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
              CGRPLGL F+ +TG+LYIAD + GL+RVG  GG A  LA   +G    F + V +DQ+T
Sbjct  116   KCGRPLGLRFHYKTGNLYIADAYMGLMRVGPKGGEATVLAMKADGVPLRFTNGVDIDQVT  175

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             GD YF +S   +  +   ++  + D++GRL+KY+  T QVT + + +  P G A+S D T
Sbjct  176   GDVYFTDSSMNYQRSQHEQVTATKDSTGRLMKYDPRTNQVTVLQSNITYPNGVAMSADRT  235

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
              + + L    K+++H+IRGPK   +E  ++ L G P+ V+      GG+W+ ++  + + 
Sbjct  236   HLIVALTGPCKLMRHWIRGPKTGKSEPFVD-LPGYPDNVR--PDGKGGYWIALHREKYEL  292

Query  836   P-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
             P  P +  +A++    GK+++     K   +         GK Y G++E  +VGV ++
Sbjct  293   PFGPDSHLVAMRVSAGGKLVQQMRGPKSL-RPTEVMERKDGKIYMGNVELPYVGVVKS  349



>ref|XP_010672984.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/336 (33%), Positives = 170/336 (51%), Gaps = 37/336 (11%)
 Frame = +2

Query  92    DLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKC  265
             +L+  L +  AFGP+  AFD  G GPY G+ DGRI+K+      +VDFA TSP R  E C
Sbjct  41    ELLEVLPIDGAFGPESLAFDAAGDGPYAGISDGRIIKWLPHQRRWVDFAFTSPLR--EVC  98

Query  266   DG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFI  442
             +  +N   +   CGRPLGL FN +TG+LYIAD + GLL VG NGGLA+ +A  + G    
Sbjct  99    EKQSNHEQMEHKCGRPLGLSFNDKTGELYIADAYLGLLVVGPNGGLARSVATEVEGIPLG  158

Query  443   FADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAG  622
             F + + +DQ +GD YF  S   +    +  +  S D +GRLLKY+  T QVT++L  L  
Sbjct  159   FTNGLDIDQQSGDVYFTSSSTRYPRRSYMSLILSNDKTGRLLKYDPETKQVTKLLDNLTF  218

Query  623   PVGNAISEDHTFIFITLFIGRKIIKHYIRG-PKAKTTETVLENLGGNPEFVKRATSLSGG  799
             P G ++S++  F+ +      +I++++++  PK+ T E VL  L G P+ +K  +   G 
Sbjct  219   PNGVSLSKNRKFLLLIETTSCQILRYWLKNTPKSGTVE-VLAELPGYPDNIKMNS--KGQ  275

Query  800   FWVPVNTPREQQPSPMTD----------------------------SIAVKFDRNGKILE  895
             +WV + + R +    +                               +AVK D N  +L+
Sbjct  276   YWVGIYSKRGKVLKWLLSYHWVGNTIVKLPFNAVELVKLFVRLRAIGLAVKLDENCNVLQ  335

Query  896   TRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
                      K +    E  G  + GS+   F  +Y+
Sbjct  336   MLEDKSGMLKFVSEVVEKDGNLWFGSVVLPFASLYK  371



>gb|EMT28724.1| putative Strictosidine synthase [Aegilops tauschii]
Length=340

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 166/305 (54%), Gaps = 22/305 (7%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKC-------DGTNG  280
             G +  AFD  G GPYTGV D R+LK+  S   + DF   + +R    C       + T G
Sbjct  44    GAERLAFDALGQGPYTGVSDRRVLKWDGSAVGWTDFDHHANYRKLPMCTVAMAPSEETEG  103

Query  281   TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
                  +CGRPLGL F+  +GDLY+AD + GL+RVG +GG A+ LA   +G  F F + + 
Sbjct  104   -----LCGRPLGLAFHLESGDLYMADAYNGLMRVGPDGGEAEVLATAADGVQFNFVNGLD  158

Query  461   LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
             +DQ+TGD YF +S   +       I  + D +GRLLKY+A T QVT +  GL  P G A+
Sbjct  159   IDQVTGDVYFTDSSVTYPRRFNTEIMMNADATGRLLKYDARTKQVTVLKYGLPYPNGVAV  218

Query  641   SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
             S D   I +   +  +  ++Y++GPKA   E +L +L G P+ V+R    +GG+WV +N 
Sbjct  219   SHDRMHIVVAHTLPCQAYRYYLQGPKAGHYE-LLADLPGYPDNVRRDE--NGGYWVALNQ  275

Query  821   PREQQPS---PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFV  991
              R +  +   P+   + V+ D NG  +E  N  K     L    E  GK + GS+E D++
Sbjct  276   ERGRPGATTRPVRHLVGVRLDGNGVEVEELNAAKGV--TLSEVAERKGKLWLGSIELDYI  333

Query  992   GVYRA  1006
             G+  A
Sbjct  334   GLLVA  338



>ref|XP_010430839.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=315

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/309 (36%), Positives = 170/309 (55%), Gaps = 13/309 (4%)
 Frame = +2

Query  89   RDLIAKLKLQNAFG---PKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRT  253
            RD+ +  K+ N  G   P+  AFDP G GPY GV DGR+LK+      + DFA T     
Sbjct  13   RDVFSLAKVVNLVGTSGPESIAFDPAGEGPYVGVADGRVLKWRGKLLGWTDFAYT--MAN  70

Query  254  KEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGK  433
            ++ C       L  +CGRPLGL F+++TGDLYIAD +FGLL VG  GGLAK L     G+
Sbjct  71   RQICVLPFAPELEHVCGRPLGLRFHKKTGDLYIADAYFGLLIVGPAGGLAKPLVTEAEGQ  130

Query  434  NFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTG  613
             F F + + +D+     YF ++   F   ++ R   + D +GR +KY+ ++ + T +L G
Sbjct  131  PFRFTNDLDIDEENDVVYFTDASSKFQRWEYFRSFLNVDKTGRFIKYDRSSKKATVLLHG  190

Query  614  LAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLS  793
            ++   G A+S+D +F+ +      KI++ ++ GPKA  T+ V   L G P+ ++R +   
Sbjct  191  ISFANGVALSKDRSFVLVAETTNCKILRLWLSGPKA-GTQDVFVVLPGYPDNIRRNS--K  247

Query  794  GGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGS  973
            G FWV +N+   ++   +  + AVK   +GK+LE      +  + +    E  GK + GS
Sbjct  248  GEFWVALNSLINEE---IRYTKAVKLSESGKVLEALGDKANRLQFISDVEEKDGKIWIGS  304

Query  974  LEADFVGVY  1000
              A FVGVY
Sbjct  305  SVAPFVGVY  313



>ref|XP_002888958.1| hypothetical protein ARALYDRAFT_476542 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65217.1| hypothetical protein ARALYDRAFT_476542 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 158/294 (54%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK+     +VDFA  +       CDG  GT L   CG
Sbjct  38    GPEAFAFDSTGKGFYTGVSGGKILKYLPETGYVDFAQITESSNSSWCDGNIGTALAGRCG  97

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN +TGDLY+AD   GL  +   GGLA ++A  ++GK F F D + +D  TG  
Sbjct  98    RPAGIAFNEKTGDLYVADAPLGLHVISPAGGLATKIADSVDGKPFKFLDGLDVDPTTGVV  157

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F            D +G+L KY+ +T  VT ++ GL+G  G A+S D +F+ 
Sbjct  158   YFTSFSSRFTPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVL  217

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ F    I +++I+GPKA ++E    ++  NP+ +KR  S +G FWV     +   P  
Sbjct  218   VSQFTKSNIKRYWIKGPKAGSSEDFTNSV-SNPDNIKRIGS-TGNFWVASVVNKIIVP--  273

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              T+  AVK + NG++L+T  L   +   LL    E+ G  Y G+L   F G+ +
Sbjct  274   -TNPSAVKVNSNGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGILK  326



>ref|XP_003564761.1| PREDICTED: strictosidine synthase 3-like [Brachypodium distachyon]
Length=341

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 162/296 (55%), Gaps = 11/296 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT--NGTNLLS  295
            G +  AFD  G GPYTGV DGR+LK+  S   +  FA  + +R    C  +        S
Sbjct  49   GAESLAFDANGAGPYTGVSDGRVLKWGGSAAGWTTFAHNANYRKLPLCVWSVVPSEETES  108

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            +CGRPLGL F++ +G+LYIAD + GL++VG +GG A+ LA G +G  F F + + +DQ T
Sbjct  109  LCGRPLGLAFHKSSGNLYIADAYKGLMKVGPDGGEAEVLATGADGTAFNFVNGIDVDQST  168

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            GD YF +S   +       I  + D +GRLLKY+A T QV  +  GLA P G A+S D +
Sbjct  169  GDVYFTDSSLTYPRRFNIEIMMNADATGRLLKYDAKTKQVMVLKDGLAYPNGVAVSHDMS  228

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ-  832
            ++ +   +  +  K+Y++GP A   E +  +L G P+ V+R      G+WV +N  +   
Sbjct  229  YVVVAHTVPCQAFKYYLKGPNAGRYE-LFADLPGYPDNVRR--DGHNGYWVALNQEKAHP  285

Query  833  -QPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
               +P+   + V+ + +G  +E   LT      L    E   K + GS+E D+VG+
Sbjct  286  NATAPVKHLVGVRLNADG--VEVEELTAAKGVTLSEVQEQDSKLWLGSVELDYVGI  339



>gb|AAB40593.1| strictosidine synthase [Arabidopsis thaliana]
 gb|AAB40594.1| strictosidine synthase [Arabidopsis thaliana]
Length=335

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 158/294 (54%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK+     +VDFA  +       CDGT GT L   CG
Sbjct  38    GPEAFAFDSTGKGFYTGVSGGKILKYLPETGYVDFAQITESSNSSWCDGTIGTALAGRCG  97

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN +TGDLY+AD   GL  +   GGLA ++   ++GK F F D + +D  TG  
Sbjct  98    RPAGIAFNEKTGDLYVADAPLGLHVISPAGGLATKITDSVDGKPFKFLDGLDVDPTTGVV  157

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F            D +G+L KY+ +T  VT ++ GL+G  G A+S D +F+ 
Sbjct  158   YFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVL  217

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ F    I +++I+GPKA ++E    ++  NP+ +KR  S +G FWV     +   P  
Sbjct  218   VSQFTKSNIKRYWIKGPKAGSSEDFTNSV-SNPDNIKRIGS-TGNFWVASVVNKIIVP--  273

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              T+  AVK + NG++L+T  L   +   LL    E+ G  Y G+L   F G+ +
Sbjct  274   -TNPSAVKVNSNGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGILK  326



>ref|XP_004974461.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=341

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 166/299 (56%), Gaps = 15/299 (5%)
 Frame = +2

Query  125  FGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTN---GTNL  289
             GP+  AFD RG GPY  + DGRILK++  +  F  FA  SP   K  CD  +       
Sbjct  46   IGPESVAFDRRGAGPYVSISDGRILKYAGKSVGFTTFAY-SPSYIKNNCDAPSELPSVAT  104

Query  290  LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
             S CGRPLGL F++ +GDLYIAD + GL+RVG NGG A  LA    G    F + V +DQ
Sbjct  105  ESSCGRPLGLRFHKNSGDLYIADAYMGLMRVGPNGGEATVLATEAGGVPLRFTNGVDVDQ  164

Query  470  LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
            +TGD YF +S   +       +  SGD++GR+++Y   T +VT + +G+  P G AIS D
Sbjct  165  VTGDVYFTDSSTTYSRAQHQMVTASGDSTGRIMRYNRRTNKVTVLQSGVTYPNGIAISAD  224

Query  650  HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE  829
             + + + L    K+++++IRGP+A T+E +  +L G P+ V+      GG+WV ++  RE
Sbjct  225  RSHLIVALTGPCKLMRYWIRGPEAGTSE-LFADLPGYPDNVR--PDGKGGYWVALH--RE  279

Query  830  QQPSPM-TDS--IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
            +   P   DS  +A++    G+ L+     KD  +   +     GK Y GS+E  +V +
Sbjct  280  KYELPFGKDSHLVAIRIGAEGEKLQEMRGPKDV-RPTEAVERGDGKIYLGSVELPYVSI  337



>ref|NP_177542.1| strictosidine synthase 2 [Arabidopsis thaliana]
 sp|P94111.2|SSL12_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 12; Short=AtSSL12; 
AltName: Full=Strictosidine synthase 1; Short=SS-1; 
AltName: Full=Strictosidine synthase 13; Short=AtSS13; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52513.1|AC016662_7 putative strictosidine synthase; 35901-37889 [Arabidopsis thaliana]
 gb|AAK59475.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AAL34150.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AEE35538.1| strictosidine synthase 2 [Arabidopsis thaliana]
Length=335

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 157/294 (53%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK+     +VDFA  +       CDGT GT L   CG
Sbjct  38    GPEAFAFDSTGKGFYTGVSGGKILKYLPETGYVDFAQITESSNSSWCDGTIGTALAGRCG  97

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN +TGDLY+AD   GL  +   GGLA ++   ++GK F F D + +D  TG  
Sbjct  98    RPAGIAFNEKTGDLYVADAPLGLHVISPAGGLATKITDSVDGKPFKFLDGLDVDPTTGVV  157

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F            D +G+L KY+ +T  VT ++ GL+G  G A+S D +F+ 
Sbjct  158   YFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVL  217

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ F    I +++I+GPKA ++E    N   NP+ +KR  S +G FWV     +   P  
Sbjct  218   VSQFTKSNIKRYWIKGPKAGSSED-FTNSVSNPDNIKRIGS-TGNFWVASVVNKIIVP--  273

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              T+  AVK + NG++L+T  L   +   LL    E+ G  Y G+L   F G+ +
Sbjct  274   -TNPSAVKVNSNGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGILK  326



>ref|XP_008465977.1| PREDICTED: strictosidine synthase 1-like [Cucumis melo]
Length=371

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 114/309 (37%), Positives = 164/309 (53%), Gaps = 32/309 (10%)
 Frame = +2

Query  38   SMLMFISSLCMIHSHPERDLIAKLKLQNA-FGPKDTAFDPRGGGPYTGVRDGRILKFSNG  214
            S+L  ++ LCM+        +  ++L    FGP+  AFD RG GPY  V DGRILK+   
Sbjct  29   SLLGAVAVLCMVGVV--EGAVEAVELPGGVFGPESIAFDCRGEGPYASVSDGRILKWKGP  86

Query  215  N--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGS  388
            +  +  FA+TSP R  ++CDG   +   + CGRPLG+ F+  T DLYIAD +FGLL VG 
Sbjct  87   DLGWTQFALTSPNREGKECDGQPQSE--AACGRPLGIKFHPTTCDLYIADAYFGLLAVGP  144

Query  389  NGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLL  568
             GGLA+QLA    G    F +++ +D   G  YF +S  +F    +     +GD +GRLL
Sbjct  145  KGGLARQLATSAQGVPLRFTNALDIDPQNGVVYFTDSSILFQRRVWLLSIMNGDKTGRLL  204

Query  569  KYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLEN  748
            KY+  T  VT +  GLA P G A++ D +F+ +      +I+K +++GPKA T E +   
Sbjct  205  KYDPRTQNVTVLRNGLAFPNGVALNADSSFLLMAETGTLQILKFWLKGPKANTME-IFAQ  263

Query  749  LGGNPEFVKRATSLSGGFWVPVNTPRE-----------------QQ-----PSPMTDSIA  862
            L   P+ +KR    +G FW+ +NT R                  QQ     P    D +A
Sbjct  264  LERFPDNIKRTD--NGDFWIAMNTARGKLDTQTWKEMYMRGAKLQQGEVKIPWIQADPVA  321

Query  863  VKFDRNGKI  889
            VK D  G++
Sbjct  322  VKLDERGEV  330



>gb|EEC84480.1| hypothetical protein OsI_31139 [Oryza sativa Indica Group]
Length=340

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 143/240 (60%), Gaps = 9/240 (4%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFS----NGNFVDFAITSPFRT-KEKCDGTNGTN  286
            AFGP+  AFD RGGGPYTGV +GR+L++        + +FA      T  E         
Sbjct  33   AFGPESLAFDHRGGGPYTGVSNGRVLRWRADRRRPGWTEFAHNYKHATVAECAARKKAAA  92

Query  287  LLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLD  466
              S+CGRPLG+ F+RRTG++YIAD + GL+RVG  GG+A+ +AA   G    F + V +D
Sbjct  93   AESVCGRPLGVQFDRRTGEMYIADAYLGLMRVGRRGGMAEVVAAEAGGVALNFVNGVDVD  152

Query  467  QLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISE  646
            Q TGD YF +S   +  +D+  +  SGD +GRLL+YE  TG VT + +GLA P G A+S 
Sbjct  153  QATGDVYFTDSSTTYKRSDYLLVVLSGDATGRLLRYEPRTGNVTVLESGLAFPNGVAVSA  212

Query  647  DHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSG---GFWVPVN  817
            D T + +      ++++H++RG  A  TE VL +L G P+ V+ A +  G    +WV +N
Sbjct  213  DGTHLVVAETASCRLLRHWLRGSNAGATE-VLADLPGYPDNVRPAAADGGRGASYWVALN  271



>gb|AFK33536.1| unknown [Medicago truncatula]
Length=310

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 151/266 (57%), Gaps = 19/266 (7%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNG  280
            L +  A GP+   FD  GGGPYTGV DGRILK+      + +FA+TS  R++  C     
Sbjct  40   LHVTRAIGPESLVFDSHGGGPYTGVADGRILKWKGKKRGWTEFAVTSSNRSQ--CVRPFA  97

Query  281  TNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVS  460
              L  ICGRPLGL F+++ GDLYIAD + GL  VG+ GGLA Q+A    G  F F + + 
Sbjct  98   PKLEHICGRPLGLRFDKKNGDLYIADAYLGLKVVGAAGGLATQVATEAEGHPFHFTNDLD  157

Query  461  LDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAI  640
            +D+  G  YF +S  ++    +  +  SGD +GRL+KY+ +T +V  +L GLA P G A+
Sbjct  158  IDENEGVIYFTDSSTVYERTQYTLLLVSGDKTGRLMKYDKSTKEVKVLLRGLAFPNGVAL  217

Query  641  SEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNT  820
            S+D +F+ +      +I++ ++ GPKA    T + +L G P+ ++R +   G FWV +  
Sbjct  218  SKDGSFLLVAETSNCRILRLWLHGPKAGKVSTFV-DLPGFPDNIRRNS--YGQFWVALY-  273

Query  821  PREQQPSPMTDSIAVKFDRNGKILET  898
                       S AVK    G+ILET
Sbjct  274  -----------SSAVKLSDEGEILET  288



>ref|XP_004967164.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=342

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 12/305 (4%)
 Frame = +2

Query  104  KLKL-QNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT  274
            +L+L  +  GP+  AFD  G GPY  + DGR+LK+      +  FA  SP  TK  CD  
Sbjct  40   RLQLPDDLIGPESVAFDAHGAGPYVSISDGRVLKYDGEGAGWKTFAY-SPSYTKNNCDDF  98

Query  275  NGTNLL---SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
            +    +   S CGRPLGL F+  +G+LYIAD + GL+RVG NGG A  LA    G    F
Sbjct  99   SELPAVAKESSCGRPLGLRFHNNSGNLYIADAYMGLMRVGPNGGEATVLATEAGGAPLRF  158

Query  446  ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
             + V +DQ+TGD YF +S + +       +  SGD++GR++KY+  T +VT + +G+  P
Sbjct  159  TNGVDIDQVTGDVYFTDSSKTYTRAQHQMVTTSGDSTGRIMKYDPRTNKVTVLQSGVTYP  218

Query  626  VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
             G AIS D T + + L    K+++++IRGPKA T+E    +L G P+ V+      GG+W
Sbjct  219  NGIAISADRTHLVVALTGPCKLMRYWIRGPKANTSEP-FADLPGYPDNVR--PDGKGGYW  275

Query  806  VPVNTPREQQPSPMTDS-IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEA  982
            V ++  + + P  M    +A++   +G+ L+     K+  +         GK Y GS+E 
Sbjct  276  VALHREKYELPFGMDRHLLAIRIGADGEKLQEMKGPKNV-RPTEVVERDGGKLYLGSVEL  334

Query  983  DFVGV  997
             +VG+
Sbjct  335  SYVGI  339



>ref|XP_007202861.1| hypothetical protein PRUPE_ppa015510mg, partial [Prunus persica]
 gb|EMJ04060.1| hypothetical protein PRUPE_ppa015510mg, partial [Prunus persica]
Length=334

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/241 (40%), Positives = 151/241 (63%), Gaps = 8/241 (3%)
 Frame = +2

Query  113  LQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRTKEKCDGTNGTN  286
            +++A GP+   FDP GGGPYTG+ DGRI+K+     ++++FA+TSP R  + C+G++  +
Sbjct  10   VEDAVGPESFVFDPLGGGPYTGISDGRIVKWDQDKHHWINFAVTSPNR--DGCEGSHEHD  67

Query  287  LLS-ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
                ICGRPLGL FN  +GDLY+AD + GLL VG  GGLA ++    +G  F F +++ +
Sbjct  68   KTEHICGRPLGLCFNETSGDLYVADAYMGLLIVGPQGGLATEVVTRAHGIPFGFTNALDI  127

Query  464  DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
            DQ  G  YF +S   +   ++  +  SGD +GRL+KY+  + QV  +L  L+ P G A+S
Sbjct  128  DQEPGAVYFTDSSSQYQRRNYISVILSGDKTGRLMKYDPESKQVQVLLGNLSFPNGVALS  187

Query  644  EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTP  823
            ++  FI +      +I++++++ PKA T + V   L G P+ +KR  S  GGFWV +++ 
Sbjct  188  KNGDFILLAETTHCRIMRYWLKTPKAGTFQ-VFAQLPGFPDNIKR--SPRGGFWVGIHSR  244

Query  824  R  826
            R
Sbjct  245  R  245



>ref|XP_011035620.1| PREDICTED: strictosidine synthase 3-like [Populus euphratica]
Length=299

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/301 (37%), Positives = 171/301 (57%), Gaps = 7/301 (2%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN-FVDFAITSPFRTKEKCDGTNGT  283
            + L+ +FGP+  AF+  GG  YTGV DG +L++     +  FA TSP R+   C+GT   
Sbjct  1    MALRPSFGPESLAFETPGGAFYTGVNDGLVLRYQPPTGWTTFAFTSPNRSIALCNGTTDP  60

Query  284  NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
            +   ICGRPLGL ++  T  LYIAD ++GLL   SNG LA Q+A    G+ F+  +++ +
Sbjct  61   DKGPICGRPLGLAYSPFTKLLYIADAYYGLLVADSNGRLATQIATSAEGQPFVVCNALDI  120

Query  464  DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
            D  TG+ YF ++  ++   + ++   + D++GRLLKY+  T QVT +L  L+  VG A+S
Sbjct  121  DPFTGNIYFTDASAVYDLRNSSKALLANDSTGRLLKYDVRTNQVTVLLRNLSVAVGVAVS  180

Query  644  EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLG-GNPEFVKRATSLSGGFWVPVNT  820
            +D  F+ ++ F+G +I ++++ G  A T++  L NL    P  +KR TSL G F +   T
Sbjct  181  KDGGFVLVSEFVGNRIRRYWLTGRNAGTSDIFLSNLNILRPNNIKR-TSL-GDFLIAAAT  238

Query  821  PREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKA-YTGSLEADFVGV  997
             R  Q S     + V+ +  G+I  T +L   Y   L S  +  G + Y  S   +FVGV
Sbjct  239  VR--QDSQTLVPVRVRVNELGRISATVSLEAQYGSTLISEAQQSGLSLYVSSRGVNFVGV  296

Query  998  Y  1000
            Y
Sbjct  297  Y  297



>ref|XP_004971567.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=341

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 167/305 (55%), Gaps = 12/305 (4%)
 Frame = +2

Query  104  KLKL-QNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT  274
            +L+L  +  GP+  AFD  G GPY  + DGR+LK+      +  FA  SP  TK KCD  
Sbjct  39   RLQLPDDLIGPESVAFDAHGSGPYVSISDGRVLKYDGEGAGWKTFAY-SPSYTKNKCDEF  97

Query  275  N---GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
            +        S CGRPLGL F+  +G+LYIAD + GL+RVG NGG A  LA    G    F
Sbjct  98   SELPAVATESSCGRPLGLRFHNNSGNLYIADAYMGLMRVGPNGGEATVLATEAGGAPLRF  157

Query  446  ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
             + V +DQ+TGD YF +S + +       +  SGD++GR++KY+  T QVT + +G+  P
Sbjct  158  TNGVDIDQVTGDVYFTDSSKTYTRAQHQMVTTSGDSTGRIMKYDPQTNQVTVLQSGVTYP  217

Query  626  VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
             G AIS D T + I L    K+++++IRGPK  T+E    +L G P+ V+       G+W
Sbjct  218  NGIAISADRTHLIIALTGPCKLMRYWIRGPKTNTSEP-FADLPGYPDNVR--PDGKEGYW  274

Query  806  VPVNTPREQQPSPM-TDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEA  982
            V ++  + + P  + T  +AV+    G+ L+     K+  +         GK Y GS+E 
Sbjct  275  VALHREKFELPFGLDTHLLAVRIGAEGEKLQEMKGPKNV-RPTEVVERDGGKIYLGSVEL  333

Query  983  DFVGV  997
             +VG+
Sbjct  334  SYVGI  338



>ref|XP_010108510.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC19610.1| Strictosidine synthase 1 [Morus notabilis]
Length=386

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 149/245 (61%), Gaps = 8/245 (3%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNG  280
            L +  A GP+  AFD  G GPYTGV DGRI+K+      ++DFA+TSP R+   C+G++ 
Sbjct  56   LPIVGALGPESYAFDSLGDGPYTGVSDGRIIKWQEDQRRWIDFAVTSPNRSS--CEGSHD  113

Query  281  TNLLS-ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
             +L   ICGRPLGL F++ +GDLYIAD + GLL VG+ GGLA ++     G  F F + +
Sbjct  114  HHLTEHICGRPLGLSFHKTSGDLYIADAYMGLLVVGAEGGLATRVVTQAQGVPFAFPNGL  173

Query  458  SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
             ++   G  YF +S   +   ++  +  SGDT+GRL+ Y+  + QV  +L  L+ P G A
Sbjct  174  DINDENGLVYFTDSSSRYQRRNYLSVILSGDTTGRLMSYDPQSKQVDVLLENLSFPNGVA  233

Query  638  ISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVN  817
            +S++  F+ I      +I+++++R PKA T E V   L G P+ +K   S  GGFWV ++
Sbjct  234  LSQNGDFLLIAETTSCRIMRYWLRTPKAGTFE-VFSQLPGFPDNIK--GSPRGGFWVAIH  290

Query  818  TPREQ  832
            + R++
Sbjct  291  SERKK  295



>ref|XP_008655533.1| PREDICTED: strictosidine synthase 3-like [Zea mays]
 tpg|DAA45310.1| TPA: hypothetical protein ZEAMMB73_945680 [Zea mays]
Length=338

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 160/298 (54%), Gaps = 12/298 (4%)
 Frame = +2

Query  125  FGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT--NGTNLL  292
             G +  AFD RG GPY GV DGR+LK+  S   +  FA ++ +R    C  +        
Sbjct  45   IGAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAHSANYRKIPLCTASVVPSEQTE  104

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
            S+CGRPLGL F   TGDLYIAD + GL++VG NGG A+ LA       F F + + +DQ 
Sbjct  105  SMCGRPLGLQFFAMTGDLYIADAYMGLMKVGPNGGEAQVLATQAGDAPFHFVNGLDVDQA  164

Query  473  TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
            TGD YF +S  I+       I  + D +GRLLKY+A T +VT +   L  P G A+S D 
Sbjct  165  TGDVYFTDSSAIYPRRFNTEIMMNADATGRLLKYDARTKRVTVLKADLPYPNGVAVSNDR  224

Query  653  TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR--  826
            T + +   +  +  +++++GPKA   E +L +L G P+ V+R     GG+WV +N  +  
Sbjct  225  THVVVAHTVPCQAFRYWLKGPKAGQYE-LLADLPGYPDNVRR--DARGGYWVALNQEKAR  281

Query  827  -EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
             +    P    + V+   +G ++E   LT      L    E  G+ + GS+E D+VG+
Sbjct  282  LDATAPPAKHLVGVRLAVDGAVVE--ELTAAKGVTLSDVAEKDGQLWLGSIELDYVGL  337



>emb|CDP09527.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 173/338 (51%), Gaps = 39/338 (12%)
 Frame = +2

Query  89   RDLIAK---LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRT  253
            RDL+ K   + L  A GP+  AFDP G GPYTGV DGRILK+      +VDFA+TS  R 
Sbjct  39   RDLLHKADTVNLTGAVGPESLAFDPNGEGPYTGVADGRILKWQGHQLGWVDFAVTSSQR-  97

Query  254  KEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGK  433
             + C      ++  ICGRPLGL F+R+ GDLYIAD + GL  VG  GGLA  L   + G 
Sbjct  98   -KDCFHPFAPHMEHICGRPLGLRFDRKNGDLYIADAYLGLQVVGPTGGLATPLVTEVEGA  156

Query  434  NFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTG  613
               F + + +D+     YF +S  +FL   F     S D +GRL+KY+ ++ +V+ +L G
Sbjct  157  VLRFTNDMDIDEHEDTIYFTDSSTVFLRRQFISSVLSADRTGRLMKYDKSSKEVSILLRG  216

Query  614  LAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLS  793
            LA   G ++S+D +F+ +      +I++ ++RGP A   +T  E L G P+ ++R +   
Sbjct  217  LAFANGVSLSKDQSFVLVAESTTCRIVRFWLRGPNAGKHDTFTE-LPGFPDNIRRNS--K  273

Query  794  GGFWVPVNTP---------------REQQPSPMT-------------DSIAVKFDRNGKI  889
            G FWV ++                 +     P++              + A+K    G++
Sbjct  274  GEFWVALHAKTGLLIKWVIANSWSGKTLLKLPLSFKQLHHFLVGGQAHATAIKLSEEGEV  333

Query  890  LET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
            L+   +L     + +    E  GK + GS+   F+G+Y
Sbjct  334  LDVLEDLDGKTLRFISEVEERNGKLWIGSVLMPFIGIY  371



>tpg|DAA61232.1| TPA: strictosidine synthase 3 [Zea mays]
Length=343

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 153/260 (59%), Gaps = 6/260 (2%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRTKEKCDGTNGTNL-LSI  298
            GP+  AFD RGGGPY+GV DGR+L++      + +FA  S  R+   C       +  S+
Sbjct  50   GPESLAFDGRGGGPYSGVSDGRVLRWQGPLRGWTEFAYNSKHRSVALCAPDKKLVVPESL  109

Query  299  CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTG  478
            CGRPLGL F+R++GDLY+AD + GLLRV + GGLA+ +A    G  F F + + +DQ TG
Sbjct  110  CGRPLGLQFHRQSGDLYVADAYLGLLRVAARGGLAQVVATEAAGGPFNFLNGLDVDQRTG  169

Query  479  DAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTF  658
            D YF +S   +  +D+  +   GD +GRLL+YE  TG+V  +  GL+ P G A+S D T 
Sbjct  170  DVYFTDSSATYRRSDYLLVVAMGDETGRLLRYERRTGRVGVLQAGLSYPNGVAVSADGTH  229

Query  659  IFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQP  838
            + +      ++ +++IRG +A T++T  E L G P+ ++      GG+WV +++      
Sbjct  230  VVVAHTALCELRRYWIRGARAGTSDTFAE-LPGYPDNLR--ADGRGGYWVALSSGVAADE  286

Query  839  SPMTDSIAVKFDRNGKILET  898
            +    ++AV+  R+G + E 
Sbjct  287  AAAAPTVAVRVSRDGNVTEA  306



>emb|CDX95058.1| BnaC05g06130D [Brassica napus]
Length=374

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 123/334 (37%), Positives = 184/334 (55%), Gaps = 26/334 (8%)
 Frame = +2

Query  53   ISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDF  229
            +SSL     H      +++K  N   GP+  AFDP G GPYTGV DGRIL +    + DF
Sbjct  46   LSSLPKERDHENLLQNSEIKFLNEVQGPESIAFDPLGRGPYTGVADGRILFWDGTRWTDF  105

Query  230  AITSPFRTKEKCDGTNGTNLLS------ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSN  391
            A TS  R+ E CD    ++LL+      ICGRPLGL F++RTGDLY+AD +FG+++VG  
Sbjct  106  AYTSNNRS-ELCD--TKSSLLAYLKNEHICGRPLGLRFHKRTGDLYVADAYFGIMKVGPE  162

Query  392  GGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLK  571
            GGLA  L    +G    F + + +D   G+ YF +S  +F   +F  +  SG+ +GR+LK
Sbjct  163  GGLATSLTTEGDGVPLRFTNDLDVDD-EGNVYFTDSSSVFQRRNFMHLIVSGEDTGRVLK  221

Query  572  YEAATGQVTEVLTGLAGPVGNAISEDHT-FIFITLFIGRKIIKHYIRGPKAKTTETVLEN  748
            Y   T + T +L  L  P G ++ +D + FIF    IGR + K++++G KA T+E V+  
Sbjct  222  YNPETKETTTLLRNLQFPNGLSLGKDGSFFIFCEGSIGR-LRKYWLKGEKAGTSE-VVAL  279

Query  749  LGGNPEFVKRATSLSGGFWVPVNTPRE-------QQPSP--MTDSIAVKFDRNGKILET-  898
            L G P+ ++  T+  G FWV V+  R          P+      ++AVK+ ++GK+L+  
Sbjct  280  LHGFPDNIR--TNKDGDFWVAVHCHRNIFTHVMAHHPNVGGWPHAVAVKYSKDGKVLKVL  337

Query  899  RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
             +      K +    E  GK + GS+   F+ VY
Sbjct  338  EDKQGKVVKAVSEIEEKDGKLWMGSVLMSFIAVY  371



>emb|CDM84363.1| unnamed protein product [Triticum aestivum]
Length=317

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/308 (36%), Positives = 172/308 (56%), Gaps = 13/308 (4%)
 Frame = +2

Query  98   IAKLKLQNAF--GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITS--PFRTKEKC  265
            I +L L +    GP+  AFD +G GPY+GV DGRIL++ +G+   +   +  P   ++ C
Sbjct  11   IQQLPLADGLLQGPESVAFDAQGHGPYSGVSDGRILRW-DGDKTGWTTYAYGPGYDEDMC  69

Query  266  DGT---NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKN  436
              +     T++ S CGRPLGL F+ ++GDLY+AD + GL+RVG  GG A  L   ++ K 
Sbjct  70   TASIFRPATSMESQCGRPLGLQFHHKSGDLYVADAYRGLMRVGPGGGEATVLVNAVDDKP  129

Query  437  FIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGL  616
              F + + +DQ+TG  YF +S   +       + +SGD++GRL++Y+  TG V  + T L
Sbjct  130  LRFTNGIDVDQVTGQVYFTDSSMNYDRTRHEMVTRSGDSTGRLMRYDPRTGDVAVLQTRL  189

Query  617  AGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSG  796
            A   G AIS D T + +      K+I+H+I G KA T+E    +L G P+ V+      G
Sbjct  190  AYANGVAISTDRTHLIVASTGPCKLIRHWIEGAKAGTSEP-FTDLPGYPDNVR--PDRRG  246

Query  797  GFWVPVNTPREQQPS-PMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGS  973
            G+WV ++  + + PS P +  +AV+   +GKILE    +K   K         GK Y GS
Sbjct  247  GYWVALHGEKNELPSRPNSHLLAVRVGADGKILEEMRGSKRV-KPAEVVERDNGKLYIGS  305

Query  974  LEADFVGV  997
            ++  +VGV
Sbjct  306  IDLPYVGV  313



>ref|XP_008244844.1| PREDICTED: strictosidine synthase 1 [Prunus mume]
Length=389

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 156/263 (59%), Gaps = 14/263 (5%)
 Frame = +2

Query  71   IHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSP  244
            + +H E        ++ A GP+  AFDP GGGPYTGV DGRI+K+     ++++FA+TSP
Sbjct  41   LSNHEESKFEVVPIVEGAVGPESFAFDPLGGGPYTGVSDGRIVKWDQDKHHWINFAVTSP  100

Query  245  --------FRTKEKCDGTNGTNLLS-ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGG  397
                      ++  C+G++  +    ICGRPLGL FN+ +GDLYIAD + GLL VG  GG
Sbjct  101  NSASLCNPIPSRGGCEGSHEHDKTEHICGRPLGLCFNQTSGDLYIADAYMGLLIVGPQGG  160

Query  398  LAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYE  577
            LA ++    +G  F F +++ +DQ  G  YF +S   +   ++  +  SGD +GRL+KY+
Sbjct  161  LATEVVTRAHGIPFGFTNALDIDQELGAVYFTDSSSQYQRRNYISVILSGDKTGRLMKYD  220

Query  578  AATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGG  757
              + QV  +L  L+ P G A+S++  FI +      +I++++++ PKA T + V   L G
Sbjct  221  PESKQVQVLLENLSFPNGVALSKNGDFILLVETTHCRIMRYWLKTPKAGTFQ-VFAQLPG  279

Query  758  NPEFVKRATSLSGGFWVPVNTPR  826
             P+ +KR  S  GGFWV +++ R
Sbjct  280  FPDNIKR--SPRGGFWVGIHSRR  300



>ref|XP_007146688.1| hypothetical protein PHAVU_006G061000g, partial [Phaseolus vulgaris]
 gb|ESW18682.1| hypothetical protein PHAVU_006G061000g, partial [Phaseolus vulgaris]
Length=346

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/336 (34%), Positives = 180/336 (54%), Gaps = 18/336 (5%)
 Frame = +2

Query  35   VSMLMFISSLCM---IHSHPERDLIAKLKLQN-AFGPKDTAFDPRGGGPYTGVRDGRILK  202
            ++ML+  S++ M   + S     L+ +L L +   GP    FD  GGGPY GV DGRILK
Sbjct  10   ITMLITFSAIFMTFLLCSPSVAILLTRLPLPSPTTGPDSLEFDRNGGGPYVGVSDGRILK  69

Query  203  FSN-GNFVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLL  376
            +     F ++  TSP R K  C+G  + + L S CGRPLGL FN +T +LY+AD +FGL+
Sbjct  70   YVGPKGFEEYGYTSPNRNKTLCNGLADFSELQSECGRPLGLRFNHQTNELYVADAYFGLV  129

Query  377  RVGSNGGL------AKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIA  538
            ++G NGG       A Q     +     F D + +D  TG  YF ++   F   D   + 
Sbjct  130  KIGPNGGAPIQSFKALQPQEHSDNSTLEFLDGIDIDVDTGIVYFTQASTNFHFKDGQALE  189

Query  539  QSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPK  718
             S D SG L   +  T +   ++ GLA   G A+S D +F+ ++ ++G +I + +++GP+
Sbjct  190  NSRDKSGSLFSLDPKTNETRVLMRGLALASGVAVSRDGSFVLVSEYLGNRIQRFWVKGPR  249

Query  719  AKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS--PMTDSIAVKFDRNGKIL  892
            A ++E  ++ L G P+ ++R +   G FWV VN    + P   P      V+   NG +L
Sbjct  250  ANSSEIFMQ-LTGRPDNIRRNS--RGQFWVAVNGVLGRNPPSRPTILPGGVRIGVNGVVL  306

Query  893  ETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGV  997
            + R+L +++  + +    E+ G  Y+GSL A +V +
Sbjct  307  QIRSLGREFGSEGVSEVHEHNGTLYSGSLRASYVSI  342



>ref|XP_004967142.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=342

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 168/305 (55%), Gaps = 12/305 (4%)
 Frame = +2

Query  104  KLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGT  274
            +L+L +   GP+  AFD  G GPY  + DGR+LK+      +  FA  SP  TK KCD  
Sbjct  40   RLQLPDDLVGPESVAFDAHGAGPYVSISDGRVLKYGGEGVGWKTFAY-SPSYTKNKCDEF  98

Query  275  N---GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
            +        S CGRPLGL F+  +G+LYIAD + GL+RVG NGG A  LA    G    F
Sbjct  99   SELPAVATESSCGRPLGLRFHNNSGNLYIADAYMGLMRVGPNGGEATVLATEAGGAPLRF  158

Query  446  ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
             + V +DQ+TGD YF +S + +       +  SGD++GR++KY+  T +VT + +G+  P
Sbjct  159  TNGVDIDQVTGDVYFTDSSKTYTRAQHQMVTTSGDSTGRIMKYDPRTNKVTVLQSGVTYP  218

Query  626  VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
             G AIS D T + + L    K++K++IRG KA T+E    +L G P+ V+      GG+W
Sbjct  219  NGIAISADRTHLVVALTGPCKLMKYWIRGSKANTSEP-FADLPGYPDNVR--PDGKGGYW  275

Query  806  VPVNTPREQQPSPMTDS-IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEA  982
            V ++  + + P  +    +A++   +G+ L+     K+  +         GK Y GS+E 
Sbjct  276  VALHREKYELPFGLDKHLLAIRIGADGEKLQEMKGPKNV-RPTEVVERQDGKIYLGSVEL  334

Query  983  DFVGV  997
             +VG+
Sbjct  335  SYVGI  339



>ref|XP_004237337.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=377

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 147/250 (59%), Gaps = 13/250 (5%)
 Frame = +2

Query  89   RDLIAK-----LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPF  247
            +D+++K     LKL +AFG +   FDP G GPYTGV DGRI+K+   N  +VDFA+TS  
Sbjct  41   QDVLSKAEMIPLKL-DAFGAESVVFDPNGEGPYTGVADGRIIKWLQHNQTWVDFAVTSSQ  99

Query  248  RTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGIN  427
            R  E C   +   +  +CGRPLGL F+ +TGDLYIAD + GL  VG NGGLA  L     
Sbjct  100  R--ENCTRASAPEMEHVCGRPLGLRFDHQTGDLYIADAYLGLQVVGPNGGLATPLVQHFE  157

Query  428  GKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVL  607
             +  +F + + +D      YF +S  I+    F     SGD +GRL+KY+ +T QVT +L
Sbjct  158  DQPLLFTNDLDIDDHDHVIYFTDSSTIYQRRQFVNATASGDKTGRLMKYDKSTKQVTILL  217

Query  608  TGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATS  787
             GL+   G A+S+D TF+ ++     +I +++++GP   T +T  + L G P+ V+  + 
Sbjct  218  QGLSFANGVALSKDRTFVLVSETSACRITRYWLKGPNVGTHDTFAQ-LPGFPDNVRMNS-  275

Query  788  LSGGFWVPVN  817
              G FWV ++
Sbjct  276  -RGEFWVALH  284



>emb|CDM84367.1| unnamed protein product [Triticum aestivum]
Length=565

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/333 (35%), Positives = 182/333 (55%), Gaps = 13/333 (4%)
 Frame = +2

Query  23   TMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAF--GPKDTAFDPRGGGPYTGVRDGRI  196
            T+  V ++M   S  M  +  +   I +L L +    GP+  AFD +G GPY+GV DGRI
Sbjct  8    TIAVVLLVMIFMSGAMAATSLDATRIQQLPLADGLLQGPESVAFDAQGHGPYSGVSDGRI  67

Query  197  LKFSNGNFVDFAITS--PFRTKEKCDGT---NGTNLLSICGRPLGLDFNRRTGDLYIADI  361
            L++ +G+   +   +  P   ++ C  +     T+  S CGRPLGL F+ ++GDLY+AD 
Sbjct  68   LRW-DGDKTGWTTYAYGPGYDEDMCTASIFRPATSTESQCGRPLGLQFHHKSGDLYVADA  126

Query  362  HFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQ  541
            + GL+RVG  GG A  L + ++ K   F + V +DQ+TG  YF +S   +       + +
Sbjct  127  YRGLMRVGPGGGEATVLVSAVDDKPLRFTNGVDVDQVTGQVYFTDSSMNYDRTQHEMVTR  186

Query  542  SGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKA  721
            SGD++GRL++Y+  TG V  + T LA   G AIS D T + +      K+I+H+I G KA
Sbjct  187  SGDSTGRLMRYDPRTGDVAVLQTRLAYANGVAISTDRTHLIVASTGPCKLIRHWIEGAKA  246

Query  722  KTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPS-PMTDSIAVKFDRNGKILET  898
             T+E    +L G P+ V+      GG+WV ++  + + PS P +  +AV+   +GKILE 
Sbjct  247  GTSEP-FTDLPGYPDNVR--PDRRGGYWVALHGEKNELPSRPNSHLLAVRVGADGKILEE  303

Query  899  RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
               +K   K         GK Y GS++  +VGV
Sbjct  304  MRGSKRV-KPAEVVERDNGKLYIGSIDLPYVGV  335



>ref|XP_003580953.1| PREDICTED: strictosidine synthase 1-like [Brachypodium distachyon]
Length=345

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 166/297 (56%), Gaps = 13/297 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITS--PFRTKEKCDGTN---GTNLL  292
            GP+  AFD  G GPY+GV DGRILK+ NG+ + +   +  P  + E C  +     T   
Sbjct  51   GPESVAFDSEGQGPYSGVSDGRILKW-NGDKIGWTTYAYGPDYSSEACTASKLRPETVTE  109

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
            S CGRPLGL F+ ++G+LYIAD + GL+RVG  GG A  L    +G    F + V +DQ+
Sbjct  110  SHCGRPLGLQFHHKSGNLYIADAYKGLMRVGPTGGEATVLVNQADGAPLRFTNGVDVDQI  169

Query  473  TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
            TG  YF +S   +  +    + ++GD++GRL++Y+  T  VT + +G+  P G +IS D 
Sbjct  170  TGQVYFTDSSMNYQRSQHEMVTRTGDSTGRLMRYDPRTNDVTTLQSGITYPNGVSISHDR  229

Query  653  TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ  832
            T + +      K+++++I+GP A  TE    +L G P+ V++     GG+WV ++  + +
Sbjct  230  THLVVASTGPCKLLRYWIKGPDAGKTEP-FADLPGYPDNVRQ--DRRGGYWVALHREKNE  286

Query  833  QPSPM-TDSIAVKFDRNGKILET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
             P    +  +AV+  RNGK+LE  R      P  +       GK Y GS+E  +VGV
Sbjct  287  LPFEFGSHLLAVRVGRNGKVLEEMRGPKSVRPTEINERGN--GKYYMGSVELPYVGV  341



>ref|XP_002452451.1| hypothetical protein SORBIDRAFT_04g026050 [Sorghum bicolor]
 gb|EES05427.1| hypothetical protein SORBIDRAFT_04g026050 [Sorghum bicolor]
Length=344

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 165/298 (55%), Gaps = 11/298 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITS--PFRTKEKCDGTNGTNLL---  292
             GP+  AFD  G GPY+GV DGR+LK+ NG    ++  +  P      C  +         
Sbjct  51    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYGPGYDAAACTASRARPAELTE  109

Query  293   SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
             S CGRPLGL F+  +G+LYIAD + GL+RVG  GG A  LAA  +G    F + V +DQ+
Sbjct  110   SKCGRPLGLRFHHASGNLYIADAYKGLMRVGPGGGEATVLAAEADGVPLRFTNGVDVDQV  169

Query  473   TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
             TGD +F +S   +  +   R+  +GD+SGR++KY+  TGQV  +L G+  P G AIS D 
Sbjct  170   TGDVFFTDSSMNYPRSQHERVTATGDSSGRIMKYDPKTGQVRVLLAGVTYPNGLAISADR  229

Query  653   TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ  832
             T + + L    K+++++I GPKA T E  L +L G P+ V+      GGFWV ++  + +
Sbjct  230   THLVVALTGPCKLLRYWIEGPKAGTAEH-LADLPGYPDNVR--ADGRGGFWVALHREKME  286

Query  833   QP-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              P  P +  +AV+   +G++++     K   +         GK Y GS+E  +V V R
Sbjct  287   LPFGPDSHLLAVRVGADGQVVQVMRGPKSV-RPTEVVERGGGKLYMGSVELPYVAVVR  343



>ref|XP_004488398.1| PREDICTED: strictosidine synthase 3-like [Cicer arietinum]
Length=340

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 173/310 (56%), Gaps = 12/310 (4%)
 Frame = +2

Query  95   LIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKC  265
            L+ +L L ++  GP+  AFD  GGGPYTGV DGRILK+   N  F++FA  SP R K  C
Sbjct  31   LLNRLYLPSSLTGPESLAFDSIGGGPYTGVSDGRILKYDGPNSCFLEFAHISPDRDKTMC  90

Query  266  DG-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAA-GINGKNF  439
            DG ++ + L   CGRP+GL FN +TG+LYIAD ++GL++V  +GG A QL A    G  F
Sbjct  91   DGISDFSELQETCGRPMGLSFNYKTGELYIADAYYGLVKVPYDGGTATQLVANNEQGNPF  150

Query  440  IFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQ-SGDTSGRLLKYEAATGQVTEVLTGL  616
             F   + +D  TG  YF E+   +   D  ++   + D SGRL +Y+  T + T +L+ L
Sbjct  151  GFLAGLDVDPQTGIVYFTEASSAYKIRDLHKLLNGTQDYSGRLFRYDPTTNETTLLLSDL  210

Query  617  AGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSG  796
            A   G A+S + +F+ ++ ++  +I + +++GP A T++  L  L G P+ +KR +  + 
Sbjct  211  AVAAGVAVSNNGSFVLVSEYMANRIKRFWLKGPNAYTSDIFLR-LPGRPDNIKRNS--AN  267

Query  797  GFWVPVN--TPREQQPSPMTDSIAVKFDRNGKILETRNLTKDYP-KLLGSYFEYFGKAYT  967
             FWV VN        P P    + ++ +  G I++   L +++  + +    E  GK Y 
Sbjct  268  EFWVAVNYPFGSPPPPIPPVLPLGLRVNEQGLIIQAVPLVEEFSTESVSEVQESEGKLYA  327

Query  968  GSLEADFVGV  997
             SL   +  +
Sbjct  328  TSLHESYANI  337



>ref|XP_004955245.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=349

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 171/309 (55%), Gaps = 11/309 (4%)
 Frame = +2

Query  89   RDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAIT--SPFRTKEK  262
            R L   L+     GP+  AFD  G GPY+GV DGR+LK+ NG    ++    SP    + 
Sbjct  43   RSLHLPLRGSLLRGPESVAFDGDGAGPYSGVSDGRVLKW-NGLVRGWSTYAYSPGYDAKA  101

Query  263  CDGTN---GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGK  433
            C  +         S+CGRPLGL F+  +G+LYIAD + GL+RVG  GG AK L    +G 
Sbjct  102  CTASRTRPAEVTESMCGRPLGLRFHYGSGNLYIADAYKGLMRVGPGGGEAKVLVTKADGV  161

Query  434  NFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTG  613
               F + V +DQ+TG+ +F +S   +  +   R+  +GD++GRL+KY+  T  VT + +G
Sbjct  162  PLRFTNGVDIDQVTGEVFFTDSSMNYQRSQHERVTATGDSTGRLMKYDPKTNHVTVLQSG  221

Query  614  LAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLS  793
            +  P G AIS D T + + L    K+++++I+G KA T+E  L +L G P+ V+    + 
Sbjct  222  ITYPNGLAISADRTHLVVALTGPCKLMRYWIKGSKAGTSEP-LADLPGYPDNVR--ADIK  278

Query  794  GGFWVPVNTPREQQP-SPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTG  970
            GGFWV ++  + + P  P +  +AV+ + NGKI++     K   +         GK Y G
Sbjct  279  GGFWVALHREKMELPFGPDSHLLAVRINANGKIVQVMRGPKSV-RPTEVMEREGGKLYMG  337

Query  971  SLEADFVGV  997
            S+E  +V V
Sbjct  338  SVELPYVAV  346



>ref|XP_011027271.1| PREDICTED: strictosidine synthase 3-like isoform X2 [Populus 
euphratica]
Length=373

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/333 (35%), Positives = 169/333 (51%), Gaps = 41/333 (12%)
 Frame = +2

Query  107   LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDG-TN  277
             L+L+ A GP+  AFDP  GGPY G+ DGR++K+      +++F+  S  + ++ C G  +
Sbjct  47    LQLEGAIGPESFAFDPLAGGPYAGISDGRVVKWEERERRWINFSFAS--QERDGCGGPQD  104

Query  278   GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSV  457
                   ICGRPLGL F+   GDLYIAD + GLLRVG+ GGLA ++     G    F + +
Sbjct  105   HQQTEHICGRPLGLCFDETHGDLYIADAYMGLLRVGAQGGLATKIVTHAQGIPLSFTNGL  164

Query  458   SLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNA  637
              +DQ  G  YF +S   +    +  +  SGD SGRL+KY+    QV+ +L+ L  P G A
Sbjct  165   DIDQSNGAIYFTDSSSQYQRRHYLSVVLSGDKSGRLMKYDPVNKQVSVLLSNLTFPNGVA  224

Query  638   ISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVN  817
             +S+D TFI +      +I++++I+  KA T E V   L G P+ +KR  S  GG+WV +N
Sbjct  225   LSKDGTFILLAETTRCRILRYWIKTSKAGTVE-VFAQLQGFPDNIKR--SPRGGYWVGLN  281

Query  818   TPREQQPS---------------PMTDS-------------IAVKFDRNGKILETRNLTK  913
             + RE+                  P+  S             +AV+   NG ILE      
Sbjct  282   SRREKLSELLFSYPWIGNVLLKLPLDISMLESTLSKYRGSGLAVRLSENGDILEV--FED  339

Query  914   DYPKLLGSYFEYFGK---AYTGSLEADFVGVYR  1003
             +    L S  E   K    + GS+   F G YR
Sbjct  340   EDGNRLQSVSEVMEKDEILWIGSIALPFAGRYR  372



>ref|XP_002456721.1| hypothetical protein SORBIDRAFT_03g041380 [Sorghum bicolor]
 gb|EES01841.1| hypothetical protein SORBIDRAFT_03g041380 [Sorghum bicolor]
Length=347

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/302 (37%), Positives = 169/302 (56%), Gaps = 19/302 (6%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNG----TNL  289
            G +  AFD +G GPY GV DGR+LK+  S+  +  +A ++ +R    C  T G    T  
Sbjct  51   GAESLAFDGKGEGPYAGVSDGRVLKWGGSSVGWTTYAHSANYRKIPLC--TAGVLPSTET  108

Query  290  LSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGIN-GKNFIFADSVSLD  466
             S+CGRPLGL F+ +TGDLYIAD + GL+RVG  GG A+ LA G + G  F F + + +D
Sbjct  109  ESLCGRPLGLQFHAKTGDLYIADAYLGLMRVGPGGGEAEVLATGSDDGVPFNFVNGLDVD  168

Query  467  QLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISE  646
            Q TGD YF +S   +       I  + D +GRLL+Y+A TG VT + +GL  P G A+S 
Sbjct  169  QATGDVYFTDSSATYPRRFNTEIMMNADATGRLLRYDARTGGVTVLRSGLPYPNGVAVSR  228

Query  647  DHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR  826
            D   + +   +  +  ++++RG +A   E +L +L G P+ V+R     GG+WV +N  +
Sbjct  229  DGAQVVVAHTVPCQAFRYFLRGARAGQYE-LLADLPGYPDNVRR--DGKGGYWVALNQEK  285

Query  827  EQ-----QPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFV  991
            ++     + +P+   + V+ D  G  +E   LT      L    E  GK + GS+E ++V
Sbjct  286  QRLDATSETAPVKHLVGVRLDAQG--VEVEELTAAKGVTLSDVAERRGKLWLGSVELEYV  343

Query  992  GV  997
            G+
Sbjct  344  GL  345



>ref|XP_011027270.1| PREDICTED: strictosidine synthase 3-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/337 (36%), Positives = 171/337 (51%), Gaps = 43/337 (13%)
 Frame = +2

Query  98    IAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN---FVDFAITSPFRTKEKCD  268
             + ++ +  AFGP+  AFD  G GPYT + DGRI+K+  GN   + DFA+ SP R  + C 
Sbjct  60    LKEVPIVGAFGPESFAFDSLGQGPYTSLSDGRIIKW-QGNRKGWTDFAVASPNR--DGCG  116

Query  269   G-TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
             G  +      ICGRPLGL F+   GDLYIAD + GLLRVG+ GGLA ++     G    F
Sbjct  117   GPQDHQQTEHICGRPLGLCFDETHGDLYIADAYMGLLRVGAQGGLATKIVTHAQGIPLSF  176

Query  446   ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
              + + +DQ  G  YF +S   +    +  +  SGD SGRL+KY+    QV+ +L+ L  P
Sbjct  177   TNGLDIDQSNGAIYFTDSSSQYQRRHYLSVVLSGDKSGRLMKYDPVNKQVSVLLSNLTFP  236

Query  626   VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
              G A+S+D TFI +      +I++++I+  KA T E V   L G P+ +KR  S  GG+W
Sbjct  237   NGVALSKDGTFILLAETTRCRILRYWIKTSKAGTVE-VFAQLQGFPDNIKR--SPRGGYW  293

Query  806   VPVNTPREQQPS---------------PMTDS-------------IAVKFDRNGKILETR  901
             V +N+ RE+                  P+  S             +AV+   NG ILE  
Sbjct  294   VGLNSRREKLSELLFSYPWIGNVLLKLPLDISMLESTLSKYRGSGLAVRLSENGDILEV-  352

Query  902   NLTKDYPKLLGSYFEYFGK---AYTGSLEADFVGVYR  1003
                 +    L S  E   K    + GS+   F G YR
Sbjct  353   -FEDEDGNRLQSVSEVMEKDEILWIGSIALPFAGRYR  388



>ref|XP_004986993.1| PREDICTED: strictosidine synthase 3-like [Setaria italica]
Length=342

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/304 (37%), Positives = 164/304 (54%), Gaps = 12/304 (4%)
 Frame = +2

Query  107  LKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT-  274
            L L N   G +  AFD RG GPY GV DGR+LK+  S   +  FA +  +R    C  + 
Sbjct  42   LPLPNGVTGAESLAFDRRGQGPYAGVSDGRVLKWGGSTLGWTTFAHSPNYRKIPLCTASV  101

Query  275  -NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFAD  451
                   SICGRPLGL F  +TGDLYIAD + GL++VG +GG A+ LA   +G  F F +
Sbjct  102  VPSEETESICGRPLGLQFFAKTGDLYIADAYHGLMKVGPDGGEAEVLATQADGVPFHFVN  161

Query  452  SVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVG  631
             + +DQ TGD YF +S   +       I  + D +GRLLKY+A   QVT +  GL  P G
Sbjct  162  GLDVDQATGDVYFTDSSITYPRRFNTEIMMNADATGRLLKYDARAKQVTVLRAGLPYPNG  221

Query  632  NAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVP  811
             A+S D T + +   +  +  +++++G KA   E ++ +L G P+ V+R     GG+WV 
Sbjct  222  VAVSGDRTHVVVAHTVPCQAFRYWLKGSKAGQYE-LMADLPGYPDNVRR--DAKGGYWVA  278

Query  812  VNTPREQ--QPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEAD  985
            +N  + +    +P+   + V+   +G  +E   LT      L    E  G+ + GS+E D
Sbjct  279  LNQEKARFDAAAPVKHLVGVRLGSDG--VEVEELTAAKGVTLSDVAEKDGQLWLGSVELD  336

Query  986  FVGV  997
            +VG+
Sbjct  337  YVGL  340



>ref|XP_010110078.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25145.1| Strictosidine synthase 1 [Morus notabilis]
Length=332

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 118/332 (36%), Positives = 176/332 (53%), Gaps = 13/332 (4%)
 Frame = +2

Query  26   MFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKF  205
            M ++ + +F S   ++ S P  +         A GP   AFD  G GP+TG+ DGRIL++
Sbjct  1    MLFIIIFLF-SIPSLVFSQPFSNFQRYDLPSTAVGPFSLAFDASGRGPFTGISDGRILRY  59

Query  206  S--NGNFVDFAITSPFRTKEKCDGTNGTNLL---SICGRPLGLDFNRRTGDLYIADIHFG  370
                 +F DFA TSP  +K  CDGT+  +     +ICGRPLG+ F  RT  LY+ D + G
Sbjct  60   DPVQNSFFDFAFTSPTGSKAVCDGTDNNDNPDRGAICGRPLGISFYFRTNQLYVTDAYKG  119

Query  371  LLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGD  550
            L+ V  NG LA+ +A    G  F F   + +DQ+TGD YF +    F  +   +   + D
Sbjct  120  LVVVPPNGRLAENVATSAEGVPFKFPFHLDVDQVTGDVYFTDFSSQFQLSQLLQAIDARD  179

Query  551  TSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTT  730
             +GRLLKY   T + T +L GL G  G A+S D T++ +      ++ K ++ GP A TT
Sbjct  180  ATGRLLKYNPNTRETTVLLRGLTGAAGVALSYDRTYLLVAEMNANRVKKLWLSGPNAFTT  239

Query  731  ETVLENLGGNPEFVKRATSLSGGFWVPVNT--PREQQPSPMTDSIAVKFDR-NGKILETR  901
              ++    G P  +++  SL+  FWV VNT  P     S +    AV+     G IL+T 
Sbjct  240  VDLI-TFQGRPNNIEK-NSLT-DFWVVVNTRIPGTTAGSFIRIPSAVRISGIGGGILQTV  296

Query  902  NLTKDYPKLLGSYFEYFG-KAYTGSLEADFVG  994
            +L++ +P +  S F+ +G   Y GSL  D++G
Sbjct  297  DLSRYFPNMTISEFQPYGLGGYIGSLRTDYLG  328



>ref|XP_009391266.1| PREDICTED: strictosidine synthase 3-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 116/340 (34%), Positives = 182/340 (54%), Gaps = 16/340 (5%)
 Frame = +2

Query  11    MKSLTMFWVSMLMFISSLCMIHSHPER-DLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRD  187
             M+   +F V M +   + C       R + + +L L+   GP+  AFD  G GPYTGV  
Sbjct  1     MRLALLFVVLMAILSCTACYKEIAMNRLEGLERLALRTVVGPESLAFDRHGRGPYTGVSG  60

Query  188   GRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADI  361
             GRIL + +    +  +A+ +  R +E C+G++  ++  +CGRPLGL F+  TG LY+AD 
Sbjct  61    GRILMWQDKGRGWTGYAVNAANRRRE-CEGSD-VSMERVCGRPLGLQFHHATGVLYVADA  118

Query  362   HFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQ  541
             +FGLL VG  GG A+ LAA   G  F F + V +DQ TG  YF +S   +   D+     
Sbjct  119   YFGLLAVGPTGGAAELLAASAEGVPFNFTNGVDVDQKTGVVYFTDSSTQYQRQDYILAVV  178

Query  542   SGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKA  721
             +GD++GRL+KY+  T +VT +  GL  P G A+S D +F+        ++IK+++RGPKA
Sbjct  179   TGDSTGRLMKYDPRTRKVTVLRRGLRFPNGVALSGDGSFLLFAETGTCRVIKYWLRGPKA  238

Query  722   KTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR------EQQPSPMTDSIAVKFDRNG  883
              TTE V   L   P+ ++R  +  G +WV +N  +       +  +     +A++    G
Sbjct  239   ATTE-VFAELPRYPDNIRR--TPGGEYWVALNGEKIDLNGAAKAEAATERPVAMRLSAEG  295

Query  884   KILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             K++E   L  +    +    E  G  + GS+E  +V VY+
Sbjct  296   KLVEA--LDGEELASVSEVAEESGSVWVGSVEMPYVDVYK  333



>ref|NP_001150769.1| strictosidine synthase 3 precursor [Zea mays]
 gb|ACG40318.1| strictosidine synthase 3 precursor [Zea mays]
Length=343

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/260 (37%), Positives = 152/260 (58%), Gaps = 6/260 (2%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNG--NFVDFAITSPFRTKEKCDGTNGTNL-LSI  298
            GP+  AFD RGGGPY+GV DGR+L++      + +FA  S  R+   C       +  S+
Sbjct  50   GPESLAFDGRGGGPYSGVSDGRVLRWQGPLRGWTEFAYNSKHRSVALCAPDKKLVVPESL  109

Query  299  CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTG  478
            CGRPLGL F+R++GDLY+AD + GLLRV + GGLA+ +A    G  F F + + +DQ TG
Sbjct  110  CGRPLGLQFHRQSGDLYVADAYLGLLRVAARGGLAQVVATEAAGGPFNFLNGLDVDQRTG  169

Query  479  DAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTF  658
            D YF +S   +  +D+  +   GD +GRL +YE  TG+V  +  GL+ P G A+S D T 
Sbjct  170  DVYFTDSSATYRRSDYLLVVAMGDETGRLXRYERRTGRVGVLQAGLSYPNGVAVSADGTH  229

Query  659  IFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQP  838
            + +      ++ +++IRG +A T++T  E L G P+ ++      GG+WV +++      
Sbjct  230  VVVAHTALCELRRYWIRGARAGTSDTFAE-LPGYPDNLR--ADGRGGYWVALSSGVAADE  286

Query  839  SPMTDSIAVKFDRNGKILET  898
            +    ++AV+  R+G + E 
Sbjct  287  AAAAPTVAVRVSRDGNVTEA  306



>ref|XP_007045667.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY01499.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=495

 Score =   178 bits (452),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 169/326 (52%), Gaps = 23/326 (7%)
 Frame = +2

Query  83   PERDLIAK----LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSP  244
            PE D + K    + L    GP+  AFD +  GPY GV DGRILK+   N  + +FAI S 
Sbjct  169  PEGDDLHKKYYQIDLPQVTGPESIAFDCKNQGPYVGVSDGRILKWQGPNLGWKEFAIPSS  228

Query  245  FRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGI  424
             R ++ CDG+   +L   CGRPLGL FN  T DL+IAD +FGLL VG +GG+A+QLA   
Sbjct  229  DRDRKLCDGSTNPDLEPTCGRPLGLKFNSATCDLFIADAYFGLLLVGRSGGVAQQLATSA  288

Query  425  NGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEV  604
             G  F F +++ +D  TG  YF +S  IF    +     + D SGRLLKY   T +VT +
Sbjct  289  EGVPFKFTNALDIDTNTGVVYFTDSSIIFQRRHYFLSTITFDRSGRLLKYNFRTKEVTVL  348

Query  605  LTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRAT  784
              GLA P G A+S+D++F+ +      +I+K  +       T      L   P+ +KR  
Sbjct  349  YKGLAFPNGVALSKDNSFLLVAETTKMRILKFNLDSTTDSYTPEQFAQLPKMPDNIKRND  408

Query  785  SLSGGFWVPVNTPR-------EQQPSPMT-------DSIAVKFDRNGKILETRNLTKDYP  922
               G FWV +N+ R       E + S  T       D + VK+D+ GKI++  +      
Sbjct  409  --KGEFWVALNSGRGRIQNEGETKLSSETTIPWFTLDPVGVKYDQEGKIMKQLDGNGGIR  466

Query  923  -KLLGSYFEYFGKAYTGSLEADFVGV  997
               +    E  GK Y GS+   +VGV
Sbjct  467  FDSVSEVEELNGKLYIGSVVKPYVGV  492



>ref|XP_009128022.1| PREDICTED: strictosidine synthase 1 isoform X2 [Brassica rapa]
Length=327

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 110/298 (37%), Positives = 160/298 (54%), Gaps = 8/298 (3%)
 Frame = +2

Query  116   QNAFGPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGTNLL  292
             +N  GP+  AFD  G G YTGV  G+ILK++    +VDFA  +       CDG  GT L 
Sbjct  35    ENRSGPEAFAFDSTGKGFYTGVSGGKILKYTPETGYVDFAQITE-SNSSWCDGVVGTALA  93

Query  293   SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
               CGRP G+ FN +TG+LY+AD   GL  V   GGLA ++A  ++GK F F D + +D  
Sbjct  94    GRCGRPAGIAFNEKTGELYVADAPLGLHVVSPAGGLAVKIADSVDGKPFKFLDGLDVDPT  153

Query  473   TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
             TG  YF      +            D +G+L KY+ +T  VT ++ GL+G  G A+S D 
Sbjct  154   TGVVYFTSFSSRYTPIQVLIALGLKDATGKLFKYDPSTKVVTVLMEGLSGSAGCAVSSDG  213

Query  653   TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ  832
             +F+ ++ F    I +++I+GPKA ++E    N   NP+ +KR  S +G FW+     +  
Sbjct  214   SFVLVSQFTKSNIKRYWIKGPKAGSSED-FTNSVSNPDNIKRIGS-TGNFWIASVVNKIV  271

Query  833   QPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              P   T+  AVK + NG++L+T  L   +   LL    E+ G  Y G+L   F GV +
Sbjct  272   VP---TNPSAVKVNSNGEVLQTIPLKDQFGDTLLSEVNEFDGSLYIGTLTGPFAGVLK  326



>ref|XP_004974462.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=341

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 173/311 (56%), Gaps = 18/311 (6%)
 Frame = +2

Query  104   KLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSN--GNFVDFAITSPFRTKEKCDGT  274
             +L+L +   GP+  AFD  G GPY  + DGR+LK++     +  FA  SP  TK  C  T
Sbjct  38    RLELPDGLIGPESVAFDRHGAGPYVSISDGRVLKYAGEGAGWTTFAY-SPSYTKNDCGVT  96

Query  275   NGTNLL---SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
             +    +   S CGRPLGL F+  +G+LYIAD + GL+RVG NGG A  LA    G    F
Sbjct  97    SELPAVARESSCGRPLGLRFHNNSGNLYIADAYMGLMRVGPNGGEATVLATEAGGAPLRF  156

Query  446   ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
              + V +DQ+TGD YF +S   +       +  SGD++GR+++Y   T +VT + +G+  P
Sbjct  157   TNGVDVDQVTGDVYFTDSSTTYTRAQHQMVTSSGDSTGRIMRYNRRTNKVTVLQSGVTYP  216

Query  626   VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
              G AIS D + + + L    K+++++IRGPKA T+E +  +L G P+ V+      GG+W
Sbjct  217   NGIAISADRSHLIVALTGPCKLMRYWIRGPKAGTSE-LFTDLQGYPDNVR--PDGKGGYW  273

Query  806   VPVNTPREQQPSPM-TDS--IAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGS  973
             V ++  RE+   P   DS  +A++    G+ L+     KD  P  +    +  GK Y GS
Sbjct  274   VALH--REKYELPFGKDSHLVAIRIGSQGEKLQEMTGPKDVRPTEVVERED--GKIYLGS  329

Query  974   LEADFVGVYRA  1006
             +E  +V + ++
Sbjct  330   VELSYVSIVKS  340



>ref|XP_011075408.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 11 [Sesamum indicum]
Length=368

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/328 (32%), Positives = 168/328 (51%), Gaps = 34/328 (10%)
 Frame = +2

Query  104  KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTNGT  283
            ++ L  A GP+   FDP GGGPYTGV DGR+LK++  ++V+FA+TS  R  EKC      
Sbjct  44   RIHLSRAVGPESLVFDPSGGGPYTGVADGRVLKWNGVDWVEFAVTSSQR--EKCSHPFNP  101

Query  284  NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
             +  ICGRPLGL F+ +T DLYIAD + GL  VG  GG+  QL   + G+   F + + +
Sbjct  102  AMEHICGRPLGLRFHPKTEDLYIADAYLGLQVVGPGGGMGSQLVTEVEGQPLRFTNDMDI  161

Query  464  DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
            D+     YF +S  +F   +F     + D +G+L+KY+    +VT +L GLA   G ++S
Sbjct  162  DEEEDVIYFTDSSTVFHRREFMSSVLTMDMTGKLMKYDIPKKEVTVLLRGLAFANGVSLS  221

Query  644  EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTP  823
            +D +F+ +      +I++ +++GP A   + +   L G P+ ++R +   G FWV +++ 
Sbjct  222  KDRSFVLVAETTRCRIVRFWLQGPNAGKHD-IFAELPGFPDNIRRNS--EGEFWVALHSK  278

Query  824  ---------------REQQPSPMT-------------DSIAVKFDRNGKILET-RNLTKD  916
                           R     P+T              + AVK    GKIL+   ++   
Sbjct  279  TGVLTKWATSYSWFGRSLLKLPLTFKQLHYLLVGGKPHATAVKLSNEGKILQVLEDVEGK  338

Query  917  YPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
              K +    E  GK +  S+   ++G+Y
Sbjct  339  TLKFISEVEERHGKLWIASVLMPYIGIY  366



>ref|XP_004305393.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/291 (36%), Positives = 161/291 (55%), Gaps = 18/291 (6%)
 Frame = +2

Query  131  PKDTAFDPRGGGPYTGVRDGRILKFSNGNF--VDFAITSPFRTKEKCDGTNGTNLLSICG  304
            P+  AFD  G  PY GV DGRI K+    F  ++FA+TS  R +E CD +   +   ICG
Sbjct  45   PESIAFDCNGA-PYVGVADGRIFKWLGSPFGWIEFAVTSANRPREVCDLSTSKDNEPICG  103

Query  305  RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
            RPLGL F+  T +LYIAD +FGLL+ G  GG+A+ LA    G  F F + V +D  +G  
Sbjct  104  RPLGLKFDLTTCELYIADAYFGLLKTGPYGGVAQVLATSAEGFPFRFLNGVDIDHQSGMV  163

Query  485  YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
            YF ++  I+   ++     +GD +GRL++Y+ +T +VT +L GLA   G A+S+D  F+ 
Sbjct  164  YFTDTSAIYQRRNWELSVSTGDKTGRLMRYDPSTKKVTVLLHGLAFANGVALSKDSDFVL  223

Query  665  ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
            +T    + +++++++GP+A T +T   NL G P+ +    +++G FWV  N+    +   
Sbjct  224  VTQTTAKNVLRYWLQGPRANTVDTFF-NLRGAPDNIN--ININGEFWVAENSAGRGK---  277

Query  845  MTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
                 AVK D  G  L+      D    +    + +G  + GS+   FVGV
Sbjct  278  -----AVKLDAQGNFLD----VVDGLNPVSHVEQRYGNLWIGSVVNKFVGV  319



>ref|XP_010471492.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=337

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 157/294 (53%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK+     +V+FA  +       CDG  GT L   CG
Sbjct  37    GPEAFAFDSTGKGFYTGVSGGKILKWLPETGYVNFAQITESSNSSWCDGNIGTALAGRCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN  TGDLY+ D   GL  +  NGGLA ++A  ++GK F F D + +D  TG  
Sbjct  97    RPAGIAFNENTGDLYVGDAPLGLHVISPNGGLATKIADSVDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F            D +G+L KY+ +T  VT ++ GL+G  G A+S D +F+ 
Sbjct  157   YFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ F    I +++I+GPKA T+E    ++  NP+ +KR  S +G FWV     +   P  
Sbjct  217   VSQFTKSNIKRYWIKGPKAGTSEDFTNSV-SNPDNIKRVGS-TGNFWVASVVNKFIVP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              T+  AVK + +G++L+T  L   +   LL    E+ G  Y G+L   F G+ +
Sbjct  273   -TNPSAVKVNSDGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGILK  325



>ref|XP_004974464.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=341

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 115/311 (37%), Positives = 170/311 (55%), Gaps = 17/311 (5%)
 Frame = +2

Query  104   KLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAI--TSPFRTKEKCDGT  274
             +L+L +   GP+  AFD RG GPY  V DGRILK++ G  V FA    SP   K  CD  
Sbjct  37    RLELPDGLIGPESVAFDRRGDGPYVSVSDGRILKYA-GKSVGFATFAYSPSYIKNGCDAP  95

Query  275   N----GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFI  442
             +         S CGRPLGL F+  +G+LYIAD + GL+RVG NGG A   A    G    
Sbjct  96    SSELPAVATESSCGRPLGLRFHNNSGNLYIADAYMGLMRVGPNGGEATVDATEAGGAPLR  155

Query  443   FADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAG  622
             F + V +DQ+TGD YF +S   +       +  SGD++GR+++Y   T +VT + +G+  
Sbjct  156   FTNGVDVDQVTGDVYFTDSSTTYTRAQHQMVTASGDSTGRIMRYNRRTNKVTVLQSGVTY  215

Query  623   PVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGF  802
             P G AIS D + + + L    K+++++IRGPKA T+E +  +L G P+ V+      GG+
Sbjct  216   PNGIAISADRSHLIVALTGPCKLMRYWIRGPKAGTSE-LFTDLPGYPDNVR--PDGKGGY  272

Query  803   WVPVNTPREQQPSPM-TDS--IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGS  973
             WV ++  RE+   P   DS  +A++    G+ L+     KD  +         GK Y GS
Sbjct  273   WVALH--REKYELPFGKDSHLVAIRIGSEGEKLQEMRGPKDV-RPTEVVEREDGKIYLGS  329

Query  974   LEADFVGVYRA  1006
             +E  +V + ++
Sbjct  330   VELSYVSMVKS  340



>ref|XP_011075619.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 11 [Sesamum indicum]
Length=331

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 143/238 (60%), Gaps = 8/238 (3%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGTNG-TNLL  292
            A GP+  +FD  G GPYTGV DGRI+++  +   +VDFA+TSP R  + C+G +  +   
Sbjct  48   AIGPESFSFDGNGDGPYTGVSDGRIIRWRANESQWVDFAVTSPMR--DGCEGPHDHSQKE  105

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
             ICGRPLGL FN +TGDLYI D + GLL VG NGGLA  LA  ++G  F F +S+ +D  
Sbjct  106  HICGRPLGLRFNEKTGDLYITDAYMGLLVVGPNGGLASPLAQQLDGLAFGFTNSLDIDHN  165

Query  473  TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
            TG  YF +S   F   ++  +  SGD +GRL+K++  T + T +L  L  P G A+S++ 
Sbjct  166  TGVVYFTDSSTRFPRRNYVSVIISGDDTGRLMKFDPRTKKTTLLLNNLKFPNGVALSKNG  225

Query  653  TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR  826
             F+        ++ K +++ PKA   E VL  L G P+ VKR +   G FWV +N+ R
Sbjct  226  DFLLFVETTTCRLFKFWLKPPKAGNVE-VLAQLPGFPDNVKRNS--IGEFWVGINSKR  280



>ref|XP_004967140.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=342

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 167/305 (55%), Gaps = 12/305 (4%)
 Frame = +2

Query  104  KLKL-QNAFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT  274
            +L+L  +  GP+  AFD  G GPY  + DGR+LK+      +  FA  SP   K KCD  
Sbjct  40   RLQLPDDLIGPESVAFDAHGAGPYVSISDGRVLKYDGEGAGWKTFAY-SPSYAKNKCDDF  98

Query  275  N---GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIF  445
            +        S CGRPLGL F+  +G+LYIAD + GL+RVG NGG A  LA    G    F
Sbjct  99   SELPAVATESSCGRPLGLRFHNNSGNLYIADAYMGLMRVGPNGGEATVLATEAGGAPLRF  158

Query  446  ADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGP  625
             + V +DQ+TGD YF +S + +       +  SGD++GR++KY+  T +VT + +G+  P
Sbjct  159  TNGVDIDQVTGDVYFTDSSKTYTRAQHQMVTTSGDSTGRIMKYDPRTNKVTVLQSGVTYP  218

Query  626  VGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFW  805
             G AIS D T + + L    K++K++IRG KA T+E    +L G P+ V+      GG+W
Sbjct  219  NGIAISADRTHLVVALTGPCKLMKYWIRGSKANTSEP-FADLPGYPDNVR--PDGKGGYW  275

Query  806  VPVNTPREQQPSPMTDS-IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEA  982
            V ++  + + P  +    +A++   +G+ L+     K+  +         GK Y GS+E 
Sbjct  276  VALHREKYELPFGLDKHLLAIRIGADGEKLQEMKGPKNV-RPTEVVERDGGKIYLGSVEL  334

Query  983  DFVGV  997
             +VG+
Sbjct  335  SYVGI  339



>ref|XP_010042385.1| PREDICTED: strictosidine synthase 1-like [Eucalyptus grandis]
Length=372

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 167/324 (52%), Gaps = 36/324 (11%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLS  295
            AFGP+  AFDP GGGPYTGV DGRILK+      +VDFA TS  R  + C       L  
Sbjct  51   AFGPESLAFDPSGGGPYTGVADGRILKWEGDERGWVDFAFTSSRR--KDCIRPFAPELEH  108

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            +CGRPLGL F+++TGDLYIAD +FGL+ VG +GGLA  +A+   GK F   + + +D+  
Sbjct  109  VCGRPLGLRFDKKTGDLYIADAYFGLMVVGPDGGLATLVASEAEGKPFRLTNDLDIDESE  168

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
               YF +S   F    F     SGD +GRL+KY+ ++ ++  +L GL  P G A+S+D  
Sbjct  169  DVIYFTDSSTTFQRRQFLSACLSGDKTGRLMKYDKSSKELKVLLRGLTFPNGVALSKDGL  228

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE--  829
            F+ +      +I++ +++GP A   + +   L G P+ ++R +   G FWV +++ +   
Sbjct  229  FLLVVETATYRILRLWLKGPNAGKLD-IFAELPGFPDNIRRNSR--GEFWVALHSKKGPA  285

Query  830  ---------------------QQPSPMT-----DSIAVKFDRNGKILE-TRNLTKDYPKL  928
                                 QQ   +      D+IA+K    G+ILE   +      + 
Sbjct  286  SRFFLSSSLIGNFALRLPISFQQLHSLVVGGKADAIAIKLGEEGEILEVVEDAEGKTVQF  345

Query  929  LGSYFEYFGKAYTGSLEADFVGVY  1000
            L    E   K +  S+   F+ +Y
Sbjct  346  LSEVEERDDKLWIASVMRPFIAIY  369



>ref|XP_010023798.1| PREDICTED: strictosidine synthase 1-like [Eucalyptus grandis]
 gb|KCW90055.1| hypothetical protein EUGRSUZ_A02257 [Eucalyptus grandis]
Length=372

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 167/324 (52%), Gaps = 36/324 (11%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLS  295
            AFGP+  AFDP GGGPYTGV DGRILK+      +VDFA TS  R  + C       L  
Sbjct  51   AFGPESLAFDPSGGGPYTGVADGRILKWEGDERGWVDFAFTSSRR--KDCIRPFAPELEH  108

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            +CGRPLGL F+++TGDLYIAD +FGL+ VG +GGLA  +A+   GK F   + + +D+  
Sbjct  109  VCGRPLGLRFDKKTGDLYIADAYFGLMVVGPDGGLATLVASEAEGKPFRLTNDLDIDESE  168

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
               YF +S   F    F     SGD +GRL+KY+ ++ ++  +L GL  P G A+S+D  
Sbjct  169  DVIYFTDSSTTFQRRQFLSACLSGDKTGRLMKYDKSSKELKVLLRGLTFPNGVALSKDGL  228

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPRE--  829
            F+ +      +I++ +++GP A   + +   L G P+ ++R +   G FWV +++ +   
Sbjct  229  FLLVVETATYRILRLWLKGPNAGKLD-IFAELPGFPDNIRRNSR--GEFWVALHSKKGPA  285

Query  830  ---------------------QQPSPMT-----DSIAVKFDRNGKILE-TRNLTKDYPKL  928
                                 QQ   +      D+IA+K    G+ILE   +      + 
Sbjct  286  SRFFLSSSLIGNFALRLPISFQQLHSLVVGGKADAIAIKLGEEGEILEVVEDAEGKTVQF  345

Query  929  LGSYFEYFGKAYTGSLEADFVGVY  1000
            L    E   K +  S+   F+ +Y
Sbjct  346  LSEVEERDDKLWIASVMRPFIAIY  369



>ref|XP_010428364.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=337

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 157/294 (53%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK+     +V+FA  +       CDG  GT L   CG
Sbjct  37    GPEAFAFDSTGKGFYTGVSGGKILKWLPETGYVNFAQITESSNSSWCDGNIGTALAGRCG  96

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN  TGDLY+AD   GL  +   GGLA ++A  ++GK F F D + +D  TG  
Sbjct  97    RPAGIAFNENTGDLYVADAPLGLHVISPAGGLATKIADSVDGKPFKFLDGLDVDPTTGVV  156

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F            D +G+L KY+ +T  VT ++ GL+G  G A+S D +F+ 
Sbjct  157   YFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVL  216

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ F    I +++I+GPKA T+E    ++  NP+ +KR  S +G FWV     +   P  
Sbjct  217   VSQFTKSNIKRYWIKGPKAGTSEDFTNSV-SNPDNIKRVGS-TGNFWVASVVNKFIVP--  272

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              T+  AVK + +G++L+T  L   +   LL    E+ G  Y G+L   F G+ +
Sbjct  273   -TNPSAVKVNSDGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGILK  325



>ref|XP_002514533.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF47639.1| strictosidine synthase, putative [Ricinus communis]
Length=352

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/343 (34%), Positives = 181/343 (53%), Gaps = 16/343 (5%)
 Frame = +2

Query  8     NMKSLTMFWVSMLM---FISSLCMIHSH-PERDLIA----KLKLQNAFGPKDTAFDPRGG  163
             NM++L     S L+   F+S L + H     RD +     +L L    GP+  AFD  G 
Sbjct  14    NMRTLIPSSPSTLLSCFFLSFLVLAHGRFLLRDALNNYYYQLNLPGVLGPESLAFDCNGN  73

Query  164   GPYTGVRDGRILKFSN--GNFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRT  337
             GPY GV DGRIL++      +V+FAITS  R  + CDG+  T+L  ICGRPLGL F+  T
Sbjct  74    GPYAGVSDGRILRWQGQGKGWVEFAITSANR--KLCDGSENTDLEPICGRPLGLKFHPAT  131

Query  338   GDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLT  517
              DLY+AD +FGLL+VG NGG+A +LA    G    F + + +D  +G  YF +S   +  
Sbjct  132   CDLYVADAYFGLLKVGPNGGVATRLATSAEGVPLKFTNDLDIDPNSGVVYFTDSSVHYER  191

Query  518   NDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIK  697
               F       D +GRLLKY+  T +V+ +  GLA P G  +S+D++++ +   +  +++K
Sbjct  192   RLFMEAISKADRTGRLLKYDLTTKKVSVLYRGLAFPNGVVLSKDNSYLLLVESMNFQVLK  251

Query  698   HYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDR  877
               +          V  +L   P+ ++R    +G FWV +NT R +    + D + ++F+ 
Sbjct  252   FPLSSYGVGVPH-VFASLDRFPDNIRRND--NGDFWVALNTARGKLQGAVEDPVGIRFNE  308

Query  878   NGKILETRNLT-KDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              G++++  N    D    +    E+ G+ + GS    +VG  +
Sbjct  309   YGRVVQVVNGNGGDTLDSVSEIEEHDGRLWFGSPTQPYVGTLK  351



>ref|XP_010416234.1| PREDICTED: strictosidine synthase 1 [Camelina sativa]
Length=338

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 157/294 (53%), Gaps = 7/294 (2%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF-SNGNFVDFAITSPFRTKEKCDGTNGTNLLSICG  304
             GP+  AFD  G G YTGV  G+ILK+     +V+FA  +       CDG  GT L   CG
Sbjct  38    GPEAFAFDSTGKGFYTGVSGGKILKWLPETGYVNFAQITESSNSSWCDGNIGTALAGRCG  97

Query  305   RPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDA  484
             RP G+ FN  TGDLYIAD   GL  +   GGLA ++A  ++GK F F D + +D  TG  
Sbjct  98    RPAGIAFNENTGDLYIADAPLGLHVISPAGGLATKIADSVDGKPFKFLDGLDVDPTTGVV  157

Query  485   YFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIF  664
             YF      F            D +G+L KY+ +T  VT ++ GL+G  G A+S D +F+ 
Sbjct  158   YFTSFTSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVL  217

Query  665   ITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSP  844
             ++ F    I +++I+GPKA T+E    ++  NP+ +KR  S +G FWV     +   P  
Sbjct  218   VSQFTKSNIKRYWIKGPKAGTSEDFTNSV-SNPDNIKRVGS-TGNFWVASVVNKFIVP--  273

Query  845   MTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              T+  AVK + +G++L+T  L   +   LL    E+ G  Y G+L   F G+ +
Sbjct  274   -TNPSAVKVNSDGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGILK  326



>ref|XP_010922155.1| PREDICTED: strictosidine synthase 3-like [Elaeis guineensis]
Length=370

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/353 (31%), Positives = 180/353 (51%), Gaps = 37/353 (10%)
 Frame = +2

Query  35   VSMLMFISSLCMIHSHPERDLIAKLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNG  214
            +S+L+ + S+     +P+   I  L L  A GP+  AFD +G GPYTG+ DGRILK+   
Sbjct  18   LSVLLSLDSVFHDSKNPD---IEMLPLDAATGPESIAFDAKGEGPYTGISDGRILKWQGK  74

Query  215  N--FVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGS  388
               ++++A         KC G+   NL  +CGRPLGL F+ +TG+L++AD + GLL VG 
Sbjct  75   EHGWLEYAAVHAPHLLSKCRGSQDPNLEHVCGRPLGLRFSDKTGELFVADAYLGLLVVGP  134

Query  389  NGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLL  568
            +   A  +A    G  F   + + +D  +G  YF +S   F    +     +GD +GRL+
Sbjct  135  DDKFATPIAKQAQGVEFHVTNGLDIDPDSGAVYFTDSSMRFQRRQYISAVIAGDKTGRLM  194

Query  569  KYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLEN  748
            KY+  + +V  +L  L+ P G A+S+D + + I   I  +I+++++R PKA T E V+  
Sbjct  195  KYDPQSKEVQVLLDSLSFPNGVALSQDGSHLLIVETITCRILRYWLRTPKANTVE-VIAQ  253

Query  749  LGGNPEFVKRATSLSGGFWVPVNTPRE-----------------------QQPSPMTD--  853
            L G P+ +KR  S  GGFWV +++ R                        Q+ S   +  
Sbjct  254  LPGFPDNIKR--SPRGGFWVALHSKRTKFVERVLSDPWLCDVLLNSSIDLQRVSSFVNRR  311

Query  854  ---SIAVKFDRNGKILET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
               + A++   +G++LE          + +    E +G+ + GS+   FVG+Y
Sbjct  312  SGKASALRLSEDGQVLEVLEGFGGGTMRAISEVEERYGRLWIGSIAMPFVGIY  364



>ref|XP_007037729.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY22230.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=334

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/305 (35%), Positives = 164/305 (54%), Gaps = 10/305 (3%)
 Frame = +2

Query  101   AKLKLQ-NAFGPKDTAFDPRGGGPYTGVRDGRILKFS--NGNFVDFAITSPFRTKEKCDG  271
             +K++L  NA GP+  AF    G   TG+ DGRILK+      FVDF   +P R+K  CDG
Sbjct  35    SKIQLPPNATGPEALAFVSGTGQFCTGIADGRILKYQGPTTGFVDFGFAAPNRSKSVCDG  94

Query  272   TNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFAD  451
             T+  N   +CGRPLGL  +  T  LY+ D  FG   +G  GG    L+ G +G+ F F +
Sbjct  95    TDTANPKPVCGRPLGLALHHATNRLYVCDAFFGFGVLGPKGGQVTILSTGADGEPFRFCN  154

Query  452   SVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVG  631
             +V + Q TGD YF +S  ++          + D++GRL+KY+  T QVT +   L+G VG
Sbjct  155   AVDVHQRTGDVYFTDSSAVYDIRQIETAISTNDSTGRLMKYDFKTEQVTVLFRNLSGAVG  214

Query  632   NAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVP  811
              A+ E+  F+ ++ FI  + IK +++G KA   E +  NL   P+ +KR  + S  FW+ 
Sbjct  215   VAVDEEAKFVLVSEFIINRTIKIWLQGTKANKFEII--NLQPMPDNIKR--TASENFWLA  270

Query  812   VNTPREQQPSPMTDSIAVKFDRNGKILETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADF  988
                 ++   S +   I  + + +G +L+T N  + Y  K +    E+ G  +  S   +F
Sbjct  271   AAMIKQGTQSLV--PIGQRINASGTVLQTVNFERWYGNKSISEVQEFNGLLHVASRLVNF  328

Query  989   VGVYR  1003
             +GVY+
Sbjct  329   IGVYK  333



>ref|XP_009339573.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=375

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/325 (33%), Positives = 168/325 (52%), Gaps = 36/325 (11%)
 Frame = +2

Query  122   AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLS  295
             A GP+  AFDP G GPYTGV DGR+LK+   N  + DFA+T+  R  ++C       +  
Sbjct  55    ALGPESLAFDPTGDGPYTGVADGRVLKWDRNNRRWTDFAVTTSQR--KECVRPFAPEMEH  112

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
             +CGRPLGL F+++ GDLYIAD + GL  VG  GGLA Q+   + G+  +F + + +D+  
Sbjct  113   VCGRPLGLKFDKKNGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLLFTNDLDIDEHK  172

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
                YF +S  IF    F     +GD +GRLLKY  ++ +VT +L GLA   G A+S+D +
Sbjct  173   DVIYFTDSSTIFQRRQFMSSVFNGDRTGRLLKYNKSSKEVTVLLRGLAFANGVALSKDRS  232

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTP----  823
             F+ +      +I++ ++ GP A  T+ V   L G P+ ++R +  +G FWV ++      
Sbjct  233   FVLVAESTTCRILRVWLDGPNAGNTD-VFAELPGFPDNIRRNS--NGEFWVALHAKSGFV  289

Query  824   -----------REQQPSPM-------------TDSIAVKFDRNGKILET-RNLTKDYPKL  928
                        +     P+               + AVK   NG++L+   +      K 
Sbjct  290   SKFITSNTWVGKSMLKLPLDFKRLHSLLVGGKAHATAVKLSENGEVLQVLEDCEGKTMKF  349

Query  929   LGSYFEYFGKAYTGSLEADFVGVYR  1003
             +    E  G+ + GS+   F+G+Y+
Sbjct  350   ISELEEKDGELWMGSVLMPFIGIYK  374



>tpg|DAA45309.1| TPA: hypothetical protein ZEAMMB73_979948 [Zea mays]
Length=357

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 160/299 (54%), Gaps = 13/299 (4%)
 Frame = +2

Query  125  FGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT--NGTNLL  292
             G +  AFD RG GPY GV DGR+LK+  S   +  FA ++ +R    C  +        
Sbjct  63   IGAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAHSANYRKIPLCTASVVPSEQTE  122

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKN-FIFADSVSLDQ  469
            S+CGRPLGL F   TGDLYIAD + GL++VG NGG   Q+ A   G   F F + + +DQ
Sbjct  123  SMCGRPLGLQFFAMTGDLYIADAYMGLMKVGPNGGEEAQVLATQAGDAPFHFVNGLDVDQ  182

Query  470  LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
             TGD YF +S  I+       I  + D +GRLLKY+A T +VT +   L  P G A+S D
Sbjct  183  ATGDVYFTDSSAIYPRRFNTEIMMNADATGRLLKYDARTKRVTVLKADLPYPNGVAVSND  242

Query  650  HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR-  826
             T + +   +  +  +++++GPKA   E +L +L G P+ V+R     GG+WV +N  + 
Sbjct  243  RTHVVVAHTVPCQAFRYWLKGPKAGQYE-LLADLPGYPDNVRR--DARGGYWVALNQEKA  299

Query  827  --EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
              +    P    + V+   +G ++E   LT      L    E  G+ + GS+E D+VG+
Sbjct  300  RLDATAPPAKHLVGVRLAVDGAVVE--ELTAAKGVTLSDVAEKDGQLWLGSIELDYVGL  356



>ref|XP_010091689.1| Strictosidine synthase [Morus notabilis]
 gb|EXB44955.1| Strictosidine synthase [Morus notabilis]
Length=349

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/274 (38%), Positives = 152/274 (55%), Gaps = 23/274 (8%)
 Frame = +2

Query  104  KLKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTNGT  283
            +++L    GP+  AFD  G GPY  V DG ILK+   N        P   +  CDG+   
Sbjct  41   QIELPKVNGPESFAFDCHGKGPYASVSDGTILKWEGPNL---GWKEP---RSLCDGSTNP  94

Query  284  NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
            +    CGRPLGL F+  T DLYIAD +FGLL+VG +GG+A Q+A       F FA+++ +
Sbjct  95   DNEPTCGRPLGLKFSPITCDLYIADAYFGLLKVGPSGGVAHQVATSAEAIPFGFANALDI  154

Query  464  DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
            D  TG  YF +S  ++    +     +GD +GRL++Y+  T + T ++ GLA P G A+S
Sbjct  155  DSQTGVVYFTDSSTVYQRRVWLLSVLTGDRTGRLIQYDPHTKKTTVLVRGLAFPDGVALS  214

Query  644  EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTP  823
             D++F+        +I + ++RGPKA+T+E V   LG +P+ +KR  + +G FWV +NT 
Sbjct  215  NDNSFLLFAESTTMRIFRVWLRGPKAQTSE-VFAQLGRSPDNIKR--NQNGEFWVALNTG  271

Query  824  RE--------------QQPSPMTDSIAVKFDRNG  883
            R                 PS + D +AVKFD +G
Sbjct  272  RAVIKKLVHKKFRDQVTMPSWIGDPVAVKFDGDG  305



>gb|EMT33531.1| Strictosidine synthase 1 [Aegilops tauschii]
Length=317

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/309 (36%), Positives = 172/309 (56%), Gaps = 15/309 (5%)
 Frame = +2

Query  98   IAKLKLQNAF--GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITS--PFRTKEKC  265
            I +L L +    GP+  AFD +G GPY+GV DGRIL++ +G+ + +   +  P   ++ C
Sbjct  11   IQQLPLADGLLQGPESVAFDAQGHGPYSGVSDGRILRW-DGDKIGWTTYAYGPGYDEDMC  69

Query  266  DGT---NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKN  436
              +   + T+  S CGRPLGL F+ ++GDLY+AD + GL+RVG  GG A  L   I+ K 
Sbjct  70   TASIFRSATSTESQCGRPLGLQFHHKSGDLYVADAYRGLMRVGPGGGEATVLVNAIDDKP  129

Query  437  FIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGL  616
              F + V +DQ+TG  YF +S   +       + +SGD +GRL++Y   TG V  + T L
Sbjct  130  LRFTNGVDIDQVTGQVYFTDSSMNYDRTHHELVTRSGDLTGRLMRYAPRTGDVAVLQTRL  189

Query  617  AGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSG  796
            A   G AIS D T + +      K+++H+I+G KA  +E    +L G P+ V+      G
Sbjct  190  AYANGVAISTDRTHLIVASTGPCKLLRHWIKGSKAGMSEP-FADLPGYPDNVR--PDRRG  246

Query  797  GFWVPVNTPREQQPS-PMTDSIAVKFDRNGKILET-RNLTKDYPKLLGSYFEYFGKAYTG  970
            G+WV ++  + + PS P +  +AV+   +G+ILE  R   +  P  +       GK Y G
Sbjct  247  GYWVALHGEKNELPSRPNSHLLAVRIGADGEILEEMRGPKRVKPAEIMERDN--GKLYIG  304

Query  971  SLEADFVGV  997
            S++  +VGV
Sbjct  305  SIDLPYVGV  313



>ref|XP_003561520.1| PREDICTED: strictosidine synthase 1-like [Brachypodium distachyon]
Length=345

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 168/297 (57%), Gaps = 13/297 (4%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITS--PFRTKEKCDGT---NGTNLL  292
            GP+  AFD  G GPY+GV DGRILK+ NG+ + ++  +  P  + E C  +   + T   
Sbjct  51   GPESVAFDGEGHGPYSGVSDGRILKW-NGDKIGWSTYAYGPDYSSEACTASKLRSETVTE  109

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
            S CGRPLGL F+ ++G+LYIAD + GL+ VG +GG A  L   ++G    F + V +DQ+
Sbjct  110  SHCGRPLGLQFHHKSGNLYIADAYKGLMWVGPSGGEATVLVNQVDGAPLRFTNGVDVDQI  169

Query  473  TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
            TG  YF +S   +  +    + ++GD++GRL++Y+  T  VT + +G+  P G +IS D 
Sbjct  170  TGQVYFTDSSMNYQRSQHEMVTRTGDSTGRLMRYDPRTNDVTTLQSGITYPNGVSISHDR  229

Query  653  TFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQ  832
            T +        K+++++I+GP+A  TE    +L G P+ V+R     GG+WV ++  + +
Sbjct  230  THLVFASTGPCKLLRYWIKGPEAGKTEP-FADLPGYPDNVRR--DRRGGYWVALHREKNE  286

Query  833  QPSPM-TDSIAVKFDRNGKILET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
             P    +  +AV+   NGK+LE  R      P  +       GK Y GS+E  +VGV
Sbjct  287  LPFEFGSHLLAVRVGPNGKVLEEMRGPKSVRPTEINERGN--GKYYMGSVELPYVGV  341



>ref|XP_008655524.1| PREDICTED: strictosidine synthase 3-like [Zea mays]
Length=339

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 160/299 (54%), Gaps = 13/299 (4%)
 Frame = +2

Query  125  FGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT--NGTNLL  292
             G +  AFD RG GPY GV DGR+LK+  S   +  FA ++ +R    C  +        
Sbjct  45   IGAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAHSANYRKIPLCTASVVPSEQTE  104

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKN-FIFADSVSLDQ  469
            S+CGRPLGL F   TGDLYIAD + GL++VG NGG   Q+ A   G   F F + + +DQ
Sbjct  105  SMCGRPLGLQFFAMTGDLYIADAYMGLMKVGPNGGEEAQVLATQAGDAPFHFVNGLDVDQ  164

Query  470  LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
             TGD YF +S  I+       I  + D +GRLLKY+A T +VT +   L  P G A+S D
Sbjct  165  ATGDVYFTDSSAIYPRRFNTEIMMNADATGRLLKYDARTKRVTVLKADLPYPNGVAVSND  224

Query  650  HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR-  826
             T + +   +  +  +++++GPKA   E +L +L G P+ V+R     GG+WV +N  + 
Sbjct  225  RTHVVVAHTVPCQAFRYWLKGPKAGQYE-LLADLPGYPDNVRR--DARGGYWVALNQEKA  281

Query  827  --EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
              +    P    + V+   +G ++E   LT      L    E  G+ + GS+E D+VG+
Sbjct  282  RLDATAPPAKHLVGVRLAVDGAVVE--ELTAAKGVTLSDVAEKDGQLWLGSIELDYVGL  338



>ref|XP_003575472.1| PREDICTED: strictosidine synthase 1-like [Brachypodium distachyon]
Length=345

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 167/298 (56%), Gaps = 13/298 (4%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTN---GTNLLSI  298
             GP+  AFD +G GPY+GV DGRILK++ G +  +A  +P  + E C  T     T   S 
Sbjct  53    GPESVAFDAKGRGPYSGVSDGRILKWTKGGWTTYAY-APGYSSEACMATARRPETVTESS  111

Query  299   CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTG  478
             CGRPLGL F+ R+G+LYIAD + GL+RVG  GG A  L   +      F + V +DQ+TG
Sbjct  112   CGRPLGLRFHLRSGNLYIADAYKGLMRVGPGGGEATVLVNEVEDVPLRFTNGVDIDQVTG  171

Query  479   DAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTF  658
             + Y  +S   +  +    + ++GD++GRL++Y   TG+V  +  G+  P G AIS D T 
Sbjct  172   EVYLTDSSMNYQRSQHEMVTRTGDSTGRLMRYNPQTGKVVVLQAGITYPNGLAISADRTH  231

Query  659   IFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQP  838
             + I+     K+++++I+GPKA T E VL +L G P+ V+      GG+WV ++  RE+  
Sbjct  232   LVISSTGPCKLLRYWIKGPKAGTIE-VLVDLPGYPDNVR--PDGRGGYWVALH--REKNE  286

Query  839   SPM-TDS--IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
              P   DS  +AV+   +G ILE     K   +         G+ + GS+E  +V V +
Sbjct  287   LPFGVDSHLLAVRIGADGMILEEMKGPKSV-RPTEIMERKAGRLFMGSVELPYVSVVK  343



>ref|XP_004986966.1| PREDICTED: strictosidine synthase 3-like [Setaria italica]
Length=342

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/304 (37%), Positives = 162/304 (53%), Gaps = 12/304 (4%)
 Frame = +2

Query  107  LKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT-  274
            L L N   G +  AFD  G GPY GV DGR+LK+  S   +  FA +  +R    C  + 
Sbjct  42   LPLPNGVTGAESLAFDRLGQGPYAGVSDGRVLKWGGSTLGWTTFAHSPNYRKIPLCTASV  101

Query  275  -NGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFAD  451
                   SICGRPLGL F  +TGDLYIAD + GL++VG +GG A+ LA   +G  F F +
Sbjct  102  VPSEETESICGRPLGLQFFAKTGDLYIADAYHGLMKVGPDGGEAEVLATQADGVPFHFVN  161

Query  452  SVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVG  631
             + +DQ TGD YF +S   +       I  + D +GRLLKY+A   QVT +  GL  P G
Sbjct  162  GLDVDQATGDVYFTDSSITYPRRFNTEIMMNADATGRLLKYDARAKQVTVLRAGLPYPNG  221

Query  632  NAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVP  811
             A+S D T + +   +  +  +++++G KA   E ++ +L G P+ V+R     GG+WV 
Sbjct  222  VAVSGDRTHVVVAHTVPCQAFRYWLKGSKAGQYE-LMADLPGYPDNVRR--DAKGGYWVA  278

Query  812  VNT--PREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEAD  985
            +N    R    +P+   + V+   +G  +E   LT      L    E  G+ + GS+E D
Sbjct  279  LNQEKARLDAAAPVKHLVGVRLGSDG--VEVEELTAAKGVTLSDVAEKDGQLWLGSVELD  336

Query  986  FVGV  997
            +VG+
Sbjct  337  YVGL  340



>gb|EAZ40180.1| hypothetical protein OsJ_24625 [Oryza sativa Japonica Group]
Length=350

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 187/353 (53%), Gaps = 28/353 (8%)
 Frame = +2

Query  2     TTNMKSLTMFWVSMLMFISSLCMIHSHPERDLIAK---------LKLQNAF-GPKDTAFD  151
             T  + +LT   +++++F   L ++ SH     +AK         L L     GP+  AFD
Sbjct  7     TGRVGTLTRVALTIVVF---LLLLPSHALAAAVAKDTSATLVETLPLPTTLVGPESVAFD  63

Query  152   PRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTN---GTNLLSICGRPLG  316
               G GPY+GV DGRIL++   +  +  ++  SP     KC            S CGRPLG
Sbjct  64    KFGDGPYSGVSDGRILRWDGADEGWTTYS-HSPGYNVAKCMAPKLHPAELTESKCGRPLG  122

Query  317   LDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVE  496
             L F+  +G+LYIAD + GL+RVG  GG A  LA   +G  F F + V ++Q+TG+ YF +
Sbjct  123   LRFHNTSGNLYIADAYKGLMRVGPRGGEATVLATEADGVPFKFTNGVDVNQVTGEVYFTD  182

Query  497   SGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLF  676
             S   F  +    +  +GD++GRL+KY+A TG +  + +G+  P G A+S D + + + L 
Sbjct  183   SSTRFQRSQHEMVTATGDSTGRLMKYDATTGYLDVLQSGMTYPNGLALSADRSHLVVALT  242

Query  677   IGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPM---  847
                K+++H+I GPKA T+E   E L G P+ V+      GG+WV ++  RE+  SP    
Sbjct  243   GPCKLVRHWIDGPKAGTSEPFAE-LPGYPDNVR--PDGKGGYWVALH--REKTESPYGSD  297

Query  848   TDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
             T  +AV+  R GKIL+     K+  +         GK Y GS+E   V V +A
Sbjct  298   THLLAVRIGRKGKILQELRGPKNV-RPTEVIERGGGKLYLGSVELGHVAVVKA  349



>emb|CDX93560.1| BnaA06g04880D [Brassica napus]
Length=393

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 120/327 (37%), Positives = 176/327 (54%), Gaps = 44/327 (13%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTNGTNLLS----  295
            GP+  AFDP G GPYTGV DGRIL +    + DFA TS  R+ E CD    ++LL+    
Sbjct  72   GPESIAFDPLGRGPYTGVADGRILFWDGTRWTDFAYTSNNRS-ELCD--TKSSLLAYLKN  128

Query  296  --ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              ICGRPLGL F++RTGDLYIAD +FG+++VG  GGLA  L    +G    F + + +D+
Sbjct  129  EHICGRPLGLRFHKRTGDLYIADAYFGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDE  188

Query  470  LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
              G+ YF +S  +F   +F  +  SG+ +GR+LKY   T + T +L  L  P G ++  D
Sbjct  189  -EGNVYFTDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLSLGRD  247

Query  650  HT-FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR  826
             + FIF    IGR + K++++G KA T+E V+  L G P+ ++  T+  G FWV V+  R
Sbjct  248  GSFFIFCEGSIGR-LRKYWLKGEKAGTSE-VVALLHGFPDNIR--TNKDGDFWVAVHCHR  303

Query  827  E-------QQPS--------PMT-------------DSIAVKFDRNGKILET-RNLTKDY  919
                      P+        P+T              ++AVK+  +GK+L+   +     
Sbjct  304  NIFTHVMAHHPNVRKFFLKLPITVKFQYLLQVGGWPHAVAVKYSEDGKVLKVLEDKQGKV  363

Query  920  PKLLGSYFEYFGKAYTGSLEADFVGVY  1000
             K +    E  GK + GS+   F+ VY
Sbjct  364  VKAVSEIEEKDGKLWMGSVLMSFIAVY  390



>gb|EAZ04232.1| hypothetical protein OsI_26376 [Oryza sativa Indica Group]
Length=350

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 115/313 (37%), Positives = 171/313 (55%), Gaps = 16/313 (5%)
 Frame = +2

Query  95    LIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKC  265
             L+  L L     GP+  AFD  G GPY+GV DGRIL++   +  +  ++  +P     KC
Sbjct  44    LVETLPLPTTLVGPESVAFDKFGDGPYSGVSDGRILRWDGADKGWTTYS-HAPGYNVAKC  102

Query  266   DGTN---GTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKN  436
                         S CGRPLGL F+  +G+LYIAD + GL+RVG +GG A  LA   +G  
Sbjct  103   MAPKLHPAELTESKCGRPLGLRFHNTSGNLYIADAYKGLMRVGPSGGEATVLATEADGVP  162

Query  437   FIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGL  616
             F F + V ++Q+TG+ YF +S   F  +   R+  +GD++GRL+KY+  TG +  + +G+
Sbjct  163   FKFTNGVDVNQVTGEVYFTDSSTRFQRSQHERVTATGDSTGRLMKYDPTTGYLDVLQSGM  222

Query  617   AGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSG  796
               P G A+S D + + + L    K+++H+I GPKA T+E   E L G P+ V+      G
Sbjct  223   TYPNGLALSADRSHLVVALTGPCKLVRHWIEGPKAGTSEPFAE-LPGYPDNVR--PDGKG  279

Query  797   GFWVPVNTPREQQPSPM---TDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYT  967
             G+WV ++  RE+  SP    T  +AV+  R GKIL+     K+  +         GK Y 
Sbjct  280   GYWVALH--REKTESPYGSDTHLLAVRIGRKGKILQELRGPKNV-RPTEVIERGGGKLYL  336

Query  968   GSLEADFVGVYRA  1006
             GS+E   V V +A
Sbjct  337   GSVELGHVAVVKA  349



>ref|XP_010056146.1| PREDICTED: strictosidine synthase 1 [Eucalyptus grandis]
 ref|XP_010056153.1| PREDICTED: strictosidine synthase 1 [Eucalyptus grandis]
Length=374

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 143/239 (60%), Gaps = 8/239 (3%)
 Frame = +2

Query  122  AFGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT-NGTNLL  292
            A GP+  AFDPRG GPYTGV DGRI+K+  S   +VDFA TSP  +++ C+   N   + 
Sbjct  48   AVGPESFAFDPRGDGPYTGVSDGRIVKWAASERRWVDFAFTSP--SRDICEKPHNNQEME  105

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQL  472
            ++CGRPLGL FN RT  LYIAD + GLL VG  GG A  +AA  +G  F F +S+ +D L
Sbjct  106  NVCGRPLGLGFNPRTSRLYIADAYMGLLAVGPGGGRATVVAAQADGVPFRFTNSLDIDPL  165

Query  473  TGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDH  652
            +G  YF +S   +   ++  +  SGD +GRL+KY+  + +VT +L+ L+ P G  + E  
Sbjct  166  SGAVYFTDSSSQYQRRNYIPLILSGDRTGRLMKYDPESDRVTTILSNLSFPNGVVLGESG  225

Query  653  TFIFITLFIGRKIIKHYIRGPKAKTTET-VLENLGGNPEFVKRATSLSGGFWVPVNTPR  826
             F+ +      +I+K+++R P     E  V   L G P+ ++R  S  GG+WV + + R
Sbjct  226  DFLLVAETSTCRILKYWLRPPPEAAGEVEVFAQLPGFPDNIRR--SPRGGYWVGIFSKR  282



>ref|XP_003595639.1| Strictosidine synthase-like protein [Medicago truncatula]
Length=333

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 117/340 (34%), Positives = 176/340 (52%), Gaps = 15/340 (4%)
 Frame = +2

Query  11    MKSLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQNAF-GPKDTAFDPRGGGPYTGVRD  187
             M  +T   +S++++ SS  + +      L+ +L L  +  GP+  AFD  GGGPYTGV D
Sbjct  1     MAVITGILISLILYNSSSIVAYCK----LLDRLYLPPSLTGPESLAFDSIGGGPYTGVSD  56

Query  188   GRILKFSN--GNFVDFAITSPFRTKEKCDG-TNGTNLLSICGRPLGLDFNRRTGDLYIAD  358
             GRILK+      F++FA  SP+R K  CDG ++ + L   CGRP+GL FN +T +LYIAD
Sbjct  57    GRILKYDEECSCFLEFAHISPYRNKTNCDGISDFSELQETCGRPMGLSFNYKTKELYIAD  116

Query  359   IHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIA  538
              ++GL++V  +GG A QL + + G  F F     +D  TG  YF E+       D   + 
Sbjct  117   AYYGLVKVPYDGGAATQLVSNVLGNPFGFLAGADVDPNTGIVYFTEASYYHKIRDLRNLL  176

Query  539   QSGDT-SGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGP  715
              S D  SG L +Y   T   T +L  LA   G A+S + +F+ ++ +   +I + ++ GP
Sbjct  177   NSRDIFSGSLFRYNPTTKVTTLLLRNLAMATGVAVSSNGSFVLVSEYKANRIRRFWLTGP  236

Query  716   KAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTP--REQQPSPMTDSIAVKFDRNGKI  889
              A T++  L  L G P+ +KR +     FWV VN P      P P    + ++ +  G I
Sbjct  237   NAYTSDIFLW-LPGRPDNIKRTS--KNEFWVAVNYPFGSPPPPVPPVLPLGLRINEQGLI  293

Query  890   LETRNLTKDY-PKLLGSYFEYFGKAYTGSLEADFVGVYRA  1006
             LE   L + +    +    E  GK Y  SL   +V +  A
Sbjct  294   LEAVPLVEGFGTGSVSEVHEAEGKLYATSLRDSYVNILTA  333



>ref|XP_004150130.1| PREDICTED: strictosidine synthase 1-like [Cucumis sativus]
 gb|KGN50870.1| hypothetical protein Csa_5G305760 [Cucumis sativus]
Length=350

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 139/236 (59%), Gaps = 7/236 (3%)
 Frame = +2

Query  125  FGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FVDFAITSPFRTKEKCDGTNGTNLLSI  298
            FGP+  AFD RG GPY  V DGRILK+   +  +  FA+TSP R  ++CDG   +   + 
Sbjct  37   FGPESIAFDCRGEGPYASVSDGRILKWKGPHLGWTQFALTSPNREGKECDGQPQSE--AA  94

Query  299  CGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTG  478
            CGRPLG+ F+  T DLYIAD +FGLL VG  GGLA+QLA    G    F +++ +D   G
Sbjct  95   CGRPLGIKFHPTTCDLYIADAYFGLLAVGPKGGLARQLATSAQGVPLRFTNALDIDPQNG  154

Query  479  DAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTF  658
              YF +S  +F    +     +GD +GRLLKY+  T  VT +  GLA P G A++ D +F
Sbjct  155  IVYFTDSSILFQRRVWLLSIMNGDKTGRLLKYDPRTQNVTVLRNGLAFPNGVALNADSSF  214

Query  659  IFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR  826
            + +      +++K +++GPKA T E +   L   P+ +KR    +G FW+ +N+ R
Sbjct  215  LLMAETGTLQVLKFWLKGPKANTME-IFAQLERFPDNIKRTD--NGDFWIAMNSAR  267



>ref|XP_009394278.1| PREDICTED: strictosidine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 118/331 (36%), Positives = 170/331 (51%), Gaps = 42/331 (13%)
 Frame = +2

Query  113  LQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTNGTNLL  292
            L    GP+  AFDPRG GPYTGV DGR+L ++  ++VDFA TSP R+ E C+     +L 
Sbjct  66   LNQVQGPESIAFDPRGRGPYTGVADGRVLFWNGESWVDFAYTSPNRS-EICNLN--PSLF  122

Query  293  S------ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADS  454
            S      ICGRPLGL F++RTGDLYIAD +FGLL+VG  GGLA  L     G  F F + 
Sbjct  123  SYLKNEHICGRPLGLRFDKRTGDLYIADAYFGLLKVGPQGGLAAPLTTEAEGVPFNFTND  182

Query  455  VSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGN  634
            + +D+  G+ YF +S   +   +F ++  SG+ SGRLLKY   T +   +  GL  P G 
Sbjct  183  LDIDE-EGNVYFTDSSTNYQRRNFMQLIFSGEPSGRLLKYNPVTKETIVLHRGLQFPNGV  241

Query  635  AISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPV  814
             +S+D +F+        ++ +H+++G KA T + V   L G P+ V+  T+  G FWV +
Sbjct  242  TLSKDGSFLLFCEGSRLRLNRHWLKGEKAGTLD-VFAYLPGFPDNVR--TNEKGEFWVAI  298

Query  815  NTPREQQPSPMTD----------------------------SIAVKFDRNGKILET-RNL  907
            +         M D                            ++ +K+  NG +LET  + 
Sbjct  299  HCRHSTYAHLMADHSKLRKFFLKLPIPVKYHYFMLVGGRLHALIIKYGPNGDLLETLEDK  358

Query  908  TKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
                 K +    E  GK + GS+   F+ VY
Sbjct  359  EGKVVKAVSEVEEKDGKLWIGSVLMSFIAVY  389



>gb|KFK34942.1| hypothetical protein AALP_AA5G213900 [Arabis alpina]
Length=373

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 119/348 (34%), Positives = 180/348 (52%), Gaps = 43/348 (12%)
 Frame = +2

Query  71   IHSHPE----RDLIAKLKLQN---AFGPKDTAFDPRGGGPYTGVRDGRILKFSNGN--FV  223
            I + PE    RD+    K+ N   A GP+  AFDP G GPY GV DGR+LK+   +  ++
Sbjct  29   IFAPPEIPGSRDVFPSAKVVNVTGASGPESVAFDPSGEGPYVGVSDGRVLKWRGESLGWI  88

Query  224  DFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLA  403
            DFA TS    +EKC       L  +CGRPLGL F+++TGDLYIAD +FGLL VG  GGLA
Sbjct  89   DFAHTS--TNREKCVRPFAPELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLA  146

Query  404  KQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAA  583
            K L    +G  F F + + +D+     YF ++   F    F     + D +GRL+KY+ +
Sbjct  147  KPLVTEADGVPFRFTNDLDIDEEEDVIYFTDTSTRFQRRQFLAAVLNFDKTGRLMKYDRS  206

Query  584  TGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNP  763
            + +VT +L G+A   G A+S+D +F+ +      KI++ ++ GP A T + V   L G P
Sbjct  207  SKKVTVLLQGIAFANGVALSKDRSFVLVAETTTCKILRLWLSGPNAGTQD-VFAELPGFP  265

Query  764  EFVKRATSLSGGFWVPVNTPRE-------QQP------------SPMTDSI---------  859
            + V++ +  +G FWV +++ +         QP             P   S+         
Sbjct  266  DNVRKNS--NGEFWVALHSKKGLFAKLSLTQPWFRDLVLRLPISGPRLHSVFIGGRPHAT  323

Query  860  AVKFDRNGKILET-RNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGVY  1000
            A+K   +G++LE   +      + +    E  GK + GS+   F+GVY
Sbjct  324  AMKLSESGEVLEVLEDKEGKRLRFISEVEEKDGKLWIGSVLMPFLGVY  371



>dbj|BAD05221.1| putative male fertility protein [Oryza sativa Japonica Group]
 dbj|BAD05548.1| putative male fertility protein [Oryza sativa Japonica Group]
Length=356

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 109/304 (36%), Positives = 162/304 (53%), Gaps = 17/304 (6%)
 Frame = +2

Query  128   GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDG--TNGTNLLS  295
             G +  AFD    GPYTGV DGR+L++  +   +  FA    +R    C           S
Sbjct  58    GAESLAFDSSNHGPYTGVSDGRVLRWGGAAAGWTTFAHHENYRKIPMCTTPVAPAEETES  117

Query  296   ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
             +CGRPLGL F+ RTGDLYIAD + GL+RVG  GG A+ LAAG +G  F F + + +DQ T
Sbjct  118   MCGRPLGLAFHDRTGDLYIADAYKGLMRVGPRGGEAEVLAAGADGVPFNFVNGIDVDQAT  177

Query  476   GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
             GD YF +S   +     + I  + D + RLLKY+AAT +VT +  GL    G A+S D +
Sbjct  178   GDVYFTDSSTTYPRRFNSEIMMNADATARLLKYDAATKRVTVLRAGLPYANGVAVSRDGS  237

Query  656   FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
                +   +  +  +++I+GP A   E +L +L G P+ V+R    +GG+WV +N  + + 
Sbjct  238   HAVVAHTVPCQAFRYWIKGPNAGEYE-LLADLPGYPDNVRR--DANGGYWVALNQEKARL  294

Query  836   PSPMTDS--------IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFV  991
              +    +        + V+ D +G  +E   LT      L    E  GK + GS+E DF+
Sbjct  295   DATAAAAVAPPAKHLVGVRLDGDG--VEVEELTAAKGVTLSEVVERGGKLWLGSVELDFI  352

Query  992   GVYR  1003
             G+ +
Sbjct  353   GLMQ  356



>gb|EAZ41691.1| hypothetical protein OsJ_26224 [Oryza sativa Japonica Group]
Length=356

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 161/302 (53%), Gaps = 17/302 (6%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDG--TNGTNLLS  295
            G +  AFD    GPYTGV DGR+L++  +   +  FA    +R    C           S
Sbjct  58   GAESLAFDSSNHGPYTGVSDGRVLRWGGAAAGWTTFAHHENYRKIPMCTTPVAPAEETES  117

Query  296  ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLT  475
            +CGRPLGL F+ RTGDLYIAD + GL+RVG  GG A+ LAAG +G  F F + + +DQ T
Sbjct  118  MCGRPLGLAFHDRTGDLYIADAYKGLMRVGPRGGEAEVLAAGADGVPFNFVNGIDVDQAT  177

Query  476  GDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHT  655
            GD YF +S   +     + I  + D + RLLKY+AAT +VT +  GL    G A+S D +
Sbjct  178  GDVYFTDSSTTYPRRFNSEIMMNADATARLLKYDAATKRVTVLRAGLPYANGVAVSRDGS  237

Query  656  FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQ  835
               +   +  +  +++I+GP A   E +L +L G P+ V+R    +GG+WV +N  + + 
Sbjct  238  HAVVAHTVPCQAFRYWIKGPNAGEYE-LLADLPGYPDNVRR--DANGGYWVALNQEKARL  294

Query  836  PSPMTDS--------IAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFV  991
             +    +        + V+ D +G  +E   LT      L    E  GK + GS+E DF+
Sbjct  295  DATAAAAVAPPAKHLVGVRLDGDG--VEVEELTAAKGVTLSEVVERGGKLWLGSVELDFI  352

Query  992  GV  997
            G+
Sbjct  353  GL  354



>ref|XP_009148103.1| PREDICTED: strictosidine synthase 3 [Brassica rapa]
Length=393

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 176/327 (54%), Gaps = 44/327 (13%)
 Frame = +2

Query  128  GPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTKEKCDGTNGTNLLS----  295
            GP+  AFDP G GPYTGV DGRIL +    + DFA TS  R+ E CD    ++LL+    
Sbjct  72   GPESIAFDPLGRGPYTGVADGRILFWDGTRWTDFAYTSNNRS-ELCD--TKSSLLAYLKN  128

Query  296  --ICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQ  469
              ICGRPLGL F++RTGDLYIAD +FG+++VG  GGLA  L    +G    F + + +D+
Sbjct  129  EHICGRPLGLRFHKRTGDLYIADAYFGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDE  188

Query  470  LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
              G+ YF +S  +F   +F  +  SG+ +GR+LKY   T + T +L  L  P G ++  D
Sbjct  189  -EGNVYFTDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLSLGRD  247

Query  650  HT-FIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR  826
             + FIF    IGR + K++++G K+ T+E V+  L G P+ ++  T+  G FWV V+  R
Sbjct  248  GSFFIFCEGSIGR-LRKYWLKGEKSGTSE-VVALLHGFPDNIR--TNKDGDFWVAVHCHR  303

Query  827  E-------QQPS--------PMT-------------DSIAVKFDRNGKILET-RNLTKDY  919
                      P+        P+T              ++AVK+  +GK+L+   +     
Sbjct  304  NIFTHVMAHHPNVRKFFLKLPITVKFQYLLQVGGWPHAVAVKYSEDGKVLKVLEDKQGKV  363

Query  920  PKLLGSYFEYFGKAYTGSLEADFVGVY  1000
             K +    E  GK + GS+   F+ VY
Sbjct  364  VKAVSEIEEKDGKLWMGSVLMSFIAVY  390



>ref|XP_008655507.1| PREDICTED: strictosidine synthase 3-like [Zea mays]
 tpg|DAA45306.1| TPA: hypothetical protein ZEAMMB73_781124 [Zea mays]
Length=339

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 159/299 (53%), Gaps = 13/299 (4%)
 Frame = +2

Query  125  FGPKDTAFDPRGGGPYTGVRDGRILKF--SNGNFVDFAITSPFRTKEKCDGT--NGTNLL  292
             G +  AFD RG GPY GV DGR+LK+  S   +  FA ++ +R    C  +        
Sbjct  45   IGAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAHSANYRKIPLCTASVVPSEQTE  104

Query  293  SICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKN-FIFADSVSLDQ  469
            S+CGRPLGL F   TGDLYIAD + GL++VG NGG   Q+ A   G   F F + + +DQ
Sbjct  105  SMCGRPLGLQFFAMTGDLYIADAYMGLMKVGPNGGEEAQVLATQAGDAPFHFVNGLDVDQ  164

Query  470  LTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISED  649
             TGD YF +S  I+       I  + D +GRLLKY+A T +VT +   L  P G A+S D
Sbjct  165  ATGDVYFTDSSAIYPRRFNTEIMMNADATGRLLKYDARTKRVTVLKADLPYPNGVAVSND  224

Query  650  HTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPR-  826
             T + +   +  +  +++++GPKA   E +L +L G P+ V+R     GG+WV +N  + 
Sbjct  225  RTHVVVAHTVPCQAFRYWLKGPKAGQYE-LLADLPGYPDNVRR--DARGGYWVALNQEKA  281

Query  827  --EQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFGKAYTGSLEADFVGV  997
              +    P    + V+   +G  +E   LT      L    E  G+ + GS+E D+VG+
Sbjct  282  RLDATAPPAKHLVGVRLAVDGAAVE--ELTAAKGVTLSDVAEKDGQLWLGSIELDYVGL  338



>ref|XP_011013883.1| PREDICTED: strictosidine synthase 3-like, partial [Populus euphratica]
Length=283

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 162/285 (57%), Gaps = 6/285 (2%)
 Frame = +2

Query  107  LKLQNAFGPKDTAFDPRGGGPYTGVRDGRILKFS-NGNFVDFAITSPFRTKEKCDGTNGT  283
            + L+ +FGP+  AF+  GG  YTGV DG +L++     +  FA TSP R+   C+GT   
Sbjct  1    MALRPSFGPESLAFETPGGAFYTGVNDGLVLRYQPTTGWTTFAFTSPNRSIALCNGTTDP  60

Query  284  NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSL  463
            +   ICGRPLGL ++  T  LYIAD ++GLL   SNG LA Q+A    G+ F+  +++ +
Sbjct  61   DKGPICGRPLGLAYSPFTKLLYIADAYYGLLVADSNGRLATQIATSAEGQPFVVCNALDI  120

Query  464  DQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAIS  643
            D  TG+ YF ++  ++   + ++   + D++GRLLKY+  T QVT +L  L+  VG A+S
Sbjct  121  DPFTGNIYFTDASAVYDLRNSSKALLANDSTGRLLKYDVRTNQVTVLLRNLSVAVGVAVS  180

Query  644  EDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLG-GNPEFVKRATSLSGGFWVPVNT  820
            +D  F+ ++ F+G +I ++++ G  A T++  L NL    P  +KR TSL G F +   T
Sbjct  181  KDGGFVLVSEFVGNRIRRYWLTGRNAGTSDIFLSNLNILRPNNIKR-TSL-GDFLIAAAT  238

Query  821  PREQQPSPMTDSIAVKFDRNGKILETRNLTKDYPKLLGSYFEYFG  955
             R  Q S     + V+ +  G+I  T +L   Y   L S  +  G
Sbjct  239  VR--QDSQTLVPVRVRVNELGRISATVSLEAQYGSTLISEVQQSG  281



>ref|XP_002278088.1| PREDICTED: strictosidine synthase 3 [Vitis vinifera]
Length=391

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 118/342 (35%), Positives = 178/342 (52%), Gaps = 41/342 (12%)
 Frame = +2

Query  86    ERDLIAKLK---LQNAFGPKDTAFDPRGGGPYTGVRDGRILKFSNGNFVDFAITSPFRTK  256
             +R+L+ K +   L    GP+  AFDP G GPYTGV DGRIL ++   + DFA TSP R+ 
Sbjct  53    DRNLLQKAEIKFLNQVQGPESVAFDPLGRGPYTGVADGRILFWNGEAWSDFAYTSPNRS-  111

Query  257   EKCDGTNGT----NLLSICGRPLGLDFNRRTGDLYIADIHFGLLRVGSNGGLAKQLAAGI  424
             E CD             ICGRPLGL FN+RTGDLYIAD + GL++VG  GGLA  L    
Sbjct  112   ELCDPKPSPLSYLKNEHICGRPLGLRFNKRTGDLYIADSYLGLMKVGPEGGLATSLVTEA  171

Query  425   NGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARIAQSGDTSGRLLKYEAATGQVTEV  604
             +G    F + + +D   G+ YF +S   +   +F ++  S + SGRLLKY+  T + T +
Sbjct  172   DGVPLRFTNDLDIDD-AGNIYFTDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVL  230

Query  605   LTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGPKAKTTETVLENLGGNPEFVKRAT  784
             L GL  P G ++S+D +F+ +      +++K++++G KA T+E V   L G P+ V+  T
Sbjct  231   LRGLQFPNGVSLSKDGSFLVLCEGSPGRLVKYWLKGDKAGTSE-VFAILPGYPDNVR--T  287

Query  785   SLSGGFWVPVNTPRE-----------------QQPSPMT-----------DSIAVKFDRN  880
             +  G FWV ++  R                  + P P              ++ VK+   
Sbjct  288   NEKGEFWVAIHCRRTMYSYLCGLYPKLRMFLLKLPIPTRYQYLLHIGGRLHAVVVKYSPE  347

Query  881   GKILETRNLTK-DYPKLLGSYFEYFGKAYTGSLEADFVGVYR  1003
             GK+++    ++    + +    E  GK + GS+   FV VY+
Sbjct  348   GKLVKILEDSEGKVVRAVSEVEEREGKLWMGSVLMPFVAVYQ  389



>ref|XP_007037730.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY22231.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=336

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/337 (32%), Positives = 184/337 (55%), Gaps = 17/337 (5%)
 Frame = +2

Query  8     NMKSLTMFWVSMLMFISSLCMIHSHPERDLIAKLKLQ-NAFGPKDTAFDPRGGGPYTGVR  184
             +++  T+F + + +F S   M+ S       + ++L   A GP+  AF+   G  Y GV 
Sbjct  11    SLREATLFSIFIFIFCSP-SMVLSQ----FFSSIQLPPTAKGPESFAFELGTGRIYVGVD  65

Query  185   DGRILKFSNG---NFVDFAITSPFRTKEKCDGTNGTNLLSICGRPLGLDFNRRTGDLYIA  355
             DGRIL++ NG    FVDF  TS  R+K  CDG    +L  ICGRP+GL F+  +  LY+ 
Sbjct  66    DGRILQY-NGPATGFVDFGYTSGTRSKAVCDGATNPDLGPICGRPMGLGFHYASSQLYVC  124

Query  356   DIHFGLLRVGSNGGLAKQLAAGINGKNFIFADSVSLDQLTGDAYFVESGEIFLTNDFARI  535
             D + GL+ + S GGLA  +++  +G+ + F + + + QL+G+ +F ++  ++   + ++ 
Sbjct  125   DAYVGLVALDSRGGLANLVSSSADGEPYRFCNGLDVHQLSGNVFFTDTSTVYDLRNASKG  184

Query  536   AQSGDTSGRLLKYEAATGQVTEVLTGLAGPVGNAISEDHTFIFITLFIGRKIIKHYIRGP  715
               S D++GRLL+Y+  T +VT +L  L GP G A+S+D T++ I+ F     ++++++GP
Sbjct  185   LTSNDSTGRLLRYDPNTKRVTVLLKNLTGPAGAAVSQDGTYVLISNFNSNTTMRYWLQGP  244

Query  716   KAKTTETVLENLGGNPEFVKRATSLSGGFWVPVNTPREQQPSPMTDSIAVKFDRNGKILE  895
             +A T + +  +    P  ++   +L+G FW      +  QP+     I  +    G +  
Sbjct  245   RANTYDII--STQARPNNIQ--GTLAGDFWQAAAMVK--QPTQSLVPIGQRISGLGIVTR  298

Query  896   TRNLTKDYPKLLGSYFEYFGKA-YTGSLEADFVGVYR  1003
             T N  + Y   L S  + FG A Y  S   +F+GVYR
Sbjct  299   TVNFEQWYGNNLISEVQEFGGALYVASRYVNFIGVYR  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2862874383393