BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16368_g2_i1 len=1677 path=[1:0-881 883:882-917 919:918-1676]

Length=1677
                                                                      Score     E

ref|XP_006356653.1|  PREDICTED: isoleucine N-monooxygenase 1-like       633   0.0      
emb|CDP20403.1|  unnamed protein product                                632   0.0      
emb|CDP18411.1|  unnamed protein product                                631   0.0      
ref|XP_011071674.1|  PREDICTED: isoleucine N-monooxygenase 1-like       624   0.0      
ref|XP_011071563.1|  PREDICTED: isoleucine N-monooxygenase 1-like       622   0.0      
ref|XP_004245410.1|  PREDICTED: isoleucine N-monooxygenase 1-like       620   0.0      
emb|CDP19035.1|  unnamed protein product                                618   0.0      
ref|XP_007146888.1|  hypothetical protein PHAVU_006G078900g             617   0.0      
ref|XP_002276655.1|  PREDICTED: phenylalanine N-monooxygenase-like      617   0.0      Vitis vinifera
ref|XP_011071673.1|  PREDICTED: isoleucine N-monooxygenase 1-like       616   0.0      
emb|CAN75997.1|  hypothetical protein VITISV_022990                     614   0.0      Vitis vinifera
ref|XP_006367541.1|  PREDICTED: isoleucine N-monooxygenase 1-like       614   0.0      
ref|XP_011071676.1|  PREDICTED: isoleucine N-monooxygenase 1-like       615   0.0      
ref|XP_011084186.1|  PREDICTED: isoleucine N-monooxygenase 1-like       615   0.0      
ref|XP_003633447.1|  PREDICTED: phenylalanine N-monooxygenase-like      613   0.0      
ref|XP_002274952.2|  PREDICTED: phenylalanine N-monooxygenase-like      612   0.0      Vitis vinifera
gb|AHF20912.1|  cytochrome P450                                         611   0.0      
ref|XP_006363576.1|  PREDICTED: isoleucine N-monooxygenase 1-like       609   0.0      
ref|XP_009623062.1|  PREDICTED: isoleucine N-monooxygenase 2-like       610   0.0      
ref|XP_006376556.1|  hypothetical protein POPTR_0013s15310g             609   0.0      
ref|XP_007011304.1|  Cytochrome p450 79a2                               609   0.0      
emb|CDP12474.1|  unnamed protein product                                609   0.0      
ref|XP_002274641.1|  PREDICTED: phenylalanine N-monooxygenase-like      607   0.0      Vitis vinifera
ref|XP_002264201.1|  PREDICTED: phenylalanine N-monooxygenase           609   0.0      Vitis vinifera
ref|XP_011098372.1|  PREDICTED: phenylalanine N-monooxygenase-like      607   0.0      
ref|XP_007146890.1|  hypothetical protein PHAVU_006G079100g             607   0.0      
ref|XP_006435921.1|  hypothetical protein CICLE_v10031099mg             608   0.0      
ref|XP_007011306.1|  Cytochrome p450 79a2                               606   0.0      
ref|XP_007011296.1|  Cytochrome p450 79a2                               605   0.0      
ref|XP_006363575.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    603   0.0      
ref|XP_004237224.2|  PREDICTED: isoleucine N-monooxygenase 1-like       603   0.0      
ref|XP_011075711.1|  PREDICTED: valine N-monooxygenase 1-like           603   0.0      
ref|XP_009780952.1|  PREDICTED: isoleucine N-monooxygenase 2-like       602   0.0      
ref|XP_009599475.1|  PREDICTED: isoleucine N-monooxygenase 2-like       602   0.0      
gb|EYU45627.1|  hypothetical protein MIMGU_mgv1a004405mg                602   0.0      
ref|XP_002274920.1|  PREDICTED: phenylalanine N-monooxygenase-like      600   0.0      Vitis vinifera
ref|XP_006435920.1|  hypothetical protein CICLE_v10031309mg             600   0.0      
gb|KDP45690.1|  hypothetical protein JCGZ_17297                         601   0.0      
ref|XP_009765490.1|  PREDICTED: isoleucine N-monooxygenase 2-like...    601   0.0      
ref|XP_002274698.2|  PREDICTED: phenylalanine N-monooxygenase-like      601   0.0      Vitis vinifera
ref|XP_009369526.1|  PREDICTED: isoleucine N-monooxygenase 1-like       600   0.0      
ref|XP_006486167.1|  PREDICTED: phenylalanine N-monooxygenase-like      598   0.0      
sp|Q6J541.1|C79D3_LOTJA  RecName: Full=Isoleucine N-monooxygenase...    599   0.0      Lotus japonicus
sp|Q6J540.1|C79D4_LOTJA  RecName: Full=Isoleucine N-monooxygenase...    598   0.0      Lotus japonicus
gb|KEH34488.1|  cytochrome P450 family protein                          598   0.0      
ref|XP_002269843.2|  PREDICTED: phenylalanine N-monooxygenase           596   0.0      Vitis vinifera
ref|XP_008349637.1|  PREDICTED: isoleucine N-monooxygenase 1-like       597   0.0      
gb|AHF22089.1|  CYP79D33                                                598   0.0      
emb|CAN61661.1|  hypothetical protein VITISV_000261                     598   0.0      Vitis vinifera
ref|XP_004237225.1|  PREDICTED: isoleucine N-monooxygenase 1-like       597   0.0      
ref|XP_004252024.1|  PREDICTED: isoleucine N-monooxygenase 1-like       596   0.0      
gb|EYU45628.1|  hypothetical protein MIMGU_mgv1a023130mg                594   0.0      
ref|XP_002305081.2|  Cytochrome P450 79B2 family protein                593   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006387420.1|  hypothetical protein POPTR_1061s00200g             593   0.0      
ref|XP_009782885.1|  PREDICTED: isoleucine N-monooxygenase 2-like       593   0.0      
ref|XP_006486508.1|  PREDICTED: phenylalanine N-monooxygenase-like      591   0.0      
gb|AHF20913.1|  cytochrome P450                                         592   0.0      
ref|XP_008359055.1|  PREDICTED: isoleucine N-monooxygenase 1-like       596   0.0      
ref|XP_006435922.1|  hypothetical protein CICLE_v10031307mg             590   0.0      
ref|XP_007011293.1|  Cytochrome p450 79a2                               592   0.0      
ref|XP_002319424.1|  hypothetical protein POPTR_0013s15320g             590   0.0      Populus trichocarpa [western balsam poplar]
emb|CDP19033.1|  unnamed protein product                                587   0.0      
ref|XP_003543894.1|  PREDICTED: isoleucine N-monooxygenase 2-like       590   0.0      
ref|XP_011098373.1|  PREDICTED: valine N-monooxygenase 1-like           590   0.0      
gb|AHY21761.1|  cytochrome P450 79D15                                   589   0.0      
ref|XP_004139121.1|  PREDICTED: isoleucine N-monooxygenase 2-like       590   0.0      
ref|XP_009342222.1|  PREDICTED: isoleucine N-monooxygenase 1-like       590   0.0      
gb|AHI88992.1|  CYP79D6v4                                               589   0.0      
gb|KHG05899.1|  Phenylalanine N-monooxygenase -like protein             590   0.0      
gb|AHY21753.1|  cytochrome P450 79D15                                   588   0.0      
gb|AJD25192.1|  cytochrome P450 CYP79D40                                588   0.0      
gb|AHY21762.1|  cytochrome P450 79D15                                   587   0.0      
ref|XP_006435923.1|  hypothetical protein CICLE_v10031311mg             587   0.0      
ref|XP_011021045.1|  PREDICTED: isoleucine N-monooxygenase 2-like       588   0.0      
ref|XP_008450479.1|  PREDICTED: tyrosine N-monooxygenase-like           587   0.0      
ref|XP_009601899.1|  PREDICTED: LOW QUALITY PROTEIN: isoleucine N...    587   0.0      
gb|KEH34365.1|  cytochrome P450 family protein                          587   0.0      
gb|AHY21754.1|  cytochrome P450 79D15                                   583   0.0      
gb|AHY21746.1|  cytochrome P450 79D15                                   583   0.0      
ref|XP_011005474.1|  PREDICTED: cytochrome P450 79B1-like               584   0.0      
gb|AHY21794.1|  cytochrome P450 79D15                                   583   0.0      
ref|XP_003537358.1|  PREDICTED: isoleucine N-monooxygenase 2-like       584   0.0      
gb|AHY21755.1|  cytochrome P450 79D15                                   583   0.0      
gb|AHY21778.1|  cytochrome P450 79D15                                   582   0.0      
gb|AHY21758.1|  cytochrome P450 79D15                                   582   0.0      
gb|KHN24730.1|  Isoleucine N-monooxygenase 2                            583   0.0      
ref|XP_008385013.1|  PREDICTED: isoleucine N-monooxygenase 2-like       582   0.0      
gb|KHG04035.1|  Tyrosine N-monooxygenase                                583   0.0      
gb|ACB15184.1|  cytochrome P450                                         582   0.0      Trifolium repens [creeping white clover]
gb|AHY21742.1|  cytochrome P450 79D15                                   582   0.0      
gb|AHY21797.1|  cytochrome P450 79D15                                   582   0.0      
gb|AHY21757.1|  cytochrome P450 79D15                                   582   0.0      
gb|AHY21808.1|  cytochrome P450 79D15                                   582   0.0      
gb|ACB15165.1|  cytochrome P450                                         582   0.0      Trifolium repens [creeping white clover]
gb|AHY21801.1|  cytochrome P450 79D15                                   581   0.0      
gb|ACB15159.1|  cytochrome P450                                         581   0.0      Trifolium repens [creeping white clover]
gb|AHY21807.1|  cytochrome P450 79D15                                   581   0.0      
ref|XP_007017085.1|  Cytochrome p450 79a2, putative                     582   0.0      
gb|AHY21802.1|  cytochrome P450 79D15                                   580   0.0      
gb|AHY21806.1|  cytochrome P450 79D15                                   580   0.0      
gb|ACB15157.1|  cytochrome P450                                         580   0.0      Trifolium repens [creeping white clover]
gb|ACB15168.1|  cytochrome P450                                         580   0.0      Trifolium repens [creeping white clover]
gb|ACB15182.1|  cytochrome P450                                         579   0.0      Trifolium repens [creeping white clover]
gb|ACB15162.1|  cytochrome P450                                         579   0.0      Trifolium repens [creeping white clover]
gb|KCW54304.1|  hypothetical protein EUGRSUZ_I00267                     580   0.0      
ref|XP_010253086.1|  PREDICTED: phenylalanine N-monooxygenase           582   0.0      
gb|AHY21785.1|  cytochrome P450 79D15                                   579   0.0      
gb|ACB15183.1|  cytochrome P450                                         579   0.0      Trifolium repens [creeping white clover]
ref|XP_003556848.1|  PREDICTED: isoleucine N-monooxygenase 2-like       580   0.0      
gb|ACB15154.1|  cytochrome P450                                         579   0.0      Trifolium repens [creeping white clover]
gb|AHY21764.1|  cytochrome P450 79D15                                   579   0.0      
gb|ACB15193.1|  cytochrome P450                                         579   0.0      Trifolium isthmocarpum
ref|XP_008231301.1|  PREDICTED: isoleucine N-monooxygenase 2-like       580   0.0      
gb|AHY21782.1|  cytochrome P450 79D15                                   579   0.0      
gb|AHY21800.1|  cytochrome P450 79D15                                   579   0.0      
gb|AHY21767.1|  cytochrome P450 79D15                                   578   0.0      
gb|ACB15194.1|  cytochrome P450                                         578   0.0      Trifolium isthmocarpum
dbj|BAP15884.1|  cytochrome P450 79D16                                  579   0.0      
gb|AHY21765.1|  cytochrome P450 79D15                                   578   0.0      
gb|AHY21763.1|  cytochrome P450 79D15                                   578   0.0      
gb|AHY21799.1|  cytochrome P450 79D15                                   578   0.0      
gb|ACB15153.1|  cytochrome P450                                         577   0.0      Trifolium repens [creeping white clover]
gb|AHY21803.1|  cytochrome P450 79D15                                   577   0.0      
gb|AHY21751.1|  cytochrome P450 79D15                                   577   0.0      
gb|AHY21773.1|  cytochrome P450 79D15                                   577   0.0      
ref|XP_009354042.1|  PREDICTED: isoleucine N-monooxygenase 2-like       577   0.0      
gb|AHY21766.1|  cytochrome P450 79D15                                   577   0.0      
gb|AHY21790.1|  cytochrome P450 79D15                                   577   0.0      
ref|XP_008385015.1|  PREDICTED: isoleucine N-monooxygenase 1-like       578   0.0      
ref|XP_010030374.1|  PREDICTED: tyrosine N-monooxygenase-like           577   0.0      
ref|XP_006492162.1|  PREDICTED: phenylalanine N-monooxygenase-like      578   0.0      
gb|AHY21788.1|  cytochrome P450 79D15                                   576   0.0      
ref|XP_010030372.1|  PREDICTED: tyrosine N-monooxygenase-like           576   0.0      
ref|XP_010027351.1|  PREDICTED: tyrosine N-monooxygenase-like           576   0.0      
ref|XP_010030373.1|  PREDICTED: valine N-monooxygenase 1-like           576   0.0      
gb|ACB15191.1|  cytochrome P450                                         575   0.0      Trifolium nigrescens subsp. petrisavii
gb|AHY21774.1|  cytochrome P450 79D15                                   575   0.0      
gb|AHY21793.1|  cytochrome P450 79D15                                   574   0.0      
sp|Q9FLC8.1|C79A2_ARATH  RecName: Full=Phenylalanine N-monooxygen...    575   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_568153.1|  cytochrome P450 CYP79A2                               574   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDP45698.1|  hypothetical protein JCGZ_17305                         575   0.0      
gb|ACB15192.1|  cytochrome P450                                         573   0.0      Trifolium nigrescens subsp. petrisavii
ref|XP_006428266.1|  hypothetical protein CICLE_v10013842mg             572   0.0      
gb|KCW54305.1|  hypothetical protein EUGRSUZ_I00268                     572   0.0      
ref|XP_009354043.1|  PREDICTED: isoleucine N-monooxygenase 2-like       572   0.0      
gb|KHN48839.1|  Isoleucine N-monooxygenase 2                            569   0.0      
ref|XP_007203677.1|  hypothetical protein PRUPE_ppa026605mg             570   0.0      
gb|ACB15189.1|  cytochrome P450                                         570   0.0      Trifolium nigrescens subsp. petrisavii
ref|XP_006420514.1|  hypothetical protein CICLE_v10004690mg             571   0.0      
ref|XP_010491059.1|  PREDICTED: phenylalanine N-monooxygenase-like      570   0.0      
gb|AHY21791.1|  cytochrome P450 79D15                                   569   0.0      
ref|XP_007134794.1|  hypothetical protein PHAVU_010G076800g             570   0.0      
ref|XP_007011298.1|  Cytochrome p450 79a2                               570   0.0      
gb|AHY21787.1|  cytochrome P450 79D15                                   568   0.0      
gb|AHY21786.1|  cytochrome P450 79D15                                   568   0.0      
gb|ACB15190.1|  cytochrome P450                                         568   0.0      Trifolium nigrescens subsp. petrisavii
gb|AHY21798.1|  cytochrome P450 79D15                                   567   0.0      
gb|AHY21795.1|  cytochrome P450 79D15                                   567   0.0      
gb|KEH34486.1|  cytochrome P450 family protein                          567   0.0      
ref|XP_010456404.1|  PREDICTED: phenylalanine N-monooxygenase           566   0.0      
gb|KDP45703.1|  hypothetical protein JCGZ_17310                         565   0.0      
gb|KEH34491.1|  cytochrome P450 family protein                          565   0.0      
gb|KFK24947.1|  hypothetical protein AALP_AA8G046600                    565   0.0      
ref|XP_007145972.1|  hypothetical protein PHAVU_006G002300g             564   0.0      
ref|XP_002873202.1|  CYP79A2                                            563   0.0      
ref|XP_006464296.1|  PREDICTED: phenylalanine N-monooxygenase-like      563   0.0      
ref|XP_010110140.1|  Isoleucine N-monooxygenase 2                       560   0.0      
ref|XP_006464327.1|  PREDICTED: phenylalanine N-monooxygenase-like      562   0.0      
ref|XP_006428115.1|  hypothetical protein CICLE_v10025240mg             563   0.0      
ref|XP_006428111.1|  hypothetical protein CICLE_v10025237mg             562   0.0      
ref|XP_010543679.1|  PREDICTED: phenylalanine N-monooxygenase           560   0.0      
gb|KCW62239.1|  hypothetical protein EUGRSUZ_H04899                     559   0.0      
ref|XP_004509509.1|  PREDICTED: isoleucine N-monooxygenase 2-like       559   0.0      
ref|XP_002466099.1|  hypothetical protein SORBIDRAFT_01g001200          560   0.0      Sorghum bicolor [broomcorn]
gb|EMT15372.1|  Tyrosine N-monooxygenase                                559   0.0      
ref|XP_007207880.1|  hypothetical protein PRUPE_ppa021326mg             558   0.0      
ref|XP_008241408.1|  PREDICTED: isoleucine N-monooxygenase 2            558   0.0      
dbj|BAP15883.1|  cytochrome P450 79A68                                  558   0.0      
ref|XP_009125594.1|  PREDICTED: phenylalanine N-monooxygenase-like      558   0.0      
ref|XP_004237294.1|  PREDICTED: isoleucine N-monooxygenase 1-like       554   0.0      
ref|XP_004509430.1|  PREDICTED: isoleucine N-monooxygenase 2-like       556   0.0      
gb|ACR10256.1|  cytochrome P450 79a2                                    556   0.0      Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010059403.1|  PREDICTED: tyrosine N-monooxygenase-like           555   0.0      
ref|XP_006484922.1|  PREDICTED: phenylalanine N-monooxygenase-like      556   0.0      
gb|EMT13826.1|  Tyrosine N-monooxygenase                                555   0.0      
ref|XP_010526660.1|  PREDICTED: tryptophan N-monooxygenase 1-like       555   0.0      
gb|ADM34983.1|  CYP79D16                                                555   0.0      
gb|KHN24731.1|  Isoleucine N-monooxygenase 1                            553   0.0      
ref|XP_007203073.1|  hypothetical protein PRUPE_ppa023521mg             553   0.0      
ref|XP_006591735.1|  PREDICTED: isoleucine N-monooxygenase 1-like       554   0.0      
ref|XP_006289651.1|  hypothetical protein CARUB_v10003209mg             553   0.0      
ref|XP_010531370.1|  PREDICTED: tryptophan N-monooxygenase 1            553   0.0      
sp|Q9M7B8.1|C79D1_MANES  RecName: Full=Valine N-monooxygenase 1; ...    553   0.0      Manihot esculenta [manioc]
ref|XP_009122135.1|  PREDICTED: phenylalanine N-monooxygenase           551   0.0      
gb|AAV97889.1|  N-hydroxylating cytochrome P450 CYP79D1                 552   0.0      Manihot esculenta [manioc]
ref|XP_003629157.1|  Cytochrome P450                                    551   0.0      
ref|XP_006437149.1|  hypothetical protein CICLE_v10033385mg             554   0.0      
gb|KCW62254.1|  hypothetical protein EUGRSUZ_H04914                     550   0.0      
gb|KCW74807.1|  hypothetical protein EUGRSUZ_E03537                     547   0.0      
ref|XP_010555368.1|  PREDICTED: tryptophan N-monooxygenase 2-like       550   0.0      
ref|XP_003629158.1|  Cytochrome P450                                    548   0.0      
ref|XP_006605683.1|  PREDICTED: isoleucine N-monooxygenase 2-like       548   0.0      
ref|XP_004509432.1|  PREDICTED: isoleucine N-monooxygenase 2-like       547   0.0      
ref|XP_006486168.1|  PREDICTED: phenylalanine N-monooxygenase-like      545   0.0      
ref|XP_004967230.1|  PREDICTED: tyrosine N-monooxygenase-like           546   0.0      
ref|XP_008456975.1|  PREDICTED: isoleucine N-monooxygenase 1            545   0.0      
emb|CDP18412.1|  unnamed protein product                                540   0.0      
ref|XP_010059479.1|  PREDICTED: tyrosine N-monooxygenase-like           544   0.0      
ref|XP_010027354.1|  PREDICTED: tyrosine N-monooxygenase-like           550   0.0      
ref|XP_010027355.1|  PREDICTED: tyrosine N-monooxygenase-like           543   0.0      
gb|AGS49165.1|  cytochrome P450 CYP79B2                                 543   0.0      
gb|AGN12785.1|  tryptophan N-hydroxylase 1                              542   0.0      
emb|CDP21660.1|  unnamed protein product                                540   0.0      
ref|XP_010431975.1|  PREDICTED: tryptophan N-monooxygenase 1            541   0.0      
gb|KDP45699.1|  hypothetical protein JCGZ_17306                         538   0.0      
ref|XP_010446562.1|  PREDICTED: tryptophan N-monooxygenase 1-like       541   0.0      
ref|XP_010446588.1|  PREDICTED: tryptophan N-monooxygenase 1-like...    540   0.0      
ref|XP_010437120.1|  PREDICTED: tryptophan N-monooxygenase 1-like       540   0.0      
gb|AGN12803.1|  tryptophan N-hydroxylase 1                              540   0.0      
gb|AAN76810.1|AF453287_1  cytochrome P450                               540   0.0      Brassica napus [oilseed rape]
gb|ACR10253.1|  cytochrome P450 79b2                                    539   0.0      Brassica rapa subsp. pekinensis [bai cai]
emb|CDX69373.1|  BnaC01g00800D                                          539   0.0      
gb|KDP45693.1|  hypothetical protein JCGZ_17300                         537   0.0      
gb|AGM16417.1|  cytochrome P450 79B2                                    538   0.0      
emb|CDY63922.1|  BnaC07g51280D                                          538   0.0      
gb|KFK30571.1|  hypothetical protein AALP_AA7G279100                    538   0.0      
gb|ADW54459.1|  cytochrome P450 79B1                                    538   0.0      
ref|XP_010025546.1|  PREDICTED: tyrosine N-monooxygenase-like           537   0.0      
gb|AAV97888.1|  N-hydroxylating cytochrome P450 CYP79D2                 537   0.0      Manihot esculenta [manioc]
ref|XP_006411796.1|  hypothetical protein EUTSA_v10024861mg             537   0.0      
sp|Q9M7B7.1|C79D2_MANES  RecName: Full=Valine N-monooxygenase 2; ...    537   0.0      Manihot esculenta [manioc]
gb|AGC13081.1|  cytochrome P450 79B2                                    537   0.0      
ref|XP_002866896.1|  CYP79B2                                            537   0.0      
ref|XP_004966053.1|  PREDICTED: tyrosine N-monooxygenase-like           536   0.0      
sp|O81345.1|C79B1_SINAL  RecName: Full=Cytochrome P450 79B1             536   0.0      Sinapis alba [bai jie]
ref|XP_009129057.1|  PREDICTED: cytochrome P450 79B1                    535   0.0      
ref|XP_006480303.1|  PREDICTED: uncharacterized protein LOC102610907    557   0.0      
gb|KCW74950.1|  hypothetical protein EUGRSUZ_E03692                     534   0.0      
ref|XP_006367899.1|  PREDICTED: isoleucine N-monooxygenase 2-like       533   0.0      
ref|NP_195705.1|  tryptophan N-monooxygenase 1                          534   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AFV31131.1|  cytochrome P450 79B1                                    534   0.0      
ref|XP_009138546.1|  PREDICTED: cytochrome P450 79B1-like               533   0.0      
emb|CDY39472.1|  BnaC03g60820D                                          532   0.0      
ref|XP_006283476.1|  hypothetical protein CARUB_v10004524mg             533   0.0      
emb|CDY25587.1|  BnaA04g12790D                                          533   0.0      
gb|KDO39922.1|  hypothetical protein CISIN_1g035533mg                   531   1e-180   
emb|CBI25374.3|  unnamed protein product                                533   1e-180   
gb|KCW62253.1|  hypothetical protein EUGRSUZ_H04913                     530   2e-180   
emb|CDX90374.1|  BnaA08g16100D                                          531   2e-180   
ref|XP_002878610.1|  CYP79B3                                            531   3e-180   
ref|XP_010110139.1|  Phenylalanine N-monooxygenase                      528   4e-180   
ref|XP_009140345.1|  PREDICTED: tryptophan N-monooxygenase 2            530   1e-179   
ref|NP_179820.2|  tryptophan N-monooxygenase 2                          530   2e-179   Arabidopsis thaliana [mouse-ear cress]
gb|AAD22364.1|  putative cytochrome P450                                530   2e-179   Arabidopsis thaliana [mouse-ear cress]
gb|KDP29694.1|  hypothetical protein JCGZ_18629                         529   3e-179   
ref|XP_010472222.1|  PREDICTED: tryptophan N-monooxygenase 2            529   4e-179   
ref|XP_004295627.1|  PREDICTED: isoleucine N-monooxygenase 2-like       528   5e-179   
emb|CDY14122.1|  BnaC02g02390D                                          526   8e-179   
ref|XP_006404690.1|  hypothetical protein EUTSA_v10000114mg             528   8e-179   
ref|XP_008450367.1|  PREDICTED: isoleucine N-monooxygenase 1-like       527   8e-179   
gb|ABD84027.1|  cytochrome P450                                         527   1e-178   Bambusa ventricosa [Buddha bamboo]
dbj|BAF01576.1|  putative cytochrome P450                               526   3e-178   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32823.1|  hypothetical protein AALP_AA6G292300                    526   3e-178   
gb|KCW62252.1|  hypothetical protein EUGRSUZ_H04912                     523   5e-178   
gb|KDP20491.1|  hypothetical protein JCGZ_05367                         525   1e-177   
ref|XP_010416994.1|  PREDICTED: tryptophan N-monooxygenase 2-like       525   1e-177   
ref|XP_006296223.1|  hypothetical protein CARUB_v10025388mg             524   2e-177   
gb|KDP29696.1|  hypothetical protein JCGZ_18631                         523   5e-177   
ref|XP_002438593.1|  hypothetical protein SORBIDRAFT_10g022470          523   7e-177   Sorghum bicolor [broomcorn]
gb|ACR10255.1|  cytochrome P450 79b3                                    523   7e-177   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_006398988.1|  hypothetical protein EUTSA_v10015246mg             521   1e-176   
gb|ACJ70085.1|  cytochrome P450                                         520   3e-176   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004165284.1|  PREDICTED: isoleucine N-monooxygenase 2-like       518   4e-176   
gb|EMT05143.1|  Tyrosine N-monooxygenase                                521   7e-176   
gb|EMT03570.1|  Tyrosine N-monooxygenase                                529   2e-175   
dbj|BAK08222.1|  predicted protein                                      519   2e-175   
gb|ACM24114.1|  cytochrome P450                                         517   3e-175   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004146467.1|  PREDICTED: isoleucine N-monooxygenase 2-like       516   3e-175   
gb|EAZ29960.1|  hypothetical protein OsJ_14015                          516   9e-175   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ86038.1|  predicted protein                                      515   3e-174   
ref|XP_008450287.1|  PREDICTED: phenylalanine N-monooxygenase-lik...    516   4e-174   
emb|CAI44620.1|  B1168G10.4                                             514   6e-174   
ref|NP_001052148.1|  Os04g0171800                                       515   7e-174   
gb|KCW75037.1|  hypothetical protein EUGRSUZ_E03811                     508   2e-172   
ref|XP_002464334.1|  hypothetical protein SORBIDRAFT_01g016480          511   7e-172   
ref|XP_010045992.1|  PREDICTED: valine N-monooxygenase 1-like           508   1e-171   
gb|EMS67140.1|  Tyrosine N-monooxygenase                                509   2e-171   
gb|KCW84703.1|  hypothetical protein EUGRSUZ_B01522                     506   5e-171   
gb|EMT03957.1|  Tyrosine N-monooxygenase                                508   7e-171   
ref|XP_004154649.1|  PREDICTED: isoleucine N-monooxygenase 1-like       508   8e-171   
ref|XP_008659696.1|  PREDICTED: tyrosine N-monooxygenase-like           506   3e-170   
ref|XP_004151554.1|  PREDICTED: isoleucine N-monooxygenase 1-like       503   2e-169   
ref|NP_001050517.1|  Os03g0570100                                       504   2e-169   
gb|AAG59648.1|AC084319_6  putative cytochrome p450tyr                   503   3e-169   
emb|CBI25368.3|  unnamed protein product                                501   3e-169   
ref|XP_007011294.1|  Cytochrome p450 79a2                               497   1e-168   
ref|XP_004154686.1|  PREDICTED: isoleucine N-monooxygenase 1-like       501   1e-168   
emb|CDX98829.1|  BnaC09g50060D                                          496   3e-167   
gb|KDP45702.1|  hypothetical protein JCGZ_17309                         494   6e-167   
ref|XP_008450288.1|  PREDICTED: phenylalanine N-monooxygenase-lik...    496   1e-166   
ref|XP_003629369.1|  Cytochrome P450                                    496   2e-166   
ref|XP_003576933.1|  PREDICTED: tyrosine N-monooxygenase-like           495   4e-166   
gb|AGN12777.1|  tryptophan N-hydroxylase 1                              494   6e-166   
gb|EYU45630.1|  hypothetical protein MIMGU_mgv1a018745mg                489   9e-166   
ref|XP_002450980.1|  hypothetical protein SORBIDRAFT_05g022010          494   2e-165   
ref|XP_002464333.1|  hypothetical protein SORBIDRAFT_01g016470          493   6e-165   
gb|EMT14945.1|  Tyrosine N-monooxygenase                                491   1e-164   
ref|XP_002464329.1|  hypothetical protein SORBIDRAFT_01g016460          492   1e-164   
ref|XP_003576934.1|  PREDICTED: tyrosine N-monooxygenase-like           491   2e-164   
ref|XP_004139123.1|  PREDICTED: isoleucine N-monooxygenase 1-like       487   6e-164   
ref|XP_004151661.1|  PREDICTED: isoleucine N-monooxygenase 1-like       485   2e-163   
gb|EMT11661.1|  Tyrosine N-monooxygenase                                486   6e-163   
emb|CAH66094.1|  OSIGBa0114I04.1                                        482   3e-162   
ref|XP_002446424.1|  hypothetical protein SORBIDRAFT_06g015920          485   1e-161   
gb|EMT24111.1|  hypothetical protein F775_52527                         483   2e-161   
emb|CDX70164.1|  BnaA10g25130D                                          481   2e-161   
gb|AAF66544.1|AF140610_1  cytochrome P450 CYP79E2                       482   4e-161   
gb|EMS45429.1|  Tyrosine N-monooxygenase                                482   6e-161   
gb|KEH20391.1|  cytochrome P450 family protein                          481   7e-161   
gb|EMT14947.1|  Tyrosine N-monooxygenase                                478   3e-160   
ref|XP_008450368.1|  PREDICTED: isoleucine N-monooxygenase 1-like       480   4e-160   
ref|XP_002449720.1|  hypothetical protein SORBIDRAFT_05g022070          478   6e-160   
ref|NP_680351.1|  cytochrome P450, family 79, subfamily A, polype...    476   2e-159   
ref|XP_008644689.1|  PREDICTED: tyrosine N-monooxygenase-like           476   1e-158   
gb|EMT14944.1|  Tyrosine N-monooxygenase                                475   2e-158   
ref|XP_009600260.1|  PREDICTED: phenylalanine N-monooxygenase-like      479   1e-157   
ref|XP_003580014.1|  PREDICTED: tyrosine N-monooxygenase-like           473   2e-157   
gb|AAF66543.1|AF140609_1  cytochrome P450 CYP79E1                       472   4e-157   
ref|XP_004983125.1|  PREDICTED: tyrosine N-monooxygenase-like iso...    469   7e-156   
ref|XP_008808383.1|  PREDICTED: phenylalanine N-monooxygenase-like      466   8e-155   
ref|XP_010539173.1|  PREDICTED: dihomomethionine N-hydroxylase-like     467   2e-154   
ref|XP_010532014.1|  PREDICTED: tyrosine N-monooxygenase-like           465   3e-154   
gb|EEC74210.1|  hypothetical protein OsI_09370                          463   7e-154   
ref|XP_010519775.1|  PREDICTED: dihomomethionine N-hydroxylase-like     462   2e-153   
ref|XP_010537826.1|  PREDICTED: dihomomethionine N-hydroxylase-like     461   8e-153   
emb|CDP13907.1|  unnamed protein product                                459   1e-152   
ref|XP_008644663.1|  PREDICTED: tyrosine N-monooxygenase-like           461   2e-152   
gb|EMT08478.1|  Tyrosine N-monooxygenase                                456   8e-152   
gb|ACG29984.1|  cytochrome P450 CYP79A33                                457   6e-151   
ref|XP_006651559.1|  PREDICTED: tyrosine N-monooxygenase-like           452   9e-150   
ref|XP_006301603.1|  hypothetical protein CARUB_v10022042mg             452   2e-149   
ref|XP_002886713.1|  CYP79C2                                            449   4e-148   
ref|XP_007146887.1|  hypothetical protein PHAVU_006G0788000g            440   4e-147   
ref|XP_006411457.1|  hypothetical protein EUTSA_v10017915mg             445   8e-147   
gb|KFK37030.1|  hypothetical protein AALP_AA4G203000                    444   2e-146   
emb|CDY14795.1|  BnaC04g47920D                                          444   4e-146   
emb|CBI25370.3|  unnamed protein product                                442   6e-146   
ref|XP_010513418.1|  PREDICTED: hexahomomethionine N-hydroxylase        443   1e-145   
ref|XP_010529568.1|  PREDICTED: dihomomethionine N-hydroxylase-like     443   1e-145   
ref|NP_178055.2|  cytochrome P450, family 79, subfamily C, polype...    443   1e-145   
gb|EMT02883.1|  hypothetical protein F775_52211                         442   2e-145   
ref|NP_176122.2|  cytochrome p450 79c2                                  442   2e-145   
ref|NP_001052147.1|  Os04g0171600                                       439   1e-144   
emb|CDY06898.1|  BnaA04g24170D                                          439   2e-144   
tpg|DAA51522.1|  TPA: putative cytochrome P450 superfamily protein      440   4e-144   
ref|XP_008665466.1|  PREDICTED: tyrosine N-monooxygenase-like           439   4e-144   
ref|XP_002887782.1|  CYP79C1                                            439   5e-144   
ref|XP_009132654.1|  PREDICTED: dihomomethionine N-hydroxylase          438   5e-144   
gb|EMT22070.1|  hypothetical protein F775_52105                         439   1e-143   
ref|XP_009142023.1|  PREDICTED: dihomomethionine N-hydroxylase-like     435   7e-143   
gb|KFK25907.1|  hypothetical protein AALP_AA8G178100                    432   3e-142   
ref|XP_010508657.1|  PREDICTED: dihomomethionine N-hydroxylase-like     432   1e-141   
ref|XP_002863110.1|  predicted protein                                  429   2e-141   
ref|XP_010523407.1|  PREDICTED: dihomomethionine N-hydroxylase-like     434   3e-141   
ref|XP_010532334.1|  PREDICTED: dihomomethionine N-hydroxylase-like     431   5e-141   
ref|XP_006301545.1|  hypothetical protein CARUB_v10021979mg             430   1e-140   
ref|XP_006495331.1|  PREDICTED: phenylalanine N-monooxygenase-like      422   2e-140   
emb|CDY43061.1|  BnaA03g12080D                                          429   3e-140   
gb|EMS49024.1|  Tyrosine N-monooxygenase                                426   1e-139   
ref|XP_010532013.1|  PREDICTED: dihomomethionine N-hydroxylase-like     427   1e-139   
ref|XP_006293982.1|  hypothetical protein CARUB_v10022973mg             427   1e-139   
emb|CDY14123.1|  BnaC02g02400D                                          423   2e-139   
gb|KFK37032.1|  hypothetical protein AALP_AA4G203300                    425   5e-139   
emb|CBI25369.3|  unnamed protein product                                429   9e-139   
emb|CAN67567.1|  hypothetical protein VITISV_017718                     419   1e-138   
gb|AFR34028.1|  cytochrome P40 BCMA3                                    424   2e-138   
emb|CDY31634.1|  BnaA05g09130D                                          423   6e-138   
ref|XP_010474492.1|  PREDICTED: dihomomethionine N-hydroxylase          421   7e-138   
gb|AAD34693.1|AC006341_21  Similar to gb|AF069494 cytochrome P450...    422   8e-138   
ref|NP_563996.2|  dihomomethionine N-hydroxylase                        422   9e-138   
ref|XP_002890163.1|  CYP79F2                                            422   2e-137   
gb|KDP45692.1|  hypothetical protein JCGZ_17299                         417   1e-136   
gb|EEE60606.1|  hypothetical protein OsJ_14012                          416   6e-136   
ref|XP_010517680.1|  PREDICTED: dihomomethionine N-hydroxylase-like     417   7e-136   
emb|CAI44618.1|  B1168G10.2                                             416   9e-136   
gb|AFR34031.1|  cytochrome P450 BCMA3                                   417   2e-135   
ref|XP_009758130.1|  PREDICTED: isoleucine N-monooxygenase 2-like       411   2e-135   
gb|AFR34030.1|  cytochrome p450 BCMA2                                   416   3e-135   
gb|AFR34033.1|  cytochrome P450 BCMA3                                   416   4e-135   
ref|XP_002890164.1|  CYP79F1                                            415   6e-135   
gb|AAD03416.1|  cytochrome P450                                         409   1e-134   
ref|XP_008450475.1|  PREDICTED: LOW QUALITY PROTEIN: isoleucine N...    407   7e-134   
ref|XP_006416821.1|  hypothetical protein EUTSA_v10007301mg             412   8e-134   
gb|AFR34029.1|  cytochrome P450 BCMA1                                   411   3e-133   
ref|NP_563995.2|  Hexahomomethionine N-hydroxylase                      411   3e-133   
ref|XP_010497823.1|  PREDICTED: dihomomethionine N-hydroxylase-like     411   4e-133   
ref|XP_010476751.1|  PREDICTED: dihomomethionine N-hydroxylase          410   5e-133   
gb|AAG24796.1|  cytochrome P450 CYP79F2                                 410   5e-133   
gb|KFK43335.1|  hypothetical protein AALP_AA1G111500                    408   3e-132   
ref|XP_010497819.1|  PREDICTED: dihomomethionine N-hydroxylase-like     406   3e-131   
gb|EEC76870.1|  hypothetical protein OsI_15062                          399   9e-131   
ref|XP_009144065.1|  PREDICTED: dihomomethionine N-hydroxylase-like     405   2e-130   
ref|XP_006304976.1|  hypothetical protein CARUB_v10011470mg             403   4e-130   
gb|EAZ27538.1|  hypothetical protein OsJ_11492                          399   7e-130   
ref|XP_009149073.1|  PREDICTED: dihomomethionine N-hydroxylase-like     401   2e-129   
gb|ACR10252.1|  cytochrome P450 79f1                                    400   3e-129   
emb|CDY35091.1|  BnaA06g11010D                                          399   1e-128   
gb|AGO59948.1|  CYP79F1                                                 398   3e-128   
ref|XP_006305874.1|  hypothetical protein CARUB_v10010983mg             398   3e-128   
emb|CDY33331.1|  BnaC05g12520D                                          398   4e-128   
ref|XP_010459182.1|  PREDICTED: dihomomethionine N-hydroxylase-like     398   4e-128   
gb|ACB59213.1|  CYP79F1                                                 397   5e-128   
gb|ADC54226.1|  cytochrome P450 CYP79F1                                 396   2e-127   
gb|AGS49166.1|  cytochrome P450 CYP79F1                                 395   5e-127   
gb|KFK43843.1|  hypothetical protein AALP_AA1G181100                    394   9e-127   
ref|XP_010476752.1|  PREDICTED: dihomomethionine N-hydroxylase-like     393   2e-126   
emb|CDP18124.1|  unnamed protein product                                389   5e-126   
gb|AAD34692.1|AC006341_20  Similar to gb|AF069494 cytochrome P450...    391   1e-125   
ref|XP_004154687.1|  PREDICTED: isoleucine N-monooxygenase 1-like       383   2e-124   
gb|EEC70622.1|  hypothetical protein OsI_01880                          384   7e-124   
gb|KDP29695.1|  hypothetical protein JCGZ_18630                         374   7e-122   
ref|XP_010462740.1|  PREDICTED: dihomomethionine N-hydroxylase-like     378   2e-121   
emb|CDX99717.1|  BnaC02g36030D                                          374   7e-120   
gb|EMT29850.1|  Tyrosine N-monooxygenase                                360   8e-117   
gb|KDP45695.1|  hypothetical protein JCGZ_17302                         357   5e-115   
ref|XP_010532335.1|  PREDICTED: dihomomethionine N-hydroxylase-like     354   6e-113   
gb|EMT28582.1|  Tyrosine N-monooxygenase                                354   1e-112   
ref|XP_010429154.1|  PREDICTED: tryptophan N-monooxygenase 2-like       336   1e-107   
ref|XP_006404952.1|  hypothetical protein EUTSA_v10000278mg             331   1e-105   
emb|CDY04944.1|  BnaAnng01260D                                          325   1e-103   
emb|CDP12475.1|  unnamed protein product                                327   3e-103   
ref|XP_010905900.1|  PREDICTED: tyrosine N-monooxygenase-like           328   3e-103   
gb|KGN66523.1|  hypothetical protein Csa_1G617390                       325   3e-102   
emb|CBI25373.3|  unnamed protein product                                319   8e-102   
ref|XP_009785421.1|  PREDICTED: isoleucine N-monooxygenase 2-like       319   1e-101   
emb|CDP17747.1|  unnamed protein product                                323   3e-101   
gb|EMT08477.1|  Tyrosine N-monooxygenase                                327   7e-101   
ref|XP_010050614.1|  PREDICTED: tyrosine N-monooxygenase-like           315   9e-100   
ref|XP_006651654.1|  PREDICTED: tyrosine N-monooxygenase-like           317   1e-99    
gb|AAC17056.1|  Similar to cytochrome P450tyr gb|U32624 from Sorg...    318   1e-98    
ref|XP_006486509.1|  PREDICTED: tyrosine N-monooxygenase-like           308   9e-97    
gb|EMT29010.1|  Tyrosine N-monooxygenase                                309   2e-96    
ref|XP_010106336.1|  Isoleucine N-monooxygenase 2                       308   2e-96    
ref|XP_002523441.1|  cytochrome P450, putative                          306   1e-95    
emb|CBI24346.3|  unnamed protein product                                308   5e-95    
ref|XP_002523435.1|  cytochrome P450, putative                          306   1e-94    
ref|XP_002523438.1|  cytochrome P450, putative                          305   2e-94    
gb|KGN50755.1|  hypothetical protein Csa_5G223620                       301   1e-93    
ref|NP_973840.1|  dihomomethionine N-hydroxylase                        304   2e-93    
ref|XP_008366287.1|  PREDICTED: isoleucine N-monooxygenase 1-like       303   3e-93    
gb|ACG50668.1|  cytochrome P450 CYP79A2                                 299   6e-93    
gb|AGO81716.1|  CYP79A2                                                 292   3e-90    
ref|XP_008359054.1|  PREDICTED: tyrosine N-monooxygenase-like           290   6e-90    
ref|NP_001052153.1|  Os04g0174100                                       289   7e-90    
gb|KGN66528.1|  hypothetical protein Csa_1G620390                       292   1e-89    
ref|XP_009336813.1|  PREDICTED: cytochrome P450 703A2                   293   5e-88    
ref|XP_002523334.1|  flavonoid 3-hydroxylase, putative                  293   7e-88    
ref|XP_002978011.1|  hypothetical protein SELMODRAFT_108395             293   1e-87    
ref|XP_002966737.1|  hypothetical protein SELMODRAFT_168443             292   1e-87    
gb|KDP45691.1|  hypothetical protein JCGZ_17298                         283   2e-87    
gb|EYU32253.1|  hypothetical protein MIMGU_mgv1a004391mg                289   2e-86    
ref|XP_011093925.1|  PREDICTED: cytochrome P450 703A2                   289   3e-86    
ref|XP_010100729.1|  Flavonoid 3'-monooxygenase                         288   6e-86    
ref|XP_002990094.1|  hypothetical protein SELMODRAFT_43356              285   2e-85    
ref|XP_010529075.1|  PREDICTED: dihomomethionine N-hydroxylase-like     281   6e-85    
ref|XP_002534163.1|  cytochrome P450, putative                          278   2e-84    
ref|XP_009119683.1|  PREDICTED: cytochrome P450 703A2                   283   2e-84    
ref|XP_007220171.1|  hypothetical protein PRUPE_ppa016810mg             281   5e-84    
gb|KDP28480.1|  hypothetical protein JCGZ_14251                         282   6e-84    
ref|XP_006418407.1|  hypothetical protein EUTSA_v10007395mg             281   1e-83    
ref|XP_008349636.1|  PREDICTED: tyrosine N-monooxygenase-like           271   1e-83    
emb|CDP21012.1|  unnamed protein product                                280   2e-83    
ref|XP_003624793.1|  Flavonoid 3'-monooxygenase                         280   3e-83    
gb|EEE60610.1|  hypothetical protein OsJ_14019                          271   4e-83    
ref|XP_010501277.1|  PREDICTED: cytochrome P450 703A2                   280   4e-83    
emb|CAN74072.1|  hypothetical protein VITISV_035799                     277   8e-83    
ref|XP_003571355.1|  PREDICTED: cytochrome P450 703A2                   279   1e-82    
ref|XP_010665532.1|  PREDICTED: cytochrome P450 703A2                   279   1e-82    
ref|XP_008233175.1|  PREDICTED: cytochrome P450 703A2                   279   1e-82    
ref|XP_007051531.1|  Cytochrome P450, family 703, subfamily A, po...    279   1e-82    
gb|KFK42510.1|  hypothetical protein AALP_AA1G003300                    277   3e-82    
ref|XP_009358329.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine N-m...    267   4e-82    
gb|KDP29692.1|  hypothetical protein JCGZ_18627                         271   4e-82    
emb|CDP20032.1|  unnamed protein product                                277   4e-82    
ref|XP_010941811.1|  PREDICTED: cytochrome P450 703A2                   277   4e-82    
ref|XP_010474719.1|  PREDICTED: cytochrome P450 703A2-like              277   5e-82    
gb|EMS57417.1|  Flavonoid 3',5'-hydroxylase                             277   6e-82    
ref|XP_002263965.2|  PREDICTED: cytochrome P450 703A2                   276   1e-81    
gb|KDO86497.1|  hypothetical protein CISIN_1g045756mg                   276   2e-81    
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   275   2e-81    
gb|ABR16435.1|  unknown                                                 276   2e-81    
ref|XP_006491291.1|  PREDICTED: cytochrome P450 71A1-like               275   3e-81    
ref|XP_010275090.1|  PREDICTED: cytochrome P450 703A2                   275   5e-81    
emb|CAN79465.1|  hypothetical protein VITISV_035365                     274   5e-81    
ref|XP_004972929.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    275   5e-81    
dbj|BAK06020.1|  predicted protein                                      275   6e-81    
gb|ACN36201.1|  unknown                                                 275   7e-81    
ref|NP_001149251.1|  LOC100282873                                       275   7e-81    
ref|XP_009587545.1|  PREDICTED: cytochrome P450 703A2                   275   7e-81    
ref|XP_009118885.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    274   7e-81    



>ref|XP_006356653.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum tuberosum]
Length=495

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/492 (62%), Positives = 380/492 (77%), Gaps = 18/492 (4%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNK-PAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPKPWP++GS P++L NK P F WIH +M+EM TEIACIRLG  +VIP+TSPELA E
Sbjct  15    LPPGPKPWPIIGSFPQMLLNKDPPFHWIHKMMEEMNTEIACIRLGTIHVIPITSPELACE  74

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
             FL   DSIFSSRP CMSA LISNGYL+S+F+P G++W K RRIL SHVL+P +  WL +K
Sbjct  75    FLHTLDSIFSSRPICMSASLISNGYLTSVFVPMGDQWMKMRRILASHVLTPTSFQWLRSK  134

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGG  690
             R EEAD+L RFIYNQCK        +V+++R  TR+YCGNV + M+F+KR F     D  
Sbjct  135   RDEEADNLHRFIYNQCKNQ------SVINLRNLTRYYCGNVIRNMIFSKRLFDIIEED--  186

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
                  +EL+ A+FT+L+YL+   ++DY+PWLS+FDLDGHK II KA     KH+D +VD+
Sbjct  187   ----RDELVDALFTLLKYLHAFSISDYLPWLSVFDLDGHKKIIKKAYVTATKHIDVEVDQ  242

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RIQ+WKDG KT+EEDI+DVL+ LKD +G  +LS KEIK QVLE+M+A +DNPSNAVEWAL
Sbjct  243   RIQIWKDGNKTMEEDILDVLITLKDTNGNTLLSVKEIKAQVLELMLATVDNPSNAVEWAL  302

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+NQPKL++KA++E++ VVG  RLVQESDLP LNY+KAC++E FRLHPI+PF  PH+S
Sbjct  303   AEMLNQPKLMQKAIKELNTVVGINRLVQESDLPRLNYVKACIREAFRLHPISPFNVPHVS  362

Query  1231  TKDTVVG-GYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL---NGEDVVLTDSELK  1398
               D ++G  YFIPKGS+V++SR GLGRN R WEDPLKFKPERHL    G +VVLTDS+L+
Sbjct  363   ISDAIIGEKYFIPKGSRVLLSRLGLGRNPRVWEDPLKFKPERHLIKEGGGEVVLTDSKLR  422

Query  1399  MMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTE-SKHDLFLENPLF  1575
             ++SFS GRRGCPGVKLGS ++ ML+ARL+ GF W +P +  C DL E SK D F   PL 
Sbjct  423   LLSFSTGRRGCPGVKLGSTITTMLLARLLHGFAWSLPPNSSCNDLIESSKTDPFDTLPLL  482

Query  1576  ALAKPRLPSNLY  1611
             A AKPRL   +Y
Sbjct  483   AKAKPRLAKVMY  494



>emb|CDP20403.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/486 (59%), Positives = 370/486 (76%), Gaps = 6/486 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +P GPK  P  G I ++LRN+P  +WI+ VMD+M TEIAC R+ G ++IPVTSPELAREF
Sbjct  18    LPSGPKSLPFFGCIFQMLRNRPTHQWIYKVMDDMNTEIACFRIFGVHIIPVTSPELAREF  77

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
              KK DSIFS+RP CMSA L S GYL+++  P G+++ K +RI+ S VLSPA   WL +KR
Sbjct  78    FKKHDSIFSNRPVCMSAELSSEGYLTTILSPLGDQYKKMKRIIVSSVLSPAKHQWLHSKR  137

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEADHL+ ++YNQCK     A G +VD+R ATRHY GNV +KM+FNKR+FG G  DGGP
Sbjct  138   TEEADHLVNYVYNQCK---DDATGGLVDIRLATRHYFGNVIRKMIFNKRFFGKGMEDGGP  194

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             GA + E + A+F +L +LY   ++DY+PW+ IFD DGH+ ++T A+A  RKH D ++++R
Sbjct  195   GAEEVEHINALFKLLAHLYAFSLSDYMPWMKIFDFDGHRKVLTMAIACVRKHQDPEIEKR  254

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             I+MW+ G K  EED++DVL++LKDN+GRP+L+ +EI+ Q+ E+M A +DNPSNAVEWALA
Sbjct  255   IKMWESGLKNEEEDLLDVLIRLKDNNGRPLLTTEEIRAQITELMFATVDNPSNAVEWALA  314

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EM+NQP++L+KA EE+D VVG++RLVQESDL  L Y+KAC KE FRLHP APF  PH+S 
Sbjct  315   EMLNQPEMLQKATEEIDAVVGKDRLVQESDLARLKYVKACAKEAFRLHPYAPFNVPHVSA  374

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED---VVLTDSELKMM  1404
             +DTVVGGYFIPKGS VI+SR GLGRN R WED LKFKPERH+N  D   + L D E  M 
Sbjct  375   QDTVVGGYFIPKGSHVILSRPGLGRNPRIWEDSLKFKPERHMNHMDDARIDLNDPEFNMF  434

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGCPGV LGS ++VML+ARL+Q F W++P+ L  IDL E K   FL  PLFA+A
Sbjct  435   SFSTGRRGCPGVLLGSTLTVMLLARLLQCFNWKIPSGLSHIDLAEGKDAGFLAKPLFAVA  494

Query  1585  KPRLPS  1602
             +PR P 
Sbjct  495   EPRFPQ  500



>emb|CDP18411.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/532 (57%), Positives = 397/532 (75%), Gaps = 15/532 (3%)
 Frame = +1

Query  31    LRFSSIIFLP-----LALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSI  195
             L F SI ++P     +AL ++++ +  +WL    K     +   L +PPGPK  P  G I
Sbjct  13    LGFISISWIPFFSGFMALVSLVIFMMDKWLTICLKN----NKPRLPLPPGPKCLPFFGCI  68

Query  196   PEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRC  375
              ++LRN+P  RWI  VMD++ TEIACIR+ G ++IPVTSPELAREFLKKQDSIFSSRP  
Sbjct  69    FQMLRNRPTNRWICKVMDDLNTEIACIRIFGVHIIPVTSPELAREFLKKQDSIFSSRPVF  128

Query  376   MSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQ  555
             MSA L S G+L+++  P G+++ K +R++ S VLSPA   WL +KR EEADHL  ++YNQ
Sbjct  129   MSAELCSEGFLTTILSPLGDQYKKMKRMVVSSVLSPAKHQWLHSKRAEEADHLANYVYNQ  188

Query  556   CKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTI  735
             CK    +A G +VD+R  T+HYCGNVT+KM+FNKR+FG G  DGGPGA + E + A+F +
Sbjct  189   CK---GNATGGLVDIRLVTQHYCGNVTRKMIFNKRFFGKGMEDGGPGAEEVEHINALFKM  245

Query  736   LRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEED  915
             L +LY   V+DY+PW+ IFD DG+  I+T+A+A  RKH D ++++RI+MW+ G K  EED
Sbjct  246   LAHLYAFSVSDYMPWMKIFDFDGYGKILTEAIACVRKHQDPEIEKRIKMWESGVKKEEED  305

Query  916   IVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVE  1095
             ++DVL++LKD++GRP+L+ +EI+ Q+ E+M A +DNPSNAVEWALAEM+NQP++L+KA E
Sbjct  306   LLDVLIRLKDSNGRPLLTTEEIRAQITELMFAIVDNPSNAVEWALAEMLNQPEMLQKATE  365

Query  1096  EVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGS  1275
             E+D VVG++RLVQESDLP L Y+KACVKE FRLHP+APF  PH+ST+DTVVGGYFIPKGS
Sbjct  366   ELDAVVGKDRLVQESDLPRLKYVKACVKESFRLHPLAPFNVPHVSTQDTVVGGYFIPKGS  425

Query  1276  QVIISRTGLGRNKRAWEDPLKFKPERHLNGED---VVLTDSELKMMSFSAGRRGCPGVKL  1446
              VI+SR GL RN R WEDPLK+KPERH+   D   + L D EL M SFS GRRGCPGV L
Sbjct  426   HVILSRPGLSRNPRIWEDPLKYKPERHMKDMDDARMDLNDPELNMFSFSTGRRGCPGVLL  485

Query  1447  GSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             GS ++VML+ARL+Q F+W++P+    IDL E +   FL  PL A+A+PR P 
Sbjct  486   GSTLTVMLLARLLQCFSWKIPSGHSQIDLAECEDSGFLAKPLVAVAEPRFPQ  537



>ref|XP_011071674.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/518 (56%), Positives = 387/518 (75%), Gaps = 7/518 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             F  +L+++   +I K K+   +  +  S+PPG   +P++G  PE+++NKPAF WIH +M 
Sbjct  12    FLAVLALSFATMILK-KRLRLTKRTIPSLPPGLMGYPIIGCFPELMKNKPAFGWIHRLMQ  70

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             E+ TEIAC RLG  YVIPVTSPELAREFLKK D IF+SRP  +SA L SNGYL+++F P 
Sbjct  71    EINTEIACFRLGNAYVIPVTSPELAREFLKKHDVIFASRPDALSAKLTSNGYLTAIFSPN  130

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
              ++W K RR+L S VLSPA   WL  KR EEADH+ R++Y QC   ++     +V+VR  
Sbjct  131   DDQWRKMRRVLASEVLSPAMHQWLYGKRCEEADHVTRYVYKQC---QSPITDGLVNVRVV  187

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HYCGN+T+K++F+KR+FG+G  DGGPG  ++E L  +FTIL+Y+Y LG+ADY+PWL +
Sbjct  188   AQHYCGNLTRKLIFSKRFFGTGMEDGGPGVEEKEHLHGIFTILKYVYALGIADYLPWLEV  247

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
             FDLDGHK+I+  A+   RK+ D+++D+R+ MW+ G +  EED++DVL+ LKD +  P+LS
Sbjct  248   FDLDGHKTILKNAIRSVRKYQDSEIDKRVDMWQQGIRKTEEDVLDVLINLKDANNTPLLS  307

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              +EIK ++ EIM+A +DNPSNAVEWALAEMINQP +L +A +E+D VVGR++LV ESDL 
Sbjct  308   IEEIKAEIQEIMLATVDNPSNAVEWALAEMINQPDILHRACQELDQVVGRDKLVDESDLS  367

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              LNY+KAC KE FRLHP+ PF  PH+S+KDT+VGGYFIPKGSQV++SR GLGRN R WED
Sbjct  368   KLNYVKACAKEAFRLHPMVPFNVPHVSSKDTIVGGYFIPKGSQVLLSRLGLGRNPRIWED  427

Query  1330  PLKFKPERHLNGED--VVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWR  1503
             PL +KPERH+  +D  V+L D EL+M+SFS GRRGCPG+ LGS M+ +L+ARLIQGF W 
Sbjct  428   PLVYKPERHIVNKDSEVMLVDHELRMLSFSTGRRGCPGIMLGSTMTSILLARLIQGFNWN  487

Query  1504  VPADLPC-IDLTESKHDLFLENPLFALAKPRLPSNLYM  1614
              P +    IDL ES+ ++    PL A A PRL  ++Y+
Sbjct  488   APPNEQINIDLAESEGNMVKATPLIAHAVPRLEPHVYL  525



>ref|XP_011071563.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/490 (59%), Positives = 375/490 (77%), Gaps = 6/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPG   +P+VG  PE+++NKPAFRWIH  M E+ TEIAC RLG  YVIPVTSPELAREF
Sbjct  39    LPPGLMGYPIVGCFPEMMKNKPAFRWIHRFMQEINTEIACFRLGNAYVIPVTSPELAREF  98

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D IF+SRP  +SA L SNGYL+++F P G++W K RR+LTS VLSPA   WL  KR
Sbjct  99    LKKHDVIFASRPDALSAKLTSNGYLTAIFSPNGDQWKKMRRVLTSEVLSPAMHRWLYGKR  158

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEADH++R++Y QC   ++     +V+VR   +HYCGN+ +K++F+KR+FG+G  DGGP
Sbjct  159   CEEADHMIRYVYKQC---QSQFTDGLVNVRVVAQHYCGNLARKLIFSKRFFGTGMEDGGP  215

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  ++E L  +FTIL+Y+YGLG+ADY+PWL + DLDGHK+I+  A+   RK+ D+++D+R
Sbjct  216   GVEEKEHLHGIFTILKYVYGLGIADYLPWLEVLDLDGHKTILKNAIKSVRKYQDSEIDKR  275

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             + MW+ G +  EED++DVL+ LKD +  P+LS +EIK +++EIM+AA+DNPSNAVEWALA
Sbjct  276   VDMWQQGIRKTEEDVLDVLINLKDANNIPLLSIEEIKAEIIEIMLAAIDNPSNAVEWALA  335

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP +L +A +E+D VVGR+RLV ESDL  LNY+KAC KE FRLHP+ PF  PH+S+
Sbjct  336   EMINQPDILHRACQELDQVVGRDRLVDESDLSKLNYMKACAKEAFRLHPMVPFNVPHVSS  395

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMS  1407
             KDT+ GGYFIPKGSQV++SR GLGRN R WEDPL +KPERH+     +VVL D EL M+S
Sbjct  396   KDTIAGGYFIPKGSQVLLSRLGLGRNPRIWEDPLVYKPERHIVNKNSEVVLVDHELHMLS  455

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPAD-LPCIDLTESKHDLFLENPLFALA  1584
             FS GRRGCPG+ LGS M+ +L+ARLIQGF W  P +    IDLTES+ D+    PL A A
Sbjct  456   FSTGRRGCPGIVLGSTMTTILLARLIQGFNWSAPPNGQSNIDLTESEGDMVKATPLIAHA  515

Query  1585  KPRLPSNLYM  1614
              PRL  ++Y+
Sbjct  516   APRLEPHVYL  525



>ref|XP_004245410.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=488

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/493 (60%), Positives = 375/493 (76%), Gaps = 19/493 (4%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNK-PAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPKPWP++G+ P++L NK P F WIH +M++M TEIACIRLG  +VI VTSPELARE
Sbjct  7     LPPGPKPWPIIGNFPQMLLNKEPPFHWIHKMMEKMNTEIACIRLGNIHVITVTSPELARE  66

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
             FL  QDSIFSSRP CMSA LI+NGYL+ +F P G++W K RRIL SHVLSP +  W+ +K
Sbjct  67    FLHTQDSIFSSRPICMSASLINNGYLTPIFAPMGDQWKKMRRILASHVLSPTSLEWIRSK  126

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGG  690
             R EEAD+L RFIYNQC+        +++++R  TR+YCGNV + M F+K +F     D  
Sbjct  127   RDEEADNLHRFIYNQCENQ------SIINLRNLTRYYCGNVIRNMTFSKPFFDITEED--  178

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
                  +E + AVFT+L+YL+ LG+ DY+PWLS+FDL+GHK II  A     K +D +VD+
Sbjct  179   ----RDEQVDAVFTLLKYLHALGILDYLPWLSVFDLNGHKKIINNAYVTATKDMDVEVDQ  234

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RIQ+WKDG KT+EEDI+DVL+ LKD +G  +LS KEIK QVLE+M+AALDNPSNAVEW +
Sbjct  235   RIQIWKDGKKTMEEDILDVLITLKDTNGNALLSAKEIKAQVLELMLAALDNPSNAVEWVI  294

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+NQPKL++KA+EE++ VVG  RLVQESDLP LNY+KAC+KE FRLHPI PF  PH+S
Sbjct  295   AEMLNQPKLMQKALEELNTVVGINRLVQESDLPMLNYVKACIKEAFRLHPITPFNVPHVS  354

Query  1231  TKDTVVG-GYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL----NGEDVVLTDSEL  1395
               D ++G  YFIPKGS+V++SR GLGRN R WEDPLKFKPERHL     G +VVLTDS+L
Sbjct  355   ISDAIIGEKYFIPKGSRVLLSRLGLGRNPRVWEDPLKFKPERHLIEDGVGGEVVLTDSKL  414

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDL-TESKHDLFLENPL  1572
             +++SFS GRRGCPGVKLGS ++ ML+ARL+ GF+W +P +  C DL   SK D F   PL
Sbjct  415   RLLSFSTGRRGCPGVKLGSTIATMLLARLLHGFSWSLPPNSTCNDLIVSSKIDPFDTLPL  474

Query  1573  FALAKPRLPSNLY  1611
              A AKPRL   +Y
Sbjct  475   LAKAKPRLAKAMY  487



>emb|CDP19035.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/477 (60%), Positives = 372/477 (78%), Gaps = 6/477 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
              +G I ++LRN+P  RWI   MD++ TEIACIR+ G +VIPVTSPELAR+F KKQDSIFS
Sbjct  65    FIGCIFQMLRNRPTNRWICKFMDDLNTEIACIRIFGVHVIPVTSPELARQFCKKQDSIFS  124

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP CMSA L S G+L++   P G+++ K +R++ S VLSPA   WL +KR EEADHL+ 
Sbjct  125   SRPVCMSAELCSGGFLTTGLSPLGDQYKKMKRMVVSCVLSPAKHQWLHSKRAEEADHLVN  184

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YNQCK    +A G +VD+R  T+HYCGNV +KM+FNKR+FG G  DGGPGA + E + 
Sbjct  185   YVYNQCK---DNATGGLVDIRLVTQHYCGNVIRKMIFNKRFFGKGMEDGGPGAEEVEHIN  241

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+F IL YLY   ++DY+PW+ IFD DGH+ I+T+A+A  RKH D ++++RI+MW+ G K
Sbjct  242   ALFKILAYLYAFSLSDYMPWVKIFDFDGHRKILTEAVACVRKHQDPEIEKRIKMWESGLK  301

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
               EED++DVL++LKD++GRP+L+ +E++ Q+ E+M A +DNPSNAVEWALAEM+NQP++L
Sbjct  302   NEEEDLLDVLIRLKDSNGRPLLTTEEMRAQITELMFATVDNPSNAVEWALAEMLNQPEML  361

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             +KA EE+D VVG++RLVQESDLP L Y+KACV+E FRLHP+APF  PH+ST+DTVVGGYF
Sbjct  362   QKATEELDAVVGKDRLVQESDLPRLKYVKACVRESFRLHPLAPFNVPHVSTQDTVVGGYF  421

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL-NGED--VVLTDSELKMMSFSAGRRGC  1431
             IPKGS VI+SR GLGRN R WEDPLK+KPERH+ + ED  + L D EL M SFS GRRGC
Sbjct  422   IPKGSHVILSRPGLGRNPRIWEDPLKYKPERHMKDMEDARMDLNDPELNMFSFSTGRRGC  481

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             PGV LGS ++VML+ARL+Q F+W++P+    IDL E +   FL  PL A+A+PR P 
Sbjct  482   PGVLLGSTLTVMLLARLLQCFSWKIPSGHSQIDLAECEDAGFLAKPLVAVAEPRFPQ  538



>ref|XP_007146888.1| hypothetical protein PHAVU_006G078900g [Phaseolus vulgaris]
 gb|ESW18882.1| hypothetical protein PHAVU_006G078900g [Phaseolus vulgaris]
Length=537

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/488 (56%), Positives = 373/488 (76%), Gaps = 3/488 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGPKPWP+VG++PE+L NKPA++WIH +M +M TEIACIRLG  YVIPVTSP +A EF
Sbjct  49    LPPGPKPWPIVGNLPEMLANKPAYKWIHNLMKDMNTEIACIRLGNAYVIPVTSPTIATEF  108

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             L+KQD+ F+SR   MS  L+++GY +++F+P+G++W K ++I+T  +LSP    WL +KR
Sbjct  109   LRKQDATFASRSLSMSTELVTSGYSTTIFVPFGDQWKKMKKIVTKDLLSPHKHLWLHDKR  168

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+ ++YN+CK+     +  +V+VR A RHYCGN+ +K+ FN RYFG    DGGP
Sbjct  169   TEEADNLMFYVYNKCKMVN-DGISGLVNVRTAARHYCGNLIRKITFNARYFGKAREDGGP  227

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  + E + ++F +L Y+Y   V+DY+P L   DLDGH+  + +AL++ +K+ D  V +R
Sbjct  228   GLEEVEHVDSIFDLLNYIYSFSVSDYMPCLRALDLDGHEKKVKEALSIIKKYHDPIVQQR  287

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             I+ W DG K  EED +D+L+ LKD++  P L+ +EI  Q++E+M+A +DNPSNA EWALA
Sbjct  288   IKQWNDGLKVDEEDWLDILISLKDSNNNPSLTLEEINAQIIELMLATVDNPSNAFEWALA  347

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP+LL +AVEE+D+VVG++R+VQESD+P LNY+KAC KE FRLHPIAPF PPH+S 
Sbjct  348   EMINQPELLHRAVEELDSVVGKDRMVQESDIPKLNYVKACAKEAFRLHPIAPFIPPHVSM  407

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMS  1407
              DT+VG YFIPKGS V++SR  LGRN + W +P KFKPERHL  +G+DVVLT+  LK++S
Sbjct  408   SDTMVGNYFIPKGSHVLLSRQELGRNPKVWNEPYKFKPERHLKSDGDDVVLTEPNLKLIS  467

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS GRRGCPGV LG+ M+VML ARL+ GFTW  P ++  I+L+ES HD+ L  PL A+A 
Sbjct  468   FSTGRRGCPGVMLGTTMTVMLFARLLHGFTWTAPPNVSTINLSESDHDILLAQPLLAVAH  527

Query  1588  PRLPSNLY  1611
             PRLP+ L+
Sbjct  528   PRLPTQLF  535



>ref|XP_002276655.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=554

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/542 (53%), Positives = 395/542 (73%), Gaps = 17/542 (3%)
 Frame = +1

Query  37    FSSIIFL-PLALFTV------------MLSVTIQWLIYKTKKWYGssssslsIPPGPKPW  177
             FSS++FL P    T+                +I +++ K K    ++S ++ +PPGP PW
Sbjct  10    FSSVLFLSPANAATIDDLLSHLNFLLLTFITSIFFILTKFKFKTSTNSKAMLLPPGPAPW  69

Query  178   PLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIF  357
             PLV ++P +L NKP FRWIHG M EM TEIACI+LG  +VIPVTSPE+++EFLKK D++F
Sbjct  70    PLVRNLPHLLNNKPTFRWIHGFMKEMNTEIACIQLGNVHVIPVTSPEISKEFLKKHDAVF  129

Query  358   SSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLL  537
             +SRP  M++   S G+L++  +P+G++W K RR+L S+V++P+T  WL +KRVEE D+L+
Sbjct  130   ASRPITMASEYSSGGFLTTAVVPWGDQWKKMRRVLASNVINPSTFRWLHDKRVEETDNLV  189

Query  538   RFIYNQCKISEAS-AMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEEL  714
             R++YNQCKIS ++  +G+V+++R   R Y GN  +KM+ N RYFG G  DGGPG  +E+ 
Sbjct  190   RYVYNQCKISTSNNCLGSVINLRNTARQYSGNAIRKMILNTRYFGEGKKDGGPGVEEEQH  249

Query  715   LKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDG  894
             ++++FT+L +LY   ++DY PWL + D+DGH+  + +A+    K+ D  VD+R++ W++G
Sbjct  250   VESLFTVLAHLYAFSLSDYFPWLRVLDIDGHEKTVREAMNTINKYHDPIVDQRVEQWRNG  309

Query  895   TKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPK  1074
              K   ED++DV + +KD++G P+LS  EIK Q  E+M+AA+DNPSNA+EWALAEMINQP+
Sbjct  310   EKKEAEDLLDVFISVKDSNGEPLLSVAEIKAQCTELMLAAVDNPSNAIEWALAEMINQPR  369

Query  1075  LLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGG  1254
             +L KAVEE+D VVG+ERLVQESD   LNY+KAC+KE FRLHPIAPF  PH+S  D +V G
Sbjct  370   VLGKAVEEIDRVVGKERLVQESDFQQLNYVKACIKEAFRLHPIAPFNLPHVSNADAIVAG  429

Query  1255  YFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN---GEDVVLTDSELKMMSFSAGRR  1425
             YFIPKGS V++SR GLGRN R WE+PL F PERHL+    + V L + +L+++SFS GRR
Sbjct  430   YFIPKGSHVLLSRLGLGRNPRIWEEPLIFNPERHLSASRAQGVDLNEQDLRLISFSTGRR  489

Query  1426  GCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSN  1605
             GC G+  GS M+VML+ RL+QGFTW  P     IDL+ES++DLFL  PL ALAKPRL S+
Sbjct  490   GCTGIAFGSAMTVMLLVRLLQGFTWSPPPGQEEIDLSESRNDLFLAKPLHALAKPRLHSS  549

Query  1606  LY  1611
             LY
Sbjct  550   LY  551



>ref|XP_011071673.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=528

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/529 (55%), Positives = 385/529 (73%), Gaps = 16/529 (3%)
 Frame = +1

Query  43    SIIFLPLALFTVMLSVTI---QWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRN  213
             S  F+ L+L   +   T    +WL  K ++       +  +PPG   +P++G  PE+++N
Sbjct  6     SSFFINLSLLLALYFATKIFNKWLCLKKRR-------TPPLPPGIMGYPIIGCFPEMMKN  58

Query  214   KPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLI  393
             KP  RW+H +M EM TEIACIRLG T+VI VTSPELAREFL+KQD IF+SR   +SA L 
Sbjct  59    KPTSRWVHQLMQEMNTEIACIRLGNTHVIFVTSPELAREFLRKQDVIFASRADVLSAKLT  118

Query  394   SNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEA  573
             SNGYL+++F P  ++W K RR++ + VLSP    WL  KRVEE+DHL+R+++ Q   S++
Sbjct  119   SNGYLTAIFSPNCDQWKKMRRVIATKVLSPTAHRWLHGKRVEESDHLVRYVFKQ---SQS  175

Query  574   SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYG  753
                   V+VR A +HYCGN+ +K++FNKR+FGSG  DGGPG  ++E L+ VFTIL+Y+YG
Sbjct  176   PLTNGFVNVRVAAQHYCGNMARKLIFNKRFFGSGMEDGGPGMEEKEHLQGVFTILKYVYG  235

Query  754   LGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLV  933
              G+ADY+PWL +FDLDGHK I+  AL   RK+ D ++++R++MW+ G KT+EEDI+DVL+
Sbjct  236   FGIADYLPWLEVFDLDGHKRILKDALKRVRKYQDPEIEKRVEMWQRGMKTIEEDILDVLI  295

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
              LKD++   +LS +EIK ++ E+M+A +DNPSNAVEW+LAEMINQP +L +A +E+D VV
Sbjct  296   NLKDSNNNSLLSIQEIKAEITELMLATIDNPSNAVEWSLAEMINQPDILNRACKELDQVV  355

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             G++RLV ESDLP LNY+KAC KE FRLHPI PF  PH+S KD  VGGYFIPKGS V++SR
Sbjct  356   GKDRLVDESDLPMLNYVKACAKEAFRLHPIVPFNVPHVSVKDATVGGYFIPKGSHVLLSR  415

Query  1294  TGLGRNKRAWEDPLKFKPERHLNGED--VVLTDSELKMMSFSAGRRGCPGVKLGSLMSVM  1467
              GLGRN R WEDPL +KPERH+  +D  V+L D EL M+SFS GRRGCPGV LGS+M+ +
Sbjct  416   RGLGRNPRVWEDPLVYKPERHIVSKDSEVMLVDHELCMLSFSTGRRGCPGVVLGSIMTTI  475

Query  1468  LMARLIQGFTWRVPAD-LPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             L+ARLIQGF W  P + L  IDL ES   L +  PL A A PRL   +Y
Sbjct  476   LLARLIQGFVWTTPHNGLSNIDLVESDGGLLMAKPLIAQAVPRLEPQVY  524



>emb|CAN75997.1| hypothetical protein VITISV_022990 [Vitis vinifera]
Length=495

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/490 (56%), Positives = 373/490 (76%), Gaps = 4/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWPLV ++P +L NKP FRWIHG M EM TEIACI+LG  +VIPVTSPE+++EF
Sbjct  3     LPPGPAPWPLVRNLPHLLNNKPTFRWIHGFMKEMNTEIACIQLGNVHVIPVTSPEISKEF  62

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D++F+SRP  M++   S G+L++  +P+G++W K RR+L S+V++P+T  WL +KR
Sbjct  63    LKKHDAVFASRPITMASEYSSGGFLTTAVVPWGDQWKKMRRVLASNVINPSTFRWLHDKR  122

Query  514   VEEADHLLRFIYNQCKISEAS-AMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGG  690
             VEE D+L+R++YNQCKIS ++  +G+V+++R   R Y GN  +KM+ N RYFG G  DGG
Sbjct  123   VEEXDNLVRYVYNQCKISTSNNCLGSVINLRNTARQYSGNAIRKMILNTRYFGEGKKDGG  182

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             PG  +E+ ++++FT+L +LY   ++DY PWL + D+DGH+  + +A+    K+ D  VD+
Sbjct  183   PGVEEEQHVESLFTVLAHLYAFSLSDYFPWLRVLDIDGHEKTVREAMNTINKYHDPIVDQ  242

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             R++ W++G K   ED++DV + +KD++G P+LS  EIK Q  E+M+AA+DNPSNA+EWAL
Sbjct  243   RVEQWRNGEKKEAEDLLDVFISVKDSNGEPLLSVAEIKAQCTELMLAAVDNPSNAIEWAL  302

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEMINQP++L KAVEE+D VVG+ERLVQESD   LNY+KAC+KE FRLHPIAPF  PH+S
Sbjct  303   AEMINQPRVLGKAVEEIDRVVGKERLVQESDFQQLNYVKACIKEAFRLHPIAPFNLPHVS  362

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN---GEDVVLTDSELKM  1401
               D +V GYFIPKGS V++SR GLGRN R WE+PL F PERHL+    + V L + +L++
Sbjct  363   NADAIVAGYFIPKGSHVLLSRLGLGRNPRIWEEPLIFNPERHLSASRAQGVDLNEQDLRL  422

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFS GRRGC G+  GS M+VML+ RL+QGFTW  P     IDL+ES++DLFL  PL AL
Sbjct  423   ISFSTGRRGCTGIAFGSAMTVMLLVRLLQGFTWSPPPGQEEIDLSESRNDLFLAKPLNAL  482

Query  1582  AKPRLPSNLY  1611
             AKPRL S+LY
Sbjct  483   AKPRLHSSLY  492



>ref|XP_006367541.1| PREDICTED: isoleucine N-monooxygenase 1-like, partial [Solanum 
tuberosum]
Length=507

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/520 (58%), Positives = 391/520 (75%), Gaps = 25/520 (5%)
 Frame = +1

Query  79    MLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEI-LRNKPAF-RWIHGVMDE  252
             +LSV +   +Y    + G   ++   PP PK WP++ S+P+I L+NK  F  WIH +M+E
Sbjct  5     VLSVVLSIFLYT---FVGKVRNNKPFPPCPKSWPIIRSLPQIFLKNKTTFIYWIHKIMEE  61

Query  253   MKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYG  432
             M TEIACI LG  +VIP+TSPELA EFLK QDSIFSSRP CMSA LISN YL+S+FLP G
Sbjct  62    MNTEIACIFLGKVHVIPITSPELACEFLKIQDSIFSSRPICMSASLISNNYLTSVFLPIG  121

Query  433   EEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQAT  612
             ++W K R+IL SHVLSP +  WL  KR E  D L++F+YNQC   +      V+++R+ T
Sbjct  122   DQWMKMRKILASHVLSPTSFQWLRPKRDEAIDDLVQFVYNQCINQQ------VINLRKVT  175

Query  613   RHYCGNVTKKMLFNKR-YFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
             R YCGNV + M++NKR  FGS          +EE + A+FT+L+YL+  G++DY+PWLS+
Sbjct  176   RCYCGNVIRNMIYNKRSLFGSIE--------EEEQVDALFTLLKYLHCFGISDYLPWLSV  227

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
             FDLDGHK+II KA  +  K +D +VD RIQ+WKDG K +EEDI+DVL+ LKD++G P+++
Sbjct  228   FDLDGHKAIIKKAYDIATKQIDIEVDHRIQIWKDGNKILEEDILDVLIMLKDDNGNPLMN  287

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK QVLE+M+A +DNPSNAVEW LAEM+NQPKL++KA++E++NVVG  RLVQESDLP
Sbjct  288   VKEIKAQVLELMLATVDNPSNAVEWTLAEMLNQPKLMQKALKELNNVVGMNRLVQESDLP  347

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVG-GYFIPKGSQVIISRTGLGRNKRAWE  1326
              LNY+KAC+KE FRLHPI+PF  PH+S  DT++G  YFIPKGS V++SR GLGRN R W+
Sbjct  348   RLNYVKACIKEAFRLHPISPFNVPHVSVSDTIIGEKYFIPKGSIVLLSRLGLGRNPRVWK  407

Query  1327  DPLKFKPERHL---NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFT  1497
             DPLKFKPERHL   +G++VVLTDS+L+++SFS GRRGCP VKLGS ++ ML+ARL+Q FT
Sbjct  408   DPLKFKPERHLKKKDGDEVVLTDSKLRLLSFSIGRRGCPAVKLGSTITTMLLARLLQEFT  467

Query  1498  WRVPADLPCIDLTE-SKHDLFLENPLFALAKPRLPSNLYM  1614
             W +P +  C DL E SK D F   PL A AKPRL  ++Y+
Sbjct  468   WSLPPNSSCNDLIESSKIDHFCTLPLLAQAKPRLAKDMYL  507



>ref|XP_011071676.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=530

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/517 (56%), Positives = 386/517 (75%), Gaps = 6/517 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             F  +L+++   +I   K+   +  +  S+PPG   +P+VG  PE+++NKPAFRWIH  M 
Sbjct  12    FLALLALSFATMILMNKRLRLTKRTIPSLPPGLMGYPIVGCFPEMMKNKPAFRWIHRFMQ  71

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             E+ TEIAC RLG  Y+IPVTSPELAREFLK+ D IF+SRP  +SA L SNGYL+++F P 
Sbjct  72    EINTEIACFRLGNAYIIPVTSPELAREFLKEHDVIFASRPDALSAKLTSNGYLTAIFSPN  131

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             G++W K RR+LTS VLSPA   WL  KR EEADH++R++Y QC   ++     +V+VR  
Sbjct  132   GDQWKKMRRVLTSEVLSPAMHRWLYGKRCEEADHMMRYVYKQC---QSPMTDGLVNVRVV  188

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HYCGN+ +K++F+KR+FG+G  DGGPG  ++E L  +FTIL+YLYGLG+ADY+PWL +
Sbjct  189   AQHYCGNLARKLIFSKRFFGTGMEDGGPGVEEKEHLHGIFTILKYLYGLGIADYLPWLEV  248

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGHK+I+  A+   RK+ D+++D+R  +W+ G    EED++DVL+ LKD +  P+LS
Sbjct  249   LDLDGHKTILKNAIKSVRKYQDSEIDKRFDVWQQGIWKTEEDVLDVLINLKDANNIPLLS  308

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              +EIK +++EIM+AA+DNPSNAVEWALAEMINQP +L +A +E+D VVGR+RLV ESDL 
Sbjct  309   IEEIKAEIIEIMLAAVDNPSNAVEWALAEMINQPDILYRACQELDQVVGRDRLVDESDLS  368

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              LNY+KAC KE FRLHP+ PF  PH+S+KDT+VGGY IPKGSQV++SR GLGRN R WED
Sbjct  369   KLNYVKACAKEAFRLHPMVPFNLPHVSSKDTIVGGYLIPKGSQVLLSRPGLGRNPRIWED  428

Query  1330  PLKFKPERHLNGED--VVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWR  1503
             PL +KPERH+  +D  VVL D EL+M+SFS GRRGCPG+ LGS M+ +L+ARLIQGF W 
Sbjct  429   PLMYKPERHIVNKDSEVVLVDHELRMLSFSTGRRGCPGIVLGSTMTTILLARLIQGFNWS  488

Query  1504  VPAD-LPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              P +    IDL ES+ D+    PL A A PRL  ++Y
Sbjct  489   TPPNGQSNIDLAESEGDMVKATPLIAHAVPRLELHVY  525



>ref|XP_011084186.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=523

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/489 (58%), Positives = 371/489 (76%), Gaps = 13/489 (3%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  +P+VG +P+++ NKPAF+WIH +M E+ TEIACIRLG  YVIPVTSPELAREF
Sbjct  40    LPPGPMGYPIVGCLPKLIMNKPAFQWIHQLMQEINTEIACIRLGNAYVIPVTSPELAREF  99

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK+D  F+SRP  +SA L SNGYL++ F P G++W K RR++ S VLSPA   WL  KR
Sbjct  100   LKKEDVNFASRPEALSAKLTSNGYLTAAFCPNGDQWKKMRRVIASEVLSPAMHRWLHRKR  159

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEADH++R++Y QC   ++     +V+VR   +HYCGN+T+ ++F+KR+FG+G  DGGP
Sbjct  160   CEEADHVVRYVYKQC---QSPIRNGLVNVRVVAQHYCGNLTRNLIFSKRFFGTGMEDGGP  216

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  ++E L  +FTIL+++YG GV+DY+PWL +FDLDGHK I+  AL    K+ D ++++R
Sbjct  217   GVEEKEHLHGLFTILKHVYGFGVSDYLPWLEVFDLDGHKRILKTALKSMSKYHDLEINKR  276

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             +++W+ G K  EEDI+DVL+ LKD++  P+LS +EIK Q++EIM+A++DNPSNAVEWALA
Sbjct  277   VEVWRQGMKNTEEDILDVLINLKDSNNNPLLSTQEIKAQLIEIMLASVDNPSNAVEWALA  336

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP +L +A EE+D VVGR+RLV ESDL  LNY+KAC KE FRLHP+ PF  PH+S 
Sbjct  337   EMINQPNILNRACEELDQVVGRDRLVDESDLSKLNYVKACAKEAFRLHPMVPFNVPHVSI  396

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED--VVLTDSELKMMS  1407
             +DTVVGGYFIPKGSQV++SR GLGRN R WEDPL +KPERH+  +D  VVL D EL+M+S
Sbjct  397   EDTVVGGYFIPKGSQVLLSRLGLGRNPRVWEDPLVYKPERHIVDKDSEVVLVDHELRMIS  456

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPC-IDLTESKHDLFLENPLFALA  1584
             FS GRRGCPG+ LGS M+ +L+ARLIQGF W  P      ID  E++       PL A A
Sbjct  457   FSTGRRGCPGIVLGSTMTTILLARLIQGFNWTTPPTGSINIDYAEAE-------PLIAHA  509

Query  1585  KPRLPSNLY  1611
              PRL  ++Y
Sbjct  510   VPRLAPHVY  518



>ref|XP_003633447.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=495

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/490 (57%), Positives = 371/490 (76%), Gaps = 4/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWPLVG++PE+L  KP FRWI G+++E+ TEIACI+LG  +VIPV SPE+AREF
Sbjct  4     LPPGPTPWPLVGNLPELLTKKPVFRWILGLLEELNTEIACIKLGNVHVIPVISPEIAREF  63

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D++F+SRP  M++  +S G+L++   P+GE+W K RRI+ S VL P    WL+ KR
Sbjct  64    LKKHDAVFASRPITMASHHLSRGFLTTALSPWGEQWKKMRRIIISEVLKPERHIWLLQKR  123

Query  514   VEEADHLLRFIYNQCKISEASAMG----AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA  681
              EEAD+L+RFIYNQCK S  ++      +VV+VR A R Y GNV +KM+F++RYFG G  
Sbjct  124   TEEADNLVRFIYNQCKFSSITSHNITDSSVVNVRNAVRQYTGNVVRKMMFSRRYFGEGRK  183

Query  682   DGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQ  861
             DGGPG  +EE + ++FT+L YLY    +DY+P L +FDLDGH++++  AL++  KH D  
Sbjct  184   DGGPGLEEEEHVNSLFTLLAYLYSFSPSDYLPCLRVFDLDGHETMVKDALSIINKHHDPI  243

Query  862   VDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             VDERI  W++G K   EDI+DV + + D  G+P+LS +EIK Q++E+MI  +DNP++A E
Sbjct  244   VDERIIQWRNGEKKEVEDILDVFLTISDTKGKPLLSVEEIKAQLIELMIEIVDNPAHAAE  303

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP++++KAVEE+D VVG++RLVQESD+  L Y+KAC +E  RLHP+APF  P
Sbjct  304   WAMAEMINQPEIMQKAVEEIDRVVGKDRLVQESDIAQLKYVKACAREALRLHPMAPFNVP  363

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKM  1401
             H+S  D VV GYFIPKGS V++SR GLGRN R WE+PLKFKPERH+N E V L + EL+ 
Sbjct  364   HVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEVVDLAEHELRF  423

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFS GRRGCPG  LG+ ++V L+ARL+Q F+W VP +   IDLTES ++LFL  PL A 
Sbjct  424   ISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMNELFLAKPLHAH  483

Query  1582  AKPRLPSNLY  1611
             AKPRLP+++Y
Sbjct  484   AKPRLPASMY  493



>ref|XP_002274952.2| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=495

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/490 (57%), Positives = 369/490 (75%), Gaps = 4/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWPLVG++PE+   KP FRWI G+++E+ TEIACI+LG  +VIPV SPE+AREF
Sbjct  4     LPPGPTPWPLVGNLPELFTKKPVFRWILGLLEELNTEIACIKLGNVHVIPVISPEIAREF  63

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D++F+SRP  M++  +S G+L+++  P+GE+W K RRI+TS VL PA   WL+ KR
Sbjct  64    LKKHDAVFASRPITMTSDHLSRGFLTTVLSPWGEQWKKMRRIITSEVLKPARHMWLLQKR  123

Query  514   VEEADHLLRFIYNQCKISEASAMG----AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA  681
              EEAD+L+RFIYNQCK S  ++      +VV+VR   R Y GNV +KM+F++RYFG G  
Sbjct  124   TEEADNLVRFIYNQCKFSSITSHNFTESSVVNVRNTVRQYTGNVVRKMMFSRRYFGEGRK  183

Query  682   DGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQ  861
             DGGPG  +EE + ++FT L YLY    +DY+P L +FDLDGH+ ++ +AL +  KH D  
Sbjct  184   DGGPGLEEEEHVNSLFTTLAYLYVFSPSDYLPCLRVFDLDGHEKMVKEALRIINKHHDPI  243

Query  862   VDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             VDERI  W++G K   EDI+DV + + D  G+P+LS +EIK Q++E+MI  +DNP++A E
Sbjct  244   VDERIIQWRNGEKKEVEDILDVFITISDTKGKPLLSVEEIKAQLIELMIEIVDNPAHAAE  303

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP++++KAVEE+D VVG++RLVQESD+  L Y+KAC +E  RLHPIAPF  P
Sbjct  304   WAMAEMINQPEIMQKAVEEIDRVVGKDRLVQESDIAQLKYVKACAREALRLHPIAPFNVP  363

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKM  1401
             H+S  D VV GYFIPKGS V++SR GLGRN R WE+PLKFKPERH+N E V L + EL+ 
Sbjct  364   HVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEVVDLAEPELRF  423

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFS GRRGCPG  LG+ ++V L+ARL+Q F+W VP +   IDLTES +DLFL  PL A 
Sbjct  424   ISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMNDLFLAKPLHAH  483

Query  1582  AKPRLPSNLY  1611
             AKPRL +++Y
Sbjct  484   AKPRLHASMY  493



>gb|AHF20912.1| cytochrome P450 [Populus trichocarpa]
Length=528

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/525 (54%), Positives = 374/525 (71%), Gaps = 7/525 (1%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWY----GssssslsIPPGPKPWPLVGSIPEILRNKP  219
             +L    FT +LS T   L+     +Y      +     +PPGPK WP+VG +P +LRNKP
Sbjct  3     YLAPTSFTTLLSFTASLLVLAIILFYFIQSHKNVKKHPLPPGPKRWPIVGCLPTMLRNKP  62

Query  220   AFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISN  399
              +RWIH +M EM TEIACIRLG  +VIPV  P++A EFLK QD+ F+SRP  M+  LIS 
Sbjct  63    VYRWIHNLMKEMNTEIACIRLGNVHVIPVICPDIACEFLKAQDNTFASRPHTMTTDLISR  122

Query  400   GYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASA  579
             GYL++   P G++W K +++L +HVLSP    WL +KRVEEADHL+ ++YNQCK  ++  
Sbjct  123   GYLTTALSPSGDQWNKMKKVLMTHVLSPKKHQWLYSKRVEEADHLVHYVYNQCK--KSVH  180

Query  580   MGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLG  759
              G +V++R A +HYC N+T+KMLFNKR+FG G  DGGPG  +EE + A+F+ L ++Y   
Sbjct  181   QGGIVNLRTAAQHYCANLTRKMLFNKRFFGEGMKDGGPGFEEEEYVDALFSCLNHIYAFC  240

Query  760   VADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKL  939
             ++D++P L   DLDGH+ ++ +   +  K+ D  + ER+Q WKDG K   ED++D+L+ L
Sbjct  241   ISDFLPSLIGLDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAKKDTEDLLDILITL  300

Query  940   KDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGR  1119
             KD DG P+LS  EIK Q+ EIM+AA+DNPSNA EWA AEM+NQP++LEKA EE+D VVG+
Sbjct  301   KDPDGNPLLSKDEIKAQITEIMVAAVDNPSNACEWAFAEMLNQPEILEKATEELDRVVGK  360

Query  1120  ERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTG  1299
             ERLVQESD  +LNY+KAC +E FRLHP+APF  PH+S  DT V  YFIPKGS V++SR G
Sbjct  361   ERLVQESDFAHLNYVKACAREAFRLHPVAPFNVPHVSAADTTVANYFIPKGSYVLLSRLG  420

Query  1300  LGRNKRAWEDPLKFKPERHLNG-EDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMA  1476
             LGRN + W++PLKFKPERHLN  E VVLT++ L+ +SFS G+RGC GV LG+ M+ ML A
Sbjct  421   LGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCIGVTLGTSMTTMLFA  480

Query  1477  RLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             RL+Q FTW +P     IDLT ++  + L  PL ALAKPRLP  +Y
Sbjct  481   RLLQAFTWSLPPSQSSIDLTIAEDSMALAKPLSALAKPRLPPQVY  525



>ref|XP_006363576.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum tuberosum]
Length=506

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/509 (59%), Positives = 379/509 (74%), Gaps = 29/509 (6%)
 Frame = +1

Query  118   KKWYGssssslsIPPGPKPWPLVGSIPEI-LRNKPAF-RWIHGVMDEMKTEIACIRLGGT  291
              KW  +  ++  +PP PK WP++GS+P+I L+NKP+F  WIH +++EM TEIACIRLG  
Sbjct  17    NKWNSTIRNNKPLPPSPKSWPIIGSLPQIFLKNKPSFIHWIHKIVEEMDTEIACIRLGNV  76

Query  292   YVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSH  471
             +VIPVTSPELA EFLK QDS+FSSRP CMSA LISN Y++S+FLP G++W K RRIL SH
Sbjct  77    HVIPVTSPELACEFLKLQDSVFSSRPICMSASLISNSYITSIFLPIGDQWMKMRRILASH  136

Query  472   VLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLF  651
             VLSP++  WL  KR EE D+L RF+YN   IS         ++R+ TR YCGNV + M+F
Sbjct  137   VLSPSSFQWLRCKRDEEVDNLHRFVYNNQSISS--------NLRKVTRCYCGNVIRNMIF  188

Query  652   NKRYFGSGAADGGPGAVDE--ELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITK  825
             +K+            A+ E  E + A+FT+L YL+  GV+DY+PWLS+FDLD HK+II K
Sbjct  189   SKK-----------SALFETIEEVDALFTLLEYLHSFGVSDYLPWLSVFDLDSHKAIIKK  237

Query  826   ALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIM  1005
             A A   K++D +VD RIQ+WK+  K +EEDI+D+L+ LKD +G P+++ KEIK QVLE+M
Sbjct  238   AYATATKYIDIEVDHRIQIWKNDNKILEEDILDILIMLKDINGNPLMNVKEIKAQVLELM  297

Query  1006  IAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEG  1185
             +A +DNPSNAVEW  AEM+NQPKL++KAVEE++ VVG  RLVQESDLP LNY+KAC+KE 
Sbjct  298   LATVDNPSNAVEWTFAEMLNQPKLMQKAVEELNTVVGINRLVQESDLPRLNYVKACIKEA  357

Query  1186  FRLHPIAPFTPPHLSTKDTVVG-GYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN  1362
             FRLHPI+PF  PH+S  DT+VG  YFIPKGS V++SR GLGRN R W+DPL FKPERHL 
Sbjct  358   FRLHPISPFNVPHVSISDTIVGEKYFIPKGSVVLLSRLGLGRNPRIWKDPLNFKPERHLK  417

Query  1363  GED----VVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCID  1530
              ED    VVLTDS L+++SFS GRRGCP VKLGS ++ ML+ARL+QGFTW +P + PC D
Sbjct  418   MEDGGDQVVLTDSNLRLLSFSTGRRGCPAVKLGSTITTMLLARLLQGFTWSLPPNSPCND  477

Query  1531  LTE-SKHDLFLENPLFALAKPRLPSNLYM  1614
             L E SK + F   PL A AKPRL   +Y+
Sbjct  478   LIESSKINHFSTLPLLAQAKPRLARAMYL  506



>ref|XP_009623062.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana tomentosiformis]
Length=543

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/487 (59%), Positives = 364/487 (75%), Gaps = 15/487 (3%)
 Frame = +1

Query  181   LVGSIPE-ILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIF  357
             +VG IP+ +L  KPAF WIH +M+EM+TEI CIRLG  +VIPVTSPELA  FLK QDSIF
Sbjct  61    IVGCIPQMVLNKKPAFEWIHKLMEEMETEICCIRLGNVHVIPVTSPELACLFLKNQDSIF  120

Query  358   SSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLL  537
             SSRP CMSA L+SNGYL+SLFLP G++W K RRIL+SHVLS  +  WL  KR EEADH+L
Sbjct  121   SSRPICMSANLVSNGYLTSLFLPMGDQWMKMRRILSSHVLSATSFQWLRRKRDEEADHIL  180

Query  538   RFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVD----  705
             RF+Y+QC          V+++R+ TR+YC NV   M+F+KR  G    +     V+    
Sbjct  181   RFVYDQCVNKRI-----VINLRKVTRYYCANVINNMIFSKRLLGKRIMENRGTLVELQED  235

Query  706   -EELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQM  882
              E+ + A+FT+L Y +  G++DY+PWLS  DLDGHK+II KA  +  KH+D ++D+RI +
Sbjct  236   QEKQVDAIFTLLEYFHSFGISDYLPWLSGLDLDGHKAIIKKAFLIATKHIDLEIDQRIHI  295

Query  883   WKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMI  1062
             WKDG KTVEEDI+DVL+ L+D +G PML+ KEIK QVLE M+A LDNPS AVEW + EM+
Sbjct  296   WKDGNKTVEEDILDVLIMLRDTNGNPMLNAKEIKAQVLEFMLATLDNPSYAVEWTIKEML  355

Query  1063  NQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDT  1242
             NQPK++++A+EE+ NV+G  R VQESDLP LNY+KACVKE FRLHP+A F  PH+S  D+
Sbjct  356   NQPKIMQRAIEEIGNVIGNNRFVQESDLPQLNYVKACVKESFRLHPLAAFNAPHVSLSDS  415

Query  1243  VVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN--GEDVVLTDSELKMMSFSA  1416
             VVG YFIPKGS V++SR GLGRN R W+DP+KFKPERH+N  G DVV TDS+L  +SFS 
Sbjct  416   VVGDYFIPKGSVVLLSRLGLGRNPRVWDDPMKFKPERHMNEEGGDVVFTDSKLHFLSFSI  475

Query  1417  GRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTES--KHDLFLENPLFALAKP  1590
             GRRGCPGVKLGS ++ ML+ARL+QGFTW +P + P  DLT++  +       P FA AKP
Sbjct  476   GRRGCPGVKLGSTITTMLLARLLQGFTWSLPPNFPGNDLTDNYPESAFLCTMPFFAKAKP  535

Query  1591  RLPSNLY  1611
             RLP ++Y
Sbjct  536   RLPKDMY  542



>ref|XP_006376556.1| hypothetical protein POPTR_0013s15310g [Populus trichocarpa]
 gb|ERP54353.1| hypothetical protein POPTR_0013s15310g [Populus trichocarpa]
Length=528

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/525 (54%), Positives = 373/525 (71%), Gaps = 7/525 (1%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWY----GssssslsIPPGPKPWPLVGSIPEILRNKP  219
             +L    FT +LS T   L+     +Y      +     +PPGPK WP+VG +P +LRNKP
Sbjct  3     YLAPTSFTTLLSFTASLLVLAIILFYFIQSHKNVKKHPLPPGPKRWPIVGCLPTMLRNKP  62

Query  220   AFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISN  399
              +RWIH +M EM TEIACIRLG  +VIPV  P++A EFLK QD+ F+SRP  M+  LIS 
Sbjct  63    VYRWIHNLMKEMNTEIACIRLGNVHVIPVICPDIACEFLKAQDNTFASRPHTMTTDLISR  122

Query  400   GYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASA  579
             GYL++   P G++W K +++L +HVLSP    WL +KRVEEADHL+ ++YNQCK  ++  
Sbjct  123   GYLTTALSPSGDQWNKMKKVLMTHVLSPKKHQWLYSKRVEEADHLVHYVYNQCK--KSVH  180

Query  580   MGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLG  759
              G +V++R A +HYC N+T+KMLFNKR+FG G  DGGPG  +EE + A+F+ L ++Y   
Sbjct  181   QGGIVNLRTAAQHYCANLTRKMLFNKRFFGEGMKDGGPGFEEEEYVDALFSCLNHIYAFC  240

Query  760   VADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKL  939
             ++D++P L   DLDGH+ ++ +   +  K+ D  + ER+Q WKDG K   ED++D+L+ L
Sbjct  241   ISDFLPSLIGLDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAKKDTEDLLDILITL  300

Query  940   KDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGR  1119
             KD  G P+LS  EIK Q+ EIM+AA+DNPSNA EWA AEM+NQP++LEKA EE+D VVG+
Sbjct  301   KDRHGNPLLSKDEIKAQITEIMVAAVDNPSNACEWAFAEMLNQPEILEKATEELDRVVGK  360

Query  1120  ERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTG  1299
             ERLVQESD  +LNY+KAC +E FRLHP+APF  PH+S  DT V  YFIPKGS V++SR G
Sbjct  361   ERLVQESDFAHLNYVKACAREAFRLHPVAPFNVPHVSAADTTVANYFIPKGSYVLLSRLG  420

Query  1300  LGRNKRAWEDPLKFKPERHLNG-EDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMA  1476
             LGRN + W++PLKFKPERHLN  E VVLT++ L+ +SFS G+RGC GV LG+ M+ ML A
Sbjct  421   LGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCIGVTLGTSMTTMLFA  480

Query  1477  RLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             RL+Q FTW +P     IDLT ++  + L  PL ALAKPRLP  +Y
Sbjct  481   RLLQAFTWSLPPSQSSIDLTIAEDSMALAKPLSALAKPRLPPQVY  525



>ref|XP_007011304.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20114.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=554

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/536 (53%), Positives = 398/536 (74%), Gaps = 10/536 (2%)
 Frame = +1

Query  13    FDFMRYLRFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGS  192
             F     + F S + L L LF  ++ V ++     T+K Y   ++   +P GP PWP++G+
Sbjct  20    FAISTLVSFHSTLVLVL-LFAPLVLVKLK---STTRKNY---TNQARLPQGPTPWPVIGN  72

Query  193   IPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPR  372
             +PEI +NKPAFRWIHG+M ++ T+IACIRL   +VIPVTSPE+AREFLKK D++F+SRP 
Sbjct  73    LPEIWKNKPAFRWIHGLMKQLDTDIACIRLANIHVIPVTSPEIAREFLKKYDAVFASRPV  132

Query  373   CMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYN  552
              M+  L+S GYLS+  +P+G++W K R+++ S+++ PA    L++KR +EAD+L+RFIYN
Sbjct  133   TMATELVSRGYLSTALVPWGDQWKKMRKVIASNIIKPARLSSLLHKRTQEADNLVRFIYN  192

Query  553   QCKISEA-SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVF  729
             QC   E  S+ G+V+++R A R Y GNV +KM+F++RYFG G  DGGPG  +EE ++++F
Sbjct  193   QCINPENDSSNGSVINLRLAVRQYTGNVIRKMMFDRRYFGQGKEDGGPGHEEEEHVESLF  252

Query  730   TILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVE  909
             T+L++LY   ++DY+PWL   DL+GH+ I+++A+ +   + D  +DER+Q W++G K   
Sbjct  253   TVLKHLYSFILSDYVPWLRPLDLEGHEKIVSEAVRIVNGYHDPIIDERVQQWREGKKKEA  312

Query  910   EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKA  1089
             ED++D  +  KD DG+P LS +EIK Q  E+M+A +DNP+NAVEWA+AEMINQP+ L+KA
Sbjct  313   EDLLDAFILAKDLDGKPALSVEEIKAQCTELMLATVDNPANAVEWAMAEMINQPETLQKA  372

Query  1090  VEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPK  1269
             ++E+D VVG++RLVQE+D+P LNY+KAC +E FRLHPIAPF  PH+S  D +V GYFIPK
Sbjct  373   IKEIDGVVGKDRLVQETDIPKLNYVKACAREAFRLHPIAPFNLPHVSNTDVIVAGYFIPK  432

Query  1270  GSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAGRRGCPGVK  1443
             GS V++SR GLGRN + W++PLKFKPERHL     +V LT++EL+ +SFS GRRGC GV 
Sbjct  433   GSHVLLSRVGLGRNPKVWDEPLKFKPERHLKDGSIEVDLTETELRFISFSTGRRGCMGVA  492

Query  1444  LGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             LGS M++ML+ARLIQGF W+   D   IDL+ES+ DLFL  PL ALAKPRL + +Y
Sbjct  493   LGSEMTIMLLARLIQGFAWKAQPDEAKIDLSESEDDLFLAKPLHALAKPRLSAAVY  548



>emb|CDP12474.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/475 (59%), Positives = 360/475 (76%), Gaps = 6/475 (1%)
 Frame = +1

Query  187   GSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSR  366
             G I ++LRN+P  RWI+ VMD+M TEIAC R+ G ++IPVTSPELAREF KK DSIFS+R
Sbjct  65    GCIFQMLRNRPTHRWIYKVMDDMNTEIACFRIFGVHIIPVTSPELAREFFKKHDSIFSNR  124

Query  367   PRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFI  546
             P CMSA L S G+L++   P G+++ K +R++ S VLSPA   WL +KR EEADHL+ ++
Sbjct  125   PVCMSAELSSEGFLTTGLSPLGDQYKKMKRMIVSSVLSPAKHQWLHSKRAEEADHLVNYV  184

Query  547   YNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAV  726
             YNQCK     A   +VD+R ATRHY GNV +KM+FNKR+FG G  DGGPGA + E + A+
Sbjct  185   YNQCK---DDATAGLVDIRLATRHYLGNVIRKMIFNKRFFGKGMEDGGPGAEEVEHVNAL  241

Query  727   FTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTV  906
             F +L Y+Y   ++DY+PW+ IFD DGH+ ++T A+A  R+H D ++++RI+ W+ G K  
Sbjct  242   FKLLAYMYAFSLSDYMPWMKIFDFDGHRKVLTMAIACVRRHHDPEIEKRIKTWESGLKNE  301

Query  907   EEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEK  1086
             EED++DVL++LKDN GRP+L+ +EI+ Q+ E+M A +DNPSNAVEWALAEM+NQP++L+K
Sbjct  302   EEDLLDVLIRLKDNKGRPLLTTEEIRAQITELMFATVDNPSNAVEWALAEMLNQPEMLQK  361

Query  1087  AVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIP  1266
             A EE+D VVG++RLVQESDL  L Y+KAC KE FRLHP APF  PH+ST+DTVVGGYFIP
Sbjct  362   ATEEIDAVVGKDRLVQESDLARLKYVKACAKEAFRLHPYAPFNVPHVSTQDTVVGGYFIP  421

Query  1267  KGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED---VVLTDSELKMMSFSAGRRGCPG  1437
             KGS VI+ R GLGRN R W D LKFKPERH+N  D   + L D EL M+SFS GRRGCPG
Sbjct  422   KGSHVILCRPGLGRNPRIWGDSLKFKPERHMNDMDDARMDLNDPELNMLSFSTGRRGCPG  481

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             V LGS ++VML+ARL+Q F W++P+ L  IDL E     FL  PLFA+A+PR P 
Sbjct  482   VLLGSTLTVMLLARLLQCFNWKIPSGLSQIDLAEGMDAGFLAKPLFAVAEPRFPQ  536



>ref|XP_002274641.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=494

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/489 (56%), Positives = 368/489 (75%), Gaps = 3/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWPLVG++PE+   KP FRWI G+++E+ TEIACI+LG  +VIPV SPE+AREF
Sbjct  4     LPPGPTPWPLVGNLPELFTKKPVFRWILGLLEELNTEIACIKLGNVHVIPVISPEIAREF  63

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D++F+SRP  M++  +S G+L++   P+GE+W K RRI+ S VL PA   WL+ KR
Sbjct  64    LKKHDAVFASRPITMASHHLSRGFLTTALSPWGEQWKKMRRIIISEVLKPARHMWLLQKR  123

Query  514   VEEADHLLRFIYNQCKISEASAM---GAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
              EEAD+L+RFIYNQCK S ++      +VV+VR A R Y GN+ +KM+F++RYFG G  D
Sbjct  124   TEEADNLVRFIYNQCKSSTSTDNFMDSSVVNVRNAVRQYTGNIVRKMMFSRRYFGEGRKD  183

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGPG  +EE + ++FT L YLY    +DY+P L +FDLDGH+ ++ +AL++  KH D  V
Sbjct  184   GGPGLEEEEHVNSLFTSLAYLYAFSPSDYLPCLRVFDLDGHEKMVKEALSIISKHHDPIV  243

Query  865   DERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEW  1044
             D+RI  W++G K   EDI+DV + + D  G+P+LS +EIK Q++E+MI  +DNP++A EW
Sbjct  244   DDRIIQWRNGEKKEVEDILDVFITISDTKGKPLLSVEEIKAQLIELMIEIVDNPAHAAEW  303

Query  1045  ALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPH  1224
             A+AEMINQP++++KAVEE+D VVG++RLVQESD+  L Y+KAC +E  RLHPIAPF  PH
Sbjct  304   AMAEMINQPEIMQKAVEEIDRVVGKDRLVQESDIAQLKYVKACAREALRLHPIAPFNVPH  363

Query  1225  LSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKMM  1404
             +S  D VV GYFIPKGS V++SR GLGRN R WE+PLKFKPERH+N E V L +SEL+ +
Sbjct  364   VSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEVVDLAESELRFI  423

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGCPG  LG+ ++V L+ARL+Q F+W VP +   IDL ES ++LFL  PL A A
Sbjct  424   SFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQNQIDLKESMNELFLAKPLHAHA  483

Query  1585  KPRLPSNLY  1611
             KPR  +++Y
Sbjct  484   KPRFHASMY  492



>ref|XP_002264201.1| PREDICTED: phenylalanine N-monooxygenase [Vitis vinifera]
Length=550

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/539 (53%), Positives = 391/539 (73%), Gaps = 15/539 (3%)
 Frame = +1

Query  4     APIFDFMRYLRFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPL  183
             A I D + +L F  ++F+        +SV + +  +K+K    ++S S+ +PPGP PWPL
Sbjct  22    AAIDDVLSHLTFLLMLFI--------ISVILNFTKFKSKT--STNSKSMMLPPGPAPWPL  71

Query  184   VGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSS  363
             V ++P +L  KP FRWIHG M EM TEI CI+LG  +VIPVTSPE++REFLKK D++ +S
Sbjct  72    VRNLPHLLNRKPTFRWIHGFMKEMNTEIECIQLGDVHVIPVTSPEISREFLKKHDTVLAS  131

Query  364   RPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRF  543
             RP  M     S G+L++  +P+GE+W K RR+L S V++P+T  WL +KRVEEAD+L+R+
Sbjct  132   RPITMVTEYSSGGFLTTAVVPWGEQWKKMRRVLASKVINPSTFRWLHDKRVEEADNLVRY  191

Query  544   IYNQCKISEAS-AMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             +YNQCKIS ++  +G+V++VR   R Y GN  +KM+ N RYFG G  DGGPG  +E+ ++
Sbjct  192   VYNQCKISTSNNCLGSVINVRNTVRQYSGNAIRKMILNTRYFGEGKQDGGPGVEEEQHVE  251

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++FT+L +LY   ++DY PW  + DLDGH+  + +A+    K+ D  VD+R++ W++G K
Sbjct  252   SLFTVLAHLYAFSLSDYFPWFRVLDLDGHEKTVREAMNTINKYHDPIVDQRVEHWRNGEK  311

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
               E D++DV + +KD++G P+LS  EIK Q  E+++AA+DNPSNA+EWA+AEMINQP++L
Sbjct  312   EAE-DLLDVFISIKDSNGEPLLSVAEIKAQCTELILAAVDNPSNAIEWAMAEMINQPRVL  370

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
              KAVEE+D VVG+ERLVQES+   LNY+KAC+KE FRLHPIAPF  PH+S  D +V  YF
Sbjct  371   GKAVEEIDRVVGKERLVQESNFQQLNYVKACIKEAFRLHPIAPFNLPHVSNADAIVASYF  430

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN---GEDVVLTDSELKMMSFSAGRRGC  1431
             IPKGS V++SR GLGRN R WE+PL F PERHLN    + V L + +L+++SFS GRRGC
Sbjct  431   IPKGSHVLLSRLGLGRNPRIWEEPLIFNPERHLNASTAQGVDLNEQDLRLISFSTGRRGC  490

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNL  1608
              G+  GS M+VML+ RL+QGFTW  P     +DL+ES++DLFL NPL ALAKPRL S+L
Sbjct  491   TGIAFGSAMTVMLLVRLLQGFTWSPPPGQKEVDLSESRNDLFLANPLHALAKPRLHSSL  549



>ref|XP_011098372.1| PREDICTED: phenylalanine N-monooxygenase-like [Sesamum indicum]
Length=535

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/490 (59%), Positives = 370/490 (76%), Gaps = 6/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  +P+VG +PE+++NKPAFRWIH +M E+ TEIACIRLG T+VI VTSPELAREF
Sbjct  40    LPPGPMGYPIVGCLPEMMKNKPAFRWIHKLMQEINTEIACIRLGNTHVIVVTSPELAREF  99

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             L+KQD IF+SRP  MS  L SNG+L++   P G +W K RRI+ S VLSP     L  KR
Sbjct  100   LRKQDVIFASRPNSMSGNLTSNGFLTTAISPMGNQWKKMRRIIASEVLSPVMHQRLHAKR  159

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EE +HL+R++YNQ   S+   +  +V+VR A +HYCGNV +K++F KR+FG G  DGGP
Sbjct  160   REETEHLVRYVYNQ---SQNPLVNGLVNVRVAAQHYCGNVIRKLVFGKRFFGVGTEDGGP  216

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  ++E + A+FTIL+YLYG G+AD++PWL +FDLDG K I+  AL   +K+ D ++D+R
Sbjct  217   GMEEKEHVDALFTILKYLYGFGIADHLPWLEVFDLDGCKRILKDALRSLKKYQDPEIDKR  276

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             + MW+ G K  EEDI+DVL+ LKD++   +LS +EIK Q+ EIM+AA+DNPSNAVEWALA
Sbjct  277   VYMWQQGIKKTEEDILDVLINLKDSEKNYVLSIQEIKAQITEIMLAAIDNPSNAVEWALA  336

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP +L +A +E+D VVGR RLV ESDL  LNYIKACVKE FRLHPIAPF  PH+S 
Sbjct  337   EMINQPDILGRAYKELDQVVGRNRLVDESDLYRLNYIKACVKEAFRLHPIAPFNIPHVSM  396

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED--VVLTDSELKMMS  1407
             ++T VGGYFIPK S V++SR GLGRN R WEDPL +KP+RH+  +D  VVL D +L+M+S
Sbjct  397   EETTVGGYFIPKNSHVLLSRYGLGRNPRIWEDPLVYKPDRHIVNKDTEVVLMDHDLRMIS  456

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPC-IDLTESKHDLFLENPLFALA  1584
             FS GRRGCPG  LGS M+V+L+ARLIQGF+W  P + P  IDL E + DL +  PL A A
Sbjct  457   FSTGRRGCPGAVLGSTMAVILLARLIQGFSWSPPPNAPSNIDLVELEGDLLMAKPLIAYA  516

Query  1585  KPRLPSNLYM  1614
              PRL  ++Y+
Sbjct  517   IPRLEPHVYL  526



>ref|XP_007146890.1| hypothetical protein PHAVU_006G079100g [Phaseolus vulgaris]
 gb|ESW18884.1| hypothetical protein PHAVU_006G079100g [Phaseolus vulgaris]
Length=538

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/524 (53%), Positives = 379/524 (72%), Gaps = 9/524 (2%)
 Frame = +1

Query  49    IFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFR  228
             +F+ +  F +M+          +KK         ++PPGPKPWP+VG++PE+L  +PA +
Sbjct  19    LFVIITCFIIMIKTLRSNFTESSKK------QKPNLPPGPKPWPIVGNLPEMLAKEPAHK  72

Query  229   WIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYL  408
             WIH +M EM TEIACIRLG  YVIPVTSP +A EFL+KQD+ F+SR   MS  LIS+GY 
Sbjct  73    WIHNLMKEMNTEIACIRLGNAYVIPVTSPTIATEFLRKQDATFASRSLSMSTELISSGYS  132

Query  409   SSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGA  588
             ++ F P+G++W K ++ILT+ +LSP    WL +KR EEA +L  ++YN+CK+     +  
Sbjct  133   TTAFAPFGDQWKKMKKILTNDLLSPQKHLWLHDKRTEEAQNLTFYVYNKCKMVN-DGISG  191

Query  589   VVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVAD  768
             +V+VR A RHYCGN+ +K+ FN RYFG    DGGPG  + E + ++F +L Y+    V+D
Sbjct  192   LVNVRTAARHYCGNLIRKITFNTRYFGEAREDGGPGFEEVEHVDSIFDLLNYVNSFSVSD  251

Query  769   YIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDN  948
             Y+P L   DLDGH+  + +AL + +K+ D  V +RI+ W DG K  +ED +DVL+ LKD+
Sbjct  252   YMPCLRALDLDGHEKKVKEALRIVKKYHDPIVQQRIKQWNDGLKIDKEDWLDVLISLKDS  311

Query  949   DGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERL  1128
             +  P L+ +EI  Q++E+M+A +DNPSNA EWALAEMINQP+LL +AVEE+D+VVG++R+
Sbjct  312   NNNPSLTLEEINAQIIELMVATVDNPSNAFEWALAEMINQPELLHRAVEELDSVVGKDRM  371

Query  1129  VQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGR  1308
             VQESD+P LNY+KAC KE FRLHPIAPF PPH+S  DT+VG YFIPKGS V++SR  LGR
Sbjct  372   VQESDIPKLNYVKACAKEAFRLHPIAPFNPPHVSMSDTMVGNYFIPKGSHVLLSRQELGR  431

Query  1309  NKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARL  1482
             N + W +P KFKPERHL  +G+DVVLT+  LK++SFS GRRGCPGV LG+ M+VML ARL
Sbjct  432   NPKVWNEPYKFKPERHLKSDGDDVVLTEPNLKLISFSTGRRGCPGVMLGTTMTVMLFARL  491

Query  1483  IQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLYM  1614
             + GF+W  P ++  I+L+ES HD+ L  PL A+A+PRLP  LY+
Sbjct  492   LHGFSWTAPPNVSTINLSESDHDILLAQPLLAVAQPRLPPQLYI  535



>ref|XP_006435921.1| hypothetical protein CICLE_v10031099mg [Citrus clementina]
 gb|ESR49161.1| hypothetical protein CICLE_v10031099mg [Citrus clementina]
Length=569

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/495 (57%), Positives = 371/495 (75%), Gaps = 11/495 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG++PEI RNKPAF+WIH VM E+KT I+CIRLG  +VIPVTSPE+A E 
Sbjct  73    LPPGPAAWPIVGNLPEIWRNKPAFKWIHSVMKELKTNISCIRLGNVHVIPVTSPEIALEV  132

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DSIF++RP  M     S G+LS   +P+G++W K R+++ SHVLS A  + L++KR
Sbjct  133   LKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWKKMRKMVASHVLSSARLNSLISKR  192

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+RFIYNQC+  E+++   VVDVR ATRHYCGNV +KM+FN+RYFG G  DGGP
Sbjct  193   REEADNLVRFIYNQCR--ESASAATVVDVRLATRHYCGNVIRKMMFNRRYFGEGKEDGGP  250

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE ++++F  L++LY   ++DY+PW+ +FDL+GH+ I++ A+    K+ D+ +DER
Sbjct  251   GFEEEEHVESLFVALQHLYSFTLSDYVPWMRVFDLEGHEKIVSAAMKTANKYHDSIIDER  310

Query  874   IQMWK--DGTKTVEEDI--VDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +Q  +  D  K    D+  +DVL+  KD +G P+LS  EIK+Q +++ +A +DNPSNA E
Sbjct  311   VQQRRHHDNKKEAHNDLDLLDVLISAKDENGDPLLSIDEIKSQCMDLTLATVDNPSNAAE  370

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP++L KA EE+D VVG+ERLVQESD+P LNYIKAC++E  RLHP+APF  P
Sbjct  371   WAIAEMINQPEILRKATEEIDRVVGKERLVQESDVPQLNYIKACLREVLRLHPVAPFNLP  430

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED-----VVLTD  1386
             H+ST+D  V GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D     V LT+
Sbjct  431   HVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSPDDHHHQVELTE  490

Query  1387  SELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLEN  1566
              EL+ +SFS GRRGC G+ LGS MSVML+ARL+QGF W  P+D   +DL+ESK DL +  
Sbjct  491   PELRFLSFSRGRRGCMGMALGSEMSVMLLARLLQGFNWSAPSDEEMVDLSESKCDLLMAK  550

Query  1567  PLFALAKPRLPSNLY  1611
             PL A AKPRLP++LY
Sbjct  551   PLHARAKPRLPADLY  565



>ref|XP_007011306.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20116.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=553

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/490 (56%), Positives = 371/490 (76%), Gaps = 4/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWP++G++PEI R +PAFRWIHG+M E+ T+I C+RL   +VI VTSP +A EF
Sbjct  61    LPPGPTPWPIIGNLPEIWRKRPAFRWIHGLMKELHTDILCVRLANIHVIAVTSPVIALEF  120

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK DS+F+SRP  M+    S  +L+   +P+G++W K RR++T  +LS +  H L+  R
Sbjct  121   LKKNDSVFASRPVTMATEYSSRRFLTIAVVPWGDQWKKMRRVVTCEILSTSKLHSLLENR  180

Query  514   VEEADHLLRFIYNQCKIS--EASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG  687
              EEAD+L+RFIYNQCK +  + S   AVV++R A R Y GNV +KM+FN+RYFG G  DG
Sbjct  181   TEEADNLVRFIYNQCKSNGHDNSTASAVVNLRLAMRQYSGNVIRKMIFNRRYFGEGRKDG  240

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GPG  +EE ++++FT+LR+ Y   ++DYIPWL  FDL+GH+  ++KA+ +  ++ D  +D
Sbjct  241   GPGYEEEEHVESLFTVLRHAYSFILSDYIPWLRSFDLEGHEKTVSKAMKIVNEYQDPLID  300

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             ER+Q W++G +T  ED++D  +  KD++G+P LS +EIK Q  E+M++ +DNPSNAVEWA
Sbjct  301   ERVQEWREGKRTESEDLLDAFILAKDSNGKPALSIEEIKAQCAELMLSTVDNPSNAVEWA  360

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             +AEMINQP+ L KAVEE+D VVG+ERLVQE+D+P LNY+KAC +EGFRLHP+APF  PH+
Sbjct  361   MAEMINQPETLLKAVEEIDAVVGKERLVQEADIPKLNYVKACAREGFRLHPVAPFNLPHV  420

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED--VVLTDSELKM  1401
             ST D  V GYFIPKGS V++SR GLGRN + W+DPLKFKPERHL      V LT+++L+ 
Sbjct  421   STADATVAGYFIPKGSHVLLSRYGLGRNPKVWDDPLKFKPERHLKDGSMCVDLTETDLRF  480

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFS GRRGC  V LG+ M+VML+ARL+QGFTWRVP +   IDL+E+  DLF+  PL AL
Sbjct  481   ISFSTGRRGCMAVALGTAMTVMLLARLLQGFTWRVPPNEASIDLSEANDDLFMAKPLQAL  540

Query  1582  AKPRLPSNLY  1611
              +PRLP++LY
Sbjct  541   GQPRLPAHLY  550



>ref|XP_007011296.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20106.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=554

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/480 (56%), Positives = 371/480 (77%), Gaps = 3/480 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             ++G++PEI +NKPAFRWIHG+M ++ T+IACIRL   +VIPVTSPE+AREFLKK D++F+
Sbjct  69    VIGNLPEIWKNKPAFRWIHGLMKQLDTDIACIRLANIHVIPVTSPEIAREFLKKYDAVFA  128

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+  L S G+LS++ +P+G++W K RR++TS+++ P T  WL++KR +EAD+L+R
Sbjct  129   SRPLTMATELASRGFLSTILVPWGDQWKKMRRVVTSNIMRPETLSWLLHKRTQEADNLVR  188

Query  541   FIYNQCKISEA-SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELL  717
             FIYNQC   E  S+ G+V+D+R A R Y GNV  +M+FNKRYFG G  DGGPG  +EE +
Sbjct  189   FIYNQCVNPENDSSNGSVIDLRLAVRQYTGNVISRMMFNKRYFGKGKEDGGPGHEEEEHV  248

Query  718   KAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGT  897
             +++FT+L +LY   ++DY PWL   DL+GH+ I+++A+ +   + D  +DER+Q W++G 
Sbjct  249   ESIFTVLIHLYSFALSDYAPWLRPLDLEGHEKIVSEAMRIVNGYHDPIIDERVQQWREGK  308

Query  898   KTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKL  1077
             K   ED++D  +  KD+DG+P LS +EIK Q  ++M+A +DNP+NA EWA+AEMINQP+ 
Sbjct  309   KKEPEDLLDAFILAKDSDGKPALSVEEIKAQCFDLMLATVDNPANAAEWAMAEMINQPET  368

Query  1078  LEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGY  1257
             L+KA+EE+D VVG++RLVQE+D+P LN++KAC +E FRLHP+APF PPH+S  D +V GY
Sbjct  369   LQKAIEEIDGVVGKDRLVQETDIPKLNFVKACAREAFRLHPMAPFNPPHVSNADAIVAGY  428

Query  1258  FIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN--GEDVVLTDSELKMMSFSAGRRGC  1431
             FIPKGS V++SR GLGRN + W++P KFKPERH      +V LT++EL+ +SFS GRRGC
Sbjct  429   FIPKGSHVLLSRVGLGRNPQVWDEPSKFKPERHFKDGSMEVNLTETELRFISFSTGRRGC  488

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              GV LGS M++ML ARLIQGF W+VP D   IDL+ES+ +LFL  PL ALAKPRLP+ +Y
Sbjct  489   IGVALGSEMTIMLFARLIQGFAWKVPPDEAKIDLSESEDNLFLAKPLHALAKPRLPAAVY  548



>ref|XP_006363575.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine N-monooxygenase-like 
[Solanum tuberosum]
Length=518

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/530 (57%), Positives = 384/530 (72%), Gaps = 31/530 (6%)
 Frame = +1

Query  61    LALFTVMLSVTIQWLIYKT---KKWYGssssslsIPPGPKPWPLVGSIPEI-LRNKPAF-  225
              + F+   + T  W I+ +    KW  S  ++   PP PK WP++GS+P+I L+NKP+F 
Sbjct  8     FSTFSKFNNSTTPWRIFISTILSKWNSSIRNNKPFPPSPKSWPIIGSLPQIFLKNKPSFI  67

Query  226   RWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGY  405
              WIH +M+EM TEIACIRLG  +VIPVTSPELA EFLK QDS+FSSRP CMSA LISN Y
Sbjct  68    HWIHTIMEEMDTEIACIRLGNVHVIPVTSPELACEFLKIQDSVFSSRPICMSASLISNSY  127

Query  406   LSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMG  585
             ++S+FLP G++W K R IL SHVLSP +  WL  KR EE D+L RF+YN    S      
Sbjct  128   ITSIFLPIGDQWMKMRGILASHVLSPTSFQWLRCKRDEEVDNLHRFVYNNQSTS------  181

Query  586   AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDE--ELLKAVFTILRYLYGLG  759
               +++R+ TR YCGNV + M+F+K+            A+ E  E + A+FT+L YL+  G
Sbjct  182   --INLRKVTRCYCGNVIRNMIFSKK-----------SALFETIEEVDALFTLLEYLHSFG  228

Query  760   VADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKL  939
             ++DY+PWLS+FDLDGHK+II KA A   KH+D +VD RIQ+WKDG KT+++DI+D+L+ L
Sbjct  229   ISDYLPWLSVFDLDGHKAIIKKAYATATKHIDIEVDHRIQIWKDGNKTLKQDILDILIML  288

Query  940   KDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGR  1119
             KD +G P+++ KEIK QVLE+M+A +DN SNAVEW   EM+NQPKL++KAVEE++ VVG 
Sbjct  289   KDINGNPLMNVKEIKAQVLELMLATVDNLSNAVEWTFEEMLNQPKLMQKAVEELNTVVGI  348

Query  1120  ERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVG-GYFIPKGSQVIISRT  1296
              RLVQESDLP LNY+KAC+KE FRLHPI+PF  PH+S  DT+V   YFIPKGS V++SR 
Sbjct  349   NRLVQESDLPRLNYVKACIKEAFRLHPISPFNVPHVSVSDTIVSKKYFIPKGSVVLLSRL  408

Query  1297  GLGRNKRAWEDPLKFKPERHLNGED---VVLTDSELKMMSFSAGRRGCPGVKLGSLMSVM  1467
             GLGRN R W+DPLKFKPERHL  ED   VVLTDS L ++SFS GRRGCP VKLGS ++ M
Sbjct  409   GLGRNPRIWKDPLKFKPERHLKMEDGGEVVLTDSNLHLLSFSIGRRGCPAVKLGSTITTM  468

Query  1468  LMARLIQGFTWRVPADLPCIDLTE-SKHDLFLENPLFALAKPRLPSNLYM  1614
             L+ARL+QGFTW +P +  C DL E SK + F   PL A AKPRL   +++
Sbjct  469   LLARLLQGFTWSLPLNSACNDLIESSKMNHFSTLPLLAQAKPRLARAMHL  518



>ref|XP_004237224.2| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=517

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/493 (59%), Positives = 371/493 (75%), Gaps = 19/493 (4%)
 Frame = +1

Query  157   PPGPKPWPLVGSIPEI-LRNKPAF-RWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             PPGPK WP++G  P+I L+NK A    IH +M+EM TEIACIR+G  +VIPVTSPELA E
Sbjct  37    PPGPKSWPIIGCFPQIILKNKHALINRIHKIMEEMNTEIACIRVGNYHVIPVTSPELACE  96

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
             FLK QDSIFS RP CMSA L+SNGYL+ +F+P G++W K ++ILTSHVLSP +  WL  K
Sbjct  97    FLKGQDSIFSFRPLCMSASLVSNGYLTPIFVPSGDQWMKMKKILTSHVLSPTSFQWLHCK  156

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGG  690
             R EEADHL R +YNQC      +   V+++R+ TR++CGNV + M+F+KR         G
Sbjct  157   RKEEADHLHRLVYNQC------SNQLVINLREVTRYHCGNVIRNMIFSKRSLF------G  204

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
                 DEE + AVFT++ Y+Y   ++DY+ WLS  DLDGHK+II KA A+  K++D +VD+
Sbjct  205   IIEQDEEQIDAVFTLIEYVYSFSISDYLQWLSFLDLDGHKAIIKKAYAIATKYIDIEVDK  264

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RIQ+WKDG KT+EEDI+DVL+ LKD +G P+++ KEIK QVLE  +A +DNPSNAVEWAL
Sbjct  265   RIQIWKDGNKTLEEDILDVLIMLKDTNGNPLMNVKEIKAQVLEFFMATVDNPSNAVEWAL  324

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+PKL++KA+EE++ VVG  R VQESDL  LNY+KAC+KE FRLHP   F  PH+S
Sbjct  325   AEMLNEPKLMQKAIEELNTVVGINRWVQESDLSRLNYVKACIKEAFRLHPFMAFNVPHVS  384

Query  1231  TKDTVVG-GYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL---NGEDVVLTDSELK  1398
               DT++G  YFIPKGS V++SR GLGRN R WEDPLKFKPERHL   +G +VVLTDS L+
Sbjct  385   VSDTIIGEKYFIPKGSIVLLSRLGLGRNSRVWEDPLKFKPERHLKMKDGGEVVLTDSNLR  444

Query  1399  MMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTE-SKHDLFLENPLF  1575
             ++SFS GRRGCP VKLGS ++ ML+ARL+QGFTW +P++ PC DL E SK + F   PL 
Sbjct  445   LLSFSIGRRGCPAVKLGSTITTMLLARLLQGFTWDLPSNSPCNDLIESSKINHFSTLPLL  504

Query  1576  ALAKPRLPSNLYM  1614
             A AKPRL   +Y+
Sbjct  505   AQAKPRLAKAMYL  517



>ref|XP_011075711.1| PREDICTED: valine N-monooxygenase 1-like [Sesamum indicum]
Length=522

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/509 (55%), Positives = 372/509 (73%), Gaps = 16/509 (3%)
 Frame = +1

Query  97    QWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACI  276
             +WL  K +K       +  +PPG   +P+VG  PE+++NKP FRW+  +M EM TEIACI
Sbjct  23    KWLCLKKRK-------TPPLPPGLMGYPIVGCFPEMMKNKPTFRWVQQLMQEMNTEIACI  75

Query  277   RLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRR  456
             RLG T+VI VTSP+LARE L+KQD IF+SR   +SA L SNGYL+++F P  ++W K RR
Sbjct  76    RLGNTHVIFVTSPQLARELLRKQDVIFASRADVLSARLASNGYLTAIFSPNCDQWKKMRR  135

Query  457   ILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVT  636
             ++ S VLSP    WL NKR +E DHL+++++ Q      S    +V+VR A +HYCGN+T
Sbjct  136   VIASGVLSPTMHQWLHNKRSKEVDHLVKYVFKQ------SLTNGLVNVRVAAQHYCGNMT  189

Query  637   KKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSI  816
             +K++FNKR+FG+G  DG PG  +E+ L  VFTIL+Y+YG G+ DY+PWL +FDLDGHK I
Sbjct  190   RKLIFNKRFFGTGMEDGDPGMEEEDHLHGVFTILKYVYGFGIGDYLPWLEVFDLDGHKRI  249

Query  817   ITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVL  996
             I  AL   RK+ D ++D+R++MW+ G K ++EDI+DV + LKD++   +LS +EIK ++ 
Sbjct  250   IKDALKKVRKYQDPEIDQRVEMWQQGMKKIQEDILDVFINLKDSNNNSLLSIEEIKAEIT  309

Query  997   EIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACV  1176
             E M+A +DNPSNAVEWALAEMINQP +L++A +E+D VVG++RLV ESDLP LNY+K C 
Sbjct  310   EFMLATIDNPSNAVEWALAEMINQPDILDRACKELDQVVGKDRLVDESDLPMLNYVKVCA  369

Query  1177  KEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERH  1356
             KE FRLHP+A F  PH+S KDT VGGYFIPK S V++SR GLGRN R W+DPL +KPERH
Sbjct  370   KEAFRLHPVAAFNVPHVSIKDTTVGGYFIPKDSHVLLSRRGLGRNSRVWKDPLIYKPERH  429

Query  1357  LNGED--VVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPC-I  1527
             +  +D  V+L D EL+M+SFS GRRGCPG+ LGS M++ML+ARLIQGF+W  P + P  I
Sbjct  430   IINKDSKVLLVDHELRMLSFSTGRRGCPGIVLGSTMTIMLLARLIQGFSWTAPPNGPSNI  489

Query  1528  DLTESKHDLFLENPLFALAKPRLPSNLYM  1614
             DL ES   L +  PL A A  RL  N+Y+
Sbjct  490   DLVESDGGLLMAKPLVAHAVARLEPNVYL  518



>ref|XP_009780952.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=534

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/482 (59%), Positives = 370/482 (77%), Gaps = 14/482 (3%)
 Frame = +1

Query  181   LVGSIPE-ILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIF  357
             +VG IP+ +L  KPAF WIH +M+EM TEIACIRLG  +VIPVTSPELA  FLK QDSIF
Sbjct  61    IVGCIPQMVLNKKPAFEWIHKLMEEMDTEIACIRLGNVHVIPVTSPELACLFLKNQDSIF  120

Query  358   SSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLL  537
             SSRP CMSA L+SNGYL+   +P G++W K+RRI++SHVLS  +  WL +KR EEADHLL
Sbjct  121   SSRPICMSANLVSNGYLNLGSVPMGDQWMKRRRIISSHVLSATSFQWLRHKRDEEADHLL  180

Query  538   RFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELL  717
             RF+Y+QC I++      V+++R+ TR+Y  NV K M+F+KR  G           ++E +
Sbjct  181   RFVYHQC-INKC----LVINLRKVTRYYSANVIKNMIFSKRLLGPLVE----SEEEDEQV  231

Query  718   KAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGT  897
              A+FT+L Y +   ++DY+PWLS FDLDGHK+II KA A+  K++D ++DERI +WK+G 
Sbjct  232   DAIFTLLEYFHSFSISDYLPWLSGFDLDGHKAIIKKAFAIATKYIDLEIDERIHIWKNGN  291

Query  898   KTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKL  1077
             KTVEEDI+DVL+ LKD +G PML+DKEIK QVLE+M+A +DNPS+AVE  + EM+NQPK+
Sbjct  292   KTVEEDILDVLIILKDTNGNPMLNDKEIKAQVLELMLATIDNPSHAVECTIKEMLNQPKI  351

Query  1078  LEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGY  1257
             +++A EE+DNV+G  RLVQESDLP LNY+KAC+KE FRLHP+A F  PH+S  D+VVG Y
Sbjct  352   MQRATEEIDNVIGSNRLVQESDLPQLNYVKACIKESFRLHPLAAFNVPHVSISDSVVGEY  411

Query  1258  FIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN--GEDVVLTDSELKMMSFSAGRRGC  1431
             FIPKGS V++SR GLGRN R W+DP+KFKPERH++  G DVV TDSEL+++SFS GRRGC
Sbjct  412   FIPKGSAVLLSRLGLGRNPRVWDDPMKFKPERHISEEGGDVVFTDSELRLLSFSIGRRGC  471

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHD--LFLENPLFALAKPRLPSN  1605
             PGVKLGS ++ ML+ARL+QGFTW +P++ P  DLT    +  L    P FA AKPRLP +
Sbjct  472   PGVKLGSTITTMLLARLLQGFTWSLPSNSPGNDLTNDYPECVLLCTMPFFAEAKPRLPKD  531

Query  1606  LY  1611
             +Y
Sbjct  532   MY  533



>ref|XP_009599475.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana tomentosiformis]
Length=544

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/535 (56%), Positives = 391/535 (73%), Gaps = 24/535 (4%)
 Frame = +1

Query  67    LFTVMLSVTIQW-LIYKT------KKWYGsssssls---IPPGPKPWPLVGSIPE-ILRN  213
             LF +++S  I W +++ T      K W  + +       +PPGP PWP+VG  P+ +L+ 
Sbjct  13    LFHIVVSTFIMWKILFPTILKITRKSWSSARNEKTKKPLLPPGPNPWPIVGCFPQMLLKK  72

Query  214   KPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLI  393
             KPA++WIH +M+EM+TEIACIRLG T+VI VTSPELA  FLK+QDS+FSSR  CMSA LI
Sbjct  73    KPAYQWIHELMEEMETEIACIRLGSTHVIAVTSPELACHFLKEQDSLFSSRRICMSATLI  132

Query  394   SNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQ-CKISE  570
             SNGYL+S+FLP G++W K RR L SHVLS ++  WL +KR EEADHLLRF+YNQ C  +E
Sbjct  133   SNGYLTSVFLPMGDQWMKMRRFLASHVLSQSSHLWLRHKRDEEADHLLRFVYNQYCSSNE  192

Query  571   ASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPG----AVDEELLKAVFTIL  738
                    +++R+ TR+YC NV K M+F+KR  G        G       EE ++AVFT+L
Sbjct  193   P----VTINLRKVTRYYCANVVKNMIFSKRLLGKRIMKKNEGPSVEEEAEEQVEAVFTLL  248

Query  739   RYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKT-VEED  915
              YLY L +++Y+PWLS FDLDGHK+II KA A   K +D ++D+R+Q+WKD  K  V+ED
Sbjct  249   DYLYSLSISEYLPWLSGFDLDGHKAIIKKAYAKATKLIDHEIDQRLQIWKDSNKAHVKED  308

Query  916   IVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVE  1095
             I+DVL++LKD +G P++S KEIK QVLE+M+A +DNPSNAVE A+ EM+N+P+++++A+E
Sbjct  309   ILDVLIRLKDTNGNPLMSVKEIKAQVLELMLATVDNPSNAVECAIKEMLNKPQIMQRALE  368

Query  1096  EVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGS  1275
             E+D VVGR RLVQESDLP LNY+KAC++E FRLHP+ PF  PH+S  DT+VG YFIPKGS
Sbjct  369   EIDTVVGRNRLVQESDLPQLNYVKACLREAFRLHPLMPFNVPHVSVSDTIVGEYFIPKGS  428

Query  1276  QVIISRTGLGRNKRAWEDPLKFKPERHLN--GEDVVLTDSELKMMSFSAGRRGCPGVKLG  1449
              V++SR GLGRN R WEDP+KFKPE HLN  G +VVL DSEL + SFS GRRGCPGVKLG
Sbjct  429   VVLLSRLGLGRNPRVWEDPMKFKPEHHLNEEGGEVVLNDSELHLFSFSIGRRGCPGVKLG  488

Query  1450  SLMSVMLMARLIQGFTWRVPADLPCIDLTE-SKHDLFLENPLFALAKPRLPSNLY  1611
             S ++ ML+ARL+QGF W +P + P  D  E S  +L    P FA AKPRL   +Y
Sbjct  489   STITTMLLARLLQGFNWNLPPNSPGNDFIEKSGRNLSCTVPFFAQAKPRLSEGMY  543



>gb|EYU45627.1| hypothetical protein MIMGU_mgv1a004405mg [Erythranthe guttata]
Length=529

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/514 (55%), Positives = 375/514 (73%), Gaps = 6/514 (1%)
 Frame = +1

Query  61    LALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHG  240
             L L T+++    +WL +  K+     ++   +PPGP  +P++G +PE+ + KP FRWIH 
Sbjct  13    LLLATIIIVFFAKWLNHSKKR---RKTTKPPLPPGPTGYPIIGCLPEMTKKKPTFRWIHK  69

Query  241   VMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLF  420
             +M EM TEIAC RLGGT+VIPVTSPEL+REFLK+ D IF+SRP CMSA L S  YLS++ 
Sbjct  70    LMQEMDTEIACFRLGGTHVIPVTSPELSREFLKEHDLIFASRPHCMSARLTSCNYLSTVI  129

Query  421   LPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDV  600
              P G++W K RRIL+SH LS A    L +KR +EADHL+R++Y Q    + +    +V++
Sbjct  130   GPIGDQWKKMRRILSSHALSSAMHTKLHDKRDKEADHLVRYVYTQLLSPQNNNKNGLVNL  189

Query  601   RQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPW  780
             R AT+HYCGNV +KM+F KR+FG+G  DGGPG  + E +  +FTIL YLYG  +ADY+P 
Sbjct  190   RVATQHYCGNVIRKMVFGKRFFGAGMEDGGPGLEEREHVDGLFTILTYLYGFAIADYVPC  249

Query  781   LSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRP  960
             L +FD DG++ I+  AL   RK+ D ++  R++MW+ G K  E+DI+DV + LKD+   P
Sbjct  250   LEVFDFDGYRKILGDALDNVRKYQDREITNRVEMWRKGIKKTEDDILDVFINLKDSKHNP  309

Query  961   MLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQES  1140
             +LS +EI+ Q+ EIM+A +DNPSNAVEWA+AEMINQP +L +A  E+D+VVGR ++VQES
Sbjct  310   LLSVQEIRAQITEIMLAGVDNPSNAVEWAMAEMINQPHILNRACRELDSVVGRGKMVQES  369

Query  1141  DLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRA  1320
             DLPNLNY++ACVKE FRLHP+APF  PH+ST+D VVGGYFIP+GS V++SR GLGRN R 
Sbjct  370   DLPNLNYVRACVKESFRLHPVAPFNVPHVSTEDAVVGGYFIPRGSHVLLSRPGLGRNPRV  429

Query  1321  WEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGF  1494
             WE+PL++KPERH+  E   V L D +L+M+SFS GRRGCPGV LGS M+VML+ARL+ GF
Sbjct  430   WENPLEYKPERHMVFESAQVELVDHDLRMLSFSTGRRGCPGVTLGSTMAVMLLARLLHGF  489

Query  1495  TWRVPADLPCIDLTESKHDLFLENPLFALAKPRL  1596
              W  P  +  IDL ES+  L L  PL   A PRL
Sbjct  490   DWMAPPGVR-IDLVESEGVLLLAKPLVLHATPRL  522



>ref|XP_002274920.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=495

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/490 (55%), Positives = 366/490 (75%), Gaps = 4/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWPLVG++PE+   KP FRWI G+++E+ TEIACI+LG  +VIPV SPE+ARE 
Sbjct  4     LPPGPTPWPLVGNLPELFTKKPVFRWILGLLEELNTEIACIKLGNVHVIPVISPEIAREI  63

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+ D++F+SRP  M++  +S G+L++   P+GE+W K RR + S VL P    WL+ KR
Sbjct  64    LKEHDAVFASRPITMASHHLSRGFLTTALSPWGEQWKKMRRTIISEVLKPERHIWLLQKR  123

Query  514   VEEADHLLRFIYNQCKISEASAMG----AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA  681
              EEAD+L+RFIYNQCK S  ++      +VV+VR A R Y GNV +KM+F++RYFG G  
Sbjct  124   TEEADNLVRFIYNQCKFSSITSHNFTDSSVVNVRNAVRQYTGNVVRKMMFSRRYFGEGRK  183

Query  682   DGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQ  861
             DGGPG  +EE + ++FT L YLY    +DY+P L +FDLDGH+ ++ +AL++  KH D  
Sbjct  184   DGGPGLEEEEHVNSLFTTLVYLYVFSPSDYLPCLRVFDLDGHEKMVKEALSIINKHHDPI  243

Query  862   VDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             VDERI  W++G K   EDI+DV + + D  G+P+LS +EIK Q++E+MI  +DNP++A E
Sbjct  244   VDERIIQWRNGEKKEVEDILDVFITISDTKGKPLLSVEEIKAQLIELMIEIVDNPAHAAE  303

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMIN+P++++KAVEE+D VV ++RLVQESD+  L Y+KAC +E  RLHP+APF  P
Sbjct  304   WAMAEMINKPEIMQKAVEEIDRVVAKDRLVQESDIAQLKYVKACAREALRLHPMAPFNVP  363

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKM  1401
             H+S  D VV GYFIPKGS V++SR GLGRN R WE+PLKFKPERH+N E V L + EL+ 
Sbjct  364   HVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEVVDLAEPELRF  423

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFS GRRGCPG  LG+ ++V L+ARL+Q F+W VP +   IDLTES ++LFL  PL A 
Sbjct  424   ISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMNELFLAKPLHAH  483

Query  1582  AKPRLPSNLY  1611
             AKPRLP+++Y
Sbjct  484   AKPRLPASMY  493



>ref|XP_006435920.1| hypothetical protein CICLE_v10031309mg [Citrus clementina]
 gb|ESR49160.1| hypothetical protein CICLE_v10031309mg [Citrus clementina]
Length=502

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/496 (56%), Positives = 371/496 (75%), Gaps = 12/496 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG++PEI RNKPAF+WIH VM E+KT I+CIRLG  +VIPVTSPE+A E 
Sbjct  6     LPPGPAAWPIVGNLPEIWRNKPAFKWIHSVMKELKTNISCIRLGNVHVIPVTSPEIALEV  65

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DSIF++RP  M     S G+LS   +P+G++W K R+++ SHVLS A  + L++KR
Sbjct  66    LKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWKKMRKMVASHVLSSARLNSLISKR  125

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+RFIYNQC+ S ++A   VVDVR ATRHYCGNV +KM+FN+RYFG G  DGGP
Sbjct  126   REEADNLVRFIYNQCRKSASAA--TVVDVRLATRHYCGNVIRKMMFNRRYFGEGKEDGGP  183

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE ++++F  L++LY   ++DY+PW+ +FDL+GH+ I++ A+    K+ D+ +DER
Sbjct  184   GFEEEEHVESLFVALQHLYSFTLSDYVPWMRVFDLEGHEKIVSAAMKTANKYHDSIIDER  243

Query  874   IQMWK---DGTKTV--EEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAV  1038
             +   +   D  K    ++D++DVL+   D +G P+LS  EIK+Q +++ +A +DNPSNA 
Sbjct  244   VHQRRRHHDNKKEAHKDQDLLDVLISANDENGVPLLSIDEIKSQCMDLTLATVDNPSNAA  303

Query  1039  EWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTP  1218
             EWA+AEMINQP++L+KA EE+D VVG+ERLVQESD+P LNYIKAC++E  RLHP+APF  
Sbjct  304   EWAIAEMINQPEILQKATEEIDRVVGKERLVQESDVPQLNYIKACLREVLRLHPVAPFNL  363

Query  1219  PHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED-----VVLT  1383
             PH+ST+D  + GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D     V L 
Sbjct  364   PHVSTRDATIAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSVDDHHHQVELA  423

Query  1384  DSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLE  1563
             ++EL+ +SFS GRRGC G+ LGS MSVML+ARL+QGF W  P+D   +DL+ESK DL + 
Sbjct  424   ETELRFLSFSRGRRGCMGMALGSEMSVMLLARLLQGFNWSAPSDEEMVDLSESKCDLLMA  483

Query  1564  NPLFALAKPRLPSNLY  1611
              PL A AKPRLP+ LY
Sbjct  484   KPLHARAKPRLPAELY  499



>gb|KDP45690.1| hypothetical protein JCGZ_17297 [Jatropha curcas]
Length=543

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/488 (56%), Positives = 358/488 (73%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGPKPWP++G +P + +N+PAFRWIH +M +M TEIACIRLG  +VIPVT P+++ E 
Sbjct  55    LPPGPKPWPIIGCLPAMYKNEPAFRWIHNLMKQMNTEIACIRLGNVHVIPVTCPKISCEL  114

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK QD+ F++RP  MS    S GYL++   P+G++W K R +L + +LSPA Q      R
Sbjct  115   LKAQDANFATRPISMSTRFTSKGYLATALAPFGDQWKKMRGVLVTQLLSPAKQRRFYGTR  174

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
             VEEA+HL+R+ YNQC        G +VDVR A +HYCGNV +KM+FNKR+FG G  +GGP
Sbjct  175   VEEANHLVRYAYNQCN------EGGLVDVRVAAQHYCGNVIRKMMFNKRFFGKGRKNGGP  228

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE + A+F +L +LY   ++DY+P L  FDLDGH+ II ++  +  K+ D  +++R
Sbjct  229   GFEEEEHIDAIFRVLHHLYAFCLSDYLPCLVGFDLDGHEKIIKESNGIIGKYHDPIIEDR  288

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             +Q WKDGTK  EED++DVL+ LKD++G P+LS  EIK Q+ EIM+  +DNPSNAVEWA+A
Sbjct  289   VQQWKDGTKKEEEDLLDVLITLKDDNGNPLLSTDEIKAQITEIMLETVDNPSNAVEWAIA  348

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQPK+LEKAVEE+D VVG+ERLVQESDL  LNYI AC +E FRLHP+ PF  PH+S 
Sbjct  349   EMINQPKILEKAVEELDRVVGKERLVQESDLSQLNYITACAREAFRLHPVVPFNVPHVSM  408

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMS  1407
              DT V  +FIPKGS V++SR GLGRN + W++P KFKPE H+  NG  V L D  L  +S
Sbjct  409   TDTTVANFFIPKGSHVLLSRVGLGRNPKIWDEPHKFKPEHHIKNNGSQVTLIDPYLNFIS  468

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
              S GRRGCPGV +G+ M++ML ARL+QGFTW VP +   I+LTESK  L L  PL AL K
Sbjct  469   LSTGRRGCPGVTMGTSMTLMLFARLLQGFTWNVPPNQTSINLTESKSSLGLAKPLVALVK  528

Query  1588  PRLPSNLY  1611
             PRLP+++Y
Sbjct  529   PRLPAHVY  536



>ref|XP_009765490.1| PREDICTED: isoleucine N-monooxygenase 2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765491.1| PREDICTED: isoleucine N-monooxygenase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=543

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/487 (59%), Positives = 364/487 (75%), Gaps = 15/487 (3%)
 Frame = +1

Query  181   LVGSIPE-ILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIF  357
             +VG IP+ +L  KPAF WIH +M+EM TEIACIRLG  +VIPVTSPELA  FLK QDSIF
Sbjct  61    IVGCIPQMVLNKKPAFEWIHKLMEEMDTEIACIRLGNVHVIPVTSPELACLFLKNQDSIF  120

Query  358   SSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLL  537
             SSRP CMSA L+SNGYL+SLFLP G++W K RRIL+SHVLS  +  WL  KR EEADH+L
Sbjct  121   SSRPICMSANLVSNGYLTSLFLPMGDQWMKMRRILSSHVLSATSFQWLRRKRDEEADHIL  180

Query  538   RFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFG-SGAADGGP----GAV  702
             RF+Y QC          V+++R+ TR+YC NV   M+F+KR  G S   +GGP       
Sbjct  181   RFVYEQCINKRL-----VINLRKVTRYYCANVINNMIFSKRLLGKSIIQNGGPLVELQED  235

Query  703   DEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQM  882
              E+ + A+FT+L Y +   ++DY+PWLS FDLDGHK+II KA A+  KH+D ++D+RI +
Sbjct  236   QEKQIDAIFTLLEYFHSFSISDYLPWLSGFDLDGHKAIIKKAFAIATKHIDLEIDQRIHI  295

Query  883   WKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMI  1062
              K+G KTVEEDI+DVL+ L+D +G PML+ KEIK QVLE M+A LDNPS AVEW + EM+
Sbjct  296   SKNGKKTVEEDILDVLIMLRDTNGNPMLNAKEIKAQVLEFMLATLDNPSYAVEWTIKEML  355

Query  1063  NQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDT  1242
             NQPK++++A+EE+DNV+G  RLVQESDLP LNY+KAC+KE FRLHP+  F  PH+S  D+
Sbjct  356   NQPKIMQRAIEEIDNVMGSNRLVQESDLPRLNYVKACIKESFRLHPLTAFNAPHVSVSDS  415

Query  1243  VVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN--GEDVVLTDSELKMMSFSA  1416
             VVG YFIPKGS V++SR GLGRN R W+DP+KFKPERH++  G DVV TDSEL+++SFS 
Sbjct  416   VVGEYFIPKGSVVLLSRLGLGRNPRVWDDPMKFKPERHISEEGGDVVFTDSELRLLSFSI  475

Query  1417  GRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHD--LFLENPLFALAKP  1590
             GRRGCPGV LGS ++ ML+ARL+QGFTW +P + P  DL +   +  L    P FA AK 
Sbjct  476   GRRGCPGVNLGSTITTMLLARLLQGFTWSLPLNSPGNDLADDYPECALLCIMPFFAKAKL  535

Query  1591  RLPSNLY  1611
             RL  ++Y
Sbjct  536   RLSKDMY  542



>ref|XP_002274698.2| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=563

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/507 (54%), Positives = 373/507 (74%), Gaps = 4/507 (1%)
 Frame = +1

Query  103   LIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRL  282
             ++YK K     +     +PPGP PWPLVG++PE+   KP FRWI G+++E+ TEIACI+L
Sbjct  55    ILYKLKPKTLITKQMPLLPPGPTPWPLVGNLPELFTKKPVFRWILGLLEELNTEIACIKL  114

Query  283   GGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRIL  462
             G  +VIPV SPE+AREFLKK D++F+SRP  M++  +S G+L++   P+GE+W K RRI+
Sbjct  115   GNVHVIPVISPEIAREFLKKHDAVFASRPITMASHHLSRGFLTTALSPWGEQWKKMRRII  174

Query  463   TSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMG----AVVDVRQATRHYCGN  630
              S VL P     L+ KR EEAD+L+RFIYNQCK S  ++      +VV+VR A R Y GN
Sbjct  175   ISEVLKPERHISLLQKRTEEADNLVRFIYNQCKFSSITSHNFTDSSVVNVRNAVRQYTGN  234

Query  631   VTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHK  810
             V +KM+F++RYFG    DGGPG  +EE + ++FT L YLY    +DY+P L +FDLDGH+
Sbjct  235   VVRKMMFSRRYFGEVRKDGGPGLEEEEHVNSLFTSLAYLYSFSPSDYLPCLRVFDLDGHE  294

Query  811   SIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQ  990
             +++  AL++  KH D  +DERI  W++G K   ED +DV + ++D  G+P+LS +EIK Q
Sbjct  295   TMVKDALSIINKHHDPILDERIMKWRNGEKKEVEDTLDVFLTIRDTKGKPLLSVEEIKAQ  354

Query  991   VLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKA  1170
             ++E+MI  +DNP++A EWA+AEMI+QP++++KAVEE+D VVG++RLVQESD+  L Y+KA
Sbjct  355   LIELMIEIVDNPAHAAEWAMAEMIDQPEIMQKAVEEIDRVVGKDRLVQESDIAQLKYVKA  414

Query  1171  CVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPE  1350
             C +E  RLHPIAPF  PH+S  D VV GYFIPKGS V++SR GLGRN R WE+PLKFKPE
Sbjct  415   CAREALRLHPIAPFNVPHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPE  474

Query  1351  RHLNGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCID  1530
             RH+N E V L + EL+ +SFS GRRGCPG  LG+ ++V L+ARL+Q F+W VP +   ID
Sbjct  475   RHMNDEVVDLAEPELRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQID  534

Query  1531  LTESKHDLFLENPLFALAKPRLPSNLY  1611
             LTES ++LFL  PL A AKPRLP+++Y
Sbjct  535   LTESMNELFLAKPLHAHAKPRLPASMY  561



>ref|XP_009369526.1| PREDICTED: isoleucine N-monooxygenase 1-like [Pyrus x bretschneideri]
Length=534

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/492 (57%), Positives = 366/492 (74%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP+VG++PE+L NKP FRWIH +MDEM TEIACIRLG T VIP+T P+L+
Sbjct  43    LPPTPKCLKPWPIVGNLPELLANKPTFRWIHKMMDEMNTEIACIRLGNTNVIPITCPQLS  102

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+IF+SRP  +S  LI+ GY +++ +P+GE+W K R+++ S +L+P    WL 
Sbjct  103   REILKKQDAIFASRPLSISTFLITKGYKTAVMVPFGEQWKKMRKVIASELLTPMRHKWLA  162

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KRVEEADH+++++YNQC  +E    G +V++R AT+HYC NV KKM+ NKRYFG    D
Sbjct  163   DKRVEEADHIVKYVYNQCNNNEG---GGIVNLRLATQHYCANVIKKMVLNKRYFGEEMED  219

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGPG  +++ L+ VFT+L Y+Y    +DYIP L   DLDGH+ II  A+  TRK+ D  +
Sbjct  220   GGPGLEEQKYLENVFTMLNYIYSFSASDYIPCLRGLDLDGHEKIIKDAIRDTRKYQDPLI  279

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ER+ +  K G      D++D+L+ LKD +G P+LS +EIK QV E+++AA+DNPSNA E
Sbjct  280   EERVREHQKFGNNKEAHDLLDILISLKDKNGEPLLSLEEIKAQVNELIMAAVDNPSNAAE  339

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP+L EKA +E+D V+G+ R VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  340   WAIAEMINQPELFEKATQELDAVIGKNRQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  399

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS VI+SR GLGRN + W++PLKFKPERHL  +G  VVLT+SEL
Sbjct  400   HVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESEL  459

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GFTW VP     I+LTES +DL L  PL 
Sbjct  460   RFISFSTGMRGCVASTLGTAMTVMLFARLLHGFTWHVPPTESSIELTESTNDLLLAKPLL  519

Query  1576  ALAKPRLPSNLY  1611
             A AKPRLP+++Y
Sbjct  520   AYAKPRLPAHVY  531



>ref|XP_006486167.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=521

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/495 (56%), Positives = 369/495 (75%), Gaps = 11/495 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG++PE+ RNKP F+WIH VM E+ T I+CIR G  +VIPVTSPE+A E 
Sbjct  25    LPPGPAAWPIVGNLPEMWRNKPTFKWIHSVMKELNTNISCIRFGNVHVIPVTSPEIALEV  84

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DSIF++RP  M     S G+LS   +P+G++W K R+++ SHVLS A  + L++KR
Sbjct  85    LKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWKKMRKMVASHVLSSARLNSLISKR  144

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+++RFIYNQC+ S ++A   VVDVR ATRHYCGNV +KM+FN+RYFG G  DGGP
Sbjct  145   REEADNIVRFIYNQCRKSASAA--TVVDVRLATRHYCGNVIRKMMFNRRYFGEGKEDGGP  202

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE ++++F  L++LY   ++DY+PW+ +FDL+GH+ I++ A+    K+ D+ +DER
Sbjct  203   GFEEEEHVESLFVALQHLYSFTLSDYVPWMRVFDLEGHEKIVSAAMKTANKYHDSIIDER  262

Query  874   IQMWK--DGTKTVEEDI--VDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +Q  +  D  K    D+  +DVL+  KD +G P+LS  EIK+Q +++ +A +DNPSNA E
Sbjct  263   VQQRRHHDNKKEAHNDLDLLDVLISAKDENGDPLLSIDEIKSQCMDLTLATVDNPSNAAE  322

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP++L+KA EE+D VVG+ERLVQESD+P LNYIKAC++E  RLHP+APF  P
Sbjct  323   WAIAEMINQPEILQKATEEIDRVVGKERLVQESDVPQLNYIKACLREVLRLHPVAPFNLP  382

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED-----VVLTD  1386
             H+ST+D  V GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D     V LT+
Sbjct  383   HVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSPDDHHHQVELTE  442

Query  1387  SELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLEN  1566
              EL+ +SFS GRRGC G+ LGS MSVML+ARL+QGF W  P+D   +DL+ESK DL +  
Sbjct  443   PELRFLSFSRGRRGCMGMALGSEMSVMLLARLLQGFNWSAPSDEEMVDLSESKCDLLMAK  502

Query  1567  PLFALAKPRLPSNLY  1611
             PL A AKPRLP++LY
Sbjct  503   PLHARAKPRLPADLY  517



>sp|Q6J541.1|C79D3_LOTJA RecName: Full=Isoleucine N-monooxygenase 1; AltName: Full=Cytochrome 
P450 79D3 [Lotus japonicus]
 gb|AAT11920.1| cytochrome P450 [Lotus japonicus]
Length=535

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/534 (53%), Positives = 384/534 (72%), Gaps = 11/534 (2%)
 Frame = +1

Query  16    DFMRYLRFSSIIFLPLALFTVML-SVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGS  192
             DF+         FL + +F+ M+  VT   L+ K+KK+         +PPGPKPWP+VG+
Sbjct  6     DFLSLCHEFPWTFLLVVIFSFMIFKVTKTHLVNKSKKY--------KLPPGPKPWPIVGN  57

Query  193   IPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPR  372
             +PE+L N+PA  WIH +M EM TEIACIRL  T VIPVT P +A EFLKK D+ F+SRP+
Sbjct  58    LPEMLANRPATIWIHKLMKEMNTEIACIRLANTIVIPVTCPTIACEFLKKHDASFASRPK  117

Query  373   CMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYN  552
              MS  + S+G+++++ +PYGE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN
Sbjct  118   IMSTDIASDGFITTVLVPYGEQWKKMKRVLVNNLLSPQKHQWLLGKRNEEADNLMFYIYN  177

Query  553   QCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFT  732
             +C   + +    +V++R A +HY GNV +K++FN RYFG    DGGPG  + E + A FT
Sbjct  178   KC-CKDVNDGPGLVNIRIAAQHYGGNVFRKLIFNSRYFGKVMEDGGPGFEEVEHINATFT  236

Query  733   ILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEE  912
             IL+Y+Y   ++D++P+L   DLDGH+S I KA+ + RK+ D  +D+RI+ W DG KTVEE
Sbjct  237   ILKYVYAFSISDFVPFLRRLDLDGHRSKIMKAMRIMRKYHDPIIDDRIKQWNDGLKTVEE  296

Query  913   DIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAV  1092
             D++DVL+KLKD + +P+L+ KE+K Q++E+ I  +DNPSNA EWALAEMINQP+LL++A 
Sbjct  297   DLLDVLIKLKDANNKPLLTLKELKAQIIELAIEMVDNPSNAFEWALAEMINQPELLKRAT  356

Query  1093  EEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKG  1272
             EE+DNVVG+ERLVQESD+P L ++KAC +E  RLHP+  F  PHL   DT+VG Y  PKG
Sbjct  357   EELDNVVGKERLVQESDIPKLQFVKACAREALRLHPMEYFNVPHLCMNDTMVGDYLFPKG  416

Query  1273  SQVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLG  1449
             +QV++SR  LGRN + W DPLKF PERHL  G DVVLT+ +L+ +SF+ GRR CPGV LG
Sbjct  417   TQVLLSRVALGRNPKFWTDPLKFNPERHLKEGIDVVLTEPDLRFISFTTGRRSCPGVALG  476

Query  1450  SLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             + M+VML AR++ GF+W  P D+  IDL  SK DLFL  PL  +AKPRL + LY
Sbjct  477   TTMTVMLFARMLHGFSWSPPPDVSSIDLVPSKDDLFLAKPLLLVAKPRLAAELY  530



>sp|Q6J540.1|C79D4_LOTJA RecName: Full=Isoleucine N-monooxygenase 2; AltName: Full=Cytochrome 
P450 79D4 [Lotus japonicus]
 gb|AAT11921.1| cytochrome P450 [Lotus japonicus]
Length=536

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/534 (52%), Positives = 382/534 (72%), Gaps = 11/534 (2%)
 Frame = +1

Query  16    DFMRY-LRFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGS  192
             DF+ + L FS    L +  F ++  VT    + K+KK+         +PPGPKPWP+VG+
Sbjct  6     DFLSFCLEFSWTFLLVVIFFFIIFKVTKSHSVNKSKKY--------KLPPGPKPWPIVGN  57

Query  193   IPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPR  372
             +PE+L N+PA  WIH +M EM TEIACIRL  T VIPVT P +A EFLKK D+ F+SRP+
Sbjct  58    LPEMLANRPATIWIHKLMKEMNTEIACIRLANTIVIPVTCPTIACEFLKKHDASFASRPK  117

Query  373   CMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYN  552
              MS  + S+G+L+++ +PYGE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN
Sbjct  118   IMSTDIASDGFLTTVLVPYGEQWKKMKRVLVNNLLSPQKHQWLLGKRNEEADNLMFYIYN  177

Query  553   QCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFT  732
             +C   + +    +V++R A +HY GNV +K++FN RYFG    DGGPG  + E + A FT
Sbjct  178   KC-CKDVNDGPGLVNIRIAAQHYGGNVFRKLIFNTRYFGKVMEDGGPGFEEVEHINATFT  236

Query  733   ILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEE  912
             IL+Y+Y   ++D+IP+L   DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEE
Sbjct  237   ILKYVYAFSISDFIPFLRRLDLDGHRSKIMKAMGIMKKYHDPIIHDRIKQWNDGLKTVEE  296

Query  913   DIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAV  1092
             D++DVL+KLKD   +P+L+ KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A 
Sbjct  297   DLLDVLIKLKDASNKPLLTLKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRAT  356

Query  1093  EEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKG  1272
             EE+DNVVG+ERLVQESD+P L ++KAC +E  RLHP+  F  PHL   DT+VG Y  PKG
Sbjct  357   EELDNVVGKERLVQESDIPKLQFVKACAREALRLHPMEYFNVPHLCMNDTMVGDYLFPKG  416

Query  1273  SQVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLG  1449
             +QV++SR  LGRN + W DPLKF PERHL  G DVVLT+ +L+ +SF+ GRR CPGV LG
Sbjct  417   TQVLLSRVALGRNPKFWTDPLKFNPERHLKEGIDVVLTEPDLRFISFTTGRRSCPGVTLG  476

Query  1450  SLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             + M++ML AR++ GF+W  P ++  IDLT+S  DLF+  PL  +AKPRL + LY
Sbjct  477   TTMTIMLFARMLHGFSWSAPPNVSSIDLTQSSDDLFMAKPLCVVAKPRLAAELY  530



>gb|KEH34488.1| cytochrome P450 family protein [Medicago truncatula]
Length=528

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/533 (52%), Positives = 379/533 (71%), Gaps = 15/533 (3%)
 Frame = +1

Query  19    FMRYLRFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIP  198
             F+  LR SS     +  FT  +  T+++ + +  K          +PPGPKPWP+VG++P
Sbjct  7     FLMLLRQSSRPLFLVMFFTFRVIKTLRYHLNENPK-------KRKLPPGPKPWPIVGNLP  59

Query  199   EILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCM  378
             E+L NKP  RWIH +M+E  TEIACIRLG  +VIPVT P +A EFL+K D  F+SRP  M
Sbjct  60    EMLANKPTTRWIHKIMEEKNTEIACIRLGNVHVIPVTYPTIAHEFLRKHDIDFASRPVSM  119

Query  379   SAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQC  558
             ++ +ISNGYL+S+F+P+GE+W K + ++ +++LSP    WL +KR EEAD+L+ ++YN+C
Sbjct  120   ASDIISNGYLTSVFVPFGEQWKKMKNVVANNLLSPRRHQWLQHKRNEEADNLIFYVYNKC  179

Query  559   KISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTIL  738
                     G +V+VR AT+H+CGNV +K+ FN RYFG G  DGGPG  + E + AVFT+L
Sbjct  180   N------NGGLVNVRIATQHFCGNVFRKLFFNTRYFGKGMEDGGPGLEEIEHVDAVFTLL  233

Query  739   RYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDI  918
              ++Y    +DY+PWL + DLDGHK  +  A+ +  KH D+ ++ERIQ W DG+K VEED+
Sbjct  234   NHVYAFSASDYLPWLRLLDLDGHKGKVKNAMIIINKHHDSLIEERIQQWNDGSKNVEEDL  293

Query  919   VDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEE  1098
             +DVL+ LKD +  P+L+ KEIK  ++E+++A +DNPSNAVEW LAEM+ QP+L EKA EE
Sbjct  294   LDVLISLKDVNNNPLLTTKEIKALLIELIMATVDNPSNAVEWILAEMLIQPELFEKATEE  353

Query  1099  VDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQ  1278
             +DN+VG++RLVQESD+P LN++KAC +E FRLHPI  F  PH+ST DT+VG YFIPKGS 
Sbjct  354   LDNIVGKDRLVQESDIPKLNFLKACAREAFRLHPITDFNVPHVSTNDTMVGNYFIPKGSH  413

Query  1279  VIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGS  1452
             V++ R GLGRN+  W +P KFKPERHL  +G  + LT+ ELK +SFS GRRGCP V LGS
Sbjct  414   VLLGRRGLGRNRNVWAEPYKFKPERHLKNDGSAIALTEPELKFISFSTGRRGCPAVMLGS  473

Query  1453  LMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              M++ML+ARL+ GFTW    ++  I+  +S   + L+ PL   AKPRL + LY
Sbjct  474   TMTIMLLARLLHGFTWSAHPNISRINHFDSNGVISLDEPLTVAAKPRLAAELY  526



>ref|XP_002269843.2| PREDICTED: phenylalanine N-monooxygenase [Vitis vinifera]
Length=493

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/489 (56%), Positives = 365/489 (75%), Gaps = 6/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWPL+ ++P++L+NKP FRWIHG M EM TEIACI+LG  +VIPV SPE++REF
Sbjct  3     LPPGPAPWPLLRNLPDLLKNKPVFRWIHGFMKEMNTEIACIQLGNVHVIPVISPEISREF  62

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D+IF+SRP  M++   S G+L+   +P G +W K RR++ S V++  T  WL +KR
Sbjct  63    LKKHDAIFASRPVTMASEYSSGGFLTIAVVPKGTQWKKMRRVVASDVINETTFKWLHDKR  122

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
             VEEAD+L+RFIYNQCK   + +   +++VR   R Y GNV +KM+ N RYFG G  DGGP
Sbjct  123   VEEADNLVRFIYNQCKTFTSPS---IINVRNTVRQYSGNVIRKMILNTRYFGEGKKDGGP  179

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +E+ ++++FT+L +LY   ++DY PW+ + DLDGH+  + +A+    K+ D  V+ R
Sbjct  180   GIEEEQHVESLFTVLAHLYAFSLSDYFPWMRVLDLDGHEKTVRQAMNTIDKYHDPIVENR  239

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
              + W++G K   ED++D+ + +KD  G P+LS  EIK Q  E+M+AA+DNPSNA+EWA+A
Sbjct  240   AKQWRNGGKKEAEDLLDIFLSIKDAHGEPLLSVAEIKAQCTELMLAAVDNPSNAIEWAMA  299

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP++L KAVEE++ VVG+ERLVQESD   LNY+KAC +E FRLHPIAPF  PH+ST
Sbjct  300   EMINQPEVLRKAVEEINRVVGKERLVQESDFEQLNYVKACAREAFRLHPIAPFHLPHVST  359

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN---GEDVVLTDSELKMM  1404
              D VV GYFIPKGS V++SR GLGRN R WE+PL+FKPERHL+   G+ V LT+ +L+ +
Sbjct  360   CDAVVAGYFIPKGSHVLLSRLGLGRNGRIWEEPLRFKPERHLSEGTGKMVELTEPDLRFI  419

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SF  GRRGCPG   GS M+VML+ARL+QGFTW  P +   IDL+ES++DL LE PL A+A
Sbjct  420   SFGTGRRGCPGKATGSAMTVMLLARLLQGFTWSAPPEQKEIDLSESRNDLSLEKPLHAVA  479

Query  1585  KPRLPSNLY  1611
             KPRL ++LY
Sbjct  480   KPRLHASLY  488



>ref|XP_008349637.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=534

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/492 (56%), Positives = 368/492 (75%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP++G++P++L NKP FRWIH +MDEM TEIACIRLG T VIP+T P+L+
Sbjct  42    LPPTPKCLKPWPIIGNLPQLLANKPTFRWIHKMMDEMNTEIACIRLGNTNVIPITCPQLS  101

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+IF+SRP  +S  LI+ GY++++ +P+GE+W K R+++TS +LSP    WL 
Sbjct  102   REILKKQDAIFASRPXSISTFLITKGYITTVMVPFGEQWKKMRKVITSELLSPMRHKWLT  161

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KRVEEADH+++++YNQCK +E    G +V++R AT+HYC NV KKM+ NKRYFG    D
Sbjct  162   DKRVEEADHIVQYVYNQCKNNEG---GGIVNLRLATQHYCANVIKKMVLNKRYFGEEMED  218

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGPG  +++ L+ VFT+L Y+Y    +DYIP L   DLDGH+ II  A+  T K+ D  +
Sbjct  219   GGPGLEEQKYLENVFTMLNYIYSFSASDYIPCLRGLDLDGHEKIIKDAIRDTGKYQDPLI  278

Query  865   DERIQMWKD-GTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ER++   + G     +D++D+L+ LKD  G P+LS +EIK QV E+++AA+DNPSNA E
Sbjct  279   EERVREHMELGNNKEAQDLLDILISLKDKTGEPLLSVEEIKAQVNELIMAAVDNPSNAAE  338

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP+L EKA +E+D VVG+ R VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  339   WAIAEMINQPELFEKATQELDAVVGKNRQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  398

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS VI+SR GLGRN + W++PLKFKPERHL  +G  VVLT+SEL
Sbjct  399   HVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESEL  458

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GF+W VP     I+LTES++DL L  PL 
Sbjct  459   RFISFSTGMRGCVASGLGTXMTVMLFARLLHGFSWHVPPTESSIELTESQNDLLLAKPLL  518

Query  1576  ALAKPRLPSNLY  1611
             A AKPRL +++Y
Sbjct  519   AYAKPRLAAHVY  530



>gb|AHF22089.1| CYP79D33 [Maesa lanceolata]
Length=550

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/489 (57%), Positives = 366/489 (75%), Gaps = 8/489 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             IPPGPKPWPL+GS+PE+L NKPAFRWIH +MD+M  EI CIRLG  +VI VT+PE+A EF
Sbjct  61    IPPGPKPWPLIGSLPELLNNKPAFRWIHKIMDKMNAEIICIRLGNVHVIAVTAPEIALEF  120

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD +FSSRP  +   + S GY ++   P+GE+W K RR+L S VLS     WL  KR
Sbjct  121   LKQQDIVFSSRPISLPPKIASGGYKTTALSPWGEQWKKMRRVLASEVLSMERHRWLQCKR  180

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EE+DHL+R++YNQC +      G VV+VR AT+HYCGN+ +K++F +R+FG GA DGGP
Sbjct  181   DEESDHLVRYVYNQCHMK-----GGVVNVRIATQHYCGNMIRKIIFGRRFFGVGAVDGGP  235

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWL-SIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             G  + E +K+  TIL+YLY   ++DYIP+L    DLDGH+++  +A    RK+ D  +DE
Sbjct  236   GPEEVEHVKSSLTILQYLYSFCISDYIPFLRGYLDLDGHENMTREACESLRKYQDPIIDE  295

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+ WK+G K  +EDI+D+L+ LKD +G+P+LS  EIK Q++E++IA +DNPSNAVEWAL
Sbjct  296   RIKQWKEGKKEDQEDILDILIMLKDPNGQPLLSSDEIKAQIVELIIATVDNPSNAVEWAL  355

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+NQP+ + KA+EE+D VVG  RLV+ESD+P LNY+K+C+KE FR+HPI PF  PH+S
Sbjct  356   AEMLNQPQTMYKALEELDRVVGNSRLVEESDIPRLNYLKSCIKESFRIHPINPFNIPHVS  415

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMM  1404
               DT V GYFIP+GS V++SR GLGRN R W +PL+F PERHL  +G +V LTD +L+++
Sbjct  416   ISDTNVAGYFIPRGSHVLLSRPGLGRNPRVWSEPLRFIPERHLKDDGSNVGLTDPDLRIL  475

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGC GV LGS ++VML ARL+  F+W +P D+P I+L ES  DL L  PL A+A
Sbjct  476   SFSIGRRGCAGVTLGSTITVMLFARLLHSFSWSLPPDVPKIELKESPDDLLLAKPLVAIA  535

Query  1585  KPRLPSNLY  1611
             KPRL   LY
Sbjct  536   KPRLDEKLY  544



>emb|CAN61661.1| hypothetical protein VITISV_000261 [Vitis vinifera]
Length=572

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/520 (54%), Positives = 378/520 (73%), Gaps = 6/520 (1%)
 Frame = +1

Query  61    LALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHG  240
             L    ++  V+I  +  K K    +SS  + +PPGP PWPL+ ++P++L+NKP FRWIHG
Sbjct  51    LNFVLLLFCVSILVIFTKFKSNTSTSSKGMHLPPGPAPWPLLRNLPDLLKNKPVFRWIHG  110

Query  241   VMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLF  420
              M EM TEIACI+LG  +VIPV SPE++REFLKK D+IF+SRP  M++   S G+L+   
Sbjct  111   FMKEMNTEIACIQLGNVHVIPVISPEISREFLKKHDAIFASRPVTMASEYSSGGFLTIAV  170

Query  421   LPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDV  600
             +P G +W K RR++ S V++  T  WL +KRVEEAD+L+RFIYNQCK   + +   +++V
Sbjct  171   VPKGTQWKKMRRVVASDVINETTFKWLHDKRVEEADNLVRFIYNQCKTFTSPS---IINV  227

Query  601   RQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPW  780
             R   R Y GNV +KM+ N RYFG G  DGGPG  +E+ ++++FT+L +LY   ++DY PW
Sbjct  228   RNTVRQYSGNVIRKMILNTRYFGEGKKDGGPGIEEEQHVESLFTVLAHLYAFSLSDYFPW  287

Query  781   LSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRP  960
             + + DLDGH+  + +A+    K+ D  V+ R + W++G K   ED++D+ + +KD  G P
Sbjct  288   MRVLDLDGHEKTVRQAMNTIDKYHDPIVENRAKQWRNGGKKEAEDLLDIFLSIKDAHGEP  347

Query  961   MLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQES  1140
             +LS  EIK Q  E+M+AA+DNPSNA+EWA+AEMINQP++L KAVEE++ VVG+ERLVQES
Sbjct  348   LLSVAEIKAQCTELMLAAVDNPSNAIEWAMAEMINQPEVLRKAVEEINRVVGKERLVQES  407

Query  1141  DLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRA  1320
             D   LNY+KAC +E FRLHPIAPF  PH+ST D VV GYFIPKGS V++SR GLGRN R 
Sbjct  408   DFEQLNYVKACAREAFRLHPIAPFHLPHVSTCDAVVAGYFIPKGSHVLLSRLGLGRNGRI  467

Query  1321  WEDPLKFKPERHLN---GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQG  1491
             WE+PL+FKPERHL+   G+ V LT+ +L+ +SF  GRRGCPG   GS M+VML+ARL+QG
Sbjct  468   WEEPLRFKPERHLSEGTGKMVELTEPDLRFISFGTGRRGCPGKATGSAMTVMLLARLLQG  527

Query  1492  FTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             FTW  P +   IDL+ES++DL LE PL A+AKPRL ++LY
Sbjct  528   FTWSAPPEQKEIDLSESRNDLSLEKPLHAVAKPRLHASLY  567



>ref|XP_004237225.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=521

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/491 (60%), Positives = 367/491 (75%), Gaps = 20/491 (4%)
 Frame = +1

Query  157   PPGPKPWPLVGSIPEI-LRNKPAF-RWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             PPGPK WP++G  P+I L+NK A    IH +M+EM TEIACIR+G  +VIPVTSPELA E
Sbjct  46    PPGPKSWPIIGCFPQIILKNKHALINRIHKIMEEMNTEIACIRVGNYHVIPVTSPELACE  105

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
             FLK QDS+FSSRP CMSA LISN Y++S+FLP G++W K RRIL SHVLSP T  WL  K
Sbjct  106   FLKSQDSVFSSRPICMSANLISNNYITSIFLPIGDQWMKMRRILASHVLSPTTFQWLSCK  165

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRY-FGSGAADG  687
             R EEAD+L RF+YN   IS        +++R+ TR YCGNV + M+F+KR  FGS   + 
Sbjct  166   RDEEADNLHRFVYNNQCIS--------INLRRVTRCYCGNVIRNMIFSKRSSFGSTIEE-  216

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
                   EE + AVFT+L YL+  G++DY+PWLS FDLDGHK+II KA A   KH+D +VD
Sbjct  217   ------EEQVDAVFTLLEYLHSFGISDYLPWLSFFDLDGHKAIIKKAYAKATKHIDIEVD  270

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             +RIQ+WKDG KT++EDI+DVL+ LKD +G P+++ KEI+ QVLE+M+A +DNPSNAVEW 
Sbjct  271   KRIQIWKDGNKTLKEDILDVLIMLKDTNGNPLMNVKEIRAQVLELMLATVDNPSNAVEWT  330

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             LAEM+N+PKL++KA+EE++ VVG  R VQESDLP LNY+K C+KE FRLHPI+PF   H+
Sbjct  331   LAEMLNEPKLMQKAIEELNTVVGINRWVQESDLPRLNYVKTCIKEAFRLHPISPFNVLHV  390

Query  1228  STKDTVVG-GYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKMM  1404
             S  DT+VG  YFIPKGS V++SR GLGRN R WE+PLKFKPERHL  ED       L+++
Sbjct  391   SVSDTIVGEKYFIPKGSIVLLSRFGLGRNCRVWEEPLKFKPERHLKMEDGGKVVLNLRLL  450

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTE-SKHDLFLENPLFAL  1581
             SFS GRRGCP VKLGS ++ ML+ARL+QGFTW +P   PC DL E SK + F   PL A 
Sbjct  451   SFSIGRRGCPAVKLGSTITTMLLARLLQGFTWSLPPISPCNDLIESSKINHFSTLPLLAQ  510

Query  1582  AKPRLPSNLYM  1614
             AKPRL   +Y+
Sbjct  511   AKPRLAKAMYL  521



>ref|XP_004252024.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=526

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/494 (58%), Positives = 372/494 (75%), Gaps = 21/494 (4%)
 Frame = +1

Query  157   PPGPKPWPLVGSIPEIL-RNKPAF-RWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             PP PK WP++G +P+I  +NK +F  WIH  M+EM TEIACI +G  +VIPVTSPELA E
Sbjct  43    PPCPKSWPIIGILPQIFTKNKSSFVYWIHKTMEEMNTEIACIYVGNVHVIPVTSPELACE  102

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
             FLK QDS+FSSRP CMSA LISN YL+S+FLP G++W K R+IL SHVLSP++  WL  K
Sbjct  103   FLKIQDSVFSSRPICMSAKLISNNYLTSVFLPIGDQWMKMRKILASHVLSPSSLQWLRPK  162

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGG  690
             R E  D L+ F+Y QC   +       +++R+ TR YCGN  + M++NKR   +   +  
Sbjct  163   RDEAIDDLVEFVYKQCINQQ------FINLRKVTRCYCGNAIRNMVYNKRSLFASREE--  214

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
                 DE+ + A+FT+L+YL+  G++DY+PWLS+FDLDGHK+II KA  +  K +D +VD 
Sbjct  215   ----DEQQVDALFTLLKYLHCFGISDYLPWLSMFDLDGHKAIIKKAYDIATKQIDIEVDH  270

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RIQ+WKDG K +E+DI+DV + LKD++G P+++ KEIK QVLE+M+A +DNPSNAVEW L
Sbjct  271   RIQIWKDGYKNLEQDILDVFIMLKDDNGNPLMNAKEIKAQVLELMLATVDNPSNAVEWTL  330

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+NQPKL++KA++E+D+VVG  RLVQESDLP LNYIKAC+KE FRLHPI+PF  PH+S
Sbjct  331   AEMLNQPKLMQKAIKELDDVVGMNRLVQESDLPRLNYIKACIKEAFRLHPISPFNVPHVS  390

Query  1231  TKDTVVG-GYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE-----DVVLTDSE  1392
               DT++G  +FIPKGS V++SR GLGRN R W++PLKFKPERHL  +     +VVLTDS+
Sbjct  391   VSDTIIGEKHFIPKGSIVLLSRLGLGRNPRVWKNPLKFKPERHLKKKKKDDGEVVLTDSK  450

Query  1393  LKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTE-SKHDLFLENP  1569
             L+++SFS GRRGCP VKLGS ++ ML+ARL+QGFTW +P +    DL E SK D F   P
Sbjct  451   LRLLSFSIGRRGCPAVKLGSTITTMLLARLLQGFTWSLPPNSSSNDLLESSKVDHFCTLP  510

Query  1570  LFALAKPRLPSNLY  1611
             L A AKPRL +N+Y
Sbjct  511   LLAQAKPRLANNMY  524



>gb|EYU45628.1| hypothetical protein MIMGU_mgv1a023130mg [Erythranthe guttata]
Length=526

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/490 (57%), Positives = 357/490 (73%), Gaps = 10/490 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  +P++G +PE+ + +P FRWIH  M EM TEIAC R G T+VIPVTSPEL+REF
Sbjct  31    LPPGPIGYPIIGCLPEMTKKRPTFRWIHKRMQEMDTEIACFRFGKTHVIPVTSPELSREF  90

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D IF+SRP CMS  L SNGYLS++  PYG++W K RRIL+SH LSPA       KR
Sbjct  91    LKKHDLIFASRPDCMSGRLTSNGYLSAIISPYGDQWKKMRRILSSHALSPAMHKKFHEKR  150

Query  514   VEEADHLLRFIYNQC-------KISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGS  672
              EEADHL+R++Y Q          S  +    +V++R AT+HYCGNV +KM+F KR+FG+
Sbjct  151   GEEADHLVRYVYTQLLSSRNNNTNSNNNNNNGLVNLRVATQHYCGNVIRKMVFGKRFFGA  210

Query  673   GAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHL  852
             G  DGGPG  + E +  +FTIL YLYG  +ADY+P L IFD DG+K I+  AL   RK+ 
Sbjct  211   GMEDGGPGLEEREHVDGLFTILTYLYGFAIADYVPCLEIFDFDGYKKILGDALDNVRKYQ  270

Query  853   DTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSN  1032
             D ++  R++MW+ G K  E+DI+D  + LKD+   P+LS +EI+ Q+ EIM+A +DNPSN
Sbjct  271   DPEITNRVEMWRKGIKKTEDDILDAFINLKDSKHNPLLSVQEIRAQITEIMLAGVDNPSN  330

Query  1033  AVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPF  1212
             AVEWA+AEMINQP +L +A +E+D VVGR ++VQESDLPNLNY++ACVKE FRLHP+APF
Sbjct  331   AVEWAMAEMINQPHILNRACQELDKVVGRGKMVQESDLPNLNYVRACVKESFRLHPVAPF  390

Query  1213  TPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTD  1386
               PH+ST+D VVGGYFIP+GS V++SR GLGRN R WE+PL++ PERH+  E   V L D
Sbjct  391   NVPHVSTEDAVVGGYFIPRGSHVLLSRPGLGRNPRVWENPLEYNPERHMVVESAQVELVD  450

Query  1387  SELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLEN  1566
              +L+M+SFS GRRGCPGV LGS M+VML+ARL+ GF W  P  +  I L ES+ DL L  
Sbjct  451   HDLRMLSFSTGRRGCPGVTLGSTMAVMLLARLLHGFDWTAPPGVR-IGLGESEGDLLLAK  509

Query  1567  PLFALAKPRL  1596
             PL   A PRL
Sbjct  510   PLVLHATPRL  519



>ref|XP_002305081.2| Cytochrome P450 79B2 family protein [Populus trichocarpa]
 gb|EEE85592.2| Cytochrome P450 79B2 family protein [Populus trichocarpa]
Length=527

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/525 (52%), Positives = 382/525 (73%), Gaps = 9/525 (2%)
 Frame = +1

Query  40    SSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKP  219
             S II L   +  ++L++T+   I  +K          S+PPGP+PWPLVGS+P +LRNKP
Sbjct  9     SFIILLSFPILFLVLAITLFSFIQSSKN-----VKQYSLPPGPRPWPLVGSLPTMLRNKP  63

Query  220   AFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISN  399
              ++WIH +M EM TEIACIRLG  +VIPVT P +A EFLK+QD +FSSRP  +S+ L SN
Sbjct  64    VYQWIHNLMKEMNTEIACIRLGNIHVIPVTCPNIACEFLKEQDDVFSSRPETISSYLASN  123

Query  400   GYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASA  579
             GYL+++  P+G++W K + ++ + VLSP    WL  KRVEE D+L+R +Y QC+ S+   
Sbjct  124   GYLATVVSPFGDQWKKMKSVMATQVLSPTRHQWLHKKRVEEGDNLVRLVYKQCQESDQDG  183

Query  580   MGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLG  759
                +V++R  ++HYC NV +K++FNKRYFG G  +GGPG  +E+ + A+FTIL +L+   
Sbjct  184   ---IVNLRFTSQHYCANVIRKLMFNKRYFGVGMENGGPGFEEEQHVDALFTILSHLFSFC  240

Query  760   VADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKL  939
             V+D++ +L+  DLDGH+ ++ +   + +K+ D  +D+RIQ WKDG K   ED++DVL+ L
Sbjct  241   VSDFLSFLTWLDLDGHEKVMKEKDKIIKKYHDPIIDDRIQQWKDGKKKDIEDLLDVLITL  300

Query  940   KDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGR  1119
             KD++G P+LS  EIK QV +I++AA+DNPSNA EWA AEM+N P++LE AVEE+D VVG+
Sbjct  301   KDDNGNPLLSKDEIKAQVEDIILAAVDNPSNACEWAFAEMLNNPEILETAVEELDRVVGK  360

Query  1120  ERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTG  1299
             +RLVQESD   LNY+KAC +E FRLHP+APF  PH+S  DTVV  +FIPKGS VI+SR G
Sbjct  361   QRLVQESDFAQLNYVKACAREAFRLHPVAPFNVPHVSMADTVVAKHFIPKGSYVILSRLG  420

Query  1300  LGRNKRAWEDPLKFKPERHLNGE-DVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMA  1476
             LGRN + W++PL+FKPERHL G  +VVL ++ L+ +SFS G+RGC  V LGS M+ ML A
Sbjct  421   LGRNPKVWDEPLEFKPERHLEGTGNVVLAENGLRFISFSTGKRGCMAVTLGSSMTNMLFA  480

Query  1477  RLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             RL+ GF+W +P++   IDL+ +K  + L  PL A+AKPRLP++LY
Sbjct  481   RLLHGFSWSLPSNESSIDLSTAKDSMALAKPLLAVAKPRLPAHLY  525



>ref|XP_006387420.1| hypothetical protein POPTR_1061s00200g [Populus trichocarpa]
 gb|ERP46334.1| hypothetical protein POPTR_1061s00200g [Populus trichocarpa]
Length=541

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/478 (56%), Positives = 354/478 (74%), Gaps = 3/478 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG +P +LRNKP +RWIH +M EM TEIACIRLG  +VIPV  P++A EFLK QD+ F+
Sbjct  63    IVGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVHVIPVICPDIACEFLKAQDNTFA  122

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+  LIS+GYL+++  P G++W K +++L +HVLSP    WL +KRVEEADHL+ 
Sbjct  123   SRPNTMATDLISSGYLATILSPSGDQWNKMKKVLMTHVLSPKKHQWLYSKRVEEADHLVH  182

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YNQCK  ++   G +V++R A +HYC NVT+KMLFNKR+FG G  DGGPG  +EE + 
Sbjct  183   YVYNQCK--KSVHQGGIVNLRTAAQHYCANVTRKMLFNKRFFGEGMKDGGPGFEEEEYVD  240

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+F+ L ++Y   ++D++P L   DLDGH+ ++ +   +  K+ D  + ER+Q WKDG K
Sbjct  241   ALFSCLNHIYAFCISDFLPSLIGLDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAK  300

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D+L+ LKD  G P+LS  EIK Q+ EIM+AA+DNPSNA EWA AEM+NQP++L
Sbjct  301   KDTEDLLDILITLKDRHGNPLLSKDEIKAQITEIMVAAVDNPSNACEWAFAEMLNQPEIL  360

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             EKA EE+D VVG+ERLVQESD  +LNY+KAC +E FRLHP+APF  PH+S  DT V  YF
Sbjct  361   EKATEELDRVVGKERLVQESDFAHLNYVKACAREAFRLHPVAPFNVPHVSAADTTVANYF  420

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNG-EDVVLTDSELKMMSFSAGRRGCPG  1437
             IPKGS V++SR GLGRN + W++PLKFKPERHLN  E VVLT++ L+ +SFS G+RGC G
Sbjct  421   IPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCIG  480

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             V LG+ M+ ML ARL+Q FTW +P     IDLT ++  + L  PL ALAKPRLP  +Y
Sbjct  481   VSLGTSMTTMLFARLLQAFTWSLPPRQSSIDLTIAEDSMALAKPLCALAKPRLPPQVY  538



>ref|XP_009782885.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=543

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/487 (58%), Positives = 360/487 (74%), Gaps = 15/487 (3%)
 Frame = +1

Query  181   LVGSIPE-ILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIF  357
             +VG IP+ +L  KPAF WIH +M+EM TEIACIRLG  +VIPVTSPELA  FLK QDSIF
Sbjct  61    IVGCIPQMVLNKKPAFEWIHKLMEEMDTEIACIRLGNVHVIPVTSPELACLFLKNQDSIF  120

Query  358   SSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLL  537
             SSRP CMSA L+SNGYL+SLFLP G++W K RRIL+SHVLS  +  WL  KR EEADH+L
Sbjct  121   SSRPICMSANLVSNGYLTSLFLPMGDQWMKMRRILSSHVLSATSFQWLRRKRDEEADHIL  180

Query  538   RFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVD----  705
             RF+Y QC          V+++R+ TR+YC NV   M+F+KR  G    + G   V+    
Sbjct  181   RFVYEQCINKRL-----VINLRKVTRYYCANVINNMIFSKRLLGKSIIENGGPLVELQED  235

Query  706   -EELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQM  882
              E+ + A  T+L Y +   ++DY+PWLS FDLDGHK+II KA A+  KH+D ++D+RI +
Sbjct  236   QEKQIDAYLTLLEYFHSFSISDYLPWLSGFDLDGHKAIIKKAFAIATKHIDLEIDQRIHI  295

Query  883   WKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMI  1062
              K+G KTVEEDI+DVL+ L+D +G PML+ KEIK QVLE M+A LDNPS AVE  + EM+
Sbjct  296   SKNGKKTVEEDILDVLIMLRDTNGNPMLNAKEIKAQVLEFMLATLDNPSYAVESTIKEML  355

Query  1063  NQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDT  1242
             NQPK++++A+EE+DNV+G  RLVQESDLP LNY+KAC+KE FRLHP+  F  PH+S  D+
Sbjct  356   NQPKIMQRAIEEIDNVMGSNRLVQESDLPRLNYVKACIKESFRLHPLTAFNVPHVSVSDS  415

Query  1243  VVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN--GEDVVLTDSELKMMSFSA  1416
             VVG YFIPKGS V++SR GLGRN R W+DP+KFKPERH++  G DVV TDSEL+++SFS 
Sbjct  416   VVGEYFIPKGSVVLLSRFGLGRNPRVWDDPMKFKPERHISEEGGDVVFTDSELRLLSFSI  475

Query  1417  GRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHD--LFLENPLFALAKP  1590
             GRRGCPGV LGS ++ ML+ARL+QGFTW +P + P  DL +   +  L    P FA AK 
Sbjct  476   GRRGCPGVNLGSTITTMLLARLLQGFTWSLPLNSPGNDLADDYPECALLCTMPFFAKAKL  535

Query  1591  RLPSNLY  1611
             RL  ++Y
Sbjct  536   RLSKDMY  542



>ref|XP_006486508.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=502

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/496 (55%), Positives = 369/496 (74%), Gaps = 12/496 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG++PE+ RNKP F+WIH VM E+ T I+CIR G  +VIPVTSPE+A E 
Sbjct  6     LPPGPAAWPIVGNLPEMWRNKPTFKWIHSVMKELNTNISCIRFGNVHVIPVTSPEIALEV  65

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DSIF++RP  M     S G+LS   +P+G++W K R+++ SHVLS A  + L++KR
Sbjct  66    LKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWKKMRKMVASHVLSSARLNSLISKR  125

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+RFIYNQC+ S ++A   VVDVR ATRHYCGNV +KM+FN+RYFG G  DGGP
Sbjct  126   REEADNLVRFIYNQCRKSASAA--TVVDVRLATRHYCGNVIRKMMFNRRYFGEGKEDGGP  183

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE ++++F +L++LY   ++DY+PW+ +FDL+GH+ +I+ A+    K+ D+ +DER
Sbjct  184   GFEEEEHVESLFVVLQHLYSFTLSDYVPWMRVFDLEGHEKLISAAMKTANKYHDSMIDER  243

Query  874   IQMWK---DGTKTV--EEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAV  1038
             +Q  +   D  K    ++D++DVL+  KD +G P+LS  EIK+Q +++ +A +DNPSNA 
Sbjct  244   VQQRRHHPDNKKEAHNDQDLLDVLISAKDENGDPLLSVDEIKSQCMDLTLATVDNPSNAA  303

Query  1039  EWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTP  1218
             EWA+AEMINQP++L+KA EE+D VVG+ERLVQESD+P LNYIKAC++E  RLHP+APF  
Sbjct  304   EWAIAEMINQPEILQKATEEIDRVVGKERLVQESDVPQLNYIKACLREVLRLHPVAPFNL  363

Query  1219  PHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED-----VVLT  1383
             PH+ST+D  V GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D     V L 
Sbjct  364   PHVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSVDDHHHQVELA  423

Query  1384  DSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLE  1563
             ++EL+ +SFS GRR C G+ LGS MSV+L+ARL+QGF W  P+    IDL+ESK+DL + 
Sbjct  424   ETELRFLSFSRGRRSCMGMALGSEMSVVLLARLLQGFEWSAPSGEEKIDLSESKYDLLMA  483

Query  1564  NPLFALAKPRLPSNLY  1611
              PL A AKPRL + LY
Sbjct  484   KPLRARAKPRLAAELY  499



>gb|AHF20913.1| cytochrome P450 [Populus trichocarpa]
Length=528

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/478 (56%), Positives = 354/478 (74%), Gaps = 3/478 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG +P +LRNKP +RWIH +M EM TEIACIRLG  +VIPV  P++A EFLK QD+ F+
Sbjct  50    IVGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVHVIPVICPDIACEFLKAQDNTFA  109

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+  LIS+GYL+++  P G++W K +++L +HVLSP    WL +KRVEEADHL+ 
Sbjct  110   SRPNTMATDLISSGYLATILSPSGDQWNKMKKVLMTHVLSPKKHQWLYSKRVEEADHLVH  169

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YNQCK  ++   G +V++R A +HYC NVT+KMLFNKR+FG G  DGGPG  +EE + 
Sbjct  170   YVYNQCK--KSVHQGGIVNLRTAAQHYCANVTRKMLFNKRFFGEGMKDGGPGFEEEEYVD  227

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+F+ L ++Y   ++D++P L   DLDGH+ ++ +   +  K+ D  + ER+Q WKDG K
Sbjct  228   ALFSCLNHIYAFCISDFLPSLIGLDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAK  287

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D+L+ LKD  G P+LS  EIK Q+ EIM+AA+DNPSNA EWA AEM+NQP++L
Sbjct  288   KDTEDLLDILITLKDRHGNPLLSKDEIKAQITEIMVAAVDNPSNACEWAFAEMLNQPEIL  347

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             EKA EE+D VVG+ERLVQESD  +LNY+KAC +E FRLHP+APF  PH+S  DT V  YF
Sbjct  348   EKATEELDRVVGKERLVQESDFAHLNYVKACAREAFRLHPVAPFNVPHVSAADTTVANYF  407

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNG-EDVVLTDSELKMMSFSAGRRGCPG  1437
             IPKGS V++SR GLGRN + W++PLKFKPERHLN  E VVLT++ L+ +SFS G+RGC G
Sbjct  408   IPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCIG  467

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             V LG+ M+ ML ARL+Q FTW +P     IDLT ++  + L  PL ALAKPRLP  +Y
Sbjct  468   VSLGTSMTTMLFARLLQAFTWSLPPRQSSIDLTIAEDSMALAKPLCALAKPRLPPQVY  525



>ref|XP_008359055.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=637

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/492 (56%), Positives = 366/492 (74%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP++G++P++L NKP FRWIH +MDEM TEIACIRLG T VIP+T P+L+
Sbjct  145   LPPTPKCLKPWPIIGNLPQLLANKPTFRWIHKMMDEMNTEIACIRLGNTNVIPITCPQLS  204

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+IF+SRP  +S  LI+ GY++++ +P+GE+W K R+++TS +LSP    WL 
Sbjct  205   REILKKQDAIFASRPPSISTFLITKGYITTVMVPFGEQWKKMRKVITSELLSPMRHKWLT  264

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KRVEEADH++ ++YNQCK +E    G +V++R AT+HYC NV KKM+ NKRYFG    D
Sbjct  265   DKRVEEADHIVXYVYNQCKNNEG---GGIVNLRLATQHYCANVIKKMVLNKRYFGEEMED  321

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGPG  +++ L+ VFT+L Y+Y    +DYIP L   DLDGH+ II  A+  T K+ D  +
Sbjct  322   GGPGLEEQKYLENVFTMLNYIYSFSASDYIPCLRGLDLDGHEKIIKDAIRDTGKYQDPLI  381

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ER+ +    G     +D++D+L+ LKD  G P+LS +EIK QV E+++AA+DNPSNA E
Sbjct  382   EERVREXMXLGNNKEAQDLLDILISLKDKXGEPLLSVEEIKAQVNELIMAAVDNPSNAAE  441

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP+L EKA +E+D VVG+ R VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  442   WAIAEMINQPELFEKATQELDAVVGKNRQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  501

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS VI+SR GLGRN + W++PLKFKPERHL  +G  VVLT+SEL
Sbjct  502   HVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESEL  561

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GF+W VP     I+LTES++DL L  PL 
Sbjct  562   RFISFSTGMRGCVASGLGTTMTVMLFARLLHGFSWHVPPTESSIELTESQNDLLLAKPLL  621

Query  1576  ALAKPRLPSNLY  1611
             A AKPRL +++Y
Sbjct  622   AYAKPRLAAHVY  633



>ref|XP_006435922.1| hypothetical protein CICLE_v10031307mg [Citrus clementina]
 gb|ESR49162.1| hypothetical protein CICLE_v10031307mg [Citrus clementina]
Length=503

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/496 (55%), Positives = 370/496 (75%), Gaps = 12/496 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG++PEI RNKPAF+WIH VM E+KT I+CIRLG  +VIPVTSPE+A E 
Sbjct  6     LPPGPAAWPIVGNLPEIWRNKPAFKWIHSVMKELKTNISCIRLGNVHVIPVTSPEIALEV  65

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DSIF++RP  M     S G+LS   +P+G++W K R+++ SHVLS A  + L++KR
Sbjct  66    LKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWKKMRKMVASHVLSSARLNSLISKR  125

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+RFIYNQC+ S ++A   VVDVR ATRHYCGNV +KM+FN+RYFG G  DGGP
Sbjct  126   REEADNLVRFIYNQCRKSASAA--TVVDVRLATRHYCGNVIRKMMFNRRYFGEGKEDGGP  183

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE ++++F +L++LY   ++DY+PW+ +FDL+GH+ II+ A+    K+ D+ +DER
Sbjct  184   GFEEEEHVESLFVVLQHLYSFTLSDYVPWMRVFDLEGHEKIISAAMKTANKYHDSIIDER  243

Query  874   IQMWK---DGTKTV--EEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAV  1038
             +   +   D  K    ++D++DVL+  KD +G P+LS  EIK+Q +++ +A +DNPSNA 
Sbjct  244   VHQRRRHHDNKKEAHKDQDLLDVLISAKDENGVPLLSIDEIKSQCMDLTLATVDNPSNAA  303

Query  1039  EWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTP  1218
             EWA+AEMINQP++L+KA EE+D VVG+ERLVQESD+P LNYIKAC++E  RLHP+APF  
Sbjct  304   EWAIAEMINQPEILQKATEEIDRVVGKERLVQESDVPQLNYIKACLREVLRLHPVAPFNL  363

Query  1219  PHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED-----VVLT  1383
             PH+ST+D  + GYFIPKGS V++SR GLGRN   W+D LKF PERH+   D     + L 
Sbjct  364   PHVSTRDATIAGYFIPKGSHVLLSRIGLGRNPNVWKDSLKFIPERHIGSVDDHHHQLELA  423

Query  1384  DSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLE  1563
             ++EL+ +SFS GRR C G+ LGS MSV+L+ARL+QGF W  P+    IDL+ESK+DL + 
Sbjct  424   ETELRFLSFSRGRRSCMGMALGSEMSVVLLARLLQGFEWSAPSGEEKIDLSESKYDLLMA  483

Query  1564  NPLFALAKPRLPSNLY  1611
              PL A AKPRL + LY
Sbjct  484   KPLRARAKPRLAAELY  499



>ref|XP_007011293.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20103.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=553

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/481 (56%), Positives = 365/481 (76%), Gaps = 4/481 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             ++G++PEI R +PAFRWIHG+M E+ T+I C+RL  T+V+ VTSP +AREFLKK DS+F+
Sbjct  70    IIGNLPEIWRKRPAFRWIHGLMKELHTDILCVRLASTHVVAVTSPAIAREFLKKNDSVFA  129

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+    S  +L+   +P+G++W K RR++T  ++S +  H L+  R EEAD+L+R
Sbjct  130   SRPVTMATEYSSRRFLTIAVVPWGDQWKKMRRVVTCEIVSASKLHSLLENRTEEADNLVR  189

Query  541   FIYNQCKIS--EASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEEL  714
             FIYNQCK +  + S   AVV++R A R Y GNV +KM+FN+RYFG G  DGGPG  +EE 
Sbjct  190   FIYNQCKSNGGDNSTASAVVNLRLAMRQYSGNVIRKMIFNRRYFGEGRKDGGPGYEEEEH  249

Query  715   LKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDG  894
             ++++FT+L++LY   ++DYIPWL  FDL+GH+  + KA+ +   + D  +DER+Q W++G
Sbjct  250   VESLFTVLKHLYSFILSDYIPWLRSFDLEGHEKTVRKAMKIVNDYQDPLIDERVQEWREG  309

Query  895   TKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPK  1074
              +T  ED++D  +  KD++G+  LS +EIK Q  E+M+A +DNPSNAVEWA+AEMINQP+
Sbjct  310   KRTESEDLLDAFILAKDSNGKRALSIEEIKAQCAELMLATVDNPSNAVEWAMAEMINQPE  369

Query  1075  LLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGG  1254
             +L KAVEE+D VVG+ERLVQE+D+P LNY+KAC +EGFRLHPIAPF  PH+ST D  V G
Sbjct  370   ILLKAVEEIDAVVGKERLVQEADIPKLNYVKACAREGFRLHPIAPFNLPHVSTADATVAG  429

Query  1255  YFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED--VVLTDSELKMMSFSAGRRG  1428
             YFIPKGS V++SR GLGRN + W+DPLKF PERHL      V LT+++L+ +SFS GRRG
Sbjct  430   YFIPKGSHVLLSRYGLGRNPKVWDDPLKFNPERHLKDGSMCVGLTETDLRFISFSTGRRG  489

Query  1429  CPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNL  1608
             C GV LG+ M+VML+ARL+QGFTWRVP +   IDL+E+K DLF+  PL AL +PRLP++L
Sbjct  490   CMGVALGTAMTVMLLARLLQGFTWRVPPNEANIDLSEAKDDLFMAKPLHALGQPRLPAHL  549

Query  1609  Y  1611
             Y
Sbjct  550   Y  550



>ref|XP_002319424.1| hypothetical protein POPTR_0013s15320g [Populus trichocarpa]
 gb|EEE95347.1| hypothetical protein POPTR_0013s15320g [Populus trichocarpa]
Length=528

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/478 (56%), Positives = 352/478 (74%), Gaps = 3/478 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG +P +LRNKP +RWIH +M EM TEIACIRLG   VIPV  P++A EFLK QD+ F+
Sbjct  50    IVGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVLVIPVICPDIACEFLKAQDNTFA  109

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+  LIS GYL+++  P G++W K +++L +HVLSP    WL +KRVEEADHL+ 
Sbjct  110   SRPNTMTTDLISRGYLATILSPSGDQWNKMKKVLMTHVLSPKKHQWLYSKRVEEADHLVH  169

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YNQCK  ++   G +V++R A RHYC NVT+KMLFNKR+FG G  DGGPG  +EE + 
Sbjct  170   YVYNQCK--KSVHQGGIVNLRTAARHYCANVTRKMLFNKRFFGEGMKDGGPGFEEEEYMD  227

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+F+ L+++Y   ++D++P L   DLDGH+ ++ +   +  K+ D  + ER+Q WKDG K
Sbjct  228   ALFSCLKHIYAFCISDFLPSLIGLDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAK  287

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D+L+ LKD +G P+LS  EIK Q+ EIM+AA+DNPSNA EWA AEM+NQP++L
Sbjct  288   KDTEDLLDILITLKDRNGNPLLSKDEIKAQITEIMVAAVDNPSNACEWAFAEMLNQPEIL  347

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             EKA EE+D VVG+ERLVQESD  +LNY+KAC +E FRLHP APF  PH+S  DT V  YF
Sbjct  348   EKATEELDRVVGKERLVQESDFAHLNYVKACAREAFRLHPFAPFNVPHVSAADTTVANYF  407

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNG-EDVVLTDSELKMMSFSAGRRGCPG  1437
             IPKGS V++SR GLGRN + W++PLKFKPERHLN  E VVLT++ L+ +SFS G+RGC G
Sbjct  408   IPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCKG  467

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             V LG+ M+ ML ARL+Q FTW +P     IDLT ++  + L  PL ALAKPRL   +Y
Sbjct  468   VTLGTSMTTMLFARLLQAFTWSLPPRQSSIDLTIAEDSMALAKPLCALAKPRLRPQVY  525



>emb|CDP19033.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/456 (59%), Positives = 349/456 (77%), Gaps = 6/456 (1%)
 Frame = +1

Query  244   MDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFL  423
             MD++ TEIACIR+ G ++IPVTSPELAREF KKQDSIFSSRP  MSA L S G+L++   
Sbjct  1     MDDLNTEIACIRIFGVHIIPVTSPELAREFCKKQDSIFSSRPVFMSAELCSEGFLTTALS  60

Query  424   PYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVR  603
             P G+++ K +R++ S VLSPA   WL  KR EEADHL+ ++YNQCK +   A G +VD+R
Sbjct  61    PMGDQYKKMKRMVVSSVLSPAKHQWLQCKRAEEADHLVNYVYNQCKYN---ATGGLVDIR  117

Query  604   QATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWL  783
               T+HYCGNV +KM+FN R+FG G  DGGPGA + E +  +F IL YLY   ++DY+PW+
Sbjct  118   LVTQHYCGNVIRKMIFNIRFFGKGMEDGGPGAEEVEHINGLFKILAYLYAFSLSDYMPWM  177

Query  784   SIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPM  963
              IFD DGH+ I+T+A+A  RKH D ++++RI+MW+ G K  EED++DVL++LKDN+ RP+
Sbjct  178   KIFDFDGHRKILTEAVACVRKHQDPEIEKRIKMWESGVKNEEEDLLDVLIRLKDNNSRPL  237

Query  964   LSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESD  1143
             L+ +EI+ Q+ E+M A +DNPSNAVEWALAEM+NQP++L+KA EE+D VVG++RLVQESD
Sbjct  238   LTTEEIRAQITELMFATVDNPSNAVEWALAEMLNQPEMLQKATEELDAVVGKDRLVQESD  297

Query  1144  LPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAW  1323
             LP L Y+KACV+E  RLHP+APF  PH+ST+DTVVGGY IPKGS VI+SR GL RN R W
Sbjct  298   LPRLKYVKACVRESLRLHPLAPFNVPHVSTQDTVVGGYLIPKGSHVILSRPGLSRNPRIW  357

Query  1324  EDPLKFKPERHLNGED---VVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGF  1494
             EDPLK+KPERH+   D   + L D EL M SFS GRRGCPGV LGS ++VML+ARL+Q F
Sbjct  358   EDPLKYKPERHMKDMDDARMDLNDPELNMFSFSTGRRGCPGVLLGSTLTVMLLARLLQCF  417

Query  1495  TWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             +W++P+    IDL E +   FL  PL A+A+PR P 
Sbjct  418   SWKIPSGHSQIDLVECEDSGFLAKPLVAVAEPRFPQ  453



>ref|XP_003543894.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
 gb|KHN02647.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=537

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/479 (57%), Positives = 359/479 (75%), Gaps = 3/479 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+L NKPA +WIH +M EM TEIACIRLG  YVIPVT P +AREFL+KQD+ F+
Sbjct  58    IVGNLPEMLANKPAHKWIHNLMKEMNTEIACIRLGNAYVIPVTCPTIAREFLRKQDATFA  117

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SR + +S  LISNGY +++F P+G +W K ++ILT+ +LSP    WL  +R EEAD+L+ 
Sbjct  118   SRSQSVSTDLISNGYSTTIFGPFGAQWKKMKKILTNDLLSPHKHLWLHGQRTEEADNLMF  177

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
              +YN+CK +    +G +V++R   RHYCGN+T+K++FN RYFG G  DGGPG  + E + 
Sbjct  178   HVYNKCK-NVNDGVGGLVNIRSVARHYCGNLTRKIIFNTRYFGKGREDGGPGFEEVEHVD  236

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L+Y+Y   V+DY+P L   DLDGH+  + +AL + +K+ D  V ERI++W DG K
Sbjct  237   SIFDLLKYVYAFSVSDYMPCLRGLDLDGHEKNVKEALKIIKKYHDPIVQERIKLWNDGLK  296

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
               EED +DVLV LKD++  P+L+ +EI  Q++E+M+A +DNPSNA EWALAEMINQP+LL
Sbjct  297   VDEEDWLDVLVSLKDSNNNPLLTLEEINAQIIELMLATIDNPSNAFEWALAEMINQPELL  356

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
              +AVEE+D+VVG+ERLVQESD+P LNY+KAC +E  RLHPIAPF PPH+S  DT+VG YF
Sbjct  357   HRAVEELDSVVGKERLVQESDIPKLNYVKACAREALRLHPIAPFIPPHVSMSDTMVGNYF  416

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCP  1434
             IPKGS V++SR  LGRN + W +  KFKPERHL  +G DV LT+  LK +SFS GRRGCP
Sbjct  417   IPKGSHVMLSRQELGRNPKVWNETYKFKPERHLKSDGSDVDLTEPNLKFISFSTGRRGCP  476

Query  1435  GVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             GV LG+ M+VML ARL+ GFTW  P ++  I+L ES  D+ L  PL A+AKPRL S LY
Sbjct  477   GVMLGTTMTVMLFARLLHGFTWTAPPNVSSINLAESNDDILLAEPLVAVAKPRLASELY  535



>ref|XP_011098373.1| PREDICTED: valine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/490 (58%), Positives = 371/490 (76%), Gaps = 6/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  +P+VG +PE+++NKPAFRWIH +M E+ TEIACIRLG T+VI VTSPELAREF
Sbjct  40    LPPGPMGYPIVGCMPEMMKNKPAFRWIHKLMQEINTEIACIRLGNTHVIVVTSPELAREF  99

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             L+KQD IF+SRP+ MSA L SNG+L+    P G +W K R+++ S VLSP     L  KR
Sbjct  100   LRKQDVIFASRPKSMSANLTSNGFLTIATAPMGNQWKKMRKVIASEVLSPEMHQRLHAKR  159

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EE DHL+R++YNQ   S+   +  +V+VR   +HYCGNV++K++F KR+FG G  DGGP
Sbjct  160   CEETDHLVRYVYNQ---SQNPLLNGLVNVRVVAQHYCGNVSRKLVFGKRFFGIGTGDGGP  216

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  ++E + A+FTIL+YLYG G+AD++PWL  FDLDG K I+  A+   +K+ D ++D+R
Sbjct  217   GMEEKEHVDALFTILKYLYGFGIADHLPWLEEFDLDGCKRILKDAIRSLKKYQDPEIDKR  276

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             + MW+ G +  EEDI+DVL+ L D++   +LSD+EIK ++ EIM+AA+DNPSNAVEWALA
Sbjct  277   VYMWQQGIRKTEEDILDVLINLTDSEKNHVLSDQEIKAEITEIMLAAIDNPSNAVEWALA  336

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP +L++A +E+D VVGR RLV ESDL  LNYIKACVKE FRLHP+APF  PH+S 
Sbjct  337   EMINQPDILDRAYKELDQVVGRNRLVDESDLYRLNYIKACVKEAFRLHPVAPFNIPHVSV  396

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED--VVLTDSELKMMS  1407
             ++T VGGYFIPK S V++SR GLGRN R WEDPL +KPERH+  +D  VVL D +L+M+S
Sbjct  397   EETTVGGYFIPKNSHVLLSRHGLGRNPRIWEDPLVYKPERHIVNKDSEVVLMDHDLRMIS  456

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPC-IDLTESKHDLFLENPLFALA  1584
             FS GRRGCPGV LGS M+ +L+ARLIQGF W  P + P  IDL ES+ DL +  PL A A
Sbjct  457   FSTGRRGCPGVVLGSTMATILLARLIQGFNWSPPPNAPSNIDLVESEGDLLMAKPLIAYA  516

Query  1585  KPRLPSNLYM  1614
              PRL  ++Y+
Sbjct  517   IPRLEPHVYL  526



>gb|AHY21761.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/510 (54%), Positives = 373/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPATIWIHKMMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L S++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVSNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  V +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIVHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E++I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKEIKAQLTELVIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHLN G+DVVLT+ EL+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLNAGDDVVLTEPELRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>ref|XP_004139121.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cucumis sativus]
 ref|XP_004154685.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cucumis sativus]
Length=539

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/529 (51%), Positives = 385/529 (73%), Gaps = 8/529 (2%)
 Frame = +1

Query  31    LRFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILR  210
             L  SS  F+ +  +  +L V       K +  Y   S++ ++PPGP PWP+VG +P I R
Sbjct  7     LPLSSSTFMIILFYGSILVVAFILFYAKRRNKYCVGSTAAALPPGPTPWPIVGCLPTIWR  66

Query  211   NKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGL  390
              KP +RW+H +M+E+ TEIACIRLG  +VIPVTSPELA EFLK  DS+F+SRP  ++  +
Sbjct  67    KKPRYRWVHKIMEELNTEIACIRLGKIHVIPVTSPELAIEFLKTHDSVFASRPITVTTDI  126

Query  391   ISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISE  570
              S+G+L++   P+G +W K RRILTS +LSPA    +++KR EEAD+LLR++++  K + 
Sbjct  127   FSDGFLTAGVAPWGNQWKKMRRILTSEILSPARHRSMLSKRTEEADNLLRYVFSLTKTTP  186

Query  571   ASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLY  750
              S     V+VR  T+HY GNV ++M+FN+RY+G G  DGGP   +EE + A+FT+L+++Y
Sbjct  187   TS-----VNVRSITQHYSGNVMRRMMFNRRYYGKGRPDGGPATEEEEHIGALFTMLQHVY  241

Query  751   GLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVL  930
                V+DY+  L  FDLDGH+ I+ KAL V RK+ +  +DER+Q W+DG +   ED++D+ 
Sbjct  242   AFCVSDYMSCLKAFDLDGHERIVKKALNVIRKYEEPIIDERVQQWRDGKRKETEDMLDIF  301

Query  931   VKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNV  1110
             + LKD +G P+LS KEIK Q+ E+++A +DNPSNAVEWA+AEM+NQP+LL++A EE+D V
Sbjct  302   ISLKDGNGEPLLSVKEIKAQITELLLATVDNPSNAVEWAMAEMLNQPQLLQQATEELDRV  361

Query  1111  VGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIIS  1290
             VG++RLVQESD+PNL ++ AC +E  RLHPIAPF  PH++T D VV GY IP GS V++S
Sbjct  362   VGKQRLVQESDIPNLKFLTACAREALRLHPIAPFNLPHIATTDVVVAGYLIPAGSHVLLS  421

Query  1291  RTGLGRNKRAWEDPLKFKPERHLN--GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSV  1464
             R GLGRN R W DP++F P RHL   G D+ L + +L+ ++F+ GRRGC G  LG+ +++
Sbjct  422   RLGLGRNHRIWPDPMRFDPNRHLQDPGADLGLGEPDLRFITFTRGRRGCMGGTLGTAITM  481

Query  1465  MLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             ML+ARL+QGFTW++P  +  I+L+ES H LFL++P+FALA+PRLP +LY
Sbjct  482   MLLARLVQGFTWQLPPGVAAIELSES-HQLFLKDPMFALAQPRLPESLY  529



>ref|XP_009342222.1| PREDICTED: isoleucine N-monooxygenase 1-like [Pyrus x bretschneideri]
Length=534

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/492 (56%), Positives = 364/492 (74%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP+VG++PE+L NKP FRWIH +MDEM TEIACIRLG T VIP+T P+L+
Sbjct  43    LPPTPKCLKPWPIVGNLPELLANKPTFRWIHKMMDEMNTEIACIRLGNTNVIPITCPQLS  102

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+IF+SRP  +S  LI+ GY +++ +P+GE+W K R+++ S +L+P    WL 
Sbjct  103   REILKKQDAIFASRPLSISTFLITKGYKTAVMVPFGEQWKKMRKVIASELLTPMRHKWLA  162

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KRVEEADH+++++YNQC  +E   +G +   R AT+HYC NV KKM+ NKRYFG    D
Sbjct  163   DKRVEEADHIVKYVYNQCNNNEGGGIGNL---RLATQHYCANVIKKMVLNKRYFGEEMED  219

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGPG  +++ L+ VFT+L Y+Y    +DYIP L   DLDGH+ II  A+  TRK+ D  +
Sbjct  220   GGPGLEEQKYLENVFTMLNYIYSFSASDYIPCLRGLDLDGHEKIIKDAIRDTRKYQDPLI  279

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ER+ +  K G      D++D+L+ LKD +G P+LS +EIK QV E+++AA+DNPSNA E
Sbjct  280   EERVREHQKFGNNKEAHDLLDILISLKDKNGEPLLSLEEIKAQVNELIMAAVDNPSNAAE  339

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP+L EKA +E+D V+G+ R VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  340   WAIAEMINQPELFEKATQELDAVIGKNRQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  399

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS VI+SR GLGRN + W++PLKFKPERHL  +G  VVLT+SEL
Sbjct  400   HVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESEL  459

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GFTW VP     I+LTES +DL L  PL 
Sbjct  460   RFISFSTGMRGCVASTLGTAMTVMLFARLLHGFTWHVPPTESSIELTESTNDLLLAKPLL  519

Query  1576  ALAKPRLPSNLY  1611
             A AKPRLP+++Y
Sbjct  520   AYAKPRLPAHVY  531



>gb|AHI88992.1| CYP79D6v4 [Populus nigra]
Length=528

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/478 (56%), Positives = 352/478 (74%), Gaps = 3/478 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG +P +LRNKP +RWIH +M EM TEIACIRLG  +VIPV  P++A EFLK QD+ F+
Sbjct  50    IVGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVHVIPVICPDIACEFLKAQDNTFA  109

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+  LIS GYL++   P G++W K +++L +HVLSP    WL +KRVEEADHL+ 
Sbjct  110   SRPHTMTTNLISRGYLTTALSPSGDQWNKMKKVLMTHVLSPKKHQWLYSKRVEEADHLVH  169

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YNQCK  +++  G +V++R A +HYC NVT+KMLFNKR+FG G  DGGPG  +EE + 
Sbjct  170   YVYNQCK--KSAHQGGIVNLRTAAQHYCANVTRKMLFNKRFFGEGMKDGGPGFEEEEYVD  227

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A F+ L ++Y   ++D++P L   DLDGH+ ++ +   +  K+ D  + ER+Q WKDG K
Sbjct  228   AFFSCLNHIYAFCISDFLPSLIGLDLDGHEKVVIENHRIINKYHDPIIHERVQQWKDGAK  287

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D+L+ LKD DG P+LS  EIK Q+ EIM+AA+DNPSNA EWA AEM+NQP++L
Sbjct  288   KDTEDLLDILITLKDPDGNPLLSKDEIKAQITEIMVAAVDNPSNACEWAFAEMLNQPEIL  347

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             EKA +E+D VVG+ERLVQESD  +LNY+KAC +E FRLHP+APF  PH+   DT V  YF
Sbjct  348   EKATQELDRVVGKERLVQESDFSHLNYVKACAREAFRLHPVAPFNVPHVPAADTTVANYF  407

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNG-EDVVLTDSELKMMSFSAGRRGCPG  1437
             IPKGS V++SR GLGRN + W++PLKFKPERHLN  E VVLT++ L+ +SFS G+RGC G
Sbjct  408   IPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCIG  467

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             V LG+ M+ ML ARL+Q FTW +P     IDLT ++  + L  PL ALAKPRLP  +Y
Sbjct  468   VTLGTSMTTMLFARLLQAFTWSLPPRQSRIDLTIAEDSMALAKPLCALAKPRLPPQVY  525



>gb|KHG05899.1| Phenylalanine N-monooxygenase -like protein [Gossypium arboreum]
Length=549

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/525 (52%), Positives = 384/525 (73%), Gaps = 11/525 (2%)
 Frame = +1

Query  40    SSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEIL--RN  213
             +S + L    F V L + +   + K K   G S     +PPGP PWP++G+IPEIL  +N
Sbjct  23    TSCLVLAQPTFLV-LCLLVSLFVVKAK---GKSRKKPDLPPGPTPWPIIGNIPEILSKKN  78

Query  214   KPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLI  393
             KP +RWIH  M E+ T+IACIRL  T+VIPVTSPE+AREFLKK D++F+SRP  M+    
Sbjct  79    KPTYRWIHCFMKELNTDIACIRLANTHVIPVTSPEIAREFLKKHDAVFASRPVTMATEYS  138

Query  394   SNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEA  573
             S G+L+   +P+G++W K R+++ S +++PA    L++KR EE D+L+RFIYNQCK +  
Sbjct  139   SRGFLTIAVVPWGDQWKKMRKVMASEIITPARLRSLLDKRTEEVDNLVRFIYNQCKSNGG  198

Query  574   SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYG  753
             S+  AV+++R A R   GN+ +KM+FN+R+FG G  DGGPG  + E +++VFT+LR+LY 
Sbjct  199   SS--AVINLRLAARQCTGNIIRKMMFNRRFFGEGRKDGGPGYEEVEYIESVFTVLRHLYS  256

Query  754   LGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLV  933
               ++DY+PWL   DL+GH+ I+++A+ V   + D  +D+R++ WKDG +   ED++D  +
Sbjct  257   FILSDYMPWLRPLDLEGHEKIVSEAMKVVNGYNDPLIDKRVKEWKDGKRKEPEDLLDAFI  316

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
                D++G+P LS +EIK Q  E+M A LDNPSNA EWA+AEMINQP++L+KA EE++ VV
Sbjct  317   LAMDSEGKPALSVEEIKAQCTEMMFATLDNPSNAAEWAMAEMINQPEILQKATEEIEGVV  376

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             G +R VQESD+P LNY+K+C KE FR+HPI+PF  PH+S  D +V GYFIPKGS V++SR
Sbjct  377   GNQRWVQESDIPRLNYVKSCAKEAFRIHPISPFNLPHVSNVDAIVAGYFIPKGSHVLLSR  436

Query  1294  TGLGRNKRAWEDPLKFKPERHLNG---EDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSV  1464
              GLGRN + W++PL FKPERHL     E+V LT++EL+ +SFS GRRGC GV LGS M+V
Sbjct  437   LGLGRNPKVWDEPLGFKPERHLKDGCIEEVDLTETELRFISFSTGRRGCMGVALGSAMTV  496

Query  1465  MLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLP  1599
             M++ARLIQGF+WRVP++   IDL+ S++DLF+  PL A+AKPRLP
Sbjct  497   MVLARLIQGFSWRVPSNEANIDLSVSENDLFMAKPLHAMAKPRLP  541



>gb|AHY21753.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/510 (54%), Positives = 372/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPATIWIHKMMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L S++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVSNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHLN G+DVVLT+ EL+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLNAGDDVVLTEPELRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>gb|AJD25192.1| cytochrome P450 CYP79D40 [Salvia miltiorrhiza]
Length=522

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/482 (57%), Positives = 358/482 (74%), Gaps = 12/482 (2%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VGS+PE+L  KPAFRW+H +M ++ TEI C+RLGG +VI V SPEL+REFLKK D+ F+
Sbjct  49    VVGSLPEMLSKKPAFRWMHNLMQKLNTEILCVRLGGVHVIAVASPELSREFLKKHDAAFA  108

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  +SA LIS+GY + +  P GE+W K RR++ S VL+        + R EEADHL+R
Sbjct  109   SRPDAVSARLISDGYSALILSPAGEQWKKMRRVMVSEVLAAGVFRRFHSTRREEADHLVR  168

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++Y        S     V+VR A RHYC N+ +KM+F +R+FG+G  DGGPG  + E + 
Sbjct  169   YVY--------SRRNGAVNVRDAARHYCANLIRKMVFGERFFGAGMDDGGPGNEEREHVD  220

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
              +FT+L YLYG  +AD++PWL +FDLDGHK I++ A+   RK+ D  ++ER++MW+ G K
Sbjct  221   GLFTMLSYLYGFAIADFVPWLEVFDLDGHKRIVSNAIKKVRKYQDPLINERMEMWQLGLK  280

Query  901   TVEEDIVDVLVKLKD--NDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPK  1074
             T ++DI+D+L+ LK   ++ +P+LS +EIK Q+LEIMIA +DNPSNA EWALAEMINQP 
Sbjct  281   TQQDDILDLLINLKSESDETKPLLSLREIKVQILEIMIATVDNPSNAAEWALAEMINQPD  340

Query  1075  LLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGG  1254
             +  KA EE+D VVG+ RLV+ESDLPNLNY+KACVKE FRLHP+APF P H+S+KD VVGG
Sbjct  341   IFAKACEELDRVVGKNRLVEESDLPNLNYVKACVKEAFRLHPLAPFNPTHVSSKDLVVGG  400

Query  1255  YFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAGRRG  1428
             Y IPKGS V++SR GLGRN R W++PL+FKP RH+  E  +VVL D EL+M+SFS GRRG
Sbjct  401   YLIPKGSHVLLSRPGLGRNPRVWDEPLRFKPGRHIVDESSEVVLVDHELRMLSFSTGRRG  460

Query  1429  CPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNL  1608
             CPG+ LGS +S ML+ARLIQGF+WR P  +  IDL ES HDL L  PL A A PRL S +
Sbjct  461   CPGIVLGSTISTMLLARLIQGFSWRPPLGMDNIDLVESGHDLTLAKPLIAHATPRLDSQI  520

Query  1609  YM  1614
             Y+
Sbjct  521   YL  522



>gb|AHY21762.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/510 (53%), Positives = 373/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPATIWIHKMMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRG  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E++I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKEIKAQITELVIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHLN G+DVVLT+ EL+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLNAGDDVVLTEPELRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>ref|XP_006435923.1| hypothetical protein CICLE_v10031311mg [Citrus clementina]
 gb|ESR49163.1| hypothetical protein CICLE_v10031311mg [Citrus clementina]
Length=501

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/495 (55%), Positives = 367/495 (74%), Gaps = 12/495 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG++PE+ RNKP F+WIH VM E+ T I+CIR G  +VIPVTSPE+A E 
Sbjct  6     LPPGPAAWPIVGNLPEMWRNKPTFKWIHSVMKELNTNISCIRFGNVHVIPVTSPEIALEV  65

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DSIF++RP  M     S G+LS   +P+G++W K R+++ SHVLS A  + L++KR
Sbjct  66    LKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWKKMRKMVASHVLSSARLNSLISKR  125

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+++RFIYNQC+ S ++A   VVDVR ATRHYCGNV +KM+FN+RYFG G  DGGP
Sbjct  126   REEADNIVRFIYNQCRKSASAA--TVVDVRLATRHYCGNVIRKMMFNRRYFGEGKEDGGP  183

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE ++++F +L++LY   ++DY+PW+ +FDL+GH+ +I+ A+    K+ D+ +DER
Sbjct  184   GFEEEEHVESLFVVLQHLYSFTLSDYVPWMRVFDLEGHEKLISAAMKTANKYHDSMIDER  243

Query  874   IQMWK---DGTKTV--EEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAV  1038
             +Q  +   D  K    ++D++DV +  KD +G P+LS  EIK+Q +++ +A +DNPSNA 
Sbjct  244   VQQRRHHPDNKKEAHNDQDLLDVFISAKDENGDPLLSVDEIKSQCMDLTLATVDNPSNAA  303

Query  1039  EWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTP  1218
             EWA+AEMINQP++L+KA EE+D VVG+ERLVQESD+  LNYIKAC++E  RLHP+APF  
Sbjct  304   EWAIAEMINQPEILQKATEEIDRVVGKERLVQESDVQQLNYIKACLREVLRLHPVAPFNL  363

Query  1219  PHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED-----VVLT  1383
             PH+ST+D  V GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D     V L 
Sbjct  364   PHVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSVDDHHHQVELA  423

Query  1384  DSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLE  1563
             ++EL+ +SFS GRR C G+ LGS MSV+L+ARL+QGF W  P+    IDL+ESK+DL + 
Sbjct  424   ETELRFLSFSRGRRSCMGMALGSEMSVVLLARLLQGFEWSAPSGEEKIDLSESKYDLLMA  483

Query  1564  NPLFALAKPRLPSNL  1608
              PL A AKPRL SNL
Sbjct  484   KPLRARAKPRLTSNL  498



>ref|XP_011021045.1| PREDICTED: isoleucine N-monooxygenase 2-like [Populus euphratica]
Length=541

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/478 (55%), Positives = 353/478 (74%), Gaps = 3/478 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG +P +LRNKP +RWIH +M EM TEIACIRLG  +VIPV  P++A EFLK QD+ F+
Sbjct  63    IVGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVHVIPVICPDIASEFLKAQDNTFA  122

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRPR M+  LIS GYL++   P G++W K +++L +HVLSP    WL +KRVEEADHL+ 
Sbjct  123   SRPRTMATDLISRGYLTTALSPSGDQWNKMKKVLMTHVLSPKQHQWLYSKRVEEADHLVH  182

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YNQCK  ++   G +V++R A +HYC NVT+KMLFNKR+FG G  DGGPG  +EE + 
Sbjct  183   YVYNQCK--KSLHQGGIVNLRTAAQHYCANVTRKMLFNKRFFGEGMKDGGPGFEEEEHVD  240

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+F+ L ++Y   ++D++P L   DLDGH+ ++ +   +  K+ D  + ER+Q WKDG K
Sbjct  241   ALFSCLNHIYAFCISDFLPSLIGLDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAK  300

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D+L+ LKD +G P+LS  EIK Q+ EI++AA+DNPSNA EWA AEM+NQP++L
Sbjct  301   KDTEDLLDILITLKDPNGNPLLSKDEIKAQITEILVAAVDNPSNACEWAFAEMLNQPEIL  360

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             EKA EE+D VVG+ERLVQESD  +LNY+KAC +E FRLHP+APF  PH+S  DT V  Y 
Sbjct  361   EKATEELDRVVGKERLVQESDFAHLNYVKACAREAFRLHPVAPFNVPHVSAADTTVANYL  420

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNG-EDVVLTDSELKMMSFSAGRRGCPG  1437
             IPKGS V++SR GLGRN + W++PLKFKPERHL+  E VVLT++ L+ +SFS G+RGC G
Sbjct  421   IPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHLDEMEKVVLTENNLRFISFSTGKRGCIG  480

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             V LG+ M+ ML ARL+Q FTW +P     IDLT ++  + L  PL ALAKPRLP  +Y
Sbjct  481   VTLGTSMTTMLFARLLQAFTWSLPPSQSSIDLTIAEDSMALAKPLSALAKPRLPPQVY  538



>ref|XP_008450479.1| PREDICTED: tyrosine N-monooxygenase-like [Cucumis melo]
Length=516

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/502 (53%), Positives = 373/502 (74%), Gaps = 8/502 (2%)
 Frame = +1

Query  112   KTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGT  291
             K +  Y   S++ ++PPGP PWP+VG +P + R KP +RW+H +M+E+ TEIACIR+G  
Sbjct  11    KRRNKYCVGSTAAALPPGPIPWPIVGCLPTLWRKKPRYRWVHKIMEELNTEIACIRIGKI  70

Query  292   YVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSH  471
             +VIPVTSPELA EFLK  DS+F+SRP  ++  + S+G+L++   P+G +W K RRILTS 
Sbjct  71    HVIPVTSPELAMEFLKTHDSVFASRPITVTTDMFSDGFLTAGVAPWGNQWKKMRRILTSE  130

Query  472   VLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLF  651
             +LSPA   W+++KR EEAD+LLR++++  K +  S     V VR  T+HY GNV ++M+F
Sbjct  131   ILSPARHRWMLSKRTEEADNLLRYVFSLTKTTPTS-----VSVRSITQHYSGNVMRRMMF  185

Query  652   NKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKAL  831
             N+RYFG G ADGGP   +EE + A+FT+L+++Y   V+DY+  L  FDLDGH+ I+ KAL
Sbjct  186   NRRYFGKGRADGGPATEEEEHIGALFTMLQHVYAFCVSDYMSCLKAFDLDGHERIVKKAL  245

Query  832   AVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIA  1011
              V RK+ +  +DER+Q W+DG +   ED++D+ + LKD  G P+LS KEIK Q+ E+++A
Sbjct  246   NVIRKYEEPIIDERVQQWRDGKRIEAEDMLDIFISLKDESGEPLLSVKEIKAQITELLLA  305

Query  1012  ALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFR  1191
              +DNPSNAVEWA+AEM+NQP+ L++A EE+D VVG+ERLVQESD+PNL ++ AC +E  R
Sbjct  306   TVDNPSNAVEWAMAEMLNQPQHLQQATEELDRVVGKERLVQESDIPNLKFLTACAREALR  365

Query  1192  LHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN--G  1365
             LHPIAPF  PH++T D VV GY IP GS V++SR GLGRN R W DP++F P RHL   G
Sbjct  366   LHPIAPFNLPHIATTDVVVAGYLIPAGSHVLLSRLGLGRNHRIWPDPMRFDPNRHLQDPG  425

Query  1366  EDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESK  1545
              D+ L + +L+ ++F+ GRRGC G  LG+ +++ML+ARL+QGFTW++P  +  I+L+ES 
Sbjct  426   ADLGLAEPDLRFITFTRGRRGCMGGTLGTAITMMLLARLVQGFTWQLPPGVAAIELSESD  485

Query  1546  HDLFLENPLFALAKPRLPSNLY  1611
               LFL++PLFALA+PRLP +LY
Sbjct  486   Q-LFLKDPLFALAQPRLPESLY  506



>ref|XP_009601899.1| PREDICTED: LOW QUALITY PROTEIN: isoleucine N-monooxygenase 2-like 
[Nicotiana tomentosiformis]
Length=528

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/482 (57%), Positives = 363/482 (75%), Gaps = 20/482 (4%)
 Frame = +1

Query  181   LVGSIPEILRN-KPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIF  357
             ++GS+P++L N KP F WIH +M+EM  EIACIRLG   VIPVTSPELA EFLK QDS+F
Sbjct  61    IIGSLPQMLLNSKPTFHWIHKLMEEMDIEIACIRLGNVLVIPVTSPELACEFLKNQDSVF  120

Query  358   SSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLL  537
             SSRP CMSA L+ NGYL+S+FLP  ++WTK RRI+ S VLSP +  WL +KR E+ADHLL
Sbjct  121   SSRPICMSANLVINGYLTSVFLPICDQWTKMRRIVASLVLSPTSLQWLSHKRNEDADHLL  180

Query  538   RFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELL  717
             R++YN+C          V+++R+ TR+YCGNV   M+F+KR FG  A         EE +
Sbjct  181   RYVYNEC------XQPTVINLRKVTRYYCGNVIWNMIFSKRLFGKEA---------EEQV  225

Query  718   KAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGT  897
              A+FT+L YL+  G++D++P LS+FDLDGHK II KA A   +H+D+++D RIQ+WKD  
Sbjct  226   GALFTLLEYLHSFGISDFLPLLSVFDLDGHKEIIKKAFATATRHIDSEIDRRIQIWKDDN  285

Query  898   KTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKL  1077
             KTVEEDI+DVL+KLK  +G P+++ KEIKTQ LE+ +A + NPSNAVEW LA+M+NQP+L
Sbjct  286   KTVEEDILDVLIKLKHANGNPLMNAKEIKTQALELRLATVGNPSNAVEWTLAQMLNQPQL  345

Query  1078  LEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVG-G  1254
             +++ +EE++ VVG +R VQESDL  LN++KAC+KE FRL+ I+PF  PH+S  DT++   
Sbjct  346   MQRVIEELNIVVGSKRFVQESDLARLNFVKACIKEAFRLYTISPFNLPHVSVSDTIISEK  405

Query  1255  YFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRG  1428
             YFIPKGS V++SR GLGRN R WE+P+KFKPERHL  N  +VVL DSEL+++SFS GRRG
Sbjct  406   YFIPKGSVVLLSRLGLGRNPRVWEEPMKFKPERHLKENNGEVVLNDSELRLLSFSIGRRG  465

Query  1429  CPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTE-SKHDLFLENPLFALAKPRLPSN  1605
             CPGVKLGS ++ ML+ARL+ GF+W +P + PC DL E SK DLF   PL A  KPR+   
Sbjct  466   CPGVKLGSTITTMLLARLLHGFSWSLPPNSPCNDLIESSKSDLFCTLPLLARPKPRVDET  525

Query  1606  LY  1611
             +Y
Sbjct  526   MY  527



>gb|KEH34365.1| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/519 (53%), Positives = 375/519 (72%), Gaps = 12/519 (2%)
 Frame = +1

Query  67    LFTVMLSVTIQWLIYKTKKWY--GssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHG  240
             L+   L  T  + I KT +++     S    +PPGPKPWP+VG++PE++ N PA  WI  
Sbjct  16    LWISFLIATCGFFIIKTLRYHLMSVKSKIAKLPPGPKPWPIVGNLPEMIANNPAPMWIFK  75

Query  241   VMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLF  420
             VM+++ TEIACIRLG  ++IPVT P +ARE L+K D+ F+SRP  M++G+IS+GYL+S  
Sbjct  76    VMEDLNTEIACIRLGNVHIIPVTCPTIAREILRKHDADFASRPTTMASGIISSGYLTSAI  135

Query  421   LPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDV  600
              P+GE+W K ++I+ + +LSP    WL +KR EEAD+L+ ++YN+C        G +V V
Sbjct  136   APFGEQWKKMKKIIVNDLLSPQRYRWLQDKRNEEADNLIFYVYNKCN------NGDLVSV  189

Query  601   RQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPW  780
             R A++HYCGNV +KM FN RYFG G  DGGPG  + E + A FT+L+Y+Y    +DY+P 
Sbjct  190   RLASQHYCGNVYRKMYFNTRYFGKGMKDGGPGLEEIEHVDAAFTLLKYIYAFSASDYMPC  249

Query  781   LSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRP  960
             L + DLDGHK  I  A+ +  K+ D+ ++ERI+ W DG+KTVEED++DVL+ LKD +  P
Sbjct  250   LRLLDLDGHKGKIKNAMKIMNKYHDSIIEERIKQWNDGSKTVEEDLLDVLISLKDVNNNP  309

Query  961   MLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQES  1140
             +L+ KEIK Q++E+MIA +DNPSN VEW LAEM+NQP+L ++A  E+D +VG++RLVQES
Sbjct  310   VLTKKEIKAQLIELMIATIDNPSNLVEWILAEMLNQPELFQQATNELDKIVGKDRLVQES  369

Query  1141  DLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRA  1320
             D+PNLN++KAC +E  RL+P+APF  PH+S  DTVVG YFIPKGS V+I R+  GRN   
Sbjct  370   DIPNLNFLKACAREALRLYPMAPFNIPHVSLNDTVVGNYFIPKGSHVLIKRS--GRNPLL  427

Query  1321  WEDPLKFKPERHL-NGE-DVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGF  1494
             W++P KFKPERH  NGE ++VLT+  LK +SFS G R CPGVKLG+ M+V+L+ARL+ GF
Sbjct  428   WDEPHKFKPERHFKNGESNIVLTEPGLKFISFSTGMRSCPGVKLGTTMTVLLLARLLHGF  487

Query  1495  TWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             TW +P     I L +SK D+FL  PL  +AKPRLP+ LY
Sbjct  488   TWSIPPTTSSISLEKSKDDMFLAEPLVVVAKPRLPTELY  526



>gb|AHY21754.1| cytochrome P450 79D15, partial [Trifolium montanum]
 gb|AHY21756.1| cytochrome P450 79D15, partial [Trifolium montanum]
 gb|AHY21759.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/510 (53%), Positives = 371/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPATIWIHKMMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L S++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVSNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>gb|AHY21746.1| cytochrome P450 79D15, partial [Trifolium occidentale]
Length=508

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/510 (53%), Positives = 372/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I+K  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFKVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRKEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A+FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>ref|XP_011005474.1| PREDICTED: cytochrome P450 79B1-like [Populus euphratica]
Length=527

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/527 (51%), Positives = 379/527 (72%), Gaps = 13/527 (2%)
 Frame = +1

Query  40    SSIIFLPLALFTVMLSVTIQWLI--YKTKKWYGssssslsIPPGPKPWPLVGSIPEILRN  213
             S  I L   +  ++L++T+   I  +K  K Y        +PPGP+ WP+VG +P +LRN
Sbjct  9     SFTILLSFPVLFLVLAITLFSFIQSHKNVKQYS-------LPPGPRSWPIVGCLPTMLRN  61

Query  214   KPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLI  393
             KP ++WIH +M EM TEIACIRLG  +VIPVT P +A EFLK+QD +FSSRP+ +S+ L 
Sbjct  62    KPVYQWIHNLMKEMNTEIACIRLGNIHVIPVTCPNIACEFLKEQDDVFSSRPKTISSYLA  121

Query  394   SNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEA  573
             SNGYL+++  P+G++W K + ++   VLSP    WL  KRVEE D+L+R +Y QC+ S+ 
Sbjct  122   SNGYLATVVSPFGDQWKKMKTVMAKQVLSPTRHQWLHKKRVEEGDNLVRLVYKQCQESDQ  181

Query  574   SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYG  753
                  +V++R  ++HYC NV +K++FNKRYFG G  +GGPG  +E+ + A+FTIL +L+ 
Sbjct  182   DG---IVNLRFISQHYCANVIRKLMFNKRYFGVGMENGGPGFEEEQHVDALFTILSHLFS  238

Query  754   LGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLV  933
               V+D++ +L+  DL+GH+ ++ +   + +K+ D  +D RIQ WKDG K   ED++DVL+
Sbjct  239   FCVSDFLSFLTWLDLNGHEKVMKEKDRIIKKYHDPIIDNRIQQWKDGKKKDIEDLLDVLI  298

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
              LKD++G P+LS  EIK QV +I++AA+DNPSNA EWA AEM+N PK+LE AVEE+D VV
Sbjct  299   TLKDDNGNPLLSKDEIKAQVEDIILAAVDNPSNACEWAFAEMLNNPKILETAVEELDRVV  358

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             G++RLVQESD   LNY+KAC +E FRLHP+APF  PH+S  DTVV  +FIPKGS VI+SR
Sbjct  359   GKQRLVQESDFAQLNYVKACAREAFRLHPVAPFNVPHVSMADTVVANHFIPKGSYVILSR  418

Query  1294  TGLGRNKRAWEDPLKFKPERHLNGE-DVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVML  1470
              GLGRN + W++PL+FKPERHL G  +VVL ++ L+ +SFS G+RGC  V LGS M+ ML
Sbjct  419   LGLGRNPKVWDEPLEFKPERHLTGTGNVVLAENGLRFISFSTGKRGCMAVTLGSSMTNML  478

Query  1471  MARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              ARL+ GF+W +P++   IDL+ +K  + L  PL A+AKPRLP++LY
Sbjct  479   FARLLHGFSWSLPSNESSIDLSTAKDSMALAKPLLAVAKPRLPAHLY  525



>gb|AHY21794.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
Length=505

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/510 (53%), Positives = 371/510 (73%), Gaps = 7/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I+   K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFIIFSVIKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C       +  +V++R A
Sbjct  119   GEQWKKMKRVLINNLLSPLKHQWLLGKRNEEADNLVFYIYNKC----CKDVNGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +KM+FNKRYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKMVFNKRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ +  + +RI+ W DG KTVEED++DVL+ LKD + +P L+
Sbjct  235   LDLDGHRSKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPSLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHVSMTDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  475   PPNVSSIDLVPSDDCLFLANPLLAVAKPRL  504



>ref|XP_003537358.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
Length=537

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/479 (56%), Positives = 356/479 (74%), Gaps = 3/479 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+L NKPA +WIH +M EM TEIACIRLG  YVIPVT P +A EFL+KQD+ F+
Sbjct  58    IVGNLPEMLANKPAHKWIHNLMKEMNTEIACIRLGNAYVIPVTCPTIASEFLRKQDATFA  117

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SR + +S  LISNGY +++F P+G +W K ++ILT+++LSP    WL  +R EEAD+L+ 
Sbjct  118   SRSQTVSTDLISNGYSTAVFGPFGAQWKKMKKILTNNLLSPHKHLWLHGQRTEEADNLMF  177

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
              +YN+CK +    +G +V++R   RHYCGN+T+K++FN RYFG G  DGGPG  + E + 
Sbjct  178   HVYNKCK-NVNDGVGGLVNIRSVARHYCGNLTRKIIFNTRYFGKGREDGGPGFEEVEHVD  236

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L Y+    V+DY+P L   DLDGH+  + +AL + +K+ D  V ERI++W DG K
Sbjct  237   SIFHLLEYVNAFSVSDYVPCLRGLDLDGHEKKVKEALKIIKKYHDPIVQERIKLWNDGLK  296

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
               EED +DVLV LKD++  P L+ +EI  Q++E+MIA +DNPSNA EWALAEMINQP+LL
Sbjct  297   VDEEDWLDVLVSLKDSNNNPSLTLEEINAQIIELMIATIDNPSNAFEWALAEMINQPELL  356

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
              +AVEE+D+VVG+ERLVQESD+P LNY+KAC +E FRLHPI+PF PPH+S  DT+V  YF
Sbjct  357   HRAVEELDSVVGKERLVQESDIPKLNYVKACAREAFRLHPISPFIPPHVSMSDTMVANYF  416

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCP  1434
             IPKGS V++SR  LGRN + W +  KFKPERHL  +G DV LT+  LK +SFS GRRGCP
Sbjct  417   IPKGSHVMLSRQELGRNPKVWNETYKFKPERHLKSDGSDVDLTEPNLKFISFSTGRRGCP  476

Query  1435  GVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             GV LG+ M+VML ARL+ GFTW  P ++  I+L ES  D+ L  PL A+AKPRL S LY
Sbjct  477   GVMLGTTMTVMLFARLLHGFTWTAPPNVSSINLAESNDDILLAEPLVAVAKPRLASELY  535



>gb|AHY21755.1| cytochrome P450 79D15, partial [Trifolium montanum]
 gb|AHY21760.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/510 (53%), Positives = 371/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPATIWIHKMMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>gb|AHY21778.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21779.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21780.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21781.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21784.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
Length=508

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/510 (53%), Positives = 372/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPAPIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A+FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYIYAFSISDYVPFLRG  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>gb|AHY21758.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/510 (53%), Positives = 371/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPATIWIHKMMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRG  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  V +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIVHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKEIKAQLTELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>gb|KHN24730.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=537

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/479 (56%), Positives = 356/479 (74%), Gaps = 3/479 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+L NKPA +WIH +M EM TEIACIRLG  YVIPVT P +A EFL+KQD+ F+
Sbjct  58    IVGNLPEMLANKPAHKWIHNLMKEMNTEIACIRLGNAYVIPVTCPTIASEFLRKQDATFA  117

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SR + +S  LISNGY +++F P+G +W K ++ILT+++LSP    WL  +R EEAD+L+ 
Sbjct  118   SRSQTVSTDLISNGYSTAVFGPFGAQWKKMKKILTNNLLSPHKHLWLHGQRTEEADNLMF  177

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
              +YN+CK +    +G +V++R   RHYCGN+T+K++FN RYFG G  DGGPG  + E + 
Sbjct  178   HVYNKCK-NVNDGVGGLVNIRSVARHYCGNLTRKIIFNTRYFGKGREDGGPGFEEVEHVD  236

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L Y+    V+DY+P L   DLDGH+  + +AL + +K+ D  V ERI++W DG K
Sbjct  237   SIFHLLEYVNAFSVSDYMPCLRGLDLDGHEKKVKEALKIIKKYHDPIVQERIKLWNDGLK  296

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
               EED +DVLV LKD++  P L+ +EI  Q++E+MIA +DNPSNA EWALAEMINQP+LL
Sbjct  297   VDEEDWLDVLVSLKDSNNNPSLTLEEINAQIIELMIATIDNPSNAFEWALAEMINQPELL  356

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
              +AVEE+D+VVG+ERLVQESD+P LNY+KAC +E FRLHPI+PF PPH+S  DT+V  YF
Sbjct  357   HRAVEELDSVVGKERLVQESDIPKLNYVKACAREAFRLHPISPFIPPHVSMSDTMVANYF  416

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCP  1434
             IPKGS V++SR  LGRN + W +  KFKPERHL  +G DV LT+  LK +SFS GRRGCP
Sbjct  417   IPKGSHVMLSRQELGRNPKVWNETYKFKPERHLKSDGSDVDLTEPNLKFISFSTGRRGCP  476

Query  1435  GVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             GV LG+ M+VML ARL+ GFTW  P ++  I+L ES  D+ L  PL A+AKPRL S LY
Sbjct  477   GVMLGTTMTVMLFARLLHGFTWTAPPNVSSINLAESNDDILLAEPLVAVAKPRLASELY  535



>ref|XP_008385013.1| PREDICTED: isoleucine N-monooxygenase 2-like, partial [Malus 
domestica]
Length=508

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/492 (56%), Positives = 360/492 (73%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP+VG++PE+L NKP FRWIH +MDEM TEIACIRLG T VIP+T P+L+
Sbjct  17    LPPTPKCLKPWPIVGNLPELLANKPTFRWIHKMMDEMNTEIACIRLGNTNVIPITCPQLS  76

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+IF+SRPR +S  L++ GY ++  +P+GE+W K R+++TS +L+P    WL 
Sbjct  77    REILKKQDAIFASRPRIISTFLVTKGYKTAALVPFGEQWKKMRKVITSELLTPMRHKWLT  136

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KRVEEADH+++++YNQC  +E    G +V++R AT+HYC NV KKM+ NKRYFG    D
Sbjct  137   DKRVEEADHIVKYVYNQCNNNEG---GGIVNLRXATQHYCANVIKKMVLNKRYFGEEMED  193

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGP   +++ L+ VFT L Y+Y    +DYIP L   DLDGH+ II  A+  T K+ D  +
Sbjct  194   GGPXLEEQKYLENVFTXLNYIYSFSXSDYIPCLRGLDLDGHEKIIKDAIRDTXKYQDPLI  253

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ER+ +  K G      D++D L+ LKD +G P+LS +EIK Q  E+ IAA+DNPSNA E
Sbjct  254   EERVXEHQKLGNNKEAXDLLDXLISLKDKNGEPLLSLEEIKAQFSELTIAAVDNPSNAAE  313

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP+L EKA +E+D VVG+ R VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  314   WAIAEMINQPELFEKATQELDAVVGKNRQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  373

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS VI+SR GLGRN + W++PLKFKPE HL  +G  VVLT+SEL
Sbjct  374   HVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPEXHLKDDGSGVVLTESEL  433

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GFTW VP     I+LTES +DL L  PL 
Sbjct  434   RFISFSTGMRGCVASTLGTAMTVMLFARLLHGFTWHVPPTESXIELTESTNDLSLAKPLL  493

Query  1576  ALAKPRLPSNLY  1611
             A AKPRLP+++Y
Sbjct  494   AYAKPRLPAHVY  505



>gb|KHG04035.1| Tyrosine N-monooxygenase [Gossypium arboreum]
Length=550

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/480 (56%), Positives = 360/480 (75%), Gaps = 8/480 (2%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+L NKP FRWIH +M  + T IACIR G  +VI +T PE++ +FLK QD++F+
Sbjct  70    IVGNLPEMLINKPTFRWIHELMKGITTGIACIRFGNVHVIVITCPEISCQFLKNQDAVFA  129

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  MS  + + GYL++  +P+G++W K +++L   +LS     WL +KRVEEAD+L+R
Sbjct  130   SRPVSMSTDVTTKGYLTTALVPFGDQWKKMKKVLMGELLSTTRHRWLHDKRVEEADNLVR  189

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YN C     ++ G +V+VR A++ YCGNV +KMLFN+RYFG G  DGGPG  +EE + 
Sbjct  190   YVYNLC-----TSAGGLVNVRVASQQYCGNVPRKMLFNRRYFGEGKEDGGPGFEEEEHIS  244

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             AVFTIL YLY   V+DY+P L   DLDGH+ ++  AL+V +K+ D  +DERIQ W++G K
Sbjct  245   AVFTILAYLYSFCVSDYLPRLRGLDLDGHEKVMAGALSVMQKYHDPIIDERIQQWRNGEK  304

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                +D++DV++ +KD    P+L+  EIK Q+ EIMIA +DNPSNAVEWALAEM+N+P+++
Sbjct  305   EDVDDLLDVMISMKDAHDDPILTPDEIKAQITEIMIATVDNPSNAVEWALAEMLNRPEIM  364

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             EKA EE+D+VVGRERLVQE+D  NLNY+KAC +E FRLHPIAPF  PH+S  DT V  YF
Sbjct  365   EKAAEEIDSVVGRERLVQETDFTNLNYVKACAREAFRLHPIAPFNVPHVSVADTTVANYF  424

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDV--VLTDSELKMMSFSAGRRGCP  1434
             IPKGS V++SRTGLGRN + W+DPLKFKPERHL G  V   LT+SEL+ +SFS G RGC 
Sbjct  425   IPKGSHVLLSRTGLGRNPKFWDDPLKFKPERHLKGGGVSLALTESELRFISFSTGMRGCK  484

Query  1435  GVKLGSLMSVMLMARLIQGFTWRV-PADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             GV LG+ M+VML ARL+Q FTW + P     IDL+E+K +LFL NPL A+AKPRLPS++Y
Sbjct  485   GVLLGTSMTVMLFARLLQCFTWTIPPTSQKPIDLSEAKDNLFLANPLVAVAKPRLPSHVY  544



>gb|ACB15184.1| cytochrome P450 [Trifolium repens]
Length=510

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 370/512 (72%), Gaps = 3/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K Y   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFTFMIFRVTKSY--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKCCKDVNDDDAGLVNIRTA  178

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  179   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  238

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  239   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  298

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  299   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  358

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  359   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  418

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  419   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  478

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  479   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  510



>gb|AHY21742.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21743.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21744.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21745.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21747.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21748.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21749.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21750.1| cytochrome P450 79D15, partial [Trifolium occidentale]
Length=508

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/510 (53%), Positives = 372/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKREEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A+FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>gb|AHY21797.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
Length=505

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/516 (53%), Positives = 374/516 (72%), Gaps = 15/516 (3%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             FL + +F+ ++   I+   +K+KK+         +PPGPKPWP+VG++PE+L NKPA  W
Sbjct  3     FLLVVIFSFIIFSVIK--SHKSKKY--------RLPPGPKPWPIVGNLPEMLANKPASIW  52

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             IH +M EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +
Sbjct  53    IHKLMKEMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTT  112

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
             ++  PYGE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C       +  +
Sbjct  113   TVLTPYGEQWKKMKRVLINNLLSPLKHQWLLGKRNEEADNLVFYIYNKC----CKDVNGL  168

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADY  771
             V++R A +HY GNV +KM+FNKRYFG G  DGGPG  + E + A+FTIL+YLY   ++DY
Sbjct  169   VNIRTAAQHYGGNVFRKMVFNKRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDY  228

Query  772   IPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDND  951
             +P+L   DLDGH+S I KA+ + +K+ +  + +RI+ W DG KTVEED++DVL+ LKD +
Sbjct  229   VPFLRRLDLDGHRSKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEEDLLDVLISLKDAN  288

Query  952   GRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLV  1131
              +P L+ KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLV
Sbjct  289   NKPSLTLKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLV  348

Query  1132  QESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRN  1311
             QESD+  L +++AC +E  RLHP+  F  PH S  DT+VG Y  PKG+QV++SR  LGRN
Sbjct  349   QESDIHKLPFVRACAREALRLHPMEYFDVPHESMSDTMVGDYMFPKGTQVLLSRVALGRN  408

Query  1312  KRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQ  1488
              + W DPLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ 
Sbjct  409   PKFWTDPLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLH  468

Query  1489  GFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             GF+W  P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  469   GFSWSAPPNVSSIDLVPSDDCLFLANPLLAVAKPRL  504



>gb|AHY21757.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/510 (53%), Positives = 370/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEKLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRG  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  V +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIVHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E++I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG ERLVQESD+ 
Sbjct  298   LKEIKAQLTELVIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGNERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ EL+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPELRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>gb|AHY21808.1| cytochrome P450 79D15, partial [Trifolium repens]
Length=508

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/510 (53%), Positives = 371/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVMSHDCLFLAKPLLAVAKPRL  507



>gb|ACB15165.1| cytochrome P450 [Trifolium repens]
 gb|ACB15185.1| cytochrome P450 [Trifolium repens]
 gb|ACB15186.1| cytochrome P450 [Trifolium repens]
Length=509

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 372/512 (73%), Gaps = 4/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  478   PPNVSSIDLVMSHDCLFLAKPLLAVAKPRLAA  509



>gb|AHY21801.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
 gb|AHY21804.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
 gb|AHY21805.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=509

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/510 (53%), Positives = 369/510 (72%), Gaps = 3/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K Y   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSY--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKCCKDVNDDDAGLVNIRTA  178

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+YLY   ++DY+P+L  
Sbjct  179   AQHYGGNVFRKLVFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYLYAFSISDYVPFLRR  238

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ +  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  239   LDLDGHRSKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  298

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  299   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  358

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  359   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  418

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  419   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  478

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  479   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  508



>gb|ACB15159.1| cytochrome P450 [Trifolium repens]
 gb|ACB15161.1| cytochrome P450 [Trifolium repens]
 gb|ACB15164.1| cytochrome P450 [Trifolium repens]
 gb|ACB15178.1| cytochrome P450 [Trifolium repens]
 gb|ACB15181.1| cytochrome P450 [Trifolium repens]
Length=509

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 372/512 (73%), Gaps = 4/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  509



>gb|AHY21807.1| cytochrome P450 79D15, partial [Trifolium repens]
Length=508

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/510 (53%), Positives = 371/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>ref|XP_007017085.1| Cytochrome p450 79a2, putative [Theobroma cacao]
 gb|EOY34704.1| Cytochrome p450 79a2, putative [Theobroma cacao]
Length=557

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/482 (55%), Positives = 362/482 (75%), Gaps = 8/482 (2%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+++NKP FRW+H +M ++   IACIR G  +VIPVT PE++REFLKKQD++F+
Sbjct  77    VVGNLPEMVKNKPTFRWLHELMKQVDAGIACIRFGNVHVIPVTCPEISREFLKKQDAVFA  136

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  MS  + + G+L++  +P G++W K ++++ + +LSP    WL  KR EEAD+L+R
Sbjct  137   SRPISMSTDVTTKGFLTTALVPLGDQWKKMKKVMVTDLLSPTKHRWLHEKRAEEADNLVR  196

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YNQCK  +    G +V+VR A + YCGN+ +K+LFN+RYFG G  DGGPG  +EE + 
Sbjct  197   YVYNQCKTLDK---GRLVNVRVAAQQYCGNLPRKLLFNRRYFGEGKEDGGPGFEEEEHVG  253

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+FTIL YLY   ++DYIP L   DLDGH+ I+ +AL V  K+ D  ++ERIQ WK+G K
Sbjct  254   ALFTILSYLYSFCISDYIPCLRGLDLDGHEKIMDEALQVVGKYHDPIIEERIQQWKNGDK  313

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
               EED++D+L+ L+D  G+P+L+ +EIK Q+ E MIA +DNPSNAVEWALAEM+NQP++L
Sbjct  314   EDEEDLLDILITLRDEHGKPLLTMEEIKAQITEFMIATVDNPSNAVEWALAEMLNQPEIL  373

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             EKA +E++ VVGR RLVQESD   LNY+KAC +E FRLHPIAPF  PH+S  DT V  YF
Sbjct  374   EKATQEIEQVVGRGRLVQESDFAKLNYVKACAREAFRLHPIAPFNVPHVSVADTTVADYF  433

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL---NGEDVVLTDSELKMMSFSAGRRGC  1431
             IPKGS +++SRTGLGRN + W++PLK+KPERHL   +G  + LT+++L+ +SFS G RGC
Sbjct  434   IPKGSHLLLSRTGLGRNPKVWDEPLKYKPERHLKADHGTPLSLTETDLRFISFSTGMRGC  493

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADL--PCIDLTESKHDLFLENPLFALAKPRLPSN  1605
              GV LG+ M+VML ARL+Q FTW +P D     I+LTE+K +LFL  PL A+A PRLPSN
Sbjct  494   KGVLLGTSMTVMLFARLLQCFTWSIPPDQQGQAINLTEAKENLFLGKPLVAVASPRLPSN  553

Query  1606  LY  1611
             +Y
Sbjct  554   VY  555



>gb|AHY21802.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=509

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/510 (53%), Positives = 369/510 (72%), Gaps = 3/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKCCKDVNDDDAGLVNIRTA  178

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+YLY   ++DY+P+L  
Sbjct  179   AQHYGGNVFRKLVFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYLYAFSISDYVPFLRR  238

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ +  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  239   LDLDGHRSKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  298

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  299   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  358

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  359   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  418

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  419   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  478

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  479   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  508



>gb|AHY21806.1| cytochrome P450 79D15, partial [Trifolium repens]
Length=508

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/510 (53%), Positives = 371/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVMSHDCLFLAKPLLAVAKPRL  507



>gb|ACB15157.1| cytochrome P450 [Trifolium repens]
 gb|ACB15158.1| cytochrome P450 [Trifolium repens]
 gb|ACB15160.1| cytochrome P450 [Trifolium repens]
Length=509

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/512 (52%), Positives = 372/512 (73%), Gaps = 4/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  478   PPNVSSIDLVMSHDCLFLAKPLLAVAKPRLAA  509



>gb|ACB15168.1| cytochrome P450 [Trifolium repens]
Length=509

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 371/512 (72%), Gaps = 4/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVLV LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLVSLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
               EIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FMEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  509



>gb|ACB15182.1| cytochrome P450 [Trifolium repens]
Length=505

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 370/512 (72%), Gaps = 8/512 (2%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-----CKDAGLVNIRTA  173

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  174   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  233

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  234   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  293

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  294   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  353

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  354   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  413

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  414   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  473

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  474   PPNVSSIDLVMSHDCLFLAKPLLAVAKPRLAA  505



>gb|ACB15162.1| cytochrome P450 [Trifolium repens]
 gb|ACB15163.1| cytochrome P450 [Trifolium repens]
 gb|ACB15166.1| cytochrome P450 [Trifolium repens]
 gb|ACB15167.1| cytochrome P450 [Trifolium repens]
 gb|ACB15170.1| cytochrome P450 [Trifolium repens]
 gb|ACB15171.1| cytochrome P450 [Trifolium repens]
 gb|ACB15173.1| cytochrome P450 [Trifolium repens]
 gb|ACB15174.1| cytochrome P450 [Trifolium repens]
 gb|ACB15177.1| cytochrome P450 [Trifolium repens]
 gb|ACB15179.1| cytochrome P450 [Trifolium repens]
 gb|ACB15180.1| cytochrome P450 [Trifolium repens]
 gb|ACB15187.1| cytochrome P450 [Trifolium repens]
 gb|ACB15188.1| cytochrome P450 [Trifolium repens]
Length=505

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 370/512 (72%), Gaps = 8/512 (2%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-----CKDAGLVNIRTA  173

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  174   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  233

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  234   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  293

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  294   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  353

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  354   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  413

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  414   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  473

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  474   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  505



>gb|KCW54304.1| hypothetical protein EUGRSUZ_I00267 [Eucalyptus grandis]
Length=529

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/524 (52%), Positives = 370/524 (71%), Gaps = 14/524 (3%)
 Frame = +1

Query  67    LFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVM  246
             LF V++   I    +K    + +  S L +PPGP PWP++G +PE+L  KP FRWIH +M
Sbjct  10    LFIVLIFFLIHMTKFKFSTIHKNGRSVLQLPPGPAPWPIIGCVPEMLSQKPTFRWIHRLM  69

Query  247   DEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLP  426
              EM T+IACIRLG  +VIPVT P +AREFLKK D+ FSSRP  M+      G+L+++  P
Sbjct  70    KEMDTDIACIRLGNVHVIPVTCPNIAREFLKKHDATFSSRPTSMATRTCGGGFLTTILSP  129

Query  427   YGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQ  606
             YG++W K RR+L S ++SPA  HWL +KR EEAD+L+++IYNQ K S       +V+VR 
Sbjct  130   YGDQWMKMRRVLVSEIISPARHHWLKDKRTEEADNLVKYIYNQSKSS-----SRIVNVRT  184

Query  607   ATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLS  786
             ATR Y GNV +K++F+KRYFG   ADGGP   +EE ++A+FTIL+Y+Y   ++DY PWL+
Sbjct  185   ATRQYTGNVIRKLMFSKRYFGEERADGGPTIAEEEHIEAIFTILKYVYAFCISDYFPWLA  244

Query  787   IFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEE-------DIVDVLVKLKD  945
               DLDGH+ ++ +A+     + D  +D RI   +    + EE       D++DVLV LKD
Sbjct  245   RLDLDGHEKLVKEAIRTVNNYHDPIIDARIGKRRRFGNSNEESASDDPHDLLDVLVTLKD  304

Query  946   NDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRER  1125
             ++G+P+L+ +EIK QV EIM A +DNPSN VEWA+AEMINQP++L+ A EE+D VVG+ER
Sbjct  305   SEGKPLLTPEEIKAQVTEIMFATVDNPSNEVEWAMAEMINQPEILKTATEELDRVVGKER  364

Query  1126  LVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLG  1305
             LV+E D+P+LNYIKAC++E FRLHPI PF PPH++  D +V GYFIPKGS V++SR GLG
Sbjct  365   LVEECDIPHLNYIKACIREAFRLHPIVPFNPPHMAMSDAIVAGYFIPKGSHVLLSRLGLG  424

Query  1306  RNKRAWEDPLKFKPERHLNG--EDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMAR  1479
             RN + W  PL+F+PERH      +V LT+ +L+ +SFS GRRGC   KLG+ M+VML+AR
Sbjct  425   RNPKVWNKPLEFRPERHFTSGFTEVHLTEPDLRFISFSTGRRGCVAPKLGTTMTVMLLAR  484

Query  1480  LIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             ++QGF W+ P ++  I L ES  ++ L +PL A A+ RLP +LY
Sbjct  485   MVQGFDWKAPPNVTSIILDESPENVSLAHPLVAYAELRLPLHLY  528



>ref|XP_010253086.1| PREDICTED: phenylalanine N-monooxygenase [Nelumbo nucifera]
Length=588

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/502 (55%), Positives = 362/502 (72%), Gaps = 25/502 (5%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+  NKP+FRWI G+M E+   IACIRLG  ++IPV  PE+AREFLKKQD++F+
Sbjct  81    IVGNLPELFINKPSFRWILGLMKELNANIACIRLGNVHIIPVNCPEIAREFLKKQDALFA  140

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M     S G+LS    P+G++W K RR++ S V++PA   WL++KRVEEAD+L+R
Sbjct  141   SRPITMGTQYSSRGFLSIAVAPWGDQWKKMRRVVASEVITPARLRWLLDKRVEEADNLIR  200

Query  541   FIYNQCKISE--------ASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPG  696
             +I+NQC  S         A A G VVDVR A R Y GNV +KM+FNKRYFG G+ DGGPG
Sbjct  201   YIFNQCNSSNSKLNGTMAARAAGGVVDVRVAVRQYSGNVIRKMMFNKRYFGQGSPDGGPG  260

Query  697   AVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERI  876
             A + E + A+FT+L  LY   V+DY+P L   DL+GH+ I+ KA+ +  K+ D  +D+RI
Sbjct  261   AEEIEHVDALFTVLSLLYAFCVSDYMPCLRWLDLNGHEKIMKKAIRIVNKYHDPIIDDRI  320

Query  877   QMWK--------DGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSN  1032
             + W+          TK   +D++DVL+  KD DG+P+LS +EIK Q  +++ AA+DNPSN
Sbjct  321   KKWRGCGKDVFSSATKKEPQDLLDVLISAKDTDGKPLLSSEEIKAQTADLIYAAVDNPSN  380

Query  1033  AVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPF  1212
             AVEWALAEMINQP++L KAVEE+D+VVG  RLVQESD P LNY+KAC +E FRLHPIAPF
Sbjct  381   AVEWALAEMINQPEILRKAVEEIDSVVGNLRLVQESDFPRLNYVKACAREAFRLHPIAPF  440

Query  1213  TPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL---NGE-----  1368
               PH+S  D+ V GYFIPKGS V++SR GLGRN + W++PL+FKPERHL   NG      
Sbjct  441   NLPHVSNADSTVAGYFIPKGSHVLLSRIGLGRNPKVWDEPLRFKPERHLQLDNGRAEATA  500

Query  1369  -DVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESK  1545
              +V L + +L+ +SFS GRRGC G  LGS M+VML+ARL+QGF+W+VP  L  IDL+ES 
Sbjct  501   AEVELVEPDLRFISFSTGRRGCMGAALGSAMTVMLLARLLQGFSWQVPPGLSQIDLSEST  560

Query  1546  HDLFLENPLFALAKPRLPSNLY  1611
             +DLFL  PL A AKPRLP +LY
Sbjct  561   NDLFLAKPLRAFAKPRLPMHLY  582



>gb|AHY21785.1| cytochrome P450 79D15, partial [Trifolium suffocatum]
Length=504

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/510 (53%), Positives = 369/510 (72%), Gaps = 8/510 (2%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPAIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-----CKDAGLVNIRTA  173

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  174   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  233

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  234   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  293

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  294   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  353

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  354   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  413

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  414   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  473

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  474   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  503



>gb|ACB15183.1| cytochrome P450 [Trifolium repens]
Length=510

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/512 (52%), Positives = 370/512 (72%), Gaps = 3/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKCCKDVNDDDAGLVNIRTA  178

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  179   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  238

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH++ I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  239   LDLDGHRNKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  298

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  299   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  358

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  359   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  418

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  419   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  478

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  479   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  510



>ref|XP_003556848.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
Length=523

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/479 (56%), Positives = 356/479 (74%), Gaps = 3/479 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             ++G++PE+L ++P FRWI  +M EM TEIACIRLG  +VIPVT P +AREFL+KQD+ F+
Sbjct  44    IIGNLPEMLTHRPTFRWIQNLMKEMNTEIACIRLGNVHVIPVTCPTIAREFLRKQDATFA  103

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  ++  LIS GYLS+  +P+GE+W K RRI+++ +LS  T   L NKRVEEAD+L+ 
Sbjct  104   SRPNSITTSLISRGYLSTTLVPFGEQWKKMRRIVSNDLLSTTTHQRLENKRVEEADNLVF  163

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             +IYN+CK +  +    +V+VR   +HY  NV KK++F+ RYFG G  DGGPG  +EE + 
Sbjct  164   YIYNKCK-NNVNDNVCLVNVRYVAQHYSCNVIKKLIFSTRYFGEGKKDGGPGREEEEHVD  222

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++FT+L+Y+Y   V+DY+P+L   DLDGH+  + KAL +  K+ D  +++RI+   +G+K
Sbjct  223   SIFTMLKYIYDFSVSDYVPFLRGLDLDGHEGKVKKALEIVEKYHDPIIEQRIKERNNGSK  282

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED +D+L+ LKD +  PML+ +EIK Q+ E+M+AA+DNP+NA EW L EMINQPKLL
Sbjct  283   IDGEDFLDILISLKDANNNPMLTTQEIKAQITELMMAAMDNPTNAFEWGLGEMINQPKLL  342

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             ++AVEE+D VVG+ERLVQESD+P LNYIKAC +E FRLHPI PF  PH+S KDT+VG Y 
Sbjct  343   QRAVEELDTVVGKERLVQESDIPKLNYIKACAREAFRLHPIVPFNVPHVSLKDTIVGNYL  402

Query  1261  IPKGSQVIISRTGLGRNKRAWED-PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCP  1434
             IPKGS +++SR  LGRN + W D PLKFKPERHL N  DVVLTD +L ++SFS GRRGCP
Sbjct  403   IPKGSHILLSRQELGRNPKVWNDEPLKFKPERHLINKSDVVLTDQDLNLISFSTGRRGCP  462

Query  1435  GVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             G  LG+ M+VML ARL+  FTW  P ++  I+L ES HD+ L +P  ALAKPRLP  LY
Sbjct  463   GFMLGTTMTVMLFARLLHAFTWIAPPNVSHINLAESSHDISLAHPPLALAKPRLPPELY  521



>gb|ACB15154.1| cytochrome P450 [Trifolium repens]
 gb|ACB15169.1| cytochrome P450 [Trifolium repens]
Length=509

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/512 (52%), Positives = 371/512 (72%), Gaps = 4/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
               EIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FMEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  509



>gb|AHY21764.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21771.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/510 (53%), Positives = 370/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHELMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A+FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>gb|ACB15193.1| cytochrome P450 [Trifolium isthmocarpum]
Length=509

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/512 (52%), Positives = 371/512 (72%), Gaps = 4/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + V+PVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A+FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  509



>ref|XP_008231301.1| PREDICTED: isoleucine N-monooxygenase 2-like [Prunus mume]
Length=534

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/492 (55%), Positives = 359/492 (73%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP+VG++PE+L NKP FRWIH  M+E  T+IACIRL   +VIPV+ P L+
Sbjct  44    LPPTPKGLRPWPIVGNLPEMLMNKPTFRWIHKHMEESNTQIACIRLANVHVIPVSCPILS  103

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+ F++RP  +S  LI+ GY++++ +P+GE+W K R+++TS +LSP    WL 
Sbjct  104   REILKKQDATFATRPLSISTFLITKGYITTVMVPFGEQWKKMRKVITSELLSPMRHKWLT  163

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KR+EEADHL+R+++NQC   E S    +VD+R AT+HYC NV K+M+FN+RYF     D
Sbjct  164   DKRIEEADHLVRYVFNQCNNDEGSG---IVDLRLATQHYCANVIKRMIFNQRYFTEEMKD  220

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGP   ++  + AVF +LRY+Y    +DYI  L   DLDGH+ II   + +TRK  D  +
Sbjct  221   GGPSVEEQNYVNAVFDMLRYIYAFSASDYISCLRGLDLDGHEKIIKDCIKLTRKRQDPVI  280

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ERI +  K G   V  D++D+L+ LKD  G+P+LS  EIK QV E+++AA+DNPSNA E
Sbjct  281   EERIREHQKLGGNKVPVDLLDILISLKDASGQPLLSTDEIKGQVNEMIMAAVDNPSNAAE  340

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP L EKA +E+D VVG+ER VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  341   WAIAEMINQPHLFEKARQELDAVVGKERQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  400

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS V++SR GLGRN + W++PLK+KPERHL  +G  VVLT+SEL
Sbjct  401   HVSMADTTVGDYFIPKGSHVMLSRIGLGRNPKIWDEPLKYKPERHLKDDGSGVVLTESEL  460

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GFTW  P +   IDLTE+  +L L  PLF
Sbjct  461   RFISFSTGMRGCVASTLGTSMTVMLFARLLHGFTWEAPPNESRIDLTEADGELLLAKPLF  520

Query  1576  ALAKPRLPSNLY  1611
             ALAKPRLP+++Y
Sbjct  521   ALAKPRLPAHVY  532



>gb|AHY21782.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21783.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
Length=508

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/510 (53%), Positives = 371/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M+
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPAPIWIHKLME  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MS  + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSTDIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRG  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAMRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              K+IK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKDIKAQMTELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKGSQV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGSQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSDDCLFLAKPLLAVAKPRL  507



>gb|AHY21800.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=509

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 369/510 (72%), Gaps = 3/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K Y   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSY--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + V+PVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKCCKDVNDDDAGLVNIRTA  178

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+YLY   ++DY+P+L  
Sbjct  179   AQHYGGNVFRKLVFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYLYAFSISDYVPFLRR  238

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ +  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  239   LDLDGHRSKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  298

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              K+IK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  299   FKDIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  358

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  359   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  418

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  419   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  478

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  479   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  508



>gb|AHY21767.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21768.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21772.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 370/510 (73%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHELMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + V+PVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A+FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>gb|ACB15194.1| cytochrome P450 [Trifolium isthmocarpum]
Length=509

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/512 (52%), Positives = 370/512 (72%), Gaps = 4/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  509



>dbj|BAP15884.1| cytochrome P450 79D16 [Prunus mume]
Length=534

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/492 (55%), Positives = 359/492 (73%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP+VG++PE+L NKP FRWIH +M+E  T+IACIRL   +V PV+ P L+
Sbjct  44    LPPTPKGLRPWPIVGNLPEMLMNKPTFRWIHKLMEESNTQIACIRLANVHVTPVSCPILS  103

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+ F++RP  +S  LI+ GY++++ +P+GE+W K R+++TS +LSP    WL 
Sbjct  104   REILKKQDATFATRPLSISTFLITKGYITTVMVPFGEQWKKMRKVITSELLSPMRHKWLT  163

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KR+EEADHL+R+++NQC   E S    +VD+R AT+HYC NV K+M+FN+RYF     D
Sbjct  164   DKRIEEADHLVRYVFNQCNNDEGSG---IVDLRLATQHYCANVIKRMIFNQRYFTEEMKD  220

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGP   ++  + AVF +LRY+Y    +DYI  L   DLDGH+ II   + +TRK  D  +
Sbjct  221   GGPSVEEQNYVNAVFDMLRYIYAFSASDYISCLRGLDLDGHEKIIKDCIKLTRKRQDPVI  280

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ERI +  K G   V  D++D+L+ LKD  G+P+LS  EIK QV E+++AA+DNPSNA E
Sbjct  281   EERIREHQKLGGNKVPVDLLDILISLKDASGQPLLSTDEIKGQVNEMIMAAVDNPSNAAE  340

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP L EKA +E+D VVG+ER VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  341   WAIAEMINQPHLFEKARQELDAVVGKERQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  400

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS V++SR GLGRN + W++PLK+KPERHL  +G  VVLT+SEL
Sbjct  401   HVSMADTTVGDYFIPKGSHVMLSRIGLGRNPKIWDEPLKYKPERHLKDDGSGVVLTESEL  460

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GFTW  P +   IDLTE+  +L L  PLF
Sbjct  461   RFISFSTGMRGCVASTLGTSMTVMLFARLLHGFTWEAPPNESRIDLTEADGELLLAKPLF  520

Query  1576  ALAKPRLPSNLY  1611
             ALAKPRLP+++Y
Sbjct  521   ALAKPRLPAHVY  532



>gb|AHY21765.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21769.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21770.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/510 (53%), Positives = 369/510 (72%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHELMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>gb|AHY21763.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 369/510 (72%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + V+PVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>gb|AHY21799.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=504

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/510 (53%), Positives = 369/510 (72%), Gaps = 8/510 (2%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K Y   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSY--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-----CKDAGLVNIRTA  173

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+YLY   ++DY+P+L  
Sbjct  174   AQHYGGNVFRKLVFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYLYAFSISDYVPFLRR  233

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ +  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  234   LDLDGHRSKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  293

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              K+IK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  294   FKDIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  353

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  354   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  413

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  414   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  473

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  474   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  503



>gb|ACB15153.1| cytochrome P450 [Trifolium repens]
 gb|ACB15155.1| cytochrome P450 [Trifolium repens]
 gb|ACB15156.1| cytochrome P450 [Trifolium repens]
 gb|ACB15172.1| cytochrome P450 [Trifolium repens]
 gb|ACB15175.1| cytochrome P450 [Trifolium repens]
 gb|ACB15176.1| cytochrome P450 [Trifolium repens]
Length=505

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/512 (52%), Positives = 369/512 (72%), Gaps = 8/512 (2%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-----CKDAGLVNIRTA  173

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  174   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  233

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  234   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  293

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
               EIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  294   FMEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  353

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  354   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  413

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  414   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  473

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL  PL A+AKPRL +
Sbjct  474   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRLAA  505



>gb|AHY21803.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=509

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 369/510 (72%), Gaps = 3/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K Y   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSY--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + V+PVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKCCKDVNDDDAGLVNIRTA  178

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  179   AQHYGGNVFRKLVFNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  238

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ +  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  239   LDLDGHRSKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  298

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              K+IK Q+ E+ +  +DNP NA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  299   FKDIKAQITELAVEMVDNPPNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  358

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  359   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  418

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  419   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  478

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  479   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  508



>gb|AHY21751.1| cytochrome P450 79D15, partial [Trifolium uniflorum]
 gb|AHY21752.1| cytochrome P450 79D15, partial [Trifolium uniflorum]
Length=509

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 370/511 (72%), Gaps = 5/511 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FTIL+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTILKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLNG--EDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWR  1503
             PLKF P+RHL    +DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W 
Sbjct  418   PLKFNPDRHLKAGDDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWS  477

Query  1504  VPADLPCIDLTESKHDLFLENPLFALAKPRL  1596
              P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   APPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  508



>gb|AHY21773.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 368/510 (72%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYKLPPGPKPWPIVGNLPEMLANKPASIWIHELMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFNTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FT+L+YLY   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTMLKYLYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ +  K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIVEKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ +  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAVEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+++L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFDPDRHLKEGDDVVLTETDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAAAKPRL  507



>ref|XP_009354042.1| PREDICTED: isoleucine N-monooxygenase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/524 (50%), Positives = 383/524 (73%), Gaps = 13/524 (2%)
 Frame = +1

Query  55    LPLALFTVMLSVTI-QWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             +P+A+F   +++ +  ++  KT K      S   +PPGP+PWP+VG +P++ RN+PA++W
Sbjct  3     IPIAIFLASIAIFLFHFIRLKTSK-----RSKEILPPGPRPWPIVGCVPQMWRNRPAYKW  57

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             +H +++E  T+IAC++LG  +VI V SPE+AREFLKK D++F+SRP  M+  ++S+GY++
Sbjct  58    VHSILEEFNTDIACVKLGNVHVIAVKSPEIAREFLKKNDAVFASRPVTMATHILSSGYVT  117

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
             +  +P+G +W K RR+L + V + +  HWL+ KR EEAD+L++F+YNQC ++     G+ 
Sbjct  118   TGVVPWGCQWKKMRRVLIADVFNQSRVHWLLGKRKEEADNLVKFLYNQCSVN---PYGSG  174

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADY  771
             V+VR A   Y G V ++M+FN RYFG G  DGGPG  +EE + A+ TIL ++Y   V+DY
Sbjct  175   VNVRTAGLFYSGGVMRRMIFNSRYFGKGREDGGPGLEEEEHVSALLTILLHVYAFCVSDY  234

Query  772   IPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDND  951
             +PWL +FD+ GH+  +  AL +T+++ D  ++ER+  W+DG +T   D++DV + LKD +
Sbjct  235   LPWLRVFDIGGHEKKVRDALKITKQYQDPVINERLHQWRDGKRTEPADLLDVFISLKDAN  294

Query  952   GRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLV  1131
             G+P+LS +EIK Q+ E+ +A +DNP NA EWAL++M+NQP++L+KAVEE+D VVG+ RLV
Sbjct  295   GQPLLSSEEIKAQITELQLATVDNPFNAGEWALSQMLNQPEMLKKAVEELDRVVGKHRLV  354

Query  1132  QESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRN  1311
             QESD+P L YI+AC +E  RLHP+APF  PH+S  D VV GYFIPKGS V++SR GLGRN
Sbjct  355   QESDIPKLPYIRACSREALRLHPVAPFNLPHVSNADAVVAGYFIPKGSAVLLSRLGLGRN  414

Query  1312  KRAWEDPLKFKPERHLN---GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARL  1482
                WE+PL+F PERHLN   G+ V L + EL+ ++FS GRRGC G  LG+ ++VML+ARL
Sbjct  415   PEVWENPLRFNPERHLNGDAGQQVELEEHELRFITFSTGRRGCMGGSLGTTITVMLLARL  474

Query  1483  IQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLYM  1614
             +QGFTW +P ++  IDLTE+   LF  NPL+A AKPRLP+ LY+
Sbjct  475   LQGFTWSMPPNVDKIDLTEAL-SLFKANPLYAHAKPRLPATLYL  517



>gb|AHY21766.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21775.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21776.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21777.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/510 (53%), Positives = 368/510 (72%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHELMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA L S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADLASYGFNTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++FN RYFG G  DGGPG  + E + A FT+L+YLY   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLIFNTRYFGKGMEDGGPGFEEVEHVDATFTMLKYLYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ +  K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMEKYHDPIIHDRIKKWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ +  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAVEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>gb|AHY21790.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
Length=505

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 372/516 (72%), Gaps = 15/516 (3%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             FL + +F+ M+   I+   +K+KK+         +PPGPKPWP+VG++PE+L NKPA  W
Sbjct  3     FLLVVIFSFMIFSVIK--SHKSKKY--------RLPPGPKPWPIVGNLPEMLANKPASIW  52

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             IH +M EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +
Sbjct  53    IHKLMKEMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTT  112

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
             ++  PYGE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C       +  +
Sbjct  113   TVLTPYGEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC----CKDVNGL  168

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADY  771
             V++R A +HY GNV +K++ N RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY
Sbjct  169   VNIRTAAQHYGGNVFRKLILNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDY  228

Query  772   IPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDND  951
             +P+L   DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD +
Sbjct  229   VPFLRRLDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAN  288

Query  952   GRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLV  1131
              +P+L+ KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLV
Sbjct  289   NKPLLTLKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLV  348

Query  1132  QESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRN  1311
             QESD+  L +++AC +E  RLHP+  F  PH S  DT+VG Y  PKG+QV++SR  LGRN
Sbjct  349   QESDIHKLPFVRACAREALRLHPMEYFDVPHESMSDTMVGDYMFPKGTQVLLSRVALGRN  408

Query  1312  KRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQ  1488
              + W DPLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ 
Sbjct  409   PKFWTDPLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLH  468

Query  1489  GFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             GF+W  P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  469   GFSWSAPPNVSSIDLVPSDDCLFLANPLLAVAKPRL  504



>ref|XP_008385015.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=534

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/492 (56%), Positives = 365/492 (74%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP++G++P++L NKP FRWIH +MDEM TEIACIRLG T VIP+T P+L+
Sbjct  42    LPPTPKCLKPWPIIGNLPQLLANKPTFRWIHKMMDEMNTEIACIRLGNTNVIPITCPQLS  101

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+IF+SRP  +S  LI+ GY++++ +P+GE+W K R+++TS +LSP    WL 
Sbjct  102   REILKKQDAIFASRPXSISTFLITKGYITTVMVPFGEQWKKMRKVITSELLSPMRHKWLT  161

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KRVEEADH++ ++YNQCK +E    G +V++R AT+HYC NV KKM+ NKRYFG     
Sbjct  162   DKRVEEADHIVXYVYNQCKNNEG---GGIVNLRLATQHYCANVIKKMVLNKRYFGEEMEX  218

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGPG  +++ L+ VFT+L Y+Y    +DYIP L   DLDGH+ II  A+  T K+ D  +
Sbjct  219   GGPGLEEQKYLENVFTMLNYIYSFSASDYIPCLRGLDLDGHEKIIKDAIRDTGKYQDPLI  278

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ER+ +    G     +D++D+L+ LKD  G P+LS +EIK QV E+++AA+DNPSNA E
Sbjct  279   EERVREXMXLGNNKEAQDLLDILISLKDKXGEPLLSVEEIKAQVNELIMAAVDNPSNAAE  338

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP+L EKA +E+D VVG+ R VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  339   WAIAEMINQPELFEKATQELDAVVGKNRQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  398

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS VI+SR GLGRN + W++PLKFKPERHL  +G  VVLT+SEL
Sbjct  399   HVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESEL  458

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GF+W VP     I+LTES++DL L  PL 
Sbjct  459   RFISFSTGMRGCVASGLGTXMTVMLFARLLHGFSWHVPPTESSIELTESQNDLLLAKPLL  518

Query  1576  ALAKPRLPSNLY  1611
             A AKPRL +++Y
Sbjct  519   AYAKPRLAAHVY  530



>ref|XP_010030374.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
 gb|KCW54306.1| hypothetical protein EUGRSUZ_I00270 [Eucalyptus grandis]
Length=509

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/495 (53%), Positives = 356/495 (72%), Gaps = 14/495 (3%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWP++G +PE+L  KP FRWIH +M EM T+IACIRLG  +VIPVT PE+AREF
Sbjct  19    LPPGPAPWPIIGCMPEMLSKKPVFRWIHRLMKEMDTDIACIRLGNVHVIPVTCPEIAREF  78

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D  FSSRP  M+    S G+L+++  PYG++W K RR++ S ++SPA  HWL +KR
Sbjct  79    LKKHDVTFSSRPTSMATRTYSGGFLTTILSPYGDQWMKMRRVIVSEIISPARHHWLKDKR  138

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+++IYN+     +++    V+VR A R Y  NV +K++F+KRYFG   ADGGP
Sbjct  139   TEEADNLVKYIYNR-----STSSSRTVNVRTAARQYTANVIRKLMFSKRYFGEERADGGP  193

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
                +EE ++A+FTIL+YLY   ++DY PWL   DLDGH+  + +A++    + D  +D R
Sbjct  194   TIAEEEHVEAIFTILKYLYAFCISDYFPWLVGLDLDGHEKFVKEAVSTVNNYHDPIIDAR  253

Query  874   IQMWK-------DGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSN  1032
             I  W+       + T     D++DVL  LKD++G+P+L+ +EIK QV EIM A +DNPSN
Sbjct  254   IGKWRRFGNLNEESTSNDPHDLLDVLATLKDSEGKPLLTPEEIKAQVTEIMFATIDNPSN  313

Query  1033  AVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPF  1212
             AVEWA+AEMINQP++L+ A EE+D VVG+ERLVQE D+P+LNYIKAC++E FRLHPIAPF
Sbjct  314   AVEWAMAEMINQPEILKTATEELDRVVGKERLVQECDIPHLNYIKACIREAFRLHPIAPF  373

Query  1213  TPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTD  1386
              PPH++  D +V GYFIPKGS V++SR GLGRN + W  PL+F+PERH   +  +V LT+
Sbjct  374   IPPHMAMSDAIVAGYFIPKGSHVLLSRLGLGRNPKVWNKPLEFRPERHFTSDCTEVQLTE  433

Query  1387  SELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLEN  1566
              +L  +SFS GRRGC    LG+ M+VML+AR++QGF W    ++  I+L ES  DL L +
Sbjct  434   PDLHFISFSTGRRGCVAPMLGTAMTVMLLARMVQGFNWMALPNVTSINLDESFEDLSLAD  493

Query  1567  PLFALAKPRLPSNLY  1611
             PL A A+PRLP +LY
Sbjct  494   PLIAHAEPRLPLHLY  508



>ref|XP_006492162.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=542

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/486 (55%), Positives = 359/486 (74%), Gaps = 12/486 (2%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+  NKP F+WIH  M E+ T I+CIRLG  +VIPVTSPE+A E LK  DSIF+
Sbjct  56    IVGNLPEMWSNKPTFKWIHDFMKELNTNISCIRLGNVHVIPVTSPEIALEVLKDNDSIFA  115

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M     S G+LS   +P+GE+W K ++++ SHVL+ +    L+ +R EEAD+L+R
Sbjct  116   SRPLTMGTEYSSRGFLSIAVVPWGEQWKKMKKVVASHVLNSSRLRSLLVRRTEEADNLVR  175

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             FIYNQCK+S    +G+ VDVR ATR YCGNV +KM+FN+RYFG G  +GGPG  +EE ++
Sbjct  176   FIYNQCKVS---PIGSDVDVRLATRQYCGNVMRKMMFNRRYFGEGRENGGPGFEEEEHVE  232

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMW-----  885
             ++F +L+ LY   ++DY+PW+ +FDL+GH+ II+ A+    K+ D  +DER+Q       
Sbjct  233   SLFVVLQRLYSFALSDYVPWMRVFDLEGHEKIISDAMRTASKYHDAIIDERVQQRRQGKN  292

Query  886   KDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMIN  1065
             KD     +ED++DVL+  KD +GRP LS  EIK+Q +++M+A +DNPSN VEWA+AEMIN
Sbjct  293   KDDAHDHDEDLLDVLISAKDENGRPSLSVDEIKSQCMDLMLATVDNPSNVVEWAIAEMIN  352

Query  1066  QPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTV  1245
             QP++L+KA EE+D VVG+ERLVQESD+P LNYIKAC++E FRLHP+APF  PH+S +DT 
Sbjct  353   QPEILKKATEEIDTVVGKERLVQESDIPQLNYIKACLREMFRLHPVAPFNLPHVSNRDTT  412

Query  1246  VGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMSFS  1413
             + GYFIPKGS V+ISR GLG+N   W+DPLKF PERH++  D    V +T+ EL+ ++FS
Sbjct  413   IAGYFIPKGSHVLISRVGLGQNPNVWKDPLKFIPERHISAADPHHQVEITEPELRFLTFS  472

Query  1414  AGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPR  1593
              GRR C G+ LGS MSVML+ARL+QGF W VP+    IDL ESK+DL +  PL+A AKPR
Sbjct  473   RGRRSCMGMALGSEMSVMLLARLLQGFDWSVPSHEEKIDLAESKYDLLMAKPLYAHAKPR  532

Query  1594  LPSNLY  1611
             LP  +Y
Sbjct  533   LPDEIY  538



>gb|AHY21788.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
Length=508

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 369/510 (72%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNDDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++ N RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLILNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD   +P+L+
Sbjct  238   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAKNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFDVPHESMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  478   PPNVSTIDLVPSDDCLFLANPLLAVAKPRL  507



>ref|XP_010030372.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=509

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/495 (53%), Positives = 358/495 (72%), Gaps = 14/495 (3%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWP++G +PE+L  KP FRWIH +M EM T+IACIRLG  +VIPVT P +AREF
Sbjct  19    LPPGPAPWPIIGCVPEMLSQKPTFRWIHRLMKEMDTDIACIRLGNVHVIPVTCPNIAREF  78

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D+ FSSRP  M+      G+L+++  PYG++W K RR+L S ++SPA  HWL +KR
Sbjct  79    LKKHDATFSSRPTSMATRTCGGGFLTTILSPYGDQWMKMRRVLVSEIISPARHHWLKDKR  138

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+++IYNQ K S       +V+VR ATR Y GNV +K++F+KRYFG   ADGGP
Sbjct  139   TEEADNLVKYIYNQSKSS-----SRIVNVRTATRQYTGNVIRKLMFSKRYFGEERADGGP  193

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
                +EE ++A+FTIL+Y+Y   ++DY PWL+  DLDGH+ ++ +A+     + D  +D R
Sbjct  194   TIAEEEHIEAIFTILKYVYAFCISDYFPWLARLDLDGHEKLVKEAIRTVNNYHDPIIDAR  253

Query  874   IQMWKDGTKTVEE-------DIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSN  1032
             I   +    + EE       D++DVLV LKD++G+P+L+ +EIK QV EIM A +DNPSN
Sbjct  254   IGKRRRFGNSNEESASDDPHDLLDVLVTLKDSEGKPLLTPEEIKAQVTEIMFATVDNPSN  313

Query  1033  AVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPF  1212
              VEWA+AEMINQP++L+ A EE+D VVG+ERLV+E D+P+LNYIKAC++E FRLHPI PF
Sbjct  314   EVEWAMAEMINQPEILKTATEELDRVVGKERLVEECDIPHLNYIKACIREAFRLHPIVPF  373

Query  1213  TPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNG--EDVVLTD  1386
              PPH++  D +V GYFIPKGS V++SR GLGRN + W  PL+F+PERH      +V LT+
Sbjct  374   NPPHMAMSDAIVAGYFIPKGSHVLLSRLGLGRNPKVWNKPLEFRPERHFTSGFTEVHLTE  433

Query  1387  SELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLEN  1566
              +L+ +SFS GRRGC   KLG+ M+VML+AR++QGF W+ P ++  I L ES  ++ L +
Sbjct  434   PDLRFISFSTGRRGCVAPKLGTTMTVMLLARMVQGFDWKAPPNVTSIILDESPENVSLAH  493

Query  1567  PLFALAKPRLPSNLY  1611
             PL A A+ RLP +LY
Sbjct  494   PLVAYAELRLPLHLY  508



>ref|XP_010027351.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
 gb|KCW62237.1| hypothetical protein EUGRSUZ_H04897 [Eucalyptus grandis]
Length=531

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/485 (55%), Positives = 357/485 (74%), Gaps = 12/485 (2%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG  P +LRNKP FRWIH +M EM T+IACIRLG T+VIPVT P +AREFL+KQDS+F+
Sbjct  51    VVGCAPGMLRNKPVFRWIHRLMKEMNTDIACIRLGSTHVIPVTCPTIAREFLRKQDSLFA  110

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M++G +S+ YL++   PYGE+W K RR+L S V+ PA   WL +KR EEAD+L++
Sbjct  111   SRPVTMASGTLSSSYLTTALSPYGEQWQKMRRVLVSEVVCPARHKWLHDKRAEEADNLMK  170

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             +++N CK S     G  V++R  TRHY GNVT++++FNKRYFG G  DGGP   +E+ + 
Sbjct  171   YVFNLCKTS-----GHQVNLRSTTRHYTGNVTRRLMFNKRYFGKGRQDGGPTIDEEQHVD  225

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDG--  894
             A+F  L YLY   V+DY P+    DLDGH+  + ++    R+  +  + ERI+ W+D   
Sbjct  226   AIFHALHYLYAFCVSDYFPFSVGLDLDGHEKEVKESERTLRRLHEPIISERIKRWRDDLS  285

Query  895   ---TKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMIN  1065
                 +   +D++DVL+ LKD  G P+L+ +E++ Q +EIMI A+DNPSNAVEWA+AEMIN
Sbjct  286   SECNEKEPQDLLDVLIMLKDPQGMPLLTPEEVRAQTMEIMIEAVDNPSNAVEWAMAEMIN  345

Query  1066  QPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTV  1245
             QP+LL KA EE+D VVG+ERLVQESD+P LNYIKAC +E FRLHPIAPF  PH++  DTV
Sbjct  346   QPELLNKATEELDRVVGKERLVQESDIPRLNYIKACAREAFRLHPIAPFNVPHVAMSDTV  405

Query  1246  VGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAG  1419
             V GY IPKGS +++SR GLGRN + WE+PLKFKP+RH+  +  +VVLT+  L+ +SFS G
Sbjct  406   VAGYRIPKGSHILLSRVGLGRNPKVWEEPLKFKPDRHITSDQAEVVLTEPNLRFISFSTG  465

Query  1420  RRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLP  1599
             RRGC G  LG+ M+VML+ARLIQGF+W  P++L  I L ES++DLFL  PL A A+ RLP
Sbjct  466   RRGCMGATLGTTMTVMLLARLIQGFSWSKPSNLSSISLAESRNDLFLAEPLVAQAELRLP  525

Query  1600  SNLYM  1614
             S+LY+
Sbjct  526   SHLYL  530



>ref|XP_010030373.1| PREDICTED: valine N-monooxygenase 1-like [Eucalyptus grandis]
Length=533

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/528 (51%), Positives = 370/528 (70%), Gaps = 15/528 (3%)
 Frame = +1

Query  55    LPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWI  234
             +PL LFTV++   I       +  + +  S+  +PPGP  WP++G +PE+LR KP FRWI
Sbjct  11    IPL-LFTVLILFLIHMTKVMFRSIHKNGRSAPQLPPGPALWPIIGCVPEMLRQKPTFRWI  69

Query  235   HGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSS  414
             H +M EM T+IACIRLG  ++IPVT PE+AREFLKK D+ FSS P  ++    S G+L++
Sbjct  70    HRLMKEMDTDIACIRLGNVHIIPVTCPEIAREFLKKHDATFSSSPTSLATQTCSGGFLTT  129

Query  415   LFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVV  594
             +  PYG++W K RR++ S ++SPA  HWL +KR EEAD+L+++IYN+ K S  +     V
Sbjct  130   ILSPYGDQWMKMRRVIVSEIISPARHHWLKDKRTEEADNLVKYIYNRSKSSSRT-----V  184

Query  595   DVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYI  774
             +VR ATR Y GNV +K++F+KRYFG   AD  P   +EE + A+FTIL+YLY   ++DY 
Sbjct  185   NVRTATRQYTGNVIRKLMFSKRYFGEERADSEPTIAEEEHVGAIFTILKYLYAFCISDYF  244

Query  775   PWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWK-------DGTKTVEEDIVDVLV  933
             PWL   DLDGH+  + +A++    + D  +D RI  W+         T     D++DVLV
Sbjct  245   PWLLGLDLDGHEKFVKEAVSTVNNYHDPIIDARIGKWRRFGNLNEKSTSNDPHDLLDVLV  304

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
              LKD++G+P+L+ +EIK QV E+M A +DNPSNAVEWA+AEMINQP++L+ A EE+D VV
Sbjct  305   TLKDSEGKPLLTPEEIKAQVTEMMFATVDNPSNAVEWAMAEMINQPEILKIATEELDRVV  364

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             G+ERLVQE D+P LNYIKAC++E FRLHPIAPF PPH++  D +V GYFIPKGS V++SR
Sbjct  365   GKERLVQECDIPRLNYIKACIREAFRLHPIAPFNPPHMAMSDAIVAGYFIPKGSHVLLSR  424

Query  1294  TGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVM  1467
              GLGRN + W  PL+F+PERH   +  +V LT+  L+ +SFS GRRGC    LG+ M+V+
Sbjct  425   FGLGRNPKVWNKPLEFRPERHFTSDCIEVPLTEPNLRFISFSTGRRGCVAPMLGTAMTVI  484

Query  1468  LMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             L+AR++QGF W  P ++  I+L ES  DL L +PL A A+PRLP +LY
Sbjct  485   LLARMVQGFNWMAPPNVTSINLDESFEDLSLADPLVAHAEPRLPLHLY  532



>gb|ACB15191.1| cytochrome P450 [Trifolium nigrescens subsp. petrisavii]
Length=506

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/512 (52%), Positives = 369/512 (72%), Gaps = 7/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I+   K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFSVIKSH-KYSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  59

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  60    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  119

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  120   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-----CNDAGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++ N RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLILNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD + +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDANNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL NPL A+AKPRL +
Sbjct  475   PPNVSSIDLVPSDDCLFLANPLLAVAKPRLAA  506



>gb|AHY21774.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 369/510 (72%), Gaps = 4/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHELMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFNTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C   + +    +V++R A
Sbjct  119   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-CKDVNGDAGLVNIRTA  177

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++ N RYFG G  DGGPG  + E + A+FT+L+Y+Y   ++DY+P+L  
Sbjct  178   AQHYGGNVFRKLILNTRYFGKGMEDGGPGFEEVEHVDAIFTMLKYIYAFSISDYVPFLRR  237

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+S I KA+ + +K+ D  + +RI+ W DG KTVEED++DVL+ LKD + +P+L+
Sbjct  238   LDLDGHRSKIMKAIRIMKKYHDPIIHDRIKQWNDGLKTVEEDLLDVLISLKDANNKPLLT  297

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEI  Q  E+ +  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  298   FKEIMAQTTELAVEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  357

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  358   KLPFVRACAREALRLHPMEYFNVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  417

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  418   PLKFNPDRHLKEGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  477

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL  PL A+AKPRL
Sbjct  478   PPNVSSIDLVPSHDCLFLAKPLLAVAKPRL  507



>gb|AHY21793.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
Length=505

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/516 (52%), Positives = 371/516 (72%), Gaps = 15/516 (3%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             FL + +F+ M+   I+   +K+KK+         +PPGPKPWP+VG++PE+L NKPA  W
Sbjct  3     FLLVVIFSFMIFSVIK--SHKSKKY--------RLPPGPKPWPIVGNLPEMLANKPASIW  52

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             IH +M EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +
Sbjct  53    IHKLMKEMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTT  112

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
             ++  PYGE+W K +++L +++LSP    WL+ KR EEAD+L+ +IYN+C       +  +
Sbjct  113   TVLTPYGEQWKKMKKVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC----CKDVNGL  168

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADY  771
             V++R A +HY GNV +K++ N RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY
Sbjct  169   VNIRTAAQHYGGNVFRKLILNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDY  228

Query  772   IPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDND  951
             +P+L   DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD  
Sbjct  229   VPFLRRLDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAK  288

Query  952   GRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLV  1131
              +P+L+ KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLV
Sbjct  289   NKPLLTLKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLV  348

Query  1132  QESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRN  1311
             QESD+  L +++AC +E  RLHP+  F  PH S  DT+VG Y  PKG+QV++SR  LGRN
Sbjct  349   QESDIHKLPFVRACAREALRLHPMEYFDVPHESMSDTMVGDYMFPKGTQVLLSRVALGRN  408

Query  1312  KRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQ  1488
              + W DPLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ 
Sbjct  409   PKFWTDPLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLH  468

Query  1489  GFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             GF+W  P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  469   GFSWSAPPNVSSIDLVPSDDCLFLANPLLAVAKPRL  504



>sp|Q9FLC8.1|C79A2_ARATH RecName: Full=Phenylalanine N-monooxygenase; AltName: Full=Cytochrome 
P450 79A2; AltName: Full=Phenylalanine N-hydroxylase 
[Arabidopsis thaliana]
 dbj|BAB09969.1| cytochrome P450 [Arabidopsis thaliana]
Length=529

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/489 (55%), Positives = 358/489 (73%), Gaps = 4/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEIL-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPK WPL+G++PEIL RNKP FRWIH +M E+ T+IACIRL  T+VIPVTSP +ARE
Sbjct  40    LPPGPKSWPLIGNLPEILGRNKPVFRWIHSLMKELNTDIACIRLANTHVIPVTSPRIARE  99

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
              LKKQDS+F++RP  M     S GYL+    P GE+W K RR++ SHV S  +   ++ K
Sbjct  100   ILKKQDSVFATRPLTMGTEYCSRGYLTVAVEPQGEQWKKMRRVVASHVTSKKSFQMMLQK  159

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-  687
             R EEAD+L+R+I N+   +  +A   V+D+R A R Y GNV +KM+F  R+FG G+ DG 
Sbjct  160   RTEEADNLVRYINNRSVKNRGNAF-VVIDLRLAVRQYSGNVARKMMFGIRHFGKGSEDGS  218

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GPG  + E ++++FT+L +LY   ++DY+PWL   DL+GH+ +++ A+    K+ D  VD
Sbjct  219   GPGLEEIEHVESLFTVLTHLYAFALSDYVPWLRFLDLEGHEKVVSNAMRNVSKYNDPFVD  278

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             ER+  W++G     +D +D+ +  KD DG+P LSD+EIK QV E+M+A +DNPSNA EW 
Sbjct  279   ERLMQWRNGKMKEPQDFLDMFIIAKDTDGKPTLSDEEIKAQVTELMLATVDNPSNAAEWG  338

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             +AEMIN+P +++KAVEE+D VVG++RLV ESDLPNLNY+KACVKE FRLHP+APF  PH+
Sbjct  339   MAEMINEPSIMQKAVEEIDRVVGKDRLVIESDLPNLNYVKACVKEAFRLHPVAPFNLPHM  398

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVV-LTDSELKMM  1404
             ST DTVV GYFIPKGS V+ISR G+GRN   W+ P KF PERHL+    V L +S+L ++
Sbjct  399   STTDTVVDGYFIPKGSHVLISRMGIGRNPSVWDKPHKFDPERHLSTNTCVDLNESDLNII  458

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFSAGRRGC GV +GS M+ ML+ARLIQGFTW        ID++ESK+DLF+  PL+A+A
Sbjct  459   SFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWLPVPGKNKIDISESKNDLFMAKPLYAVA  518

Query  1585  KPRLPSNLY  1611
              PRL  ++Y
Sbjct  519   TPRLAPHVY  527



>ref|NP_568153.1| cytochrome P450 CYP79A2 [Arabidopsis thaliana]
 gb|AAF70255.1|AF245302_1 cytochrome P450 CYP79A2 [Arabidopsis thaliana]
 gb|AED90847.1| cytochrome P450 CYP79A2 [Arabidopsis thaliana]
Length=523

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/489 (55%), Positives = 358/489 (73%), Gaps = 4/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEIL-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPK WPL+G++PEIL RNKP FRWIH +M E+ T+IACIRL  T+VIPVTSP +ARE
Sbjct  34    LPPGPKSWPLIGNLPEILGRNKPVFRWIHSLMKELNTDIACIRLANTHVIPVTSPRIARE  93

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
              LKKQDS+F++RP  M     S GYL+    P GE+W K RR++ SHV S  +   ++ K
Sbjct  94    ILKKQDSVFATRPLTMGTEYCSRGYLTVAVEPQGEQWKKMRRVVASHVTSKKSFQMMLQK  153

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-  687
             R EEAD+L+R+I N+   +  +A   V+D+R A R Y GNV +KM+F  R+FG G+ DG 
Sbjct  154   RTEEADNLVRYINNRSVKNRGNAF-VVIDLRLAVRQYSGNVARKMMFGIRHFGKGSEDGS  212

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GPG  + E ++++FT+L +LY   ++DY+PWL   DL+GH+ +++ A+    K+ D  VD
Sbjct  213   GPGLEEIEHVESLFTVLTHLYAFALSDYVPWLRFLDLEGHEKVVSNAMRNVSKYNDPFVD  272

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             ER+  W++G     +D +D+ +  KD DG+P LSD+EIK QV E+M+A +DNPSNA EW 
Sbjct  273   ERLMQWRNGKMKEPQDFLDMFIIAKDTDGKPTLSDEEIKAQVTELMLATVDNPSNAAEWG  332

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             +AEMIN+P +++KAVEE+D VVG++RLV ESDLPNLNY+KACVKE FRLHP+APF  PH+
Sbjct  333   MAEMINEPSIMQKAVEEIDRVVGKDRLVIESDLPNLNYVKACVKEAFRLHPVAPFNLPHM  392

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVV-LTDSELKMM  1404
             ST DTVV GYFIPKGS V+ISR G+GRN   W+ P KF PERHL+    V L +S+L ++
Sbjct  393   STTDTVVDGYFIPKGSHVLISRMGIGRNPSVWDKPHKFDPERHLSTNTCVDLNESDLNII  452

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFSAGRRGC GV +GS M+ ML+ARLIQGFTW        ID++ESK+DLF+  PL+A+A
Sbjct  453   SFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWLPVPGKNKIDISESKNDLFMAKPLYAVA  512

Query  1585  KPRLPSNLY  1611
              PRL  ++Y
Sbjct  513   TPRLAPHVY  521



>gb|KDP45698.1| hypothetical protein JCGZ_17305 [Jatropha curcas]
Length=534

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/534 (53%), Positives = 371/534 (69%), Gaps = 14/534 (3%)
 Frame = +1

Query  31    LRFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsI-----PPGPKPWPLVGSI  195
             + F  +IF   +  T+++      LIY  K     S    SI     PPGPKPWP++G +
Sbjct  1     MAFPQLIF-SFSFITILMGTITSLLIYSIKSHKPPSKDEKSILRQQLPPGPKPWPIIGCL  59

Query  196   PEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRC  375
                 RN+PAFRWIH +M +M TEIACIRLG  +VIPVT P+++ E LK QD+ F++RP  
Sbjct  60    LAKYRNEPAFRWIHNLMKQMNTEIACIRLGNVHVIPVTCPKISCEILKAQDANFATRPIS  119

Query  376   MSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQ  555
             MS    S GYL+++  P+G++W K R +L + +LS A Q      RVEEA+HL+R++YNQ
Sbjct  120   MSTRFTSKGYLTTILAPFGDQWKKMRTVLVTEMLSAAKQRRFYGARVEEANHLVRYVYNQ  179

Query  556   CKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTI  735
             C        G +VDVR A +HYCGNVT+KM+FNKR+FG G  +GGPG  +EE + A+F +
Sbjct  180   CN------EGGLVDVRVAAQHYCGNVTRKMMFNKRFFGKGKKNGGPGFEEEEHIDAIFRV  233

Query  736   LRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEED  915
             L YLY   ++DY+P L  FDLDGH+ II +A  +  K+ D  +++R+Q WKDGTK  EED
Sbjct  234   LHYLYAFCLSDYLPCLVGFDLDGHEKIIKEANGIIGKYHDPIIEDRVQQWKDGTKKEEED  293

Query  916   IVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVE  1095
              +DVL+ LKD++G P+LS  EIK Q+ EIM+A +DNPSNAVE A AEMINQPK+LEKAVE
Sbjct  294   FLDVLITLKDDNGNPLLSTDEIKAQITEIMLATVDNPSNAVERATAEMINQPKILEKAVE  353

Query  1096  EVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGS  1275
             ++D VVG+ERLVQESDL  L+YI AC +E FRLHP  PFT PH+S  DT V  YFIPKGS
Sbjct  354   DLDRVVGKERLVQESDLSQLSYITACAREAFRLHPAVPFTVPHVSMTDTTVANYFIPKGS  413

Query  1276  QVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLG  1449
              V++SR GLGRN + W++P KFKPERH+  +G  V L +  L  +SFS GRRGCPGV +G
Sbjct  414   HVLLSRVGLGRNSKIWDEPHKFKPERHIKNDGSQVKLVEPYLNFISFSTGRRGCPGVTMG  473

Query  1450  SLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             + M++ML ARL+ GFTW VP +   IDL ES+  L L  PL AL KPRLP+ +Y
Sbjct  474   TSMTLMLFARLLHGFTWNVPPNQTSIDLKESESSLTLAKPLVALVKPRLPAYVY  527



>gb|ACB15192.1| cytochrome P450 [Trifolium nigrescens subsp. petrisavii]
Length=506

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/512 (52%), Positives = 368/512 (72%), Gaps = 7/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I+   K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFSVIKSH-KYSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  59

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACI LG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  60    EMNTEIACIHLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  119

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP    WL+ KR EEAD+L+ +IYN+C          +V++R A
Sbjct  120   GEQWKKMKRVLVNNLLSPLKHQWLLGKRNEEADNLVFYIYNKC-----CNDAGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++ N RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLILNTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD + +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDANNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL NPL A+AKPRL +
Sbjct  475   PPNVSSIDLVPSDDCLFLANPLLAVAKPRLAA  506



>ref|XP_006428266.1| hypothetical protein CICLE_v10013842mg, partial [Citrus clementina]
 gb|ESR41506.1| hypothetical protein CICLE_v10013842mg, partial [Citrus clementina]
Length=508

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/497 (54%), Positives = 356/497 (72%), Gaps = 15/497 (3%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWP+VG++P++ R KPAF WIH VM E+ T+IACIR G  +VIPVTSPE+A E 
Sbjct  11    LPPGPSPWPIVGNLPDMWRKKPAFNWIHDVMKELNTDIACIRQGNVHVIPVTSPEIALEV  70

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DS F++RP  M     S G+LS   +P G++W K R+++ SHVL  A  H L+ KR
Sbjct  71    LKDNDSTFATRPLTMGTEYSSRGFLSIAVVPLGQQWKKMRKVVASHVLCSARLHSLLFKR  130

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+RF+YNQC     S  G+VV+VR A R YCGNV + M+FN+RYFG G  DGGP
Sbjct  131   REEADNLVRFVYNQCC---KSGSGSVVNVRHAARQYCGNVMRNMMFNRRYFGEGNEDGGP  187

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE ++++F +L++LY   ++DY+PW+ +FDL+GH+ +I+ A+    K+ D  ++ER
Sbjct  188   GFDEEEHVESLFIVLQHLYSFTLSDYLPWMRVFDLEGHEKLISDAIRTVSKYHDPIIEER  247

Query  874   IQM-------WKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSN  1032
             IQ        +K G+    +D++D L+  KD  GRP LS  EIK Q +++M+A +DNPSN
Sbjct  248   IQQRSHHHGNYKKGSDD-HQDLLDALISAKDETGRPSLSVDEIKAQCMDLMLATVDNPSN  306

Query  1033  AVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPF  1212
             AVEWAL EMINQP++L+KA EEVD  VG+ERLVQE D+P LNY+KAC++E  RLHP+APF
Sbjct  307   AVEWALGEMINQPEILKKAKEEVDMFVGKERLVQEYDIPQLNYVKACLREALRLHPVAPF  366

Query  1213  TPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVL  1380
               PH+ST+D  + GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D    V L
Sbjct  367   NLPHVSTRDATIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVEL  426

Query  1381  TDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFL  1560
             T+ EL+ +SF  GRRGC GV LGS MSV+L+ARL+QGF W +P+    IDL ESK+DL +
Sbjct  427   TEPELRFVSFGRGRRGCMGVALGSEMSVILLARLLQGFDWSLPSHEEKIDLAESKYDLLM  486

Query  1561  ENPLFALAKPRLPSNLY  1611
               P+ A AKPRL + LY
Sbjct  487   AKPMHARAKPRLAAELY  503



>gb|KCW54305.1| hypothetical protein EUGRSUZ_I00268 [Eucalyptus grandis]
Length=505

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/495 (53%), Positives = 355/495 (72%), Gaps = 14/495 (3%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G +PE+LR KP FRWIH +M EM T+IACIRLG  ++IPVT PE+AREF
Sbjct  15    LPPGPALWPIIGCVPEMLRQKPTFRWIHRLMKEMDTDIACIRLGNVHIIPVTCPEIAREF  74

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D+ FSS P  ++    S G+L+++  PYG++W K RR++ S ++SPA  HWL +KR
Sbjct  75    LKKHDATFSSSPTSLATQTCSGGFLTTILSPYGDQWMKMRRVIVSEIISPARHHWLKDKR  134

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+++IYN+ K S  +     V+VR ATR Y GNV +K++F+KRYFG   AD  P
Sbjct  135   TEEADNLVKYIYNRSKSSSRT-----VNVRTATRQYTGNVIRKLMFSKRYFGEERADSEP  189

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
                +EE + A+FTIL+YLY   ++DY PWL   DLDGH+  + +A++    + D  +D R
Sbjct  190   TIAEEEHVGAIFTILKYLYAFCISDYFPWLLGLDLDGHEKFVKEAVSTVNNYHDPIIDAR  249

Query  874   IQMWK-------DGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSN  1032
             I  W+         T     D++DVLV LKD++G+P+L+ +EIK QV E+M A +DNPSN
Sbjct  250   IGKWRRFGNLNEKSTSNDPHDLLDVLVTLKDSEGKPLLTPEEIKAQVTEMMFATVDNPSN  309

Query  1033  AVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPF  1212
             AVEWA+AEMINQP++L+ A EE+D VVG+ERLVQE D+P LNYIKAC++E FRLHPIAPF
Sbjct  310   AVEWAMAEMINQPEILKIATEELDRVVGKERLVQECDIPRLNYIKACIREAFRLHPIAPF  369

Query  1213  TPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTD  1386
              PPH++  D +V GYFIPKGS V++SR GLGRN + W  PL+F+PERH   +  +V LT+
Sbjct  370   NPPHMAMSDAIVAGYFIPKGSHVLLSRFGLGRNPKVWNKPLEFRPERHFTSDCIEVPLTE  429

Query  1387  SELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLEN  1566
               L+ +SFS GRRGC    LG+ M+V+L+AR++QGF W  P ++  I+L ES  DL L +
Sbjct  430   PNLRFISFSTGRRGCVAPMLGTAMTVILLARMVQGFNWMAPPNVTSINLDESFEDLSLAD  489

Query  1567  PLFALAKPRLPSNLY  1611
             PL A A+PRLP +LY
Sbjct  490   PLVAHAEPRLPLHLY  504



>ref|XP_009354043.1| PREDICTED: isoleucine N-monooxygenase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/524 (50%), Positives = 380/524 (73%), Gaps = 13/524 (2%)
 Frame = +1

Query  55    LPLALFTVMLSVTI-QWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             +P+A+F    ++ +  ++  KT K      S   +PPGP+PWP+VG +P++ RN+PA++W
Sbjct  3     IPIAIFLASTAIFLFHFIRLKTCK-----RSKEILPPGPRPWPIVGCVPQMWRNRPAYKW  57

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             +H +++E  T+IACI+LG  +VI V SPE+AREFLKK D++F+SRP  M+  ++S+GY++
Sbjct  58    VHSILEEFNTDIACIKLGNVHVIAVKSPEIAREFLKKNDAVFASRPVTMATHILSSGYVT  117

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
             +  +P+G +W K RR+L + V + +  HWL+ +R EEAD+L++F+YNQC ++     G+V
Sbjct  118   TGVVPWGSQWKKMRRVLIADVFNQSRVHWLLGQRNEEADNLVKFLYNQCSVNPN---GSV  174

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADY  771
             V+VR A   Y G V ++M+FN RYFG G  DGGPG  +EE + A+ T+L ++Y   V+DY
Sbjct  175   VNVRTAALFYSGGVMRRMIFNSRYFGKGREDGGPGLEEEEHVSALLTMLLHVYAFCVSDY  234

Query  772   IPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDND  951
             +PWL +FD+ GH+  +  AL +T+ + D  ++ER+Q W+DG +T   D++DV + LKD +
Sbjct  235   LPWLRVFDIGGHEKKVRDALKITKHYQDPVINERLQQWRDGKRTKPADLLDVFISLKDAN  294

Query  952   GRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLV  1131
             G+P+LS +EIK Q+ E+ +A +DNP NA EWAL++M+NQP++L+KA EE+D VVG+ RLV
Sbjct  295   GQPLLSSEEIKAQITELQLATVDNPFNAGEWALSQMLNQPEMLKKAEEELDRVVGKHRLV  354

Query  1132  QESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRN  1311
             QESD+P L YI AC +E  RLHP+APF  PH+S  D VV GYFIPKGS V++SR GLGRN
Sbjct  355   QESDIPKLPYIMACSREALRLHPVAPFNLPHVSNADAVVAGYFIPKGSAVLLSRLGLGRN  414

Query  1312  KRAWEDPLKFKPERHLNG---EDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARL  1482
                WE+PL+F PERHLNG   + V L + EL+ ++FS GRRGC G  LG+ ++VML+ARL
Sbjct  415   PEVWENPLRFNPERHLNGDADQQVELEEHELRFITFSTGRRGCMGGSLGTTITVMLLARL  474

Query  1483  IQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLYM  1614
             +QGFTW +P ++  IDLTE+   LF  NPL+A AK RLP+ LY+
Sbjct  475   LQGFTWSMPPNVDKIDLTEAL-SLFKANPLYAHAKQRLPATLYL  517



>gb|KHN48839.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=473

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/472 (56%), Positives = 349/472 (74%), Gaps = 3/472 (1%)
 Frame = +1

Query  202   ILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMS  381
             +L ++P FRWI  +M EM TEIACIRLG  +VIPVT P +AREFL+KQD+ F+SRP  ++
Sbjct  1     MLTHRPTFRWIQNLMKEMNTEIACIRLGNVHVIPVTCPTIAREFLRKQDATFASRPNSIT  60

Query  382   AGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCK  561
               LIS GYL++  +P+GE+W K RRI+++ +LS  T   L NKRVEEAD+L+ +IYN+CK
Sbjct  61    TSLISRGYLTTTLVPFGEQWKKMRRIVSNDLLSTTTHQRLENKRVEEADNLVFYIYNKCK  120

Query  562   ISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILR  741
              +  +    +V+VR   +HY  NV KK++F+ RYFG G  DGGPG  +EE + ++FT+L+
Sbjct  121   -NNVNDNVCLVNVRYVAQHYSCNVIKKLIFSTRYFGEGKKDGGPGREEEEHVDSIFTMLK  179

Query  742   YLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIV  921
             Y+Y   V+DY+P+L   DLDGH+  + KAL +  K+ D  +++RI+   +G+K   ED +
Sbjct  180   YIYDFSVSDYVPFLRGLDLDGHEGKVKKALEIVEKYHDPIIEQRIKERNNGSKIDGEDFL  239

Query  922   DVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEV  1101
             D+L+ LKD +  PML+ +EIK Q+ E+M+AA+DNP+NA EW L EMINQPKLL++AVEE+
Sbjct  240   DILISLKDANNNPMLTTQEIKAQITELMMAAMDNPTNAFEWGLGEMINQPKLLQRAVEEL  299

Query  1102  DNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQV  1281
             D VVG+ERLVQESD+P LNYIKAC +E FRLHPI PF  PH+S KDT+VG Y IPKGS +
Sbjct  300   DTVVGKERLVQESDIPKLNYIKACAREAFRLHPIVPFNVPHVSLKDTIVGNYLIPKGSHI  359

Query  1282  IISRTGLGRNKRAWED-PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSL  1455
             ++SR  LGRN + W D PLKFKPERHL N  DVVLTD +L ++SFS GRRGCPG  LG+ 
Sbjct  360   LLSRQELGRNPKVWNDEPLKFKPERHLINKSDVVLTDQDLNLISFSTGRRGCPGFMLGTT  419

Query  1456  MSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             M+VML ARL+  FTW  P ++  I+L ES HD+ L +P  ALAKPRLP  LY
Sbjct  420   MTVMLFARLLHAFTWIAPPNVSHINLAESSHDISLAHPPLALAKPRLPPELY  471



>ref|XP_007203677.1| hypothetical protein PRUPE_ppa026605mg, partial [Prunus persica]
 gb|EMJ04876.1| hypothetical protein PRUPE_ppa026605mg, partial [Prunus persica]
Length=498

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/489 (53%), Positives = 365/489 (75%), Gaps = 7/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWP+VG +PE+ RN+PA++W+H V+ E+ T+IACI+LG  +VIPV SPE+AREF
Sbjct  12    LPPGPTPWPIVGCVPEMWRNRPAYKWVHKVLKELDTDIACIKLGNVHVIPVKSPEIAREF  71

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D++F+SRP  M+  L+S+G+L++  +P+G +W K R++L + V + +   WLV KR
Sbjct  72    LKKNDAVFASRPVTMATELLSSGFLTTGVVPWGGQWKKMRKVLIADVFNHSMVQWLVGKR  131

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L++F+YNQC    ++  G+VV+VR A + Y G V ++M+FN RYFG G  DGGP
Sbjct  132   NEEADNLVKFLYNQC---SSNPNGSVVNVRTAAQFYSGGVMRRMIFNTRYFGKGRKDGGP  188

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +E+ + A+ TIL ++Y   V+DY+PWL +FD+ GH+  +  AL + +++ D  +DER
Sbjct  189   GFEEEQHVSALLTILLHVYAFCVSDYLPWLRVFDISGHEKKVRGALKIIKQYQDPLIDER  248

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             ++ W+DG     ED++DV + LKD +G+P+LS +EIK Q+ E+ +A +DNP NA EWAL+
Sbjct  249   LKEWRDGRTKEPEDLLDVFISLKDANGQPLLSGEEIKAQITELQLATVDNPFNAAEWALS  308

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
              M+NQP+LL+KA EE+D VVG++RLVQESD+P L Y++AC +E  RLHP+APF  PH+S+
Sbjct  309   IMLNQPELLKKAEEELDRVVGKQRLVQESDVPKLPYVRACAREALRLHPVAPFNLPHMSS  368

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNG---EDVVLTDSELKMM  1404
              D VV GYFIPKGS V++SR GLGRN   WE+PL F PERHL G   + V L + EL+ +
Sbjct  369   TDAVVAGYFIPKGSSVLLSRLGLGRNPEVWENPLIFDPERHLKGDADQQVDLEEHELRFI  428

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             +FS GRRGC G  LG+ +++ML+ARL+QGFTW +P ++  IDLTE+   LF  NPLFA A
Sbjct  429   TFSTGRRGCMGSGLGTTITIMLLARLLQGFTWSMPPNVDKIDLTEAL-SLFKANPLFAHA  487

Query  1585  KPRLPSNLY  1611
             KPRLP++LY
Sbjct  488   KPRLPASLY  496



>gb|ACB15189.1| cytochrome P450 [Trifolium nigrescens subsp. petrisavii]
Length=506

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/512 (52%), Positives = 367/512 (72%), Gaps = 7/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP     L+ KR EEAD+L+ +IYN+C       +  +V++R A
Sbjct  119   GEQWKKMKRVLINNLLSPLKHQSLLGKRNEEADNLVFYIYNKC----CKDVNGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++   RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLVLGTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD   +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAKNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFVVPHVSMSDTTVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL NPL A+AKPRL +
Sbjct  475   PPNVSSIDLVPSHDCLFLANPLLAVAKPRLAA  506



>ref|XP_006420514.1| hypothetical protein CICLE_v10004690mg [Citrus clementina]
 gb|ESR33754.1| hypothetical protein CICLE_v10004690mg [Citrus clementina]
 gb|KDO43050.1| hypothetical protein CISIN_1g009152mg [Citrus sinensis]
Length=542

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/486 (55%), Positives = 356/486 (73%), Gaps = 12/486 (2%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+  NKP F+WIH  M E+ T I+CIRLG  +VIPVTSPE+A E LK  DSIF+
Sbjct  56    IVGNLPEMWSNKPTFKWIHDFMKELNTNISCIRLGNVHVIPVTSPEIALEVLKDNDSIFA  115

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M     S G+LS   +P+GE+W K ++++ SHVL+ +    L+ +R EEAD+L+R
Sbjct  116   SRPLTMGTEYSSRGFLSIAVVPWGEQWKKMKKVVASHVLNSSRLRSLLVRRTEEADNLVR  175

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             FIYNQCK    S +G  VDVR ATR YCGNV +KM+FN+RYFG G  +GGPG  +EE ++
Sbjct  176   FIYNQCK---DSPIGLDVDVRLATRQYCGNVMRKMMFNRRYFGEGRENGGPGFEEEEHVE  232

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMW-----  885
             ++F +L+ LY   ++DY+PW+ +FDL+GH+ II+ A+    K+ D  +DER+Q       
Sbjct  233   SLFVVLQRLYSFALSDYVPWMRVFDLEGHEKIISDAMRTASKYHDAIIDERVQQRRQGKN  292

Query  886   KDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMIN  1065
             KD     + D++DVL+  KD +GRP LS  EIK+Q +++M+A +DNPSN VEWA+AEMIN
Sbjct  293   KDDAHDHDVDLLDVLISAKDENGRPSLSVDEIKSQCMDLMLATVDNPSNVVEWAIAEMIN  352

Query  1066  QPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTV  1245
             QP++L+KA EE+D VVG+ERLVQESD+P LNYIKAC++E FRLHP+APF  PH+S +DT 
Sbjct  353   QPEILKKATEEIDRVVGKERLVQESDIPQLNYIKACLREMFRLHPVAPFNLPHVSNRDTT  412

Query  1246  VGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMSFS  1413
             + GYFIPKGS V+ISR GLG+N   W+DPLKF PERH++  D    V +T+ EL+ ++FS
Sbjct  413   IAGYFIPKGSHVLISRVGLGQNPNVWKDPLKFIPERHISAADPHHQVEITEPELRFLTFS  472

Query  1414  AGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPR  1593
              GRR C G+ LGS MSVML+ARL+QGF W VP+    IDL ESK+DL +  PL+A AKPR
Sbjct  473   RGRRSCMGMALGSEMSVMLLARLLQGFDWSVPSHEEKIDLAESKYDLLMAKPLYAHAKPR  532

Query  1594  LPSNLY  1611
             LP  +Y
Sbjct  533   LPDEIY  538



>ref|XP_010491059.1| PREDICTED: phenylalanine N-monooxygenase-like [Camelina sativa]
Length=532

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/529 (52%), Positives = 371/529 (70%), Gaps = 4/529 (1%)
 Frame = +1

Query  37    FSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEIL-RN  213
               S   L   L+ ++L++T++    + K    S +  L +PPGPK WPL+G++P+IL RN
Sbjct  2     LDSTSILAFILWFLLLALTMKRKETRKKMLVTSYTRKLPLPPGPKSWPLIGNLPDILWRN  61

Query  214   KPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLI  393
             KP FRWIH +M E+ T+IACIRL  TYVIPVTSP +ARE LKKQDSIF++RP  M     
Sbjct  62    KPVFRWIHSLMKELNTDIACIRLANTYVIPVTSPRIAREILKKQDSIFATRPLTMGTEYC  121

Query  394   SNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEA  573
             S GYL+    P GE+W K RR++ SHV S  +    + KR EEAD+ +R+I N    +  
Sbjct  122   SRGYLTVAVEPQGEQWKKMRRVVASHVTSKKSFTLTIQKRTEEADNFVRYINNLTAKNRG  181

Query  574   SAMG-AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-GPGAVDEELLKAVFTILRYL  747
              A G  V+D+R   R Y GNV +KM+F  R+FG G+ DG GPG  + E ++++FT+L +L
Sbjct  182   DANGFGVIDLRLVVRQYSGNVARKMMFGVRHFGKGSEDGSGPGFEEIEHVESLFTVLTHL  241

Query  748   YGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDV  927
             +   ++DY+PWL   DL+GH+ ++ +A+    K+ D  VDER++ W++G     +D +D+
Sbjct  242   FAFALSDYVPWLRFLDLEGHEKVVREAMGNVSKYNDPLVDERLKQWRNGKLKEPQDFLDM  301

Query  928   LVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDN  1107
              +  KD+DG P LS++EIK QV E+M+A +DNPSNA +WA+AEMIN+P +++KAVEE+D 
Sbjct  302   FIMAKDSDGNPTLSEEEIKAQVTELMLATVDNPSNAADWAMAEMINEPSIMQKAVEEIDT  361

Query  1108  VVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVII  1287
             VVG++RLV ESDLPNLNY+KACVKE FRLHP+APF  PH+ST D VV GYFIPKGS V+I
Sbjct  362   VVGKDRLVLESDLPNLNYVKACVKEAFRLHPVAPFNLPHMSTADAVVDGYFIPKGSHVMI  421

Query  1288  SRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSV  1464
             SR G+GRN   W+ PLKF PERHL N   V L D +L ++SFSAGRRGC GV +GS M+ 
Sbjct  422   SRMGIGRNPSVWDKPLKFDPERHLGNNICVELNDPDLNIISFSAGRRGCMGVDIGSAMTY  481

Query  1465  MLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             ML+ARLIQGFTW        +DL+ESK DLF+  PL A+A PRL +++Y
Sbjct  482   MLLARLIQGFTWSPVPGENKVDLSESKSDLFMAKPLHAVATPRLAAHVY  530



>gb|AHY21791.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
Length=505

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 367/510 (72%), Gaps = 7/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP     L+ KR EEAD+L+ +IYN+C       +  +V++R A
Sbjct  119   GEQWKKMKRVLINNLLSPLKHQSLLGKRNEEADNLVFYIYNKC----CKDVNGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++   RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLVLGTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD + +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDANNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHESMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKTGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  475   PPNVSTIDLVPSDDCLFLANPLLAVAKPRL  504



>ref|XP_007134794.1| hypothetical protein PHAVU_010G076800g [Phaseolus vulgaris]
 gb|ESW06788.1| hypothetical protein PHAVU_010G076800g [Phaseolus vulgaris]
Length=533

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/480 (55%), Positives = 352/480 (73%), Gaps = 4/480 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+L NKPA +WIH +M EM TEIACIRLG TYVIPV  P +AREFL +QD+ F+
Sbjct  53    IVGNLPEMLANKPAHQWIHNLMKEMNTEIACIRLGNTYVIPVICPTIAREFLSEQDATFA  112

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SR       L+S+ YL+++ +P+GE+W K ++IL++ +LS     WL +KR EEAD+L+ 
Sbjct  113   SRSLTPCTDLVSSRYLTTILVPFGEQWKKMKKILSTALLSSQKHLWLHDKRTEEADNLMF  172

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YN+  I+    +G +V++R   R YC NV +K++FN RYFG G  DGGP   + E ++
Sbjct  173   YVYNK-SITVKDGVGGLVNIRSVARLYCANVIRKIVFNTRYFGKGMKDGGPSFKEIEHVE  231

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             AVF +LRYLY   ++DY+P L   DLDGH+  + +AL V +K+ D  V ER + W    K
Sbjct  232   AVFDLLRYLYAFSISDYMPCLRRLDLDGHQKKVKEALDVIKKYHDPIVQERAKQWNHTPK  291

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
               EED +D+L+ LKD +  P+L+ +EI TQ+ E+MIA +DNPSNA EWALAEMIN+PK+L
Sbjct  292   VDEEDWLDILISLKDANNNPLLTLEEINTQITELMIATVDNPSNAFEWALAEMINEPKML  351

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             E+A+EE+D+VVG+ERLVQESD+P LNY+KAC +E FRLHPIAPF PPH+S  DT VG YF
Sbjct  352   ERAIEELDSVVGKERLVQESDIPKLNYVKACAREAFRLHPIAPFNPPHVSMSDTTVGNYF  411

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL---NGEDVVLTDSELKMMSFSAGRRGC  1431
             IPKGS VI+SR  LGRN + W +PLKFKPERHL   NG +VVLT+  L+ +SFS GRR C
Sbjct  412   IPKGSHVILSRKELGRNPKVWNEPLKFKPERHLKIDNGSNVVLTEPNLRFISFSTGRRSC  471

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             PGV LGS M+VML ARL+ GFTW  P+++  +++ ES   +FL +PL A+ KPRL  +LY
Sbjct  472   PGVMLGSTMTVMLFARLLHGFTWTAPSNVSKVNVAESNDHMFLADPLVAVGKPRLAPHLY  531



>ref|XP_007011298.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20108.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=534

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/482 (54%), Positives = 359/482 (74%), Gaps = 4/482 (1%)
 Frame = +1

Query  178   PLVGSIPEILRNKPAFR-WIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSI  354
             PLV  +P  +R       WIHG+M ++ T+IACIRL   +VIPVTSPE+AREFLKK D+ 
Sbjct  47    PLVDIVPLTVRGHSRIEVWIHGLMKQLDTDIACIRLANIHVIPVTSPEIAREFLKKYDAA  106

Query  355   FSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHL  534
             F+SRP  M+    S G+LS+  +P+G++W K R+++ S+++ PA    L++KR +EAD+L
Sbjct  107   FASRPVTMATEFASRGFLSTALVPWGDQWKKMRKVIASNIIKPARLSSLLHKRTQEADNL  166

Query  535   LRFIYNQCKISEA-SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEE  711
             +RFIYNQC   E  S+ G+V+++R A R Y GNV +KM+FNKRYFG G  DGGPG  +EE
Sbjct  167   VRFIYNQCINPENDSSNGSVINLRLAVRQYTGNVIRKMMFNKRYFGQGKEDGGPGHEEEE  226

Query  712   LLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKD  891
              ++++FT+L++LY   ++DY+PWL   DL+GH+ I+++A+ +   + D  +DER+Q W++
Sbjct  227   HVESLFTVLKHLYSFILSDYVPWLRPLDLEGHEKIVSEAVRIVNGYHDPIIDERVQQWRE  286

Query  892   GTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQP  1071
             G K   ED++D  +  KD DG+P LS +EIK Q  E+M+A +DNP+NA EWA+AEMINQP
Sbjct  287   GKKKEAEDLLDAFILAKDLDGKPALSVEEIKAQCTELMLATVDNPANAAEWAMAEMINQP  346

Query  1072  KLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVG  1251
             + L+KA+EE+D VVG++RLVQE+D+P LNY+KAC +E FRLHPIAPF  PH+S  D +V 
Sbjct  347   ETLQKAIEEIDGVVGKDRLVQETDIPKLNYVKACAREAFRLHPIAPFNLPHVSNTDVIVA  406

Query  1252  GYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAGRR  1425
             GYFIPKGS V++SR GLGRN + W++PLKFKPERHL     +V LT++EL+ +SFS GRR
Sbjct  407   GYFIPKGSHVLLSRVGLGRNSQVWDEPLKFKPERHLKDGSIEVDLTETELRFISFSTGRR  466

Query  1426  GCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSN  1605
             GC GV LGS M++ML+ARLIQGF W+   D   IDL+ES+ DLFL  PL ALAKPRL + 
Sbjct  467   GCMGVALGSEMTIMLLARLIQGFAWKAQPDEAKIDLSESEDDLFLAKPLHALAKPRLSAA  526

Query  1606  LY  1611
             +Y
Sbjct  527   VY  528



>gb|AHY21787.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
Length=505

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 366/510 (72%), Gaps = 7/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP     L+ KR EEAD+L+ +IYN+C       +  +V++R A
Sbjct  119   GEQWKKMKRVLINNLLSPLKHQSLLGKRNEEADNLVFYIYNKC----CKDVNGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++   RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLILGTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD   +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAKNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHESMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  475   PPNVSSIDLVPSDDCLFLANPLLAVAKPRL  504



>gb|AHY21786.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
 gb|AHY21789.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
 gb|AHY21792.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
Length=505

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 366/510 (72%), Gaps = 7/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP     L+ KR EEAD+L+ +IYN+C       +  +V++R A
Sbjct  119   GEQWKKMKRVLINNLLSPLKHQSLLGKRNEEADNLVFYIYNKC----CKDVNGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++   RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLVLGTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD   +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAKNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHESMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  475   PPNVSSIDLVPSDDCLFLANPLLAVAKPRL  504



>gb|ACB15190.1| cytochrome P450 [Trifolium nigrescens subsp. petrisavii]
Length=506

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/512 (52%), Positives = 367/512 (72%), Gaps = 7/512 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I++  K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFMIFRVTKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP     L+ KR EEAD+L+ +IYN+C       +  +V++R A
Sbjct  119   GEQWKKMKRVLINNLLSPLKHQSLLGKRNEEADNLVFYIYNKC----CKDVNGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++   RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLVLGTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD   +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAKNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHESMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             P ++  IDL  S   LFL NPL A+AKPRL +
Sbjct  475   PPNVSSIDLVPSDDCLFLANPLLAVAKPRLAA  506



>gb|AHY21798.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
Length=505

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 366/510 (72%), Gaps = 7/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I+   K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFIIFSVIKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP     L+ KR EEAD+L+ +IYN+C       +  +V++R A
Sbjct  119   GEQWKKMKRVLINNLLSPLKHQSLLGKRNEEADNLVFYIYNKC----CKDVNGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++   RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLVLGTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD   +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAKNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHVSMSDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  475   PPNVSSIDLVPSDDCLFLANPLLAVAKPRL  504



>gb|AHY21795.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
 gb|AHY21796.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
Length=505

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 366/510 (72%), Gaps = 7/510 (1%)
 Frame = +1

Query  70    FTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVMD  249
             +T +L V   ++I+   K +   S    +PPGPKPWP+VG++PE+L NKPA  WIH +M 
Sbjct  1     WTFLLVVIFSFIIFSVIKSH--KSKKYRLPPGPKPWPIVGNLPEMLANKPASIWIHKLMK  58

Query  250   EMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPY  429
             EM TEIACIRLG + VIPVT P +A EFLKK D+ F+SRP+ MSA + S G+ +++  PY
Sbjct  59    EMNTEIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPY  118

Query  430   GEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQA  609
             GE+W K +R+L +++LSP     L+ KR EEAD+L+ +IYN+C       +  +V++R A
Sbjct  119   GEQWKKMKRVLINNLLSPLKHQSLLGKRNEEADNLVFYIYNKC----CKDVNGLVNIRTA  174

Query  610   TRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSI  789
              +HY GNV +K++   RYFG G  DGGPG  + E + A+FTIL+YLY   ++DY+P+L  
Sbjct  175   AQHYGGNVFRKLVLGTRYFGKGMEDGGPGFEEVEHVDAIFTILKYLYAFSISDYVPFLRR  234

Query  790   FDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLS  969
              DLDGH+  I KA+ + +K+ +  + +RI+ W DG KTVE+D++DVL+ LKD   +P+L+
Sbjct  235   LDLDGHRCKIMKAMRIMKKYHEPIIHDRIKQWNDGLKTVEQDLLDVLISLKDAKNKPLLT  294

Query  970   DKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLP  1149
              KEIK Q+ E+ I  +DNPSNA EWALAEM+NQP+LL++A EE+DNVVG+ERLVQESD+ 
Sbjct  295   LKEIKAQITELAIEMVDNPSNAFEWALAEMLNQPELLKRATEELDNVVGKERLVQESDIH  354

Query  1150  NLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWED  1329
              L +++AC +E  RLHP+  F  PH+S  DT+VG Y  PKG+QV++SR  LGRN + W D
Sbjct  355   KLPFVRACAREALRLHPMEYFDVPHVSMTDTMVGDYMFPKGTQVLLSRVALGRNPKFWTD  414

Query  1330  PLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRV  1506
             PLKF P+RHL  G+DVVLT+ +L+ +SFS GRR CPGV LG+ M++ML AR++ GF+W  
Sbjct  415   PLKFNPDRHLKAGDDVVLTEPDLRFISFSTGRRSCPGVVLGTTMTIMLFARMLHGFSWSA  474

Query  1507  PADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             P ++  IDL  S   LFL NPL A+AKPRL
Sbjct  475   PPNVSSIDLVPSDDCLFLANPLLAVAKPRL  504



>gb|KEH34486.1| cytochrome P450 family protein [Medicago truncatula]
Length=533

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/527 (51%), Positives = 380/527 (72%), Gaps = 10/527 (2%)
 Frame = +1

Query  43    SIIFLPLALFTVM-LSVTIQWLIYKTKKWY-GssssslsIPPGPKPWPLVGSIPEILRNK  216
             S ++LP   F +  +++   ++I KT K+Y   + +   +PPGPKPWP+VG++PE+L NK
Sbjct  11    SFLWLPSQSFCLFFINILFGFMIIKTIKYYIVENPNKPKLPPGPKPWPIVGNLPEMLANK  70

Query  217   PAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLIS  396
             PA  WIH  M+E+ TEIACIRLG   VIPVT P +AREFL+K D+ F+SRP  M++ +IS
Sbjct  71    PATSWIHKKMEELNTEIACIRLGNVNVIPVTCPSIAREFLRKHDADFASRPITMASDIIS  130

Query  397   NGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEAS  576
             NGY++S+ +PYGE+W K +++L   + S     WL +KR EEAD+L+ ++YN+C      
Sbjct  131   NGYVTSILVPYGEQWKKMKKVLVKDLFSSRRHQWLQDKRNEEADNLMFYVYNKCN-----  185

Query  577   AMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGL  756
               G +V+VR AT+HYCGNV +K+ FN RYFG G  DGGPG  + E + A F +L  ++  
Sbjct  186   -NGGLVNVRIATQHYCGNVYRKLFFNTRYFGKGMKDGGPGLEEVEHVDAAFVMLNCVFAF  244

Query  757   GVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVK  936
               +DYIP L + DLDGHK  +  A  +   + D+ ++ERI+ W DG+K VE+D++DVL+ 
Sbjct  245   SASDYIPCLRLLDLDGHKGKVKNAKRIINNYHDSLIEERIKQWNDGSKNVEDDLLDVLIT  304

Query  937   LKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVG  1116
             LKD + +P+L+ KEIK Q++E+M+A +DNPSNAVEW LAEM+NQP+L EKA+EE+DN+VG
Sbjct  305   LKDANNKPLLTTKEIKAQIMELMLAFVDNPSNAVEWTLAEMLNQPELFEKAMEELDNIVG  364

Query  1117  RERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRT  1296
             ++R+VQESD+P LN++K C +E FRLHPI  F  PH+S KDT+VG YFIPKGS V++ R+
Sbjct  365   KDRMVQESDIPKLNFLKTCAREAFRLHPITDFNAPHVSIKDTMVGDYFIPKGSHVLLGRS  424

Query  1297  GLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVML  1470
             GLGRN + W +P KFKPERHL  +G ++ LT+ ELK ++FS GRRGCPG+ LGS M++ML
Sbjct  425   GLGRNPKVWTEPYKFKPERHLKNDGSNIALTEPELKFITFSIGRRGCPGIMLGSTMTIML  484

Query  1471  MARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             +ARL+ GFTW +P +   I   ES   + L+ PL  +AKPRL + LY
Sbjct  485   LARLLHGFTWCLPPNTTRIKFVESNGVMVLDEPLTVVAKPRLAAELY  531



>ref|XP_010456404.1| PREDICTED: phenylalanine N-monooxygenase, partial [Camelina sativa]
Length=513

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/490 (55%), Positives = 355/490 (72%), Gaps = 7/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEIL-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPK WPL+G++PEIL RNKP FRWIH +M E+ T+IACIRL  TYVIPVTSP +ARE
Sbjct  25    LPPGPKTWPLIGNLPEILGRNKPVFRWIHSLMKELNTDIACIRLANTYVIPVTSPRIARE  84

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
              LKKQDSIF++RP  M     S GYL+    P GE+W K RR++ SHV S  +    + K
Sbjct  85    ILKKQDSIFATRPLTMGTEYCSRGYLTVAVEPQGEQWKKMRRVVASHVTSKKSFTLTLQK  144

Query  511   RVEEADHLLRFIYNQCKISEASAMG-AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG  687
             R EEAD+ +R+I N   +S  +  G  V+D+R   R Y GNV +KM+F  R+FG G+ DG
Sbjct  145   RTEEADNFVRYINN---LSAKNRNGFGVIDLRLVVRQYSGNVARKMMFGVRHFGKGSEDG  201

Query  688   -GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
              GPG  + E ++++FT+L +LY   ++DY+PWL   DL+GH+ +++ A+    K+ D  V
Sbjct  202   SGPGFEEIEHVESLFTVLTHLYAFALSDYVPWLRFLDLEGHEKVVSDAMKNVSKYNDPFV  261

Query  865   DERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEW  1044
             DER+  W++G     +D +D+ +  KD+DG P LS++EIK QV E+M+A +DNPSNA EW
Sbjct  262   DERLTQWRNGKLKEPKDFLDMFIMAKDSDGNPTLSEEEIKAQVTELMLATVDNPSNAAEW  321

Query  1045  ALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPH  1224
             A+AEMIN+P +++KAVEE+D VVG++RLV ESDLPNLNY+KACVKE FRLHP+APF  PH
Sbjct  322   AMAEMINEPSIMQKAVEEIDTVVGKDRLVLESDLPNLNYVKACVKEAFRLHPVAPFNLPH  381

Query  1225  LSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKM  1401
             +ST + VV GYFIPKGS V+ISR G+GRN   W+ PLKF PERHL N   V L D +L +
Sbjct  382   MSTANAVVDGYFIPKGSHVLISRMGIGRNPSVWDKPLKFDPERHLGNNICVELYDPDLNI  441

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFSAGRRGC GV +GS M+ ML+ARLIQGFTW   +    +DL+ESK DLF+  PL A+
Sbjct  442   ISFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWSPVSGENKVDLSESKSDLFMAKPLHAV  501

Query  1582  AKPRLPSNLY  1611
             A PRL +++Y
Sbjct  502   ATPRLAAHVY  511



>gb|KDP45703.1| hypothetical protein JCGZ_17310 [Jatropha curcas]
Length=519

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/488 (55%), Positives = 356/488 (73%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGPKPWP++G +  + +N+PAFRWIH +M +M TEIACIRLG  +VIPVT P+++ E 
Sbjct  31    LPPGPKPWPIIGCLLAMYKNEPAFRWIHNLMKQMNTEIACIRLGNVHVIPVTCPKISCEI  90

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK QDS F++RP  MS  + S GYL+++  PYG++W K +RIL + +LSPA Q W   KR
Sbjct  91    LKAQDSNFATRPITMSTRVTSKGYLTTVLAPYGDQWKKMKRILVTQMLSPAKQLWFSGKR  150

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
             VE ADHL+R++Y QC      + G +VDVR A RHYCGNV +KM+FNKR+FG G  +GGP
Sbjct  151   VEGADHLVRYVYKQC------SEGGLVDVRIAARHYCGNVIRKMVFNKRFFGKGKKNGGP  204

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  + E + A+F IL Y +   ++DY+P L  FDL GH+ II +A  +  K+ D  ++ R
Sbjct  205   GFEEAEHVDALFRILDYSFSFCLSDYLPCLEGFDLGGHEKIIKEANGIIGKYHDPIIEGR  264

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             +Q WKDG+K  EE+++DVL+ LKD++G P++S  EIK ++ EIM A +DNPSNAVEWA+A
Sbjct  265   VQQWKDGSKKEEEELLDVLITLKDDNGNPLISTDEIKAKITEIMSATVDNPSNAVEWAIA  324

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQPK+ EKA EE+D VVG+ERLVQESDL  LNYI AC +E FRLHP++PF  PH+S 
Sbjct  325   EMINQPKIFEKAAEELDKVVGKERLVQESDLSQLNYITACAREAFRLHPVSPFNIPHVSI  384

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMS  1407
              DT V  YFIPKGS V++SR GLGRN + W++P KFKPERH+  +G  V L +  L  +S
Sbjct  385   TDTTVANYFIPKGSHVLLSRVGLGRNPKIWDEPHKFKPERHIKNDGSQVTLIEPYLNFIS  444

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS GRRGCP V +G+ M++ML ARL+ GFTW VP++   I+L ES+  L L  PL AL K
Sbjct  445   FSTGRRGCPAVTMGTSMTLMLFARLLHGFTWNVPSNQTSIELKESESSLTLAKPLVALVK  504

Query  1588  PRLPSNLY  1611
             PRLP+ +Y
Sbjct  505   PRLPAYVY  512



>gb|KEH34491.1| cytochrome P450 family protein [Medicago truncatula]
Length=539

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/525 (49%), Positives = 376/525 (72%), Gaps = 9/525 (2%)
 Frame = +1

Query  55    LPLALFTVMLSVTIQWLIYKTKKWYGsss-sslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             LP + + ++L +   +++ KT +++   +     +PPGPKPWP+VG+IPE+L NKPA RW
Sbjct  16    LPQSFWHLLLIIFFSFMVIKTIRYHLVENPKKAKLPPGPKPWPIVGNIPEMLANKPATRW  75

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             IH +M+E+ TE+ACIRLG  +VIPVT P +A EFL+K D+ F+SRP  MS  +IS G+L+
Sbjct  76    IHKIMEELNTEVACIRLGNVHVIPVTCPTIALEFLRKNDATFASRPISMSTDIISKGFLT  135

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
             +   P+GE+W K ++I  + + SP    WL NKR EEAD+++ ++YN+CK +  + +   
Sbjct  136   TAVTPFGEQWKKMKKIFVNELFSPHRHQWLTNKRNEEADNIMFYVYNKCKNANDNGL---  192

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADY  771
             V+VR  TRHYC N+ +K++FN RYFG G+ DGGPG  + E + A+FT+LRY++   V+DY
Sbjct  193   VNVRIVTRHYCCNLMRKLVFNTRYFGEGSNDGGPGLEEVEHVDAIFTLLRYVFAFCVSDY  252

Query  772   IPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTV--EEDIVDVLVKLKD  945
             +P+L   D D H+  +  A+++  K+ D  ++ RIQ WKD +KT    ED++D+L+ LKD
Sbjct  253   MPFLRGLDFDDHERRVKDAMSIVDKYNDPIIERRIQKWKDASKTSADSEDLLDILISLKD  312

Query  946   NDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRER  1125
              + +P+L+ +EIK Q LE+++  +DNPS+A E+A+AEMINQP LL++A EE+DNVVG++R
Sbjct  313   ANNKPLLTSEEIKAQALELVLGGVDNPSHAAEFAIAEMINQPDLLQRATEELDNVVGKQR  372

Query  1126  LVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLG  1305
             LVQESD+PNLNY+KAC KE FRLHPI  F PPH++  +  V  Y IPKGS V++S+ GLG
Sbjct  373   LVQESDIPNLNYVKACAKEAFRLHPITIFNPPHVAMDNITVSKYMIPKGSHVLLSKQGLG  432

Query  1306  RNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMAR  1479
             RN + W +P KF+PERHL  +G  VVL++ +LK +SFS GRRGCPG+ LG+ M++ML+ R
Sbjct  433   RNPKVWNEPHKFQPERHLKNDGSMVVLSEPDLKFISFSTGRRGCPGIVLGTSMTMMLLGR  492

Query  1480  LIQGFTWRVPADLPCIDLTE-SKHDLFLENPLFALAKPRLPSNLY  1611
             L+ GF W  P +   I+L + S  D +L  P+ A+AKPRL + LY
Sbjct  493   LLHGFDWSGPPNESTIELLKYSNGDRYLGGPIVAIAKPRLAAELY  537



>gb|KFK24947.1| hypothetical protein AALP_AA8G046600 [Arabis alpina]
Length=535

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/533 (51%), Positives = 372/533 (70%), Gaps = 10/533 (2%)
 Frame = +1

Query  31    LRFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGsssssls--IPPGPKPWPLVGSIPEI  204
             L F+ I+   L  F + L++  +    +TKK    +S   +  +PPGPK WPL+G++PEI
Sbjct  2     LDFTLILAFILGFFILALTMKRK----ETKKAVSMTSYRRNFPLPPGPKSWPLIGNLPEI  57

Query  205   L-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMS  381
             L +NKP +RWIH +M+E+ T+IACIRL  T+VIPVTSP +ARE LK QDSIF++RP  + 
Sbjct  58    LGKNKPVYRWIHSLMEELDTDIACIRLANTHVIPVTSPRIAREILKNQDSIFATRPLTVG  117

Query  382   AGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCK  561
                 S GYL+    P GE+W K RR++ SHV +     W + KR EEAD+L+R+I N+C 
Sbjct  118   TEYCSRGYLTIAVGPQGEQWKKMRRVVASHVTTWKGFVWTLGKRTEEADNLVRYINNRCV  177

Query  562   ISEASAMG-AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-GPGAVDEELLKAVFTI  735
              +  +  G  V+D+R   R Y GNV +KM+F  R+FG G+ DG GPG  + E ++++FT+
Sbjct  178   KNHGNGNGFPVIDLRLVVRQYSGNVARKMMFGVRHFGKGSEDGSGPGFEEIEHVESLFTV  237

Query  736   LRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEED  915
             L +LY   ++DY+PWL   DL+GH+ I++ A+    K+ DT VD+R+  W++G      D
Sbjct  238   LTHLYAFALSDYVPWLRFLDLEGHEKIVSGAMKNLSKYNDTFVDKRLMQWRNGKMKEPRD  297

Query  916   IVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVE  1095
              +D+ +  KDNDG P LSD+EIK QV E+M+  ++NPSNA EWA+AEMIN+P +++KAVE
Sbjct  298   FLDMFIMAKDNDGNPALSDEEIKAQVTELMLTTVNNPSNAAEWAMAEMINEPSIMQKAVE  357

Query  1096  EVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGS  1275
             E+D VVG++R + ESDLPNLNY+KACVKE FRLHP+APF  PH+S  DTVV GYFIPKGS
Sbjct  358   EIDKVVGKDRFILESDLPNLNYVKACVKEAFRLHPVAPFNLPHMSIADTVVDGYFIPKGS  417

Query  1276  QVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGCPGVKLGS  1452
              V+ISR G+GRN   W+ PLKF PERHL N  DV L D +L ++SFSAGRRGC G+ +GS
Sbjct  418   HVLISRMGIGRNSNVWDKPLKFDPERHLGNNVDVELNDPDLNLISFSAGRRGCMGINIGS  477

Query  1453  LMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              M+ ML+ARLIQGFTW +        ++ESK+DLF+  PL A+A PRL   +Y
Sbjct  478   AMTYMLLARLIQGFTWSLMPGEGKNYISESKNDLFMTKPLHAVATPRLAPQVY  530



>ref|XP_007145972.1| hypothetical protein PHAVU_006G002300g [Phaseolus vulgaris]
 gb|ESW17966.1| hypothetical protein PHAVU_006G002300g [Phaseolus vulgaris]
Length=546

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/478 (53%), Positives = 355/478 (74%), Gaps = 3/478 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             ++G++PE+L N+P FRWIH +M EM T+IACIRLG  +VIP+T P +AREFL+KQD+ F+
Sbjct  59    IIGNLPEMLANRPTFRWIHNLMKEMNTQIACIRLGNIHVIPITCPTIAREFLRKQDATFA  118

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  ++  LIS GYL++  +P+GE+W K RRI+++ +LS    H   +KR++EAD+L+ 
Sbjct  119   SRPTSITTSLISRGYLTTTLVPFGEQWKKMRRIVSNELLSTTIHHQFQHKRLQEADNLVF  178

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             +I+N+CK +  + +G +V+VR   +HY  NV K + F++ +FG G  DGGPG  +EE + 
Sbjct  179   YIFNKCKNNVNNDVG-LVNVRHVAQHYSCNVIKSLCFSRNHFGEGKKDGGPGLEEEEHVD  237

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+FT+L+Y+Y   V++Y+P L   DLDGH+S + KA+ +  K+ D  +D+RI+ W DG+K
Sbjct  238   AIFTLLKYIYDFSVSNYVPCLRGLDLDGHESKVKKAIQIINKYHDPIIDQRIKEWNDGSK  297

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
             T  ED +D+L+ LKD +  P+L+ +EIK Q++E+M+AA+DNPSNAVEW+LAEMINQP+LL
Sbjct  298   TDREDFLDILISLKDANKNPVLTAEEIKAQIIELMMAAVDNPSNAVEWSLAEMINQPELL  357

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             ++A +E+D VVG+ERLV+ESD+P LNY+KAC +E FRLHPIAPF  PH+S KDT+VG Y 
Sbjct  358   QQATKELDRVVGKERLVEESDIPKLNYVKACAREAFRLHPIAPFNVPHVSVKDTIVGKYL  417

Query  1261  IPKGSQVIISRTGLGRNKRAWED-PLKFKPERHLNGEDVVLTDSELKMMSFSAGRRGCPG  1437
             IPKGS V++SR  LGRN + W D  LKFKP RHL   DVVLT+ +L  +SFS GRRGCP 
Sbjct  418   IPKGSHVVLSRQELGRNSKVWSDEALKFKPVRHLKS-DVVLTEPDLNFISFSTGRRGCPA  476

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             + LG+ M+V+L ARL+  FTW  P++   I+L ES HD+ L +PL A   PRL   LY
Sbjct  477   IMLGTTMTVILFARLLHSFTWTAPSNASRINLAESHHDILLAHPLLARPNPRLQPQLY  534



>ref|XP_002873202.1| CYP79A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49461.1| CYP79A2 [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/490 (54%), Positives = 352/490 (72%), Gaps = 4/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEIL-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPK WPL+G++P+IL RN+P FRWIH +M E+ T+IACIRL  T+VIPVTSP +ARE
Sbjct  41    LPPGPKSWPLIGNLPDILGRNRPVFRWIHSLMKELNTDIACIRLANTHVIPVTSPRIARE  100

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
              LKKQDS+F++RP  M     S GYL+    P GE+W   RR++ SHV S  +    + K
Sbjct  101   ILKKQDSVFATRPLTMGTEYCSRGYLTVAVEPQGEQWKMMRRVVASHVTSKKSFQLTLQK  160

Query  511   RVEEADHLLRFIYNQCKISEASAMG-AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG  687
             R EEAD+ +R+I N+   +  +  G  V+D+R   R Y GNV +KM+F  R+FG+G+ DG
Sbjct  161   RTEEADNFVRYINNRSVKNRGNGNGFVVIDLRLVVRQYSGNVARKMMFGIRHFGNGSEDG  220

Query  688   -GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
              GPG  + E ++++FT+L +LY   ++DY+PWL   DL+GH+ I++ A+    K+ D  V
Sbjct  221   SGPGFEEIEHVESLFTVLTHLYAFALSDYVPWLRFLDLEGHEKIVSDAMRKVSKYNDPFV  280

Query  865   DERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEW  1044
             DER+  W++G     +D +D+ +  KD DG+P LSD+EIK QV E+M+A +DNPSNA EW
Sbjct  281   DERLMQWRNGNMKEPQDFLDMFIMAKDTDGKPTLSDEEIKAQVTELMLATVDNPSNAAEW  340

Query  1045  ALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPH  1224
             A+AEMIN+P +++KAVEE+D VVG++RLV ESDLPNLNY+KACVKE FRLHP+APF  PH
Sbjct  341   AMAEMINEPSIMQKAVEEIDRVVGKDRLVLESDLPNLNYVKACVKEAFRLHPVAPFNLPH  400

Query  1225  LSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKM  1401
             +ST D VV GYFIPKGS V+ISR G+GRN   W+ PLKF PERHL N   V   + +L +
Sbjct  401   MSTADAVVDGYFIPKGSHVLISRMGIGRNPSVWDKPLKFDPERHLFNNIGVDPNEPDLNI  460

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFSAGRRGC GV +GS M+ ML+ARLIQGFTW        ID++ESK DLF+  PL A+
Sbjct  461   ISFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWSPVPGESKIDISESKSDLFMAKPLHAV  520

Query  1582  AKPRLPSNLY  1611
             A PRL  ++Y
Sbjct  521   ATPRLAPHVY  530



>ref|XP_006464296.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=552

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 349/481 (73%), Gaps = 7/481 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VGS+PE+ RNKP F+WIHG+M E+ T I CIRLG  +VIPVTSPE+A EFLK  DS+F+
Sbjct  73    IVGSLPEMWRNKPTFKWIHGLMRELNTNICCIRLGNVHVIPVTSPEIALEFLKVHDSVFA  132

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M    +S G+LS   +P+G++W K R+++ SHVL       L+ KR EEA+ L+ 
Sbjct  133   SRPLTMGTEYLSGGFLSIAVVPWGQQWKKMRKVVASHVLHSVRLDSLLVKRREEAEELVS  192

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+YNQC     + + +V++VR   R YCGNV +K++F++RYFG G   GGPG  +EE ++
Sbjct  193   FVYNQCI---RNNVDSVINVRLVARRYCGNVIRKIMFSRRYFGEGKNSGGPGFQEEEHVE  249

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L ++Y   ++DYIPWL + DL+GH+ I++ A+    K+ D  +DER++ W+ G K
Sbjct  250   SLFIVLNHIYSFILSDYIPWLRVLDLEGHERIVSDAMRTISKYHDPIIDERVRQWRCGKK  309

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D  +  KD +G+P LS  EIK Q  E+M+A +DNPSNAVEWA+AEMINQP +L
Sbjct  310   KEAEDLLDAFISAKDENGKPWLSVPEIKAQCTELMVATVDNPSNAVEWAIAEMINQPDIL  369

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             +KA +E+D VVG+ RLVQESD+P+LNY+KAC++E FR+HP+ PF  PH+ST D  + GYF
Sbjct  370   KKATDEIDRVVGKGRLVQESDIPHLNYVKACLREAFRIHPVVPFNVPHVSTCDATIAGYF  429

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMSFSAGRRG  1428
             IPKGS V++SR GLGRN   WEDPLKFKPERH+N  D    V LT+ ELK +SFS GRRG
Sbjct  430   IPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTEPELKFISFSRGRRG  489

Query  1429  CPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNL  1608
             C GV LGS M+VML+ARL+ GF W VP++   IDL ESK DLF+  PL A A PRLP+ L
Sbjct  490   CMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSDLFMAKPLHARAMPRLPAEL  549

Query  1609  Y  1611
             Y
Sbjct  550   Y  550



>ref|XP_010110140.1| Isoleucine N-monooxygenase 2 [Morus notabilis]
 gb|EXC25309.1| Isoleucine N-monooxygenase 2 [Morus notabilis]
Length=482

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/481 (53%), Positives = 347/481 (72%), Gaps = 4/481 (1%)
 Frame = +1

Query  175   WPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRL-GGTYVIPVTSPELAREFLKKQDS  351
             WP++G +P +LRN+PA+RWIH +M ++ T+IAC RL G ++VI VTSPE+AREFLKK D+
Sbjct  2     WPILGCVPHMLRNRPAYRWIHRLMKQLNTDIACFRLVGNSHVIAVTSPEIAREFLKKHDA  61

Query  352   IFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADH  531
             +F+ RP  M+  ++S GYL++   P GE+W K RRIL SHVLSP+T  WL++ R +EAD+
Sbjct  62    VFALRPETMATCIVSKGYLTTALCPGGEQWKKMRRILASHVLSPSTMRWLLDMRNQEADN  121

Query  532   LLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEE  711
             L+R++YNQC     +  G VV+VR A +HY  N  ++M+F +RYFG G ADGGPG  +EE
Sbjct  122   LVRYLYNQCS---KNLKGDVVNVRTAAQHYPANAMRRMMFGRRYFGKGRADGGPGLEEEE  178

Query  712   LLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKD  891
              + + FT+L ++Y   V+DY PWL   DLDGH+  +  A+ V  K+ D  + +RIQ W++
Sbjct  179   HVSSFFTMLLHIYAFSVSDYFPWLKSLDLDGHRKKVCDAVKVVDKYHDPIIADRIQEWRE  238

Query  892   GTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQP  1071
             G KT  ED++DVL+ LKD++G P+LS  EI+ ++ EI I  +DNP NA EWAL+EMINQP
Sbjct  239   GKKTQPEDLLDVLISLKDSNGNPLLSKDEIRAKITEIFIETVDNPYNAAEWALSEMINQP  298

Query  1072  KLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVG  1251
              L+EKAVEE+D VVG++RL+QESD+P+L Y  AC +E  RLHP+APF  PH+S+ D  V 
Sbjct  299   NLIEKAVEELDRVVGKDRLLQESDIPHLPYAVACAREALRLHPMAPFNVPHVSSADCTVA  358

Query  1252  GYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKMMSFSAGRRGC  1431
             GYFIPKGS V++SR GLGRN   W+DPL+F PERHL    V L ++EL+ +SF+ GRRGC
Sbjct  359   GYFIPKGSSVLLSRLGLGRNPNVWDDPLRFDPERHLPEGHVDLVETELRFISFTRGRRGC  418

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              G  LGS ++VML+ RL+QGFTW +P  +  IDL      L    PLFA AKPRL  ++Y
Sbjct  419   VGAGLGSNLTVMLLGRLLQGFTWSIPVGVEKIDLCADADSLLKATPLFAHAKPRLNPSVY  478

Query  1612  M  1614
             M
Sbjct  479   M  479



>ref|XP_006464327.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=554

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 351/481 (73%), Gaps = 7/481 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+ RNKP F+WIHG+M E+ T I CIRLG  +VIPVTSPE+A EFLK  DS+F+
Sbjct  75    IVGNLPEMWRNKPTFKWIHGLMRELNTNICCIRLGNVHVIPVTSPEIALEFLKVNDSVFA  134

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M    +S G+LS   +P+G++W K R++++SHVL+    H L+ KR EEAD L+ 
Sbjct  135   SRPLTMGTEYLSGGFLSITVVPWGQQWKKMRKVVSSHVLNSLRLHSLLVKRREEADDLVS  194

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+YNQ      + + +V++VR   R YCGNV +K++F++RYFG G   GGPG  +EE ++
Sbjct  195   FVYNQYF---RNNVDSVINVRLVARRYCGNVIRKIMFSRRYFGEGKDSGGPGFQEEEHVE  251

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L ++Y   ++DYIPWL + DL+GH+ I++ A+    K+ D  +DER++ W+ G K
Sbjct  252   SLFIVLNHIYSFILSDYIPWLRVLDLEGHERIVSDAMRTISKYHDPIIDERVRQWRCGKK  311

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D  +  KD +G+P LS  EIK Q  E+M+A +DNPSNAVEWA+AEMINQP +L
Sbjct  312   KEAEDLLDAFISAKDENGKPWLSVPEIKAQCTELMVATVDNPSNAVEWAIAEMINQPDIL  371

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             +KA +E+D VVG+ RLVQESD+P+LNY+KAC++E FR+HP+ PF  PH+ST D  + GYF
Sbjct  372   KKATDEIDRVVGKGRLVQESDIPHLNYVKACLREAFRIHPVVPFNVPHVSTCDATIAGYF  431

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMSFSAGRRG  1428
             IPKGS V++SR GLGRN   WEDPLKFKPERH+N  D    V LT+ ELK +SFS GRRG
Sbjct  432   IPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTEPELKFISFSRGRRG  491

Query  1429  CPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNL  1608
             C GV LGS M+VML+ARL+ GF W VP++   IDL ESK DLF+  PL A A PRLP+ L
Sbjct  492   CMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSDLFMAKPLHARAMPRLPAEL  551

Query  1609  Y  1611
             Y
Sbjct  552   Y  552



>ref|XP_006428115.1| hypothetical protein CICLE_v10025240mg [Citrus clementina]
 gb|ESR41355.1| hypothetical protein CICLE_v10025240mg [Citrus clementina]
Length=583

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 349/481 (73%), Gaps = 7/481 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VGS+PE+ RNKP F+WIHG+M E+ T I CIRLG  +VIPVTSPE+A EFLK  DS+F+
Sbjct  104   IVGSLPEMWRNKPTFKWIHGLMRELNTNICCIRLGNVHVIPVTSPEIALEFLKVHDSVFA  163

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M    +S G+LS   +P+G++W K R+++ SHVL       L+ KR EEA+ L+ 
Sbjct  164   SRPLTMGTEYLSGGFLSIAVVPWGQQWKKMRKVVASHVLHSVRLDSLLVKRREEAEELVS  223

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+YNQC     + + +V++VR   R YCGNV +K++F++RYFG G   GGPG  +EE ++
Sbjct  224   FVYNQCI---RNNVDSVINVRLVARRYCGNVIRKIMFSRRYFGEGKNSGGPGFQEEEHVE  280

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L ++Y   ++DYIPWL + DL+GH+ I++ A+    K+ D  +DER++ W+ G K
Sbjct  281   SLFIVLNHIYSFILSDYIPWLRVLDLEGHERIVSDAMRTISKYHDPIIDERVRQWRCGKK  340

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D  +  KD +G+P LS  EIK Q  E+M+A +DNPSNAVEWA+AEMINQP +L
Sbjct  341   KEAEDLLDAFISAKDENGKPWLSVPEIKAQCTELMVATVDNPSNAVEWAIAEMINQPDIL  400

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             +KA +E+D VVG+ RLVQESD+P+LNY+KAC++E FR+HP+ PF  PH+ST D  + GYF
Sbjct  401   KKATDEIDRVVGKGRLVQESDIPHLNYVKACLREAFRIHPVVPFNVPHVSTCDATIAGYF  460

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMSFSAGRRG  1428
             IPKGS V++SR GLGRN   WEDPLKFKPERH+N  D    V LT+ ELK +SFS GRRG
Sbjct  461   IPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTEPELKFISFSRGRRG  520

Query  1429  CPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNL  1608
             C GV LGS M+VML+ARL+ GF W VP++   IDL ESK DLF+  PL A A PRLP+ L
Sbjct  521   CMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSDLFMAKPLHARAMPRLPAEL  580

Query  1609  Y  1611
             Y
Sbjct  581   Y  581



>ref|XP_006428111.1| hypothetical protein CICLE_v10025237mg [Citrus clementina]
 gb|ESR41351.1| hypothetical protein CICLE_v10025237mg [Citrus clementina]
Length=585

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 351/481 (73%), Gaps = 7/481 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+ RNKP F+WIHG+M E+ T I CIRLG  +VIPVTSPE+A EFLK  DS+F+
Sbjct  106   IVGNLPEMWRNKPTFKWIHGLMRELNTNICCIRLGNVHVIPVTSPEIALEFLKVNDSVFA  165

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M    +S G+LS   +P+G++W K R++++SHVL+    H L+ KR EEAD L+ 
Sbjct  166   SRPLTMGTEYLSGGFLSITVVPWGQQWKKMRKVVSSHVLNSLRLHSLLVKRREEADDLVS  225

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+YNQ      + + +V++VR   R YCGNV +K++F++RYFG G   GGPG  +EE ++
Sbjct  226   FVYNQ---YFRNNVDSVINVRLVARRYCGNVIRKIMFSRRYFGEGKDSGGPGFQEEEHVE  282

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L ++Y   ++DYIPWL + DL+GH+ I++ A+    K+ D  +DER++ W+ G K
Sbjct  283   SLFIVLNHIYSFILSDYIPWLRVLDLEGHERIVSDAMRTISKYHDPIIDERVRQWRCGKK  342

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++D  +  KD +G+P LS  EIK Q  E+M+A +DNPSNAVEWA+AEMINQP +L
Sbjct  343   KEAEDLLDAFISAKDENGKPWLSVPEIKAQCTELMVATVDNPSNAVEWAIAEMINQPDIL  402

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             +KA +E+D VVG+ RLVQESD+P+LNY+KAC++E FR+HP+ PF  PH+ST D  + GYF
Sbjct  403   KKATDEIDRVVGKGRLVQESDIPHLNYVKACLREAFRIHPVVPFNVPHVSTCDATIAGYF  462

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMSFSAGRRG  1428
             IPKGS V++SR GLGRN   WEDPLKFKPERH+N  D    V LT+ ELK +SFS GRRG
Sbjct  463   IPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTEPELKFISFSRGRRG  522

Query  1429  CPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNL  1608
             C GV LGS M+VML+ARL+ GF W VP++   IDL ESK DLF+  PL A A PRLP+ L
Sbjct  523   CMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSDLFMAKPLHARAMPRLPAEL  582

Query  1609  Y  1611
             Y
Sbjct  583   Y  583



>ref|XP_010543679.1| PREDICTED: phenylalanine N-monooxygenase [Tarenaya hassleriana]
Length=536

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 352/481 (73%), Gaps = 5/481 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             ++G++PEI RNKP FRWIH +M E+ TEIACIRL  T+VIPVTSP +AREFLKKQDS+F+
Sbjct  53    VIGNLPEIRRNKPVFRWIHSLMKELNTEIACIRLANTHVIPVTSPRIAREFLKKQDSVFA  112

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M     S GYL+   +P GE+W K R+++ SHV++  T  W   KR+EEAD+L R
Sbjct  113   SRPLTMGTEYCSRGYLTIAVVPQGEQWKKMRKMVASHVINAKTLQWTHEKRIEEADNLTR  172

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-GPGAVDEELL  717
             FI N+C +  +    A++D+R  TR Y GNV +K+LF  R+FG G  DG GPG  + E +
Sbjct  173   FINNKC-VRNSRDCSALIDLRLVTRQYSGNVARKILFGVRHFGKGTEDGAGPGFEEIEHI  231

Query  718   KAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGT  897
             +++FT+L +LY   ++DY+PWL  FDLDGH+ I+ + +    K+ D  VDER++ W+ G 
Sbjct  232   ESLFTVLTHLYSFILSDYVPWLRTFDLDGHEKIVRRGMEDVSKYNDPFVDERLRQWRHGE  291

Query  898   KTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKL  1077
             +T  +D++D+ +  KD+DG+P L+D EIK QV E+M+A +DNPSNA EWA+AEMIN+P++
Sbjct  292   RTEAQDLLDMFIMAKDSDGKPALTDDEIKAQVTELMLATVDNPSNATEWAMAEMINEPEI  351

Query  1078  LEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGY  1257
             + KA EE+D VVG++RLV ESD+PNL Y+KAC +E FRLHP+APF  PH+S  DTVV GY
Sbjct  352   MRKAAEEIDRVVGKDRLVLESDIPNLTYVKACAREAFRLHPVAPFNLPHVSNADTVVDGY  411

Query  1258  FIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL-NGE-DVVLTDSELKMMSFSAGRRGC  1431
             FIPKGS V++SR GLGRN   W++PL+F+P RHL NG   V L + +L  +SFS GRRGC
Sbjct  412   FIPKGSHVLLSRVGLGRNPSVWDNPLRFEPGRHLRNGNTSVELNEPDLNFLSFSTGRRGC  471

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPC-IDLTESKHDLFLENPLFALAKPRLPSNL  1608
              GV LGS+M++ML+ARL+QGF+W VP      ID++ES+ DLFL  PL A+A PRL   +
Sbjct  472   MGVSLGSVMTIMLLARLVQGFSWTVPGGGEGKIDISESEGDLFLAKPLHAVATPRLAPEV  531

Query  1609  Y  1611
             Y
Sbjct  532   Y  532



>gb|KCW62239.1| hypothetical protein EUGRSUZ_H04899 [Eucalyptus grandis]
Length=531

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 355/485 (73%), Gaps = 12/485 (2%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG    +L NKP FRWIH +M E KTEIACIRLG T++IPVT P +A+EFL+KQDS+F+
Sbjct  51    VVGCALGMLCNKPVFRWIHRLMKEKKTEIACIRLGSTHIIPVTCPTIAQEFLRKQDSLFA  110

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M++G +++ YL++   PYGE+W K RR+L S VL PA   WL +KR EEAD+L++
Sbjct  111   SRPVTMASGTLTSSYLTTALSPYGEQWKKMRRVLVSEVLCPARHKWLHDKRAEEADNLVK  170

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             +++N CK S     G  V++R  TRHYCGNV ++++FNKRYFG G  DGGP   +EE ++
Sbjct  171   YVFNLCKTS-----GHQVNLRATTRHYCGNVARRLMFNKRYFGKGRQDGGPTIDEEEHVE  225

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKD---  891
             A+F  L YLY   V+DY P+L   DLDGH+  + +++   R+  +  + ERI+  +D   
Sbjct  226   AIFNALYYLYAFCVSDYFPFLVGLDLDGHEKKVKESVRTLRRLHEPIISERIKRRRDDLS  285

Query  892   --GTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMIN  1065
                 +   +D++DVL+ LKD+ G+P+L+ +E++ Q +EIMI A+DNPSNAVEWA+AEMIN
Sbjct  286   WESNEKEPQDLLDVLIMLKDSQGKPLLTPEEVRAQTMEIMIEAVDNPSNAVEWAMAEMIN  345

Query  1066  QPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTV  1245
              P+LL KA EE+D VVG+ R VQESD+P LNYIKAC +E FRLHPIAPF  PH++  DT+
Sbjct  346   HPELLNKATEELDRVVGKGRFVQESDIPRLNYIKACAREAFRLHPIAPFNVPHVAMSDTM  405

Query  1246  VGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAG  1419
             V GY IPKGS +++SR GLGRN + W++PLKF P+RH+  +  +VVLT+ +L+ +SFS G
Sbjct  406   VAGYRIPKGSHILLSRVGLGRNPKVWDEPLKFNPDRHITSDQAEVVLTEPDLRFISFSTG  465

Query  1420  RRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLP  1599
             RRGC    LG+ M+VML+ARLIQGF+W  P++L  I+L ES+ DLFL  PL A A+ RLP
Sbjct  466   RRGCMAAALGTTMTVMLLARLIQGFSWSKPSNLSRINLAESRDDLFLAEPLVAQAELRLP  525

Query  1600  SNLYM  1614
             S+LY+
Sbjct  526   SHLYL  530



>ref|XP_004509509.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=532

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/528 (50%), Positives = 370/528 (70%), Gaps = 8/528 (2%)
 Frame = +1

Query  34    RFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRN  213
             + SS +F  L L  ++ +  I++  +K  K    +S   ++PPGPKPWP+ G+IPE+L N
Sbjct  9     QLSSTLFWCLILILLVFTPLIKFF-FKLNKKNIHTSRKFTLPPGPKPWPIFGNIPEMLAN  67

Query  214   KPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLI  393
             +P FRWI  +MD++ TEI CIRLG  +VI V+SPE+ARE   KQD+IF+SR    S   I
Sbjct  68    RPIFRWIQKIMDDLNTEITCIRLGKVHVILVSSPEIAREVFIKQDAIFASRANSWSNAYI  127

Query  394   SNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEA  573
             ++GYL+++F P+G++W K ++++ + ++S     WL  KRVEEAD+L+R +YNQC     
Sbjct  128   TSGYLATIFTPFGKQWKKMKKLIVTELVSSLRHKWLHGKRVEEADNLVRHVYNQC-----  182

Query  574   SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYG  753
             +  G +V+VR  +R Y GNV ++++FN RYFG+G+ DGGPG  + E ++A+FT+L +++ 
Sbjct  183   NKNGGLVNVRDVSRQYSGNVIRRLIFNTRYFGNGSEDGGPGLEEVEYVEAIFTMLEHIFA  242

Query  754   LGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLV  933
               V+D++P L   + DGH++ I KA  + RK+ D  ++ERIQ WK+G KT EED++DVL+
Sbjct  243   FSVSDFMPGLRGVNFDGHENKIKKACQIIRKYHDPIIEERIQQWKNGKKTEEEDLLDVLI  302

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
               KD   + +L+++EIK+ VLE+++AA+DNPSNAVEW LAEM+NQP+LL+KA+EE+D VV
Sbjct  303   SAKDAHNKFLLTEQEIKSCVLELVLAAIDNPSNAVEWGLAEMMNQPELLKKAIEELDTVV  362

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             G+ERLVQE D P LNY+KAC +E FRLHPI  F  PH+S KDTVV  +FIPKGS VI+ R
Sbjct  363   GKERLVQEYDFPKLNYVKACAREAFRLHPINDFNVPHVSMKDTVVSNFFIPKGSHVILRR  422

Query  1294  TGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVM  1467
              GLG N R W++P  FKPERHL  +G ++ L D  L  + FS GRRGCPG+ LG+ M +M
Sbjct  423   QGLGLNPRVWKEPFNFKPERHLKKDGSNLSLEDPSLNSIIFSTGRRGCPGIMLGTSMIIM  482

Query  1468  LMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             L ARL+ GFTW VP +   IDL E+         L A A+PRLP   Y
Sbjct  483   LFARLLHGFTWSVPPNESSIDLFETHGGTTKAKSLVAFAEPRLPPETY  530



>ref|XP_002466099.1| hypothetical protein SORBIDRAFT_01g001200 [Sorghum bicolor]
 sp|Q43135.3|C79A1_SORBI RecName: Full=Tyrosine N-monooxygenase; AltName: Full=Cytochrome 
P450 79A1; AltName: Full=Cytochrome P450Tyr [Sorghum bicolor]
 gb|AAA85440.1| cytochrome P-450 [Sorghum bicolor]
 gb|EER93097.1| hypothetical protein SORBIDRAFT_01g001200 [Sorghum bicolor]
Length=558

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/478 (54%), Positives = 351/478 (73%), Gaps = 8/478 (2%)
 Frame = +1

Query  190   SIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRP  369
             ++PE+L NKPAFRWIH +M EM T+IAC++LGG +V+ +T PE+ARE L+KQD+ F SRP
Sbjct  80    NLPEMLLNKPAFRWIHQMMREMGTDIACVKLGGVHVVSITCPEIAREVLRKQDANFISRP  139

Query  370   RCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIY  549
                ++   S GY +++  PYG++W K RR+LTS ++ P+   WL +KR +EAD+L R++Y
Sbjct  140   LTFASETFSGGYRNAVLSPYGDQWKKMRRVLTSEIICPSRHAWLHDKRTDEADNLTRYVY  199

Query  550   NQCKISEASAMGAV-VDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAV  726
             N   ++  +A G V VDVR   RHYCGNV ++++FN+RYFG   ADGGPG ++   + AV
Sbjct  200   N---LATKAATGDVAVDVRHVARHYCGNVIRRLMFNRRYFGEPQADGGPGPMEVLHMDAV  256

Query  727   FTILRYLYGLGVADYIPWLSIFDLDGHKSIITKA-LAVTRKHLDTQVDERIQMWKDGTKT  903
             FT L  LY   V+DY+PWL   DLDGH+ I+ +A +AV R H DT +D+R + WK G + 
Sbjct  257   FTSLGLLYAFCVSDYLPWLRGLDLDGHEKIVKEANVAVNRLH-DTVIDDRWRQWKSGERQ  315

Query  904   VEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLE  1083
               ED +DVL+ LKD  G P+L+ +E+K Q  +I  AA+DNPSNAVEWALAEM+N P+++ 
Sbjct  316   EMEDFLDVLITLKDAQGNPLLTIEEVKAQSQDITFAAVDNPSNAVEWALAEMVNNPEVMA  375

Query  1084  KAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFI  1263
             KA+EE+D VVGRERLVQESD+P LNY+KAC++E FRLHP+APF  PH++  DT + GY +
Sbjct  376   KAMEELDRVVGRERLVQESDIPKLNYVKACIREAFRLHPVAPFNVPHVALADTTIAGYRV  435

Query  1264  PKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPG  1437
             PKGS VI+SRTGLGRN R W++PL+F P+RHL     DV LT+++L+ +SFS GRRGC  
Sbjct  436   PKGSHVILSRTGLGRNPRVWDEPLRFYPDRHLATAASDVALTENDLRFISFSTGRRGCIA  495

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
               LG+ MSVML  RL+QGFTW  PA +  +DL+ESK D F+  PL   A+PRLP++LY
Sbjct  496   ASLGTAMSVMLFGRLLQGFTWSKPAGVEAVDLSESKSDTFMATPLVLHAEPRLPAHLY  553



>gb|EMT15372.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=534

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/489 (53%), Positives = 354/489 (72%), Gaps = 3/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WPLVGS+PE++ NKPAFRWIH VM +M T+IAC RLGG +V+P+T P++ARE 
Sbjct  41    LPPGPWSWPLVGSLPEMVLNKPAFRWIHRVMKDMGTDIACFRLGGVHVVPITCPKIAREV  100

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKKQD  F SRP   ++  IS GY   +  P+G++W K R++LTS ++ P+   WL +KR
Sbjct  101   LKKQDKNFLSRPLTFASDAISCGYKDVVLTPFGDQWMKMRKVLTSEIICPSRHKWLHDKR  160

Query  514   VEEADHLLRFIYNQCKISEASAMG-AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGG  690
              +EAD+L R+IYN      +S +G A V+VR  TRHYCGNV ++++F +RYFG    DGG
Sbjct  161   ADEADNLTRYIYNLTTGGSSSTLGLANVNVRHVTRHYCGNVIRRLVFGQRYFGEPQPDGG  220

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             PG ++ E + A+FT+L  L+   V+DY+P L + DLDGH+ II +A     +  +  ++E
Sbjct  221   PGPMEVEHMDALFTLLGLLFSFCVSDYLPCLLVLDLDGHEKIIKEANTKVDRLHNMVIEE  280

Query  871   RIQMWKDGTKTVE-EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             R + W  G +    +D++DVL+ L D D +P+L+  E+K Q  +I++AA+DNPSNAVEWA
Sbjct  281   RWRQWNSGERQDGVQDLLDVLIMLADGDSKPLLNIDEVKAQCKDIILAAIDNPSNAVEWA  340

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             LAEM+N P+LL KAVEE+D VVGRER+VQESD+  LNY+KAC++E FR+HP+APF  PH+
Sbjct  341   LAEMVNNPELLAKAVEEMDRVVGRERMVQESDIMQLNYLKACIREAFRVHPVAPFNLPHV  400

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE-DVVLTDSELKMM  1404
             +  DT+V GY +PKGS VI+SR  LGRN   W++PL FKPERH+    +VVLT+SEL+ +
Sbjct  401   AIADTIVAGYRVPKGSHVILSRLALGRNPTVWDEPLHFKPERHMGDNINVVLTESELRFI  460

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGC    LG+ MSVML ARL+ GFTW  PA +  I+L ESKHDLF+E PL   A
Sbjct  461   SFSTGRRGCIAASLGTTMSVMLFARLLHGFTWTKPAGVSAINLRESKHDLFIEKPLVLHA  520

Query  1585  KPRLPSNLY  1611
             +PRL ++LY
Sbjct  521   EPRLATHLY  529



>ref|XP_007207880.1| hypothetical protein PRUPE_ppa021326mg [Prunus persica]
 gb|EMJ09079.1| hypothetical protein PRUPE_ppa021326mg [Prunus persica]
Length=514

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/492 (55%), Positives = 359/492 (73%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP+VG++PE+L NKP FRWIH +M+E  TEIACIRL   +VIPV+ P L+
Sbjct  24    LPPTPKGLRPWPIVGNLPEMLMNKPTFRWIHKLMEESNTEIACIRLANVHVIPVSCPILS  83

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+ F++RP  +S  LI+ GY++++ +P+GE+W K R+++TS +LSP    WL 
Sbjct  84    REILKKQDATFATRPLSISTFLITKGYITTVMVPFGEQWKKMRKVITSELLSPMRHKWLT  143

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KR+EEADHL+R+++NQC   E S    +VD+R AT+HYC NV K+M+FN+RYF     D
Sbjct  144   DKRIEEADHLVRYVFNQCNNEEGSG---IVDLRLATQHYCANVIKRMIFNQRYFTEEMKD  200

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGP   ++  + AVF +LRY+Y    +DYI  L   DLDGH+ II   + +TRK  D  +
Sbjct  201   GGPSVEEQNYVNAVFDMLRYIYAFSASDYISCLRGLDLDGHEKIIKDCIKLTRKRQDPVI  260

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ERI +  K G   V  D++D+L+ LKD  G+P+LS  EIK QV E+++AA+DNPSNA E
Sbjct  261   EERIREHQKLGGNKVSVDLLDILISLKDASGQPLLSPDEIKGQVNEMIMAAVDNPSNAAE  320

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP L EKA +E+D VVG+ER VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  321   WAIAEMINQPHLFEKARQELDAVVGKERQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  380

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS V++SR GLGRN + W++PLK+KPERHL  +G  VVLT+SEL
Sbjct  381   HVSMADTTVGDYFIPKGSHVMLSRIGLGRNPKIWDEPLKYKPERHLKDDGSGVVLTESEL  440

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GFTW  P +   IDLTE+  +L L  PL 
Sbjct  441   RFISFSTGMRGCVASTLGTSMTVMLFARLLHGFTWEAPPNESRIDLTEADGELLLAKPLL  500

Query  1576  ALAKPRLPSNLY  1611
             ALAKPRLP+++Y
Sbjct  501   ALAKPRLPAHVY  512



>ref|XP_008241408.1| PREDICTED: isoleucine N-monooxygenase 2 [Prunus mume]
Length=533

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/480 (53%), Positives = 356/480 (74%), Gaps = 6/480 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VGS+PE+ RN+PA RWIH +M ++ T+IACIRLG  +VIPVTSPE+AREFLKK D++F+
Sbjct  55    IVGSLPEMWRNRPAHRWIHSLMKKLNTDIACIRLGNVHVIPVTSPEIAREFLKKNDAVFA  114

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+   +S+GYL+++  P+G++W K RR+L +   +P+  HWL+ KR EEAD+L++
Sbjct  115   SRPVTMATKTLSSGYLTTVVGPWGDQWRKMRRVLVAEAFNPSRVHWLLGKRNEEADNLVK  174

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+YNQC    A+  GAVV+VR A + Y G++ +KM+FN+ YFG G  DGGPG  +EE + 
Sbjct  175   FLYNQCS---ANQNGAVVNVRIAAQFYSGSIMRKMIFNRTYFGKGREDGGPGVEEEEHVS  231

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+ T+L Y Y   V+DY+PWL +FD+DGH+  + KA+ + +KH +  V+ER+Q W+DG +
Sbjct  232   ALLTLLTYAYAFCVSDYLPWLRVFDIDGHEKKVRKAMNIVKKHQEPIVNERLQEWRDGKR  291

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                +D++DV + LKD +G+P+LSD+EIK Q  E+ ++ +D+P N  EWAL EM+NQP++L
Sbjct  292   NEPDDLLDVFISLKDANGQPLLSDEEIKAQTTELQLSTVDSPFNIAEWALTEMLNQPEML  351

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             +KA EE+D VVG++ LVQES +P+L YI+AC KE  RLHP+ PF  PH+S  D  V GYF
Sbjct  352   KKAEEELDRVVGKKTLVQESHVPHLPYIRACAKEVMRLHPVGPFNLPHVSIADAEVAGYF  411

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN---GEDVVLTDSELKMMSFSAGRRGC  1431
             IPKGS VI+SR  LGRN R WE+PL+F PERHLN    + V L +++L+ +SFS GRRGC
Sbjct  412   IPKGSNVILSRLELGRNPRVWEEPLRFNPERHLNIAVDQQVDLEENDLRFVSFSTGRRGC  471

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              GV LGS + VML+ARL+QGF+W +P D+  ID TE +  L   +PL A AKPRLP+++Y
Sbjct  472   MGVGLGSTIVVMLLARLLQGFSWSLPPDVDKIDFTEDQIYLKKASPLLAQAKPRLPASVY  531



>dbj|BAP15883.1| cytochrome P450 79A68 [Prunus mume]
Length=533

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/480 (53%), Positives = 356/480 (74%), Gaps = 6/480 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VGS+PE+ RN+PA RWIH +M ++ T+IACIRLG  +VIPVTSPE+AREFLKK D++F+
Sbjct  55    IVGSLPEMWRNRPAHRWIHSLMKKLNTDIACIRLGNVHVIPVTSPEIAREFLKKNDAVFA  114

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+   +S+GYL+++  P+G++W K RR+L +   +P+  HWL+ KR EEAD+L++
Sbjct  115   SRPVTMATKTLSSGYLTTVVGPWGDQWRKMRRVLVAEAFNPSRVHWLLGKRNEEADNLVK  174

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+YNQC    A+  GAVV+VR A + Y G++ +KM+FN+ YFG G  DGGPG  +EE + 
Sbjct  175   FLYNQCS---ANQNGAVVNVRIAAQFYSGSIMRKMIFNRTYFGKGREDGGPGVEEEEHVS  231

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+ T+L Y Y   V+DY+PWL +FD+DGH+  + KA+ + +KH +  V+ER+Q W+DG +
Sbjct  232   ALLTLLTYAYAFCVSDYLPWLRVFDIDGHEKKVRKAMNIVKKHQEPIVNERLQEWRDGKR  291

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                +D++DV + LKD +G+P+LSD+EIK Q  E+ ++ +D+P N  EWAL EM+NQP++L
Sbjct  292   NEPDDLLDVFISLKDANGQPLLSDEEIKAQTTELQLSTVDSPFNIAEWALTEMLNQPEML  351

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             +KA EE+D VVG++ LVQES +P+L YI+AC KE  RLHP+ PF  PH+S  D  V GYF
Sbjct  352   KKAEEELDRVVGKKTLVQESHVPHLPYIRACAKEVMRLHPVGPFNLPHVSIADAEVAGYF  411

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN---GEDVVLTDSELKMMSFSAGRRGC  1431
             IPKGS VI+SR  LGRN R WE+PL+F PERHLN    + V L +++L+ +SFS GRRGC
Sbjct  412   IPKGSNVILSRLELGRNPRVWEEPLRFNPERHLNIAVDQQVDLEENDLRFVSFSTGRRGC  471

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              GV LGS + VML+ARL+QGF+W +P D+  ID TE +  L   +PL A AKPRLP+++Y
Sbjct  472   MGVGLGSTIVVMLLARLLQGFSWSLPPDVDKIDFTEDQIYLKKASPLLAQAKPRLPASVY  531



>ref|XP_009125594.1| PREDICTED: phenylalanine N-monooxygenase-like [Brassica rapa]
Length=532

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/490 (53%), Positives = 349/490 (71%), Gaps = 5/490 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEIL-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPK WPLVG++PEIL R +P FRWIH +M+E+ T+IACI L  T VIPVTSP +ARE
Sbjct  42    LPPGPKSWPLVGNLPEILWRKRPVFRWIHAIMEELNTDIACIPLANTNVIPVTSPRIARE  101

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
              LKKQDSIF++RP  M     S GYL+    P GE+W K RR++ SHV S  +  W + K
Sbjct  102   ILKKQDSIFATRPLTMGTEYCSRGYLTIAVEPQGEQWKKMRRVVASHVTSQKSFKWTLEK  161

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-  687
             R EEAD+L+R+I N C  ++ +    V+D+R   R Y GNV + MLF  R+FG G+ DG 
Sbjct  162   RTEEADNLVRYINNLCVKNQGNGF-EVIDLRLVVRQYSGNVARNMLFGVRHFGKGSEDGF  220

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GPG  + E + ++FT++ ++Y   ++DY+PWL   DL+GH+ +++ A+    K+ D+ VD
Sbjct  221   GPGFEEIEHVDSLFTVVTHIYAFALSDYVPWLRFLDLEGHEKVVSGAMRNISKYNDSFVD  280

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQV-LEIMIAALDNPSNAVEW  1044
             +R++ W+DG     +D +D+ +  KD +G P LSD+EIK QV  E+M+A +DNPSNA EW
Sbjct  281   QRLEQWRDGKMKEPQDFLDMFILAKDTNGNPALSDEEIKAQVRYELMLATVDNPSNAAEW  340

Query  1045  ALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPH  1224
             A+AEMINQP +++KAVEE+D VVG++R V ESD+ NLNY+KACVKE FRLHP+APF   H
Sbjct  341   AMAEMINQPNIMQKAVEEIDRVVGKDRFVLESDISNLNYVKACVKEAFRLHPVAPFNLTH  400

Query  1225  LSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKM  1401
             +ST D VV GYFIPKGS V+ISR G+GRN   W+ PLKF PERH+ N ++V L D +L +
Sbjct  401   MSTADAVVDGYFIPKGSHVLISRLGIGRNPNVWDKPLKFDPERHMGNNKNVELNDPDLNI  460

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFSAGRRGC G  +GS M+ ML+ARLIQGFTW        ID++ESK DLF+  PL A+
Sbjct  461   ISFSAGRRGCMGSNIGSAMTYMLLARLIQGFTWSSVHGEDKIDISESKSDLFMAKPLHAI  520

Query  1582  AKPRLPSNLY  1611
             A PRL   +Y
Sbjct  521   ATPRLAPQIY  530



>ref|XP_004237294.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=443

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/459 (59%), Positives = 343/459 (75%), Gaps = 21/459 (5%)
 Frame = +1

Query  253   MKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYG  432
             M TEIACIR G   VIPVTSPELA EFLK QDS+FSSRP CMSA L++NG+L+S+FLP G
Sbjct  1     MDTEIACIRFGNFNVIPVTSPELACEFLKTQDSVFSSRPLCMSASLVNNGFLTSIFLPSG  60

Query  433   EEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQAT  612
             ++W K RRIL SHVLSP +  WL +KR EEADHL RFIYNQ           V++VR+ T
Sbjct  61    DQWMKMRRILASHVLSPTSLQWLRHKRDEEADHLNRFIYNQ----------PVLNVRKLT  110

Query  613   RHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIF  792
             R+YCGNV K M+F+KR         G    +EE + AVFT++ Y+Y  GV+DY+P LS+F
Sbjct  111   RYYCGNVVKNMIFSKRSLF------GIIEKEEEQIDAVFTLIEYVYSFGVSDYLPCLSVF  164

Query  793   DLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSD  972
             DL G K+II KA  +  K +D +VD RIQ+WKDG KT++EDI+DVL+ LKD +G P+++ 
Sbjct  165   DLGGDKAIIMKAYDIATKQIDIEVDHRIQIWKDGNKTLKEDILDVLIMLKDINGNPLMNV  224

Query  973   KEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPN  1152
             KEIK QVLE+ +A +DNPSNAVEW LAE++NQPKL++KA+EE++ +VG  RLVQESDLP 
Sbjct  225   KEIKAQVLELFLAIVDNPSNAVEWTLAELLNQPKLMQKAIEELNIIVGINRLVQESDLPR  284

Query  1153  LNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVG-GYFIPKGSQVIISRTGLGRNKRAWED  1329
             LNY+KAC+KE FRLHPI  F  PH+S  DT++   YFI KGS VI+SR GLGRN R W+D
Sbjct  285   LNYVKACIKETFRLHPIVAFNVPHVSVSDTIISEKYFIAKGSVVILSRLGLGRNPRVWKD  344

Query  1330  PLKFKPERHL---NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTW  1500
             PLKF PERHL   +G +VVLTDS+L+++SFS GRRGCPGVKLGS ++ ML+ARL+QGFTW
Sbjct  345   PLKFNPERHLKMKDGSEVVLTDSKLRLLSFSLGRRGCPGVKLGSTITTMLLARLLQGFTW  404

Query  1501  RVPADLPCIDLTESKH-DLFLENPLFALAKPRLPSNLYM  1614
              +P + PC DL +S   + +   P  A AK RL  ++Y+
Sbjct  405   TLPPNSPCNDLIKSSQTNNYCTLPFVAHAKERLAKDMYV  443



>ref|XP_004509430.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=531

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/528 (50%), Positives = 369/528 (70%), Gaps = 8/528 (2%)
 Frame = +1

Query  34    RFSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRN  213
             + S  +F  L L  ++ +  I+ L  K  K    +S   ++PPGPKPWP+ G+IPE+L N
Sbjct  9     QLSPTLFWCLILMLLVFTSLIK-LFLKLNKKNIHTSRKFTLPPGPKPWPIFGNIPEMLAN  67

Query  214   KPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLI  393
             +P FRWI  +MD++ TEI CIRLG  +VI V+SPE+ARE   KQD+IF+SR    S   I
Sbjct  68    RPIFRWIQKIMDDLNTEITCIRLGKVHVILVSSPEIAREVFIKQDAIFASRANSWSNAYI  127

Query  394   SNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEA  573
             ++GYL+++F P+G++W K ++++   ++S     WL  KRVEEAD+L+R +YNQC     
Sbjct  128   TSGYLATIFTPFGKQWKKMKKLIVKELVSSLRHKWLHGKRVEEADNLVRHVYNQC-----  182

Query  574   SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYG  753
             +  G +V+VR  +R Y GNV ++++FN RYFG+G+ DGGPG  + E ++A+FT+L +++ 
Sbjct  183   NKNGGLVNVRDVSRQYSGNVIRRLIFNTRYFGNGSEDGGPGLEEVEYVEAIFTMLEHIFA  242

Query  754   LGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLV  933
               V+D++P L   + DGH++ I KA  + RK+ D  ++ERIQ WK+G KT EED++DVL+
Sbjct  243   FSVSDFMPGLRGVNFDGHENKIKKACQIIRKYHDPIIEERIQQWKNGKKTEEEDLLDVLI  302

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
               KD   + +L+++EIK+ VLE+++AA+DNPSNA EW LAEM+NQP+LL+KA+EE+D+VV
Sbjct  303   SAKDAHNKFLLTEQEIKSCVLELVLAAVDNPSNAFEWGLAEMMNQPELLKKAIEELDSVV  362

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             G+ERLVQE D P LNY+KAC KE FRLHPI+ F  PH++ KDTVV  Y IPK SQVI+ R
Sbjct  363   GKERLVQEYDFPKLNYVKACAKEAFRLHPISDFLIPHVAMKDTVVANYIIPKDSQVILRR  422

Query  1294  TGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVM  1467
              G+G N R WE+PLKFKPER+L  NG ++ L D+ L  + FS GRRGCPG+ LG+ M++M
Sbjct  423   QGIGLNPRVWEEPLKFKPERYLKENGSNLSLADTSLDTIIFSTGRRGCPGIMLGTSMTIM  482

Query  1468  LMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             L AR + GFTW VP     IDL+E+         L A  +PRLP   Y
Sbjct  483   LFARFLHGFTWSVPPKESSIDLSETHGGTTKAKSLVAFVEPRLPPETY  530



>gb|ACR10256.1| cytochrome P450 79a2 [Brassica rapa subsp. pekinensis]
Length=529

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/489 (53%), Positives = 348/489 (71%), Gaps = 6/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEIL-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPK WPLVG++PEIL R +P FRWIH +M+E+ T+IACI L  T VIPVTSP +ARE
Sbjct  42    LPPGPKSWPLVGNLPEILWRKRPVFRWIHAIMEELNTDIACIPLANTNVIPVTSPRIARE  101

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
              LKKQDSIF++RP  M     S GYL+    P GE+W K RR++ SHV S  +  W + K
Sbjct  102   ILKKQDSIFATRPLTMGTEYCSRGYLTIAVEPQGEQWKKMRRVVASHVTSQKSFKWTLEK  161

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-  687
             R EEAD+L+R+I N C  ++ +    V+D+R   R Y GNV + MLF  R+FG G+ DG 
Sbjct  162   RTEEADNLVRYINNLCVKNQGNGF-EVIDLRLVVRQYSGNVARNMLFGVRHFGKGSEDGF  220

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GPG  + E + ++FT++ ++Y   ++DY+PWL   DL+GH+ +++ A+    K+ D+ VD
Sbjct  221   GPGFEEIEHVDSLFTVVTHIYAFALSDYVPWLRFLDLEGHEKVVSGAMRNISKYNDSFVD  280

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             +R++ W+DG     +D +D+ +  KD +G P LSD+EIK Q  E+M+A +DNPSNA EWA
Sbjct  281   QRLEQWRDGKMKEPQDFLDMFILAKDTNGNPALSDEEIKAQ--ELMLATVDNPSNAAEWA  338

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             +AEMINQP +++KAVEE+D VVG++R V ESD+ NLNY+KACVKE FRLHP+APF   H+
Sbjct  339   MAEMINQPNIMQKAVEEIDRVVGKDRFVLESDISNLNYVKACVKEAFRLHPVAPFNLTHM  398

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKMM  1404
             ST D VV GYFIPKGS V+ISR G+GRN   W+ PLKF PERH+ N ++V L D +L ++
Sbjct  399   STADAVVDGYFIPKGSHVLISRLGIGRNPNVWDKPLKFDPERHMGNNKNVELNDPDLNII  458

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFSAGRRGC G  +GS M+ ML+ARLIQGFTW        ID++ESK DLF+  PL A+A
Sbjct  459   SFSAGRRGCMGSNIGSAMTYMLLARLIQGFTWSSVHGEDKIDISESKSDLFMAKPLHAIA  518

Query  1585  KPRLPSNLY  1611
              PRL   +Y
Sbjct  519   TPRLAPQIY  527



>ref|XP_010059403.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=528

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/484 (54%), Positives = 348/484 (72%), Gaps = 13/484 (3%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             ++G  PE+LRNKPA RWI   M+EM TEI+C R+G T VIPVT P++AREFLKKQD+ F 
Sbjct  49    VIGCAPEMLRNKPAARWILRWMEEMDTEISCFRIGNTNVIPVTDPKIAREFLKKQDATFM  108

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+A   S GY++++  PYGE+W K RR+LTS ++ PA   WL +KR EEAD+LL+
Sbjct  109   SRPISMAAWAFSGGYMTTVMSPYGEQWKKMRRVLTSEIICPARHKWLHDKRAEEADNLLK  168

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
              ++NQCK          V++R  TRHYCGNV ++++FNKRYFG G  DGGP   +E+ + 
Sbjct  169   HVFNQCKSP------GQVNLRHVTRHYCGNVIRRLVFNKRYFGKGRQDGGPTIDEEQHVD  222

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+F  L YLY   V+DY P+L   DLDGH+ ++       R+  D  ++ERI+ W+D   
Sbjct  223   ALFNALNYLYAFCVSDYFPFLVGLDLDGHEKVVKDCTMTFRRLHDPIINERIKQWRDNLS  282

Query  901   TVE-----EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMIN  1065
             +       +D++DVL+ LKD+ G+P+L+  EIK Q  E+++AA+DNPSNAVEWA+AE+IN
Sbjct  283   SESNGKEPQDLLDVLITLKDSKGKPLLTPHEIKAQATEMLMAAVDNPSNAVEWAMAEVIN  342

Query  1066  QPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTV  1245
             +P+LL KA EE+D VVG+ERLVQESD+P LNYIKAC +E FRLHPIAPF  PH++  D V
Sbjct  343   RPELLNKAKEEIDRVVGKERLVQESDIPQLNYIKACGREAFRLHPIAPFNVPHVALSDAV  402

Query  1246  VGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAG  1419
             V GY IPKGS +++SR GLGRN   W++P KFKPERH+ G+  +VVLT+ +L+ +SFS+G
Sbjct  403   VAGYHIPKGSHILVSRMGLGRNPEVWDEPTKFKPERHIMGDAVEVVLTEPDLRFISFSSG  462

Query  1420  RRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLP  1599
             RRGC   +LG+ M+VML+ARLIQGF W  P ++  I L ES+ DL L  PL   A+PRLP
Sbjct  463   RRGCIAAQLGTTMTVMLLARLIQGFNWSTPPNIYSISLNESRDDLSLAEPLVLQAEPRLP  522

Query  1600  SNLY  1611
             + LY
Sbjct  523   NYLY  526



>ref|XP_006484922.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=556

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/487 (53%), Positives = 349/487 (72%), Gaps = 13/487 (3%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+ R KPAF WIH VM E+ T+IACIRLG  +VIPVTSPE+A E LK  DS+F+
Sbjct  72    IVGNLPEMWRKKPAFNWIHDVMKELNTDIACIRLGNVHVIPVTSPEIALEVLKDNDSVFA  131

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             +RP  M     S  +LS   +P G++W K R+++ SHVL  A  H L+ KR EEAD+L+R
Sbjct  132   TRPLTMGTEYSSRRFLSIAVVPLGQQWKKMRKVVASHVLCSARLHSLLFKRREEADNLVR  191

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+Y+QC        G+VV+VR A R YCGNV + M+FN+RYFG G  DGGPG  +EE ++
Sbjct  192   FVYSQCC---KRGSGSVVNVRHAARQYCGNVMRNMMFNRRYFGEGNEDGGPGFEEEEHVE  248

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L+YLY   ++DY+PW+ +FDL+GH+ +I+ A+    K+ D  ++ERIQ  +    
Sbjct  249   SLFIVLQYLYAFTLSDYLPWMRVFDLEGHEKLISNAIRTVSKYHDPIIEERIQQRRHHRG  308

Query  901   TVE------EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMI  1062
               +      +D++DVL+  KD  GRP LS  EIK Q +++M+A +DNPSNA+EWAL EMI
Sbjct  309   NYKKESDDHQDLLDVLISAKDESGRPSLSVDEIKAQCMDLMLATVDNPSNALEWALGEMI  368

Query  1063  NQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDT  1242
             NQP++L++A EEVD VVG+ERLVQE D+P LNY+KAC++E  RLHP+APF  PH+ST+D 
Sbjct  369   NQPEILKRATEEVDMVVGKERLVQEYDIPQLNYVKACLREALRLHPVAPFNLPHVSTRDA  428

Query  1243  VVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMSF  1410
              + GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D    V LT+ EL+ +SF
Sbjct  429   TIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVELTEPELRFVSF  488

Query  1411  SAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKP  1590
             S GRRGC G  LGS MSV+L+ARL+QGF W +P++   IDL ESK+DL +  P+ A AKP
Sbjct  489   SRGRRGCMGAALGSEMSVILLARLLQGFDWSLPSNEEKIDLAESKYDLLMAKPMHASAKP  548

Query  1591  RLPSNLY  1611
             RL + LY
Sbjct  549   RLAAELY  555



>gb|EMT13826.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=534

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/489 (53%), Positives = 351/489 (72%), Gaps = 3/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WPLVGS+PE++ NKPAFRWIH VM +M T+IAC RLGG +VIP+T P++ARE 
Sbjct  41    LPPGPWSWPLVGSLPEMMLNKPAFRWIHRVMKDMGTDIACFRLGGVHVIPITCPKIAREV  100

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKKQD  F SRP   ++  IS GY  ++  P G++W K R++LTS ++ P+   WL +KR
Sbjct  101   LKKQDKNFLSRPLTFASDAISCGYKDAVLTPVGDQWMKMRKVLTSEIICPSRHKWLHDKR  160

Query  514   VEEADHLLRFIYNQCKISEASAMG-AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGG  690
              +EAD+L R+IYN   +  +S +G A ++VR  T+HYCGNV +++ F +RYF     DGG
Sbjct  161   ADEADNLTRYIYNLTAVGSSSTLGLANINVRHVTQHYCGNVIRRLAFGQRYFEEPQPDGG  220

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             PG ++ E + A FT+L  L+   V+DY+  L   DLDGH+ II +A     +  +  ++E
Sbjct  221   PGPMEVEHMDASFTLLGLLFSFCVSDYLSCLLGLDLDGHEKIIKEANTKVDRLHNMVIEE  280

Query  871   RIQMWKDGTKTVE-EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             R + W +G +    +D +D+L+ L D DG+P+LS  E+K Q  +I++AA+DNPSNAVEWA
Sbjct  281   RWRQWNNGERQDGVQDFLDILITLVDGDGKPLLSIDEVKAQCKDIILAAIDNPSNAVEWA  340

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             LAEM+N P+LL KAVEE+D VVGRERLVQESD+  LNY+KAC++E FRLHP+APF  PH+
Sbjct  341   LAEMVNSPELLAKAVEEMDQVVGRERLVQESDIMQLNYLKACIREAFRLHPVAPFNVPHV  400

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE-DVVLTDSELKMM  1404
             +  DT+V GY +PKGS VI+SR  LG+N   W++PL FKPERH+    +VVLT+SEL+ +
Sbjct  401   AIADTIVAGYRVPKGSHVILSRLALGQNPTVWDEPLHFKPERHMGDNINVVLTESELRFI  460

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGC    LG+ MSVML  RL+ GFTW  PA +P I+L ESKHDLF+E PL   A
Sbjct  461   SFSTGRRGCIAASLGTTMSVMLFGRLLHGFTWTKPAGVPAINLRESKHDLFIEKPLVLHA  520

Query  1585  KPRLPSNLY  1611
             +PRL ++LY
Sbjct  521   EPRLAAHLY  529



>ref|XP_010526660.1| PREDICTED: tryptophan N-monooxygenase 1-like [Tarenaya hassleriana]
Length=531

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/489 (51%), Positives = 355/489 (73%), Gaps = 9/489 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG +P +L  +P FRW+HG+M+++ TEIACIRLG TYVIPVT P++ARE 
Sbjct  45    LPPGPTGWPIVGMVPAMLNRRPVFRWLHGLMNQLNTEIACIRLGNTYVIPVTCPQIAREM  104

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
              K+QD+IF+SRP   +  ++SNGY + +  P+GE++ K RR++ + ++ PA   WL +KR
Sbjct  105   FKQQDAIFASRPLSYAQKVLSNGYKTCVITPFGEQFKKMRRVVMTEIVCPARHRWLHDKR  164

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSG--AADG  687
              EE DHL  ++YN  K S        +D R  +RHYCGNV KK+ F  R FG G  A DG
Sbjct  165   AEETDHLTAWLYNMVKNSNP------IDFRFVSRHYCGNVIKKLFFGTRTFGLGNMAEDG  218

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GP A D E ++A+F  L + +   ++D++PWL+  DL+GH+ I+ +A AV  K+ D  VD
Sbjct  219   GPTAEDIEHMEAMFDGLGFTFAFCISDFLPWLTGLDLNGHEKIMRRASAVMDKYHDPIVD  278

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             ERI+MW++G +T  ED +DV + LKD DG+P+L+  EIK  + E+++AA DNPSNAVEW 
Sbjct  279   ERIKMWREGERTQVEDFLDVFISLKDEDGKPLLTPDEIKPTLKELVMAAPDNPSNAVEWT  338

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             +AEM+N+P++L+KA+EE+D VVG++RLVQESD+P LNY+KAC++E FRLHP+A F  PH+
Sbjct  339   MAEMVNKPEILKKAMEEIDMVVGKDRLVQESDIPKLNYVKACLRESFRLHPVAAFNLPHV  398

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMM  1404
             +  DT V G+ +PKGSQV++SR GLGRN + W DPL FKPERH+N   +V L +++L+ +
Sbjct  399   ALSDTTVAGFHVPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHMNECSEVTLIENDLRFI  458

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGC    LG++++ ML+AR++QGFTW++P     ++L ES HDLFL  PL  + 
Sbjct  459   SFSTGRRGCAAPALGTVITTMLLARVLQGFTWKLPEGETRVELVESSHDLFLAKPLVMVG  518

Query  1585  KPRLPSNLY  1611
             +PRL  +LY
Sbjct  519   EPRLAQHLY  527



>gb|ADM34983.1| CYP79D16 [Prunus dulcis]
Length=534

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/492 (55%), Positives = 358/492 (73%), Gaps = 9/492 (2%)
 Frame = +1

Query  154   IPPGPK---PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELA  324
             +PP PK   PWP+VG++PE+L NKP FRWIH +M+E  TEIACIRL   +VIPV+ P L+
Sbjct  44    LPPTPKGLRPWPIVGNLPEMLMNKPTFRWIHKLMEESNTEIACIRLANVHVIPVSCPILS  103

Query  325   REFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLV  504
             RE LKKQD+ F++RP  +S  LI+ GY++++ +P+GE+W K R+++TS +LSP    WL 
Sbjct  104   REILKKQDATFATRPLSISTFLITKGYITTVMVPFGEQWKKMRKVITSELLSPMRHKWLT  163

Query  505   NKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAAD  684
             +KR+EEADHL+R+++NQC   E      +VD+R AT+HYC NV K+M+FN+RYF     D
Sbjct  164   DKRIEEADHLVRYVFNQCNNEEGRG---IVDLRLATQHYCANVIKRMIFNQRYFTEEMKD  220

Query  685   GGPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQV  864
             GGP   ++  + AVF +LRY+Y    +DYI  L   DLDGH+ II   + +TRK  D  +
Sbjct  221   GGPSVEEQNYVNAVFDMLRYIYAFSASDYISCLRGLDLDGHEKIIKDCIKLTRKRQDPVI  280

Query  865   DERI-QMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVE  1041
             +ERI +  K G   V  D++D+L+ LKD  G+P+LS  EIK QV E+++AA+DNPSNA E
Sbjct  281   EERIREHQKLGGNKVPVDLLDILISLKDASGQPLLSPDEIKGQVNEMIMAAVDNPSNAAE  340

Query  1042  WALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPP  1221
             WA+AEMINQP L EKA +E+D VVG+ER VQESDL  LN++KAC +E FRLHP+APF  P
Sbjct  341   WAIAEMINQPHLFEKARQELDAVVGKERQVQESDLSQLNFVKACAREAFRLHPVAPFNVP  400

Query  1222  HLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSEL  1395
             H+S  DT VG YFIPKGS V++SR GLGRN + W++PLK+KPERHL  +G  VVLT+SEL
Sbjct  401   HVSMADTTVGDYFIPKGSHVMLSRIGLGRNPKIWDEPLKYKPERHLKDDGSGVVLTESEL  460

Query  1396  KMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLF  1575
             + +SFS G RGC    LG+ M+VML ARL+ GFTW  P +   IDLTE+  +L L  PL 
Sbjct  461   RFISFSTGMRGCVASTLGTSMTVMLFARLLHGFTWEAPPNESRIDLTEAGGELLLAKPLL  520

Query  1576  ALAKPRLPSNLY  1611
             ALAKPRLP+++Y
Sbjct  521   ALAKPRLPAHVY  532



>gb|KHN24731.1| Isoleucine N-monooxygenase 1 [Glycine soja]
Length=508

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/480 (52%), Positives = 348/480 (73%), Gaps = 6/480 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++P++L NKP F WIH +M EMKTEIACIRLG  +VIPVT P +A EFL+K D  F+
Sbjct  30    IVGNLPQMLANKPVFCWIHNLMQEMKTEIACIRLGNVHVIPVTCPSIACEFLRKHDVDFA  89

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+  ++S+GY++   +P+GE+W K RRI+ + + SP    WL  KR  EAD+++ 
Sbjct  90    SRPLTMATDIMSSGYVTIAIVPFGEQWKKMRRIVVNELFSPLRHQWLQGKRNGEADNIMF  149

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YN+CK       G +V+VR   +HYC NVT+K++FN RYFG G  DGGPG  + E + 
Sbjct  150   YVYNKCKNVNN---GGLVNVRDVAQHYCCNVTRKLIFNTRYFGKGREDGGPGLEEVEHVN  206

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
              +FT+L+++Y   V+DYIP L I DLDGHKS + K +   +K+ D  +++R++ W DG+K
Sbjct  207   TIFTLLKHVYAFSVSDYIPCLRILDLDGHKSKVKKGMRTMKKYHDPIIEKRMKQWNDGSK  266

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
             TVEED++DVL+ LKD +  P L+ KEIK   +E+M+   DNPSNAVE ALAEMINQP +L
Sbjct  267   TVEEDLLDVLISLKDVNNNPTLTLKEIKALTIELMLGGADNPSNAVECALAEMINQPYIL  326

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             ++A EEVD VVG++R+VQESD+ NLNY+KACV+E FRLHP+ PF PPH+ST DT+VG YF
Sbjct  327   QQATEEVDKVVGKQRMVQESDITNLNYVKACVREAFRLHPVVPFNPPHVSTNDTMVGNYF  386

Query  1261  IPKGSQVIISRTGLGRNKRAWED-PLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGC  1431
             IPKGS V++SR GLGRN + W + P KFKPERH+  +G  +VL++ +LK +SF  GRRGC
Sbjct  387   IPKGSHVLLSRHGLGRNLKVWNNEPHKFKPERHIKNDGSMIVLSEPDLKFISFGTGRRGC  446

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             P + LGS M+VML+ARL+  F+W  P ++  ++L ++ + + L  PL  +AKPRL    Y
Sbjct  447   PAIVLGSTMTVMLLARLVHAFSWSAPPNVSSVNLVKANNGVMLLEPLVLVAKPRLTPGFY  506



>ref|XP_007203073.1| hypothetical protein PRUPE_ppa023521mg, partial [Prunus persica]
 gb|EMJ04272.1| hypothetical protein PRUPE_ppa023521mg, partial [Prunus persica]
Length=493

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/480 (53%), Positives = 353/480 (74%), Gaps = 6/480 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG +PE+ RN+PA RWIH +M ++ T+IACIRLG  +VIPVTSPE+AREFLKK D++F+
Sbjct  15    IVGCLPEMWRNRPAHRWIHSLMKKLNTDIACIRLGNVHVIPVTSPEIAREFLKKNDAVFA  74

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+   +S+GYL+++  P+G++W K RR+L +   +P+  HWL+ KR EEAD+L++
Sbjct  75    SRPVTMATKTLSSGYLTTVVGPWGDQWRKMRRVLVADAFNPSRVHWLLGKRNEEADNLVK  134

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+YNQC    A+  GAVV+VR A + Y G++ +KM+FN+ YFG G  DGGPG  +EE + 
Sbjct  135   FLYNQCS---ANQNGAVVNVRIAAQFYSGSIMRKMIFNRTYFGKGREDGGPGVEEEEHVS  191

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+ T+L Y Y   ++DY+PWL IFD+DGH+  + KA+ + +KH +  V+ER+Q W+DG +
Sbjct  192   ALLTLLTYAYAFCLSDYLPWLRIFDIDGHEKKVRKAMNIVKKHQEPIVNERLQEWRDGKR  251

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                +D++DV + LKD +G+P+LSD+EIK Q  E+ ++ +D+P N  EWAL EM+NQP++L
Sbjct  252   NEPDDLLDVFISLKDANGQPLLSDEEIKAQTTELQLSTVDSPFNVAEWALTEMLNQPEML  311

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             +KA EE+D VVG++ LVQES +P+L YI+AC KE  RLHP+ PF  PH+S  D  V GY 
Sbjct  312   KKAEEELDRVVGKKTLVQESHVPHLPYIRACAKEVMRLHPVGPFNLPHVSIADAEVAGYL  371

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN---GEDVVLTDSELKMMSFSAGRRGC  1431
             IPKGS VI+SR  LGRN R WE PL+F PERHLN    + V L +++L+ +SFS GRRGC
Sbjct  372   IPKGSNVILSRLELGRNPRVWEQPLRFNPERHLNRAVNQQVDLEENDLRFVSFSTGRRGC  431

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              GV LGS + VML+ARL+QGF+W +P D+  ID TE +  L   +PL A AKPRLP+++Y
Sbjct  432   MGVGLGSTIVVMLLARLLQGFSWSLPPDVDKIDFTEDQIYLKKASPLLAQAKPRLPASVY  491



>ref|XP_006591735.1| PREDICTED: isoleucine N-monooxygenase 1-like [Glycine max]
Length=529

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/480 (52%), Positives = 348/480 (73%), Gaps = 6/480 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++P++L NKP F WIH +M EMKTEIACIRLG  +VIPVT P +A EFL+K D  F+
Sbjct  51    IVGNLPQMLANKPVFCWIHNLMQEMKTEIACIRLGNVHVIPVTCPSIACEFLRKHDVNFA  110

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+  ++S+GY++   +P+GE+W K RRI+ + + SP    WL  KR  EAD+++ 
Sbjct  111   SRPLTMATDIMSSGYVTIAIVPFGEQWKKMRRIVVNELFSPLRHQWLQGKRNGEADNIMF  170

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             ++YN+CK       G +V+VR   +HYC NVT+K++FN RYFG G  DGGPG  + E + 
Sbjct  171   YVYNKCKNVNN---GGLVNVRDVAQHYCCNVTRKLIFNTRYFGKGREDGGPGLEEVEHVN  227

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
              +FT+L+++Y   V+DYIP L I DLDGHKS + K +   +K+ D  +++R++ W DG+K
Sbjct  228   TIFTLLKHVYAFSVSDYIPCLRILDLDGHKSKVKKGMRTMKKYHDPIIEKRMKQWNDGSK  287

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
             TVEED++DVL+ LKD +  P L+ KEIK   +E+M+   DNPSNAVE ALAEMINQP +L
Sbjct  288   TVEEDLLDVLISLKDVNNNPTLTLKEIKALTIELMLGGADNPSNAVECALAEMINQPYIL  347

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
             ++A EEVD VVG++R+VQESD+ NLNY+KACV+E FRLHP+ PF PPH+ST DT+VG YF
Sbjct  348   QQATEEVDKVVGKQRMVQESDITNLNYVKACVREAFRLHPVVPFNPPHVSTNDTMVGNYF  407

Query  1261  IPKGSQVIISRTGLGRNKRAWED-PLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGC  1431
             IPKGS V++SR GLGRN + W + P KFKPERH+  +G  +VL++ +LK +SF  GRRGC
Sbjct  408   IPKGSHVLLSRHGLGRNLKVWNNEPHKFKPERHIKNDGSMIVLSEPDLKFISFGTGRRGC  467

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             P + LGS M+VML+ARL+  F+W  P ++  ++L ++ + + L  PL  +AKPRL    Y
Sbjct  468   PAIVLGSTMTVMLLARLVHAFSWSAPPNVSSVNLVKANNGVMLLEPLVLVAKPRLTPGFY  527



>ref|XP_006289651.1| hypothetical protein CARUB_v10003209mg [Capsella rubella]
 gb|EOA22549.1| hypothetical protein CARUB_v10003209mg [Capsella rubella]
Length=527

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/489 (54%), Positives = 349/489 (71%), Gaps = 7/489 (1%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEIL-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELARE  330
             +PPGPK WPL+G++PEIL RNKP FRWIH +M E+ T+IACIRL  T+VIPVTSP LARE
Sbjct  41    LPPGPKSWPLIGNLPEILGRNKPVFRWIHSLMKELNTDIACIRLANTHVIPVTSPRLARE  100

Query  331   FLKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNK  510
              LKKQDS+F++RP  M     S GYL+    P GE+W K RR++ SHV S  +    + K
Sbjct  101   ILKKQDSVFATRPLTMGTEYCSRGYLTVAVEPLGEQWKKMRRVVASHVTSKKSLMSTLQK  160

Query  511   RVEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-  687
               EEAD L+R+I              V+D+R A R Y GNV +KM+F  R+FG G+ DG 
Sbjct  161   ITEEADDLVRYI----NNRGNGNGFGVIDLRLAVRQYSGNVARKMMFGVRHFGKGSEDGS  216

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GPG  + E ++++FT+L +LY   ++DY+PWL   DL+GH+ +++ A+    K+ D  VD
Sbjct  217   GPGFEEIEHVESLFTVLTHLYAFALSDYVPWLRFLDLEGHEKVVSGAMRNVSKYNDPFVD  276

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             ER+  W++G     +D +D+ +  KD DGRP LS++EIK QV E+M+A +DNPSNA EWA
Sbjct  277   ERLMQWRNGKLKEPQDFLDMFIMAKDADGRPTLSEEEIKAQVTELMLATVDNPSNAAEWA  336

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             +AEMIN+P++++KAVEE+D VVG++RLV ESDLPNLNY+KACVKE FRLHP+APF  PH+
Sbjct  337   MAEMINEPRIMQKAVEEIDMVVGKDRLVLESDLPNLNYVKACVKEAFRLHPVAPFNLPHM  396

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKMM  1404
             ST D VV GYFIPKGS ++ISR G+GRN   W+ PLKF PER+L N   V L ++EL ++
Sbjct  397   STADAVVDGYFIPKGSHMLISRMGIGRNPSVWDKPLKFDPERYLGNNIGVELDETELNII  456

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGC G  +G  M+ +L+ARLIQGFTW   A    ID++ES +DLF+  PL A+A
Sbjct  457   SFSTGRRGCMGANIGWPMTCVLLARLIQGFTWSPVAGESKIDMSESNNDLFMAKPLHAVA  516

Query  1585  KPRLPSNLY  1611
             KPRL  ++Y
Sbjct  517   KPRLAPHVY  525



>ref|XP_010531370.1| PREDICTED: tryptophan N-monooxygenase 1 [Tarenaya hassleriana]
Length=545

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/489 (51%), Positives = 351/489 (72%), Gaps = 9/489 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPG   WP+VG +P +L N+P FRW+H +M  + TEIAC+RLG T+VIPVT P++ARE 
Sbjct  59    LPPGFAGWPVVGMVPAMLNNRPVFRWLHSLMKRLNTEIACVRLGNTHVIPVTCPQIAREM  118

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
              K+QD+IF+SRP   +  ++SNGY + +  P+GE++ K RR++ + ++ PA   WL +KR
Sbjct  119   FKQQDAIFASRPLSYAQKVLSNGYKTCVITPFGEQFKKMRRVVMTEIVCPARHRWLHDKR  178

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSG--AADG  687
              EE DHL  ++YN  K S      + VD R  +RHYCGNV KK+ F  R FGSG  AADG
Sbjct  179   AEETDHLTAWLYNMVKSS------STVDFRDVSRHYCGNVIKKLFFGTRTFGSGKTAADG  232

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GP A D E ++A+F  L + +   ++D++PWL+  DL+GH+ I+ +A AV  K+ D  VD
Sbjct  233   GPTAEDIEHMEAMFDGLGFTFAFCISDFLPWLTGLDLNGHEKIMRRASAVMDKYHDPIVD  292

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             ERI+MW++G +T  ED +DV + LK+ DG P+L+  EIK  + E+++AA DNPSNAVEW 
Sbjct  293   ERIKMWREGKRTQVEDFLDVFISLKNEDGNPLLTPDEIKPTLKELVMAAPDNPSNAVEWT  352

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             +AEM+N P++L KA+EE+D VVG++RLVQESD+P LNY+KAC++E FRLHP+A F  PH+
Sbjct  353   MAEMVNNPEILRKAMEEIDRVVGKDRLVQESDIPKLNYVKACLREAFRLHPVAAFNLPHV  412

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMM  1404
             +  DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V L +++L+ +
Sbjct  413   ALCDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHLNECSEVTLIENDLRFI  472

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGC    LG+ ++ M++AR++QGFTW++P     ++L ES HDLFL  PL  + 
Sbjct  473   SFSTGRRGCAAPALGTAITTMMLARILQGFTWKLPEGERRVELVESSHDLFLAKPLVMVG  532

Query  1585  KPRLPSNLY  1611
             +PRL  +LY
Sbjct  533   EPRLADHLY  541



>sp|Q9M7B8.1|C79D1_MANES RecName: Full=Valine N-monooxygenase 1; AltName: Full=Cytochrome 
P450 79D1 [Manihot esculenta]
 gb|AAF27289.1|AF140613_1 N-hydroxylating cytochrome P450 [Manihot esculenta]
Length=542

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/476 (53%), Positives = 349/476 (73%), Gaps = 6/476 (1%)
 Frame = +1

Query  184   VGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSS  363
             +G+IPE++R +P FRWIH +M +M T+I  IR G T  +P++ P LARE LKK D+IFS+
Sbjct  69    IGNIPEMIRYRPTFRWIHQLMKDMNTDICLIRFGRTNFVPISCPVLAREILKKNDAIFSN  128

Query  364   RPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRF  543
             RP+ +SA  +S GYL+++ +PY ++W K R+ILTS ++SPA   WL +KR EEAD+L+ +
Sbjct  129   RPKTLSAKSMSGGYLTTIVVPYNDQWKKMRKILTSEIISPARHKWLHDKRAEEADNLVFY  188

Query  544   IYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKA  723
             I+NQ K ++       V++R ATRHY GNV +KM+F+KRYFG G  DGGPG  + E + A
Sbjct  189   IHNQFKANKN------VNLRTATRHYGGNVIRKMVFSKRYFGKGMPDGGPGPEEIEHIDA  242

Query  724   VFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKT  903
             VFT L+YLYG  ++D++P+L   DLDG +  +  A    R + +  +DERIQ WK G + 
Sbjct  243   VFTALKYLYGFCISDFLPFLLGLDLDGQEKFVLDANKTIRDYQNPLIDERIQQWKSGERK  302

Query  904   VEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLE  1083
               ED++DV + LKD+DG P+L+  EIK Q+ EIMIA +DNPSNA+EWA+ EM+NQP++L+
Sbjct  303   EMEDLLDVFITLKDSDGNPLLTPDEIKNQIAEIMIATVDNPSNAIEWAMGEMLNQPEILK  362

Query  1084  KAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFI  1263
             KA EE+D VVG++RLVQESD+PNL+Y+KAC +E FRLHP+A F  PH++ +DTV+G YFI
Sbjct  363   KATEELDRVVGKDRLVQESDIPNLDYVKACAREAFRLHPVAHFNVPHVAMEDTVIGDYFI  422

Query  1264  PKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKMMSFSAGRRGCPGVK  1443
             PKGS  ++SR GLGRN + W DPLK+ PERH+N  +VVLT+ EL+ ++FS GRRGC    
Sbjct  423   PKGSWAVLSRYGLGRNPKTWSDPLKYDPERHMNEGEVVLTEHELRFVTFSTGRRGCVASL  482

Query  1444  LGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             LGS M+ ML+AR++Q FTW  PA++  IDL E+  +L    P+ A AKPRL  +LY
Sbjct  483   LGSCMTTMLLARMLQCFTWTPPANVSKIDLAETLDELTPATPISAFAKPRLAPHLY  538



>ref|XP_009122135.1| PREDICTED: phenylalanine N-monooxygenase [Brassica rapa]
Length=525

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/480 (54%), Positives = 346/480 (72%), Gaps = 9/480 (2%)
 Frame = +1

Query  181   LVGSIPEIL-RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIF  357
             ++G++PEIL RNKP FRWIH +M+E+ T+IACIRL  T+VIPVTSP +ARE LKKQDSIF
Sbjct  50    IIGNLPEILWRNKPVFRWIHSLMEELNTDIACIRLANTHVIPVTSPRIAREILKKQDSIF  109

Query  358   SSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLL  537
             ++RP  M     S GYL+    P GE+W K RR++ SHV    +  W + +R EEAD+L+
Sbjct  110   ATRPLTMGTEYSSRGYLTIAVEPQGEQWKKMRRVVASHVTCQKSFRWTLEQRTEEADNLV  169

Query  538   RFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG-GPGAVDEEL  714
             R+I   CK SE       +DVR   R Y GNV +KMLF  R+FG G+ DG GPG  + E 
Sbjct  170   RYINKLCKGSEG------IDVRHVVRQYSGNVARKMLFGVRHFGKGSEDGSGPGFEEIEH  223

Query  715   LKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDG  894
             + ++F ++ +LY   ++DY+PWL   DL+GH+ +++ A+    K+ D  VD+R+ +W++G
Sbjct  224   VDSLFKVVTHLYAFALSDYVPWLRFLDLEGHEKVVSGAMRNVSKYNDPLVDKRLDLWRNG  283

Query  895   TKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPK  1074
                  +D +D+L+  KD +G+P LSD+EIK QV E+M+A +DNPSNAVEWA+AEMIN+P 
Sbjct  284   KMNEPQDFLDMLILAKDTNGKPALSDEEIKAQVTELMLATVDNPSNAVEWAMAEMINEPN  343

Query  1075  LLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGG  1254
             +++KAVEEVD +VG++RLV ESDLPNLNY+KACVKE FRLHP+APF  PH+ST D VV G
Sbjct  344   IMKKAVEEVDRIVGKDRLVLESDLPNLNYLKACVKEAFRLHPVAPFNLPHMSTADAVVDG  403

Query  1255  YFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL-NGEDVVLTDSELKMMSFSAGRRGC  1431
             YFIPKGS V+ISR G+GRN   W+ PLKF PERHL + ++V L D +L ++SFSAGRRGC
Sbjct  404   YFIPKGSHVLISRLGIGRNPNVWDKPLKFDPERHLGDNKNVELNDPDLNIISFSAGRRGC  463

Query  1432  PGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              G  +GS M+ ML+ARLIQGFTW        +D+TESK DLF+  PL A+  PRL  ++Y
Sbjct  464   MGSNIGSAMTYMLLARLIQGFTWSSMPGEDKVDITESKTDLFMAKPLHAVGTPRLAPHVY  523



>gb|AAV97889.1| N-hydroxylating cytochrome P450 CYP79D1 [Manihot esculenta]
Length=542

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/476 (53%), Positives = 348/476 (73%), Gaps = 6/476 (1%)
 Frame = +1

Query  184   VGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSS  363
             +G+IPE++R +P FRWIH +M +M T+I  IR G T  +P++ P LARE LKK D+IFS+
Sbjct  69    IGNIPEMIRYRPTFRWIHQLMKDMNTDICLIRFGRTNFVPISCPVLAREILKKNDAIFSN  128

Query  364   RPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRF  543
             RP+ +SA  +S GYL+++ +PY ++W K R+ILTS ++SPA   WL +KR EEAD+L+ +
Sbjct  129   RPKTLSAKSMSGGYLTTIVVPYNDQWKKMRKILTSEIISPARHKWLHDKRAEEADNLVFY  188

Query  544   IYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKA  723
             I+NQ K ++       V++R ATRHY GNV +KM+F+KRYFG G  DGGPG  + E + A
Sbjct  189   IHNQFKANKN------VNLRTATRHYGGNVIRKMVFSKRYFGKGMPDGGPGPEEIEHIDA  242

Query  724   VFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKT  903
             VFT L+YLYG  ++D++P+L   DLDG +  +  A    R +    +DERIQ WK G + 
Sbjct  243   VFTALKYLYGFCISDFLPFLLGLDLDGQEKFVLDANKTIRDYQTPLIDERIQQWKSGERK  302

Query  904   VEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLE  1083
               ED++DV + LKD+DG P+L+  EIK Q+ EIMIA +DNPSNA+EWA+ EM+NQP++L+
Sbjct  303   EMEDLLDVFITLKDSDGNPLLTPDEIKNQIAEIMIATVDNPSNAIEWAMGEMLNQPEILK  362

Query  1084  KAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFI  1263
             KA EE+D VVG++RLVQESD+PNL+Y+KAC +E FRLHP+A F  PH++ +DTV+G YFI
Sbjct  363   KATEELDRVVGKDRLVQESDIPNLDYVKACAREAFRLHPVAHFNVPHVAMEDTVIGDYFI  422

Query  1264  PKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKMMSFSAGRRGCPGVK  1443
             PKGS  ++SR GLGRN + W DPLK+ PERH+N  +VVLT+ EL+ ++FS GRRGC    
Sbjct  423   PKGSWAVLSRYGLGRNTKTWSDPLKYDPERHMNEGEVVLTEHELRFVTFSTGRRGCVASL  482

Query  1444  LGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             LGS M+ ML+AR++Q FTW  PA++  IDL E+  +L    P+ A AKPRL  +LY
Sbjct  483   LGSCMTTMLLARMLQCFTWTPPANVSKIDLAETLDELTPATPISAFAKPRLAPHLY  538



>ref|XP_003629157.1| Cytochrome P450 [Medicago truncatula]
 gb|AET03633.1| cytochrome P450 family protein [Medicago truncatula]
Length=527

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/520 (49%), Positives = 367/520 (71%), Gaps = 10/520 (2%)
 Frame = +1

Query  67    LFTVMLSVTIQWLIYKTK-KWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGV  243
             L T +  + +  L+Y  K K     S    +PPGP PWP+VG++PE+L N+P FRWI  +
Sbjct  10    LSTSLWCLILMLLVYSIKHKRSTQKSEEPKLPPGPTPWPIVGNLPEMLANRPTFRWIQKM  69

Query  244   MDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFL  423
             M+++ T+IACIRLG  +VI ++ PE+ARE   KQD+IF+SRP   S   ++NGYL++   
Sbjct  70    MNDLNTDIACIRLGNVHVITISDPEIARELCIKQDAIFASRPSSWSNEYVTNGYLTTALT  129

Query  424   PYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGA--VVD  597
             P+GE+W K ++++++ ++SP    WL +KRVEEAD+++R++YN+C     + +G   +V+
Sbjct  130   PFGEQWKKVKKVISNELVSPLRHKWLHDKRVEEADNIVRYVYNKC-----TKIGGDGIVN  184

Query  598   VRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIP  777
             V  A ++Y GNV +++L NKRYFG+G+ D GPG  + E ++A+FT+L+YL+   V+D++P
Sbjct  185   VSVAAQYYSGNVIRRLLLNKRYFGNGSEDYGPGLEEIEYVEAIFTVLQYLFAFSVSDFMP  244

Query  778   WLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGR  957
              L   DLDGH+ II KA  + +K+ D  +++RIQ WK+G K  +ED++DVL+ LKD +  
Sbjct  245   CLRGLDLDGHERIIKKACKIMKKYHDPIIEDRIQQWKNGKKIEKEDLLDVLISLKDGENN  304

Query  958   PMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQE  1137
              +L++ EIK+ +LE+++AA+DNPSN VEW LAE+INQP+LL+KA EE+D+VVG+ RLVQE
Sbjct  305   AILTEHEIKSNILELILAAVDNPSNVVEWGLAELINQPELLKKATEELDSVVGKGRLVQE  364

Query  1138  SDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKR  1317
              D P LNY+KAC KE FR HPI  F  PH++ KDT +  YFIPKGS V + R GLG N R
Sbjct  365   YDFPKLNYVKACAKEAFRRHPICDFNLPHVAMKDTTLANYFIPKGSHVYLRRQGLGTNPR  424

Query  1318  AWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQG  1491
              WE+PLKF PERHL  +G ++ L D  L +++F  GRRGC GV LG+ M++ML ARLI G
Sbjct  425   IWEEPLKFNPERHLKIDGSNLNLADPSLDLITFGTGRRGCSGVMLGTSMTIMLFARLIHG  484

Query  1492  FTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             FTW +P + P IDL+ES        PL A+A+PRL   +Y
Sbjct  485   FTWSLPPNQPSIDLSESHAGTTKAKPLVAVAEPRLEPKVY  524



>ref|XP_006437149.1| hypothetical protein CICLE_v10033385mg [Citrus clementina]
 gb|ESR50389.1| hypothetical protein CICLE_v10033385mg [Citrus clementina]
Length=621

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/487 (53%), Positives = 348/487 (71%), Gaps = 13/487 (3%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++PE+   KPAF WIH VM E+ T+IACIRLG  +VIPVTSPE+A E LK  DS+F+
Sbjct  137   IVGNLPEMWSKKPAFNWIHDVMKELNTDIACIRLGNVHVIPVTSPEIALEVLKDNDSVFA  196

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             +RP  M     S  +LS   +P G++W K R+++ SHVL  A  H L+ KR EEAD+L+R
Sbjct  197   TRPLTMGTEYSSRRFLSIAVVPLGQQWKKMRKVVASHVLCSARLHSLLFKRREEADNLVR  256

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+Y+QC        G+VV+VR A R YCGNV + M+FN+RYFG G  DGGPG  +EE ++
Sbjct  257   FVYSQCC---KRGSGSVVNVRHAARQYCGNVMRNMMFNRRYFGEGNEDGGPGFEEEEHVE  313

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             ++F +L+YLY   ++DY+PW+ +FDL+GH+ +I+ A+    K+ D  ++ERIQ  +    
Sbjct  314   SLFIVLQYLYAFTLSDYLPWMRVFDLEGHEKLISNAIRTVSKYHDPIIEERIQQRRHHRG  373

Query  901   TVE------EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMI  1062
               +      +D++DVL+  KD  GRP LS  EIK Q +++M+A +DNPSNA+EWAL EMI
Sbjct  374   NYKKESDDHQDLLDVLISAKDESGRPSLSVDEIKAQCMDLMLATVDNPSNALEWALGEMI  433

Query  1063  NQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDT  1242
             NQP++L++A EEVD VVG+ERLVQE D+P LNY+KAC++E  RLHP+APF  PH+ST+D 
Sbjct  434   NQPEILKRATEEVDMVVGKERLVQEYDIPQLNYVKACLREALRLHPVAPFNLPHVSTRDA  493

Query  1243  VVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMSF  1410
              + GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D    V LT+ EL+ +SF
Sbjct  494   TIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVELTEPELRFVSF  553

Query  1411  SAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKP  1590
             S GRRGC G  LGS MSV+L+ARL+QGF W +P++   IDL ESK+DL +  P+ A AKP
Sbjct  554   SRGRRGCMGAALGSEMSVILLARLLQGFDWSLPSNEEKIDLAESKYDLLMAKPMHASAKP  613

Query  1591  RLPSNLY  1611
             RL + LY
Sbjct  614   RLAAELY  620



>gb|KCW62254.1| hypothetical protein EUGRSUZ_H04914 [Eucalyptus grandis]
Length=519

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/487 (53%), Positives = 353/487 (72%), Gaps = 13/487 (3%)
 Frame = +1

Query  172   PWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDS  351
             PWP+VG   +++RNKP  RWI   M+EM T IAC  +G T+VIPVT P++AREFLKKQD+
Sbjct  37    PWPVVGCALDMVRNKPPARWILRWMEEMDTGIACFCIGNTHVIPVTDPKIAREFLKKQDA  96

Query  352   IFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADH  531
              F+SRP  M+A   S GY +++  PYGE+W K RR+LTS ++ PA   WL +KR EEAD+
Sbjct  97    TFASRPVSMAARAFSGGYATAVISPYGEQWKKMRRVLTSEIICPARHKWLHDKRAEEADN  156

Query  532   LLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEE  711
             L++ ++NQCK     ++G V ++R  TRHYCGNV ++++FNKRYFG G  DGGP   +EE
Sbjct  157   LVKHVFNQCK-----SLGQV-NLRHTTRHYCGNVIRRLVFNKRYFGEGREDGGPTIDEEE  210

Query  712   LLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKD  891
              + A+F  L YLY   ++DY P+L  FDLDGH+ ++ +     ++  +  ++ERI+ W+D
Sbjct  211   HVDAMFNALNYLYAFCISDYFPFLVGFDLDGHEKVVRECTRTFQRLHEPIINERIKQWRD  270

Query  892   GTKTVE-----EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAE  1056
                +       +D++DV + LKD+DG+P+L+  E+K Q  EIM+AA+DNPSNAVEWA+AE
Sbjct  271   DLSSDSNGKEPQDLLDVFIMLKDSDGKPLLTPHEVKAQATEIMMAAVDNPSNAVEWAMAE  330

Query  1057  MINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTK  1236
             MI +P+LL+KA EE+D VVG+ERLVQESD+P LNYIKAC +E FRLHPIAPF  PH++  
Sbjct  331   MIYRPELLKKAKEEIDRVVGKERLVQESDIPQLNYIKACAREAFRLHPIAPFNVPHVALS  390

Query  1237  DTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSF  1410
             D +V GY IPKGS +++SR GLGRN + W +PLKFKPERH+  +  +VVLTD +L+++SF
Sbjct  391   DAIVAGYRIPKGSHILVSRMGLGRNPKVWNEPLKFKPERHIMSDAVEVVLTDPDLRLISF  450

Query  1411  SAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKP  1590
             S GRRGC  ++LG+ M+VML+ARLIQGF W  P  +  I+L +S  DL L  PL   A+P
Sbjct  451   STGRRGCIAMQLGTTMTVMLLARLIQGFNWSKPPSVSSINLIKSMDDLSLAEPLILQAEP  510

Query  1591  RLPSNLY  1611
              LP++LY
Sbjct  511   CLPNHLY  517



>gb|KCW74807.1| hypothetical protein EUGRSUZ_E03537 [Eucalyptus grandis]
Length=473

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/477 (54%), Positives = 343/477 (72%), Gaps = 13/477 (3%)
 Frame = +1

Query  202   ILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMS  381
             +LRNKPA RWI   M+EM TEI+C R+G T VIPVT P++AREFLKKQD+ F SRP  M+
Sbjct  1     MLRNKPAARWILRWMEEMDTEISCFRIGNTNVIPVTDPKIAREFLKKQDATFMSRPISMA  60

Query  382   AGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCK  561
             A   S GY++++  PYGE+W K RR+LTS ++ PA   WL +KR EEAD+LL+ ++NQCK
Sbjct  61    AWAFSGGYMTTVMSPYGEQWKKMRRVLTSEIICPARHKWLHDKRAEEADNLLKHVFNQCK  120

Query  562   ISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILR  741
                       V++R  TRHYCGNV ++++FNKRYFG G  DGGP   +E+ + A+F  L 
Sbjct  121   SP------GQVNLRHVTRHYCGNVIRRLVFNKRYFGKGRQDGGPTIDEEQHVDALFNALN  174

Query  742   YLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVE----  909
             YLY   V+DY P+L   DLDGH+ ++       R+  D  ++ERI+ W+D   +      
Sbjct  175   YLYAFCVSDYFPFLVGLDLDGHEKVVKDCTMTFRRLHDPIINERIKQWRDNLSSESNGKE  234

Query  910   -EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEK  1086
              +D++DVL+ LKD+ G+P+L+  EIK Q  E+++AA+DNPSNAVEWA+AE+IN+P+LL K
Sbjct  235   PQDLLDVLITLKDSKGKPLLTPHEIKAQATEMLMAAVDNPSNAVEWAMAEVINRPELLNK  294

Query  1087  AVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIP  1266
             A EE+D VVG+ERLVQESD+P LNYIKAC +E FRLHPIAPF  PH++  D VV GY IP
Sbjct  295   AKEEIDRVVGKERLVQESDIPQLNYIKACGREAFRLHPIAPFNVPHVALSDAVVAGYHIP  354

Query  1267  KGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAGRRGCPGV  1440
             KGS +++SR GLGRN   W++P KFKPERH+ G+  +VVLT+ +L+ +SFS+GRRGC   
Sbjct  355   KGSHILVSRMGLGRNPEVWDEPTKFKPERHIMGDAVEVVLTEPDLRFISFSSGRRGCIAA  414

Query  1441  KLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             +LG+ M+VML+ARLIQGF W  P ++  I L ES+ DL L  PL   A+PRLP+ LY
Sbjct  415   QLGTTMTVMLLARLIQGFNWSTPPNIYSISLNESRDDLSLAEPLVLQAEPRLPNYLY  471



>ref|XP_010555368.1| PREDICTED: tryptophan N-monooxygenase 2-like [Tarenaya hassleriana]
Length=543

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/489 (52%), Positives = 356/489 (73%), Gaps = 9/489 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPG   +P+VG +P +L N+P FRW+HG+M ++ +EIAC+RLG T+VIPVT P +ARE 
Sbjct  57    LPPGFAGFPIVGMVPAMLNNRPVFRWLHGLMKQLDSEIACVRLGNTHVIPVTCPVIAREM  116

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K RR++ + V+ PA   WL +KR
Sbjct  117   LKQQDAVFASRPLSYAQKVLSNGYKTCVITPFGEQFKKMRRVVMTEVVCPARHRWLHDKR  176

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSG--AADG  687
              EE DHL  ++++  K S        VD R  +RHYCGNV KK+ F  R FG G  AADG
Sbjct  177   AEETDHLTAWLHSMVKNSSP------VDFRVLSRHYCGNVIKKLFFGTRTFGPGKMAADG  230

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GP A D E ++A+F  L + +   V+D++PWL+  DL+GH+ I+ +A AV  K+ +  VD
Sbjct  231   GPTAEDIEHMEAMFDGLGFTFAFCVSDFLPWLTGLDLNGHEKIMRRASAVMDKYHNPIVD  290

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             ERI++W++G +T  ED +DV + LKD DG+P+L+  EIK  + E+++AA DNPSNAVEWA
Sbjct  291   ERIKLWREGKRTQVEDFLDVFISLKDQDGKPLLTPDEIKPTLKELVMAAPDNPSNAVEWA  350

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             +AEM+N+P++L+KA+EE+D VVG++RLVQESD+P LNY+KAC++E FRLHP+A F  PH+
Sbjct  351   MAEMVNKPEILQKAMEEIDRVVGKDRLVQESDIPKLNYVKACLREAFRLHPVAAFNLPHV  410

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMM  1404
             S  DT V GY IPKGSQV++SR GLGRN + W +PL FKPERHLN   +V L +++L+ +
Sbjct  411   SLCDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSEPLSFKPERHLNECSEVTLIENDLRFI  470

Query  1405  SFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALA  1584
             SFS GRRGC    LG+ ++ ML+ARL+QGFTW++P  +  ++L ES HDLFL  PL  + 
Sbjct  471   SFSTGRRGCAAPALGTAITTMLLARLLQGFTWKLPEGVTRVELVESSHDLFLAKPLVMVG  530

Query  1585  KPRLPSNLY  1611
             +PRL  NLY
Sbjct  531   EPRLAENLY  539



>ref|XP_003629158.1| Cytochrome P450 [Medicago truncatula]
 gb|AET03634.1| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/490 (51%), Positives = 355/490 (72%), Gaps = 9/490 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWP+VG++PE+L N+P FRWI  +M+++ T+IACIRLG  +VI ++ PE+ARE 
Sbjct  44    LPPGPTPWPIVGNLPEMLANRPTFRWIQKMMNDLNTDIACIRLGNVHVITISDPEIAREL  103

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
               KQD+IF+SRP   S   ++NGYL++   P+GE+W K ++++++ ++SP    WL +KR
Sbjct  104   CIKQDAIFASRPSSWSNEYVTNGYLTTALTPFGEQWKKVKKVISNELVSPLRHKWLHDKR  163

Query  514   VEEADHLLRFIYNQCKISEASAMGA--VVDVRQATRHYCGNVTKKMLFNKRYFGSGAADG  687
             VEEAD+++R++YN+C     + +G   +V+V  A ++Y GNV +++L NKRYFG+G+ D 
Sbjct  164   VEEADNIVRYVYNKC-----TKIGGDGIVNVSVAAQYYSGNVIRRLLLNKRYFGNGSEDY  218

Query  688   GPGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVD  867
             GPG  + E ++A+FT+L+YL+   V+D++P L   DLDGH+ II KA  + +K+ D  ++
Sbjct  219   GPGLEEIEYVEAIFTVLQYLFAFSVSDFMPCLRGLDLDGHERIIKKACKIMKKYHDPIIE  278

Query  868   ERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWA  1047
             +RIQ WK+G K  +ED++DVL+ LKD     +L+++EIK+ +LE+ +AA+DNPSNAVEW 
Sbjct  279   DRIQQWKNGKKIEKEDLLDVLISLKDGANNAILTEQEIKSNILELTLAAVDNPSNAVEWG  338

Query  1048  LAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHL  1227
             LAE+INQPKLL+KA EE+D+VVG+ RLVQE D P LNY+KAC KE FR HPI  F  P +
Sbjct  339   LAELINQPKLLKKATEELDSVVGKGRLVQEYDFPKLNYVKACAKEAFRRHPICDFNLPRV  398

Query  1228  STKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKM  1401
             + KDT++  YFIPKGS V + R GLG N R WE+PLKF PERHL  +G ++ L D  L +
Sbjct  399   AMKDTILANYFIPKGSHVYLRRQGLGTNPRIWEEPLKFNPERHLKIDGSNLSLADPSLNV  458

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             ++F  GRRGC GV LG+ M++ML ARLI GFTW +P +   IDL+ES        PL A+
Sbjct  459   ITFGTGRRGCSGVMLGTSMTIMLFARLIHGFTWSLPPNQSNIDLSESHGGTTKAKPLVAV  518

Query  1582  AKPRLPSNLY  1611
             AKPRL   +Y
Sbjct  519   AKPRLEPKIY  528



>ref|XP_006605683.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
 gb|KHN11059.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=546

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/483 (54%), Positives = 350/483 (72%), Gaps = 6/483 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             ++G++PE++ N+P FRWI  +M+EM TEIACI+LG  +VIPVT P +A EFL+KQD+ F+
Sbjct  59    IIGNLPEMVANRPTFRWIQKLMNEMNTEIACIQLGNVHVIPVTCPTIACEFLRKQDANFA  118

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+  LIS GYL++  +P+GE+W K RRI+ + +LS  +   L  KRVEEA++L+ 
Sbjct  119   SRPTSMTTTLISRGYLTTTLVPFGEQWKKMRRIVGNDLLSTTSHQRLEYKRVEEANNLVF  178

Query  541   FIYNQCKISEASAMGAVVDV--RQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEEL  714
              IYN CK + A+    V  V  R   +HYC NV KK+ F++RYFG G  DGGPG+ + E 
Sbjct  179   HIYNNCKNNIANGNNNVGLVNVRDVAQHYCCNVMKKLNFSRRYFGEGKKDGGPGSEEVEH  238

Query  715   LKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDG  894
             L A+FT+L+Y+Y   V+DY+P L   DLDGH+  + KA+    K+ D  +++RI+ W +G
Sbjct  239   LDAIFTMLKYIYDFRVSDYVPCLRGLDLDGHEGKVKKAIETVGKYHDPIIEQRIKEWDEG  298

Query  895   TKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPK  1074
             +K   ED +D+L+ LKD +  PML+ +EIK Q++E+M+A +DNPSNAVEW LAEMINQPK
Sbjct  299   SKIHGEDFLDILISLKDANNNPMLTTQEIKAQIIELMMAGVDNPSNAVEWGLAEMINQPK  358

Query  1075  LLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGG  1254
             LL++A EE+D VVG+ERLVQESD+  LNYIKAC +E FRLHPI PF  PH+S KDT+VG 
Sbjct  359   LLQRATEELDKVVGKERLVQESDISKLNYIKACAREAFRLHPIVPFNVPHVSIKDTIVGN  418

Query  1255  YFIPKGSQVIISRTGLGRNKRAW-EDPLKFKPERHL---NGEDVVLTDSELKMMSFSAGR  1422
             Y IPKGS +++SR  +GRN++ W  +  KFKPERHL     E VVLT+ +LK +SFS GR
Sbjct  419   YLIPKGSHILLSRQEIGRNQKVWGNEAHKFKPERHLIMNKSEVVVLTEPDLKFISFSTGR  478

Query  1423  RGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             RGCP + LG+ M+VML ARL+Q FTW  P ++  I+L E+ HD+ L +PL ALAKPRL  
Sbjct  479   RGCPAIMLGTTMTVMLFARLLQAFTWTAPPNVSRINLAENNHDILLGHPLVALAKPRLTP  538

Query  1603  NLY  1611
              LY
Sbjct  539   ELY  541



>ref|XP_004509432.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=532

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/488 (53%), Positives = 353/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGPKPWP+VG+IPE+L N+P  RWI  +M+++ TEIACIRLG  +VI V+SP++AREF
Sbjct  48    LPPGPKPWPIVGNIPEMLANRPTNRWIQKIMNDLNTEIACIRLGNIHVILVSSPQIAREF  107

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
               KQD+IF+SRP   S   I  G++++   P+G++W K ++I+++ ++SP    WL +KR
Sbjct  108   FIKQDAIFASRPISWSNEYIG-GFMTTALSPFGDQWKKMKKIISNEIVSPLRHQWLHDKR  166

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
             V+EAD+L+R++YNQCK +     G +V+VR   R Y GNV ++++FN RYFG+G  DGGP
Sbjct  167   VKEADNLVRYVYNQCKKN-----GGLVNVRDVARQYSGNVIRRLIFNIRYFGNGNEDGGP  221

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G ++ E ++AVFT+L  L+   V+D++P L   DLDGHK  I KA    +K+ D  ++ER
Sbjct  222   GLMEIEYVEAVFTVLECLFAFSVSDFMPCLIGLDLDGHKKKIKKACKTMKKYHDPIIEER  281

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             IQ WK+G K  +ED++DVL+ LKD     +L+  EI++ VL+  +AA+DNPSNAVEW LA
Sbjct  282   IQQWKNGKKIKKEDLLDVLISLKDAHNNSLLTQHEIESNVLDWTLAAIDNPSNAVEWGLA  341

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP+LL+KA+EE+D+VVG+ERLVQE D P LNY+KAC KE FRLHPI+ F  PH++ 
Sbjct  342   EMINQPELLKKAIEELDSVVGKERLVQEYDFPKLNYVKACAKEAFRLHPISDFLIPHVAM  401

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMS  1407
             KDTVV  Y IPK SQVI+ R G+G N R WE+PLKFKPER+L  NG ++ L D+ L  + 
Sbjct  402   KDTVVANYIIPKDSQVILRRQGIGLNPRVWEEPLKFKPERYLKENGSNLSLADTSLDTLI  461

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS GRRGC G+ LG+ M++ML ARL+ GFTW VP +   IDL+ES        PL ALAK
Sbjct  462   FSTGRRGCSGILLGTSMTIMLFARLLHGFTWSVPPNQSSIDLSESHGGTTKAKPLVALAK  521

Query  1588  PRLPSNLY  1611
             PRL    Y
Sbjct  522   PRLLPEAY  529



>ref|XP_006486168.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=482

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/491 (55%), Positives = 346/491 (70%), Gaps = 41/491 (8%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG++PEI RNKPAF+WIH VM E+KT I+CIRLG  +VIPVTSPE+A E 
Sbjct  25    LPPGPAAWPIVGNLPEIWRNKPAFKWIHSVMKELKTNISCIRLGNVHVIPVTSPEIALEV  84

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DSIF++RP  M     S G+LS   +P+G++W K R+++ SHVLS A  + L++KR
Sbjct  85    LKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWKKMRKMVASHVLSSARLNSLISKR  144

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+RFIYNQC+ S ++A   VVDVR ATRHYCGNV +KM+FN+RYFG G  DGGP
Sbjct  145   REEADNLVRFIYNQCRKSASAA--TVVDVRLATRHYCGNVIRKMMFNRRYFGEGKEDGGP  202

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G V      A+ T  +Y                    H SII + +   R+H D +    
Sbjct  203   GFVS----AAMKTANKY--------------------HDSIIDERVHQRRRHHDNK----  234

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
                 K+  K  ++D++DVL+  KD +G P+LS  EIK+Q +++ +A +DNPSNA EWA+A
Sbjct  235   ----KEAHK--DQDLLDVLISAKDENGVPLLSIDEIKSQCMDLTLATVDNPSNAAEWAIA  288

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP++L+KA EE+D VVG+ERLVQESD+P LNYIKAC++E  RLHP+APF  PH+ST
Sbjct  289   EMINQPEILQKATEEIDRVVGKERLVQESDVPQLNYIKACLREVLRLHPVAPFNLPHVST  348

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED-----VVLTDSELK  1398
             +D  V GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D     V LT+ EL+
Sbjct  349   RDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSPDDHHHQVELTEPELR  408

Query  1399  MMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFA  1578
              +SFS GRRGC G+ LGS MSVML+ARL+QGF W  P+D   +DL+ESK DL +  PL A
Sbjct  409   FLSFSRGRRGCMGMALGSEMSVMLLARLLQGFNWSAPSDEEMVDLSESKCDLLMAKPLHA  468

Query  1579  LAKPRLPSNLY  1611
              AKPRLP+ LY
Sbjct  469   RAKPRLPAELY  479



>ref|XP_004967230.1| PREDICTED: tyrosine N-monooxygenase-like [Setaria italica]
Length=541

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/491 (51%), Positives = 343/491 (70%), Gaps = 8/491 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWP+VG++PE++ NKPAFRWIH VM ++ T+IACI+LGG +VIP+T P +ARE 
Sbjct  51    LPPGPTPWPIVGNLPEMMLNKPAFRWIHHVMKDIGTDIACIKLGGVHVIPITCPAIAREV  110

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             L+KQD+ F+SRP   ++   S GY +++  PYG++W K RR+L S ++ P+   WL +KR
Sbjct  111   LRKQDTTFASRPLTFASETFSGGYRNAVLSPYGDQWRKMRRVLASEIVCPSRHKWLCSKR  170

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              +EAD++ R++Y+  K       G  VDVR   RHYCGNV ++++FN+R+FG    DGGP
Sbjct  171   ADEADNITRYVYSLVKTKS----GGAVDVRHVARHYCGNVIRRLVFNRRHFGEPQPDGGP  226

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G ++ + + AVF  L  LY   V+DY+PWL   DLDGH+ ++ +A  +     D  +DER
Sbjct  227   GPLEVQHVDAVFRSLGLLYAFCVSDYLPWLLGLDLDGHEKMVKEANKIVNGLHDKVIDER  286

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
              + WK G +   ED +DVL+ LK  DG+ +L+ +E+K Q  +I  AA+DNPSNAVEWALA
Sbjct  287   WRQWKSGERKEPEDFLDVLITLKAADGKALLTIEEVKAQSQDITFAAVDNPSNAVEWALA  346

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             E +N P+LLEKA  E+D VVGR RLVQESD+P L Y+KAC++E FRLHP+APF  PH++ 
Sbjct  347   ETVNNPELLEKAAAELDGVVGRGRLVQESDIPWLCYLKACIREAFRLHPVAPFNVPHVAL  406

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKM  1401
              D  V GY +PKGS VI+SR GLGRN   W+DPL+F P RH+   D    V L ++EL+ 
Sbjct  407   ADATVAGYHVPKGSHVILSRIGLGRNPAVWDDPLRFDPGRHIIPGDPTAEVTLCENELRF  466

Query  1402  MSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFAL  1581
             +SFS GRRGC    LG+ MSVML  RL+Q FTW   A +  IDL+ES++D F+  PL   
Sbjct  467   ISFSTGRRGCIAASLGTAMSVMLFGRLLQCFTWSKQAAVTTIDLSESRNDTFMAKPLVLH  526

Query  1582  AKPRLPSNLYM  1614
             A+PRLP++LY+
Sbjct  527   AEPRLPAHLYL  537



>ref|XP_008456975.1| PREDICTED: isoleucine N-monooxygenase 1 [Cucumis melo]
Length=520

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/528 (48%), Positives = 368/528 (70%), Gaps = 15/528 (3%)
 Frame = +1

Query  43    SIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNK--  216
             +I F+ + LF      +I + I  ++ ++  + S   +PPGPKPWPL+G +P +LRNK  
Sbjct  2     AITFIAIILFIF----SILYAIKFSQYYHNGTPSIRRLPPGPKPWPLIGCLPAMLRNKNL  57

Query  217   PAFRWIHGVMDEMKTEIACIRLG-GTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLI  393
             P ++WIH VM +  TEIACIRLG  T++IPV SPEL+ EFL   DS+F SR   M+A ++
Sbjct  58    PTYQWIHEVMKQFNTEIACIRLGSNTHIIPVASPELSLEFLNTHDSVFGSRSISMTAEIV  117

Query  394   SNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEA  573
             SNGYLS++  P GE+W K R+IL S VL+P T H +V +R +EAD LLR+I+   +  EA
Sbjct  118   SNGYLSTVLSPMGEQWKKMRKILVSQVLNPPTLHQMVGQRTDEADILLRYIFGLTRNGEA  177

Query  574   SAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYG  753
                   +++R   RHYCG V ++M+F++RY+G G  DGGP   +E+  +A+ +ILR++  
Sbjct  178   ------INIRSIVRHYCGTVIRRMIFSRRYYGKGREDGGPSLEEEDHNQALLSILRHVNA  231

Query  754   LGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLV  933
               ++++IP L  FDLDGH+ I+ +AL V R + +  ++ER+Q W+DG K   EDI+D+L+
Sbjct  232   FSISEFIPLLKKFDLDGHEKIVKRALKVIRNNDEPIIEERVQDWRDGKKKKAEDILDILI  291

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
              LK+ +G+ +LS +EIK QV ++ +A++DNPSNAVEWALAE++NQPK+++KAVEE+D V+
Sbjct  292   SLKNENGKSLLSIEEIKAQVTDLQLASIDNPSNAVEWALAELLNQPKIIQKAVEELDKVI  351

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             GR+RLVQE D+PNL Y+ AC++E FRLHP +PF  PH+S  D  V GYFIP+GSQV++SR
Sbjct  352   GRDRLVQECDIPNLMYLTACIRESFRLHPFSPFNVPHVSNSDVFVAGYFIPRGSQVLLSR  411

Query  1294  TGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSE--LKMMSFSAGRRGCPGVKLGSLMSVM  1467
              GLGRN R WEDP++F PERHL    +    SE  L+ ++F+ GRRGC G  LG+ +++M
Sbjct  412   LGLGRNPRIWEDPMRFDPERHLKDGTIKFGISEPSLRFITFTRGRRGCIGTSLGTNITMM  471

Query  1468  LMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             L ARL+QGF+W +P + P I+      +L L  PL   A PRL   +Y
Sbjct  472   LFARLLQGFSWSLPPETPEINYYSRTDELSLPKPLHLHAVPRLSHVMY  519



>emb|CDP18412.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/454 (58%), Positives = 326/454 (72%), Gaps = 45/454 (10%)
 Frame = +1

Query  244   MDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFL  423
             M EM TEIAC RLGG +VIPVTSPE+AREFLKKQDSIFSSRP CMSA L S+ YLS++  
Sbjct  1     MHEMNTEIACFRLGGIHVIPVTSPEIAREFLKKQDSIFSSRPVCMSAELPSSKYLSAVLS  60

Query  424   PYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVR  603
             P G +  K ++I+ S VLSPA   WL  KR++EADHL+ +I NQC     S  G  V++R
Sbjct  61    PSGNQQKKMKKIVISSVLSPAKHRWLHGKRIKEADHLVNYILNQCN---NSLTGGEVNIR  117

Query  604   QATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWL  783
              A RHYCGNVT++M F+KR+FG                                DY+PW+
Sbjct  118   IAARHYCGNVTRRMFFDKRFFGR-------------------------------DYVPWM  146

Query  784   SIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPM  963
               FD+DGH+ I++ A+   RK+ D ++D RI+MWK+G K  EED++DVL+ L+D  GRP+
Sbjct  147   RSFDMDGHEKILSMAVGSVRKYQDPEIDRRIEMWKNGLKKEEEDLLDVLIMLRDGTGRPL  206

Query  964   LSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESD  1143
             L+ +EIK Q++E+M+AA+DNPSNA+EW LAEM+NQP+LL+KA +E+D VVGR+RLVQE D
Sbjct  207   LTTEEIKAQIMELMLAAVDNPSNAIEWVLAEMLNQPELLQKATQELDTVVGRDRLVQEFD  266

Query  1144  LPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAW  1323
             LP L YIKAC+KE FRLHPI+PF  PH+ST+DT+VGGYFIPKGS V++SR GLGRN R W
Sbjct  267   LPRLKYIKACIKEAFRLHPISPFNVPHVSTQDTIVGGYFIPKGSHVLLSRLGLGRNPRIW  326

Query  1324  EDPLKFKPERHLNGEDVVLTD---SELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGF  1494
             EDPLKFKPERHL   D V  D    EL  +SFS GRRGCPGV+LGS MS+ML+ARL+  F
Sbjct  327   EDPLKFKPERHLEDLDEVKVDFNNQELHFLSFSIGRRGCPGVQLGSTMSIMLLARLLHSF  386

Query  1495  TWRVPADLPCIDLTESKHDLFLENPLFALAKPRL  1596
             TW +P  L  IDLTES        PLFA+AKPRL
Sbjct  387   TWEIPRGLSRIDLTES--------PLFAIAKPRL  412



>ref|XP_010059479.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=524

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/484 (52%), Positives = 350/484 (72%), Gaps = 13/484 (3%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG   +++RNKP  RWI   M+ M T IAC R+G T+VIPV+ P++AREFLKKQD+ F+
Sbjct  45    VVGFALDMVRNKPPARWILRWMEAMDTGIACFRIGNTHVIPVSDPKIAREFLKKQDARFA  104

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+A   S  Y++++  PYGE+W K R +LTS ++ PA   WL  KR EEAD+L++
Sbjct  105   SRPVSMAAQAFSGSYMTAVISPYGEQWKKMRHVLTSQIICPARHKWLYGKRAEEADNLVK  164

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
              ++NQCK     ++G V ++R  TRHYCGNV ++++FNKRYFG G  DGGP   +EE + 
Sbjct  165   HVFNQCK-----SLGQV-NLRHTTRHYCGNVIRRLVFNKRYFGEGREDGGPTIDEEEHVD  218

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+F  L YLY   ++DY P+L  FDLDGH+ ++ +     R+  +  ++ERI+ W+D + 
Sbjct  219   AMFNALNYLYAFCISDYFPFLVGFDLDGHEKVVRECTRTFRRLHEPIINERIKQWRDDSS  278

Query  901   TVE-----EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMIN  1065
             +       +D++DVL+ LKD+DG+P+L+  E+K Q  EIM+AA+DNPSNAVEWA+AEMI 
Sbjct  279   SDSNGKEPQDLLDVLIMLKDSDGKPLLTSHEVKAQATEIMMAAVDNPSNAVEWAMAEMIY  338

Query  1066  QPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTV  1245
             +P+LL+KA EE+D VVG+ERLVQESD+P LNY+KAC +E FRLHPIAPF  PH++  D V
Sbjct  339   RPELLKKAKEEIDRVVGKERLVQESDIPQLNYVKACAREAFRLHPIAPFNVPHVALSDAV  398

Query  1246  VGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAG  1419
             V GY IPKGS +++SR GLGRN + W++PLKFKPERH   +  +VVLTD +L+++SFS G
Sbjct  399   VAGYRIPKGSHILVSRMGLGRNPKVWDEPLKFKPERHFMNDAVEVVLTDPDLRLISFSTG  458

Query  1420  RRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLP  1599
             RRGC  ++LG+ M+VML+ARLIQGF W  P  +  I+L ES  DL L  PL   A+P LP
Sbjct  459   RRGCIAMQLGTTMTVMLLARLIQGFNWSKPPSVSSINLIESMDDLSLAEPLILQAEPCLP  518

Query  1600  SNLY  1611
             ++LY
Sbjct  519   NHLY  522



>ref|XP_010027354.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=687

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/532 (51%), Positives = 372/532 (70%), Gaps = 16/532 (3%)
 Frame = +1

Query  37    FSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNK  216
             F+++ ++ L +  V+L   I+    K+ K     S  L +PPGP  WP+VG  P ++ NK
Sbjct  163   FATLTYVLLLMALVILCTIIKQFWCKSGK---GKSEPLPLPPGPASWPVVGCAPHMVWNK  219

Query  217   PAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLIS  396
             P  RWI   M+EM T IAC R+G T+VI VT P++A+EFLKKQD+ F+SRP  M+A   S
Sbjct  220   PTARWILRWMEEMDTGIACFRIGNTHVITVTDPKIAQEFLKKQDATFASRPGLMAARAFS  279

Query  397   NGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEAS  576
              GY++++  PYGE+W K RR+LTS ++ PA   WL +KR EEAD+L++ ++NQCK     
Sbjct  280   GGYVTAVISPYGEQWKKMRRVLTSEIICPARHKWLHDKRAEEADNLVKHVFNQCK-----  334

Query  577   AMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGL  756
             ++G V ++R  TRHYCGN+ ++++FNKRYFG G  DGGP   +E+ + A+F  L YLY  
Sbjct  335   SLGQV-NLRHTTRHYCGNMIRRLVFNKRYFGKGRKDGGPTIDEEQHVDALFNALNYLYAF  393

Query  757   GVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGT-----KTVEEDIV  921
              V+DY P+L   DLDGH+ ++       ++  +  + +RI+  +D +     +T  +D++
Sbjct  394   CVSDYFPFLVGLDLDGHEKVVKDWTRTFQRLHEPIIKDRIKRRRDDSSLQSNRTDPQDLL  453

Query  922   DVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEV  1101
             DVLV LKD+ G+P+L+  E+K Q  EIM+AA+DNPSNAVEWA+AEMIN+P+LL+KA EE+
Sbjct  454   DVLVMLKDSQGKPLLTPHEVKAQATEIMMAAVDNPSNAVEWAMAEMINRPELLKKAKEEI  513

Query  1102  DNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQV  1281
             D VVG+ERLVQESD+P LNYIKAC +E FRLHPIAPF  PH++  D V+ GY IPKGS +
Sbjct  514   DRVVGKERLVQESDIPQLNYIKACAREAFRLHPIAPFNVPHVALSDAVMAGYRIPKGSHI  573

Query  1282  IISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSL  1455
             +ISR GLGRN   W++PLKFKPERH+  + E+V+L + +L+ +SFS GRRGC   +LG+ 
Sbjct  574   LISRLGLGRNPEVWDEPLKFKPERHITSDTEEVLLAEPDLRFISFSTGRRGCIATQLGTT  633

Query  1456  MSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             M+VML+ARLIQGF W   A+   I+L ESK DL L  PL A AKP L  +LY
Sbjct  634   MTVMLLARLIQGFNWSPLANDSSINLKESKDDLSLAKPLVAQAKPCLVKHLY  685



>ref|XP_010027355.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=546

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/484 (52%), Positives = 350/484 (72%), Gaps = 13/484 (3%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG   +++RNKP  RWI   M+EM T IAC  +G T+VIPVT P++AREFLKKQD+ F+
Sbjct  67    VVGCALDMVRNKPPARWILRWMEEMDTGIACFCIGNTHVIPVTDPKIAREFLKKQDATFA  126

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+A   S GY +++  PYGE+W K RR+LTS ++ PA   WL +KR EEAD+L++
Sbjct  127   SRPVSMAARAFSGGYATAVISPYGEQWKKMRRVLTSEIICPARHKWLHDKRAEEADNLVK  186

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
              ++NQCK     ++G V ++R  TRHYCGNV ++++FNKRYFG G  DGGP   +EE + 
Sbjct  187   HVFNQCK-----SLGQV-NLRHTTRHYCGNVIRRLVFNKRYFGEGREDGGPTIDEEEHVD  240

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+F  L YLY   ++DY P+L  FDLDGH+ ++ +     ++  +  ++ERI+ W+D   
Sbjct  241   AMFNALNYLYAFCISDYFPFLVGFDLDGHEKVVRECTRTFQRLHEPIINERIKQWRDDLS  300

Query  901   TVE-----EDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMIN  1065
             +       +D++DV + LKD+DG+P+L+  E+K Q  EIM+AA+DNPSNAVEWA+AEMI 
Sbjct  301   SDSNGKEPQDLLDVFIMLKDSDGKPLLTPHEVKAQATEIMMAAVDNPSNAVEWAMAEMIY  360

Query  1066  QPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTV  1245
             +P+LL+KA EE+D VVG+ERLVQESD+P LNYIKAC +E FRLHPIAPF  PH++  D +
Sbjct  361   RPELLKKAKEEIDRVVGKERLVQESDIPQLNYIKACAREAFRLHPIAPFNVPHVALSDAI  420

Query  1246  VGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAG  1419
             V GY IPKGS +++SR GLGRN + W +PLKFKPERH+  +  +VVLTD +L+++SFS G
Sbjct  421   VAGYRIPKGSHILVSRMGLGRNPKVWNEPLKFKPERHIMSDAVEVVLTDPDLRLISFSTG  480

Query  1420  RRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLP  1599
             RRGC  ++LG+ M+VML+ARLIQGF W  P  +  I+L +S  DL L  PL   A+P LP
Sbjct  481   RRGCIAMQLGTTMTVMLLARLIQGFNWSKPPSVSSINLIKSMDDLSLAEPLILQAEPCLP  540

Query  1600  SNLY  1611
             ++LY
Sbjct  541   NHLY  544



>gb|AGS49165.1| cytochrome P450 CYP79B2 [Eruca vesicaria subsp. sativa]
Length=543

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/527 (48%), Positives = 367/527 (70%), Gaps = 11/527 (2%)
 Frame = +1

Query  37    FSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNK  216
             FS++ FL      V++S+    +I+K  K    +     +PPGP  +PLVG +P +L+N+
Sbjct  22    FSNMYFLTTLQALVVISL---LMIFKKIKSSSQNKKLHPLPPGPSGFPLVGMVPAMLKNR  78

Query  217   PAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLIS  396
             P FRW+H +M E+ TEIAC+RLG T+VIPVT P++ARE  K+QD++F+SRP   +  ++S
Sbjct  79    PVFRWLHSLMKELNTEIACVRLGNTHVIPVTCPKIAREIFKQQDALFASRPLTYAQKILS  138

Query  397   NGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEAS  576
             NGY + +  P+GE++ K R+++ + ++ PA   WL + R EE DHL  ++YN  K SE  
Sbjct  139   NGYKTCVITPFGEQFKKMRKVIMTEIVCPARHRWLHDNRAEETDHLTAWLYNMVKNSEP-  197

Query  577   AMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGA-ADGGPGAVDEELLKAVFTILRYLYG  753
                  VD+R  TRHYCGN  K+++F  R F     ADGGP   D E ++A+F  L + + 
Sbjct  198   -----VDLRFVTRHYCGNAIKRLMFGTRTFSEKTKADGGPTIEDIEHMEAMFEGLGFTFA  252

Query  754   LGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLV  933
               ++DY+P L+  DL+GH+ I+ +A AV  K+ D  +DERI+MW++G +T  ED +D+ +
Sbjct  253   FCISDYLPMLTGLDLNGHEKIMREASAVMDKYHDPIIDERIKMWREGKRTQIEDFLDIFI  312

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
              +KD DG+P+L+  EIK  + E+++AA DNPSNAVEWA+AEMIN+P++L+KA+EE++ VV
Sbjct  313   SIKDADGQPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMINKPEVLQKAMEEIERVV  372

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             G+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++  DT V GY IPKGSQV++SR
Sbjct  373   GKERLVQESDIPKLNYLKAIIREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQVLLSR  432

Query  1294  TGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVML  1470
              GLGRN + W DPL FKPERHLN   +V L +++L+ +SFS G+RGC    LG+ ++VM+
Sbjct  433   YGLGRNPKVWSDPLSFKPERHLNECLEVTLIENDLRFISFSTGKRGCAAPALGTAITVMM  492

Query  1471  MARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             +ARL+QGF W++P     ++L ES HD+FL  PL  + + RL  NLY
Sbjct  493   LARLLQGFKWKLPGGETRVELMESSHDMFLAKPLVMVGELRLSENLY  539



>gb|AGN12785.1| tryptophan N-hydroxylase 1 [Leavenworthia alabamica]
Length=543

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/488 (50%), Positives = 350/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG +P +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  56    LPPGPTGWPIVGMVPAMLKSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREI  115

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  116   LKQQDALFASRPLTYAQKVLSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKR  175

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  176   AEENDHLTAWVYNMVKNSGS------VDFRFVTRHYCGNAIKKLMFGTRTFSKNTAPDGG  229

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+ ++ A+  K+ D  +DE
Sbjct  230   PTIEDIEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDE  289

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD DG P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  290   RIKMWREGKRTQIEDFLDIFISIKDQDGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  349

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  350   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAIIREAFRLHPVAAFNLPHVA  409

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  410   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  469

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ ML+ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  470   FSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMIGE  529

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  530   LRLPEHLY  537



>emb|CDP21660.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/475 (54%), Positives = 331/475 (70%), Gaps = 44/475 (9%)
 Frame = +1

Query  187   GSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSR  366
             G I ++LRN+P  RWI+ VMD+M TEIAC  + G ++IPVTSPELAREF KK DSIFS+R
Sbjct  65    GCIFQMLRNRPTHRWIYKVMDDMNTEIACFGIFGVHIIPVTSPELAREFFKKHDSIFSNR  124

Query  367   PRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFI  546
             P CMSA L S G+L++   P G+++ K +R++ S                          
Sbjct  125   PVCMSAELSSEGFLTTGLSPLGDQYKKMKRMIVS--------------------------  158

Query  547   YNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAV  726
                            +D+R ATRHY GNV +KM+FNKR+FG G  DGGPGA + E + A+
Sbjct  159   ---------------MDIRLATRHYLGNVIRKMIFNKRFFGKGMEDGGPGAEEVEHVNAL  203

Query  727   FTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTV  906
             F +L Y+Y   ++DY+PW+ IFD DGH+ ++T A+A  R+H D ++++RI+ W+ G K  
Sbjct  204   FKLLAYMYAFSLSDYMPWMKIFDFDGHRKVLTMAIACVRRHHDPEIEKRIKTWESGLKNE  263

Query  907   EEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEK  1086
             EED++DVL++LKDN GRP+L+ +EI+ Q+ E+M A +DNPSNAVEWALAEM+NQP++L+K
Sbjct  264   EEDLLDVLIRLKDNKGRPLLTTEEIRAQITELMFATVDNPSNAVEWALAEMLNQPEMLQK  323

Query  1087  AVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIP  1266
             A EE+D VVG++RLVQESDL  L Y+KAC KE  RLHP APF  PH+ST+DTVVGGYFIP
Sbjct  324   ATEEIDTVVGKDRLVQESDLARLKYVKACAKEALRLHPYAPFNVPHVSTQDTVVGGYFIP  383

Query  1267  KGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED---VVLTDSELKMMSFSAGRRGCPG  1437
             KGS VI+ R GLGRN R W D LKFKPERH+N  D   + L D EL M SFS GRRGCPG
Sbjct  384   KGSHVILCRPGLGRNPRIWGDSLKFKPERHMNDMDDARMDLNDPELNMFSFSTGRRGCPG  443

Query  1438  VKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             V LGS ++VML+ARL+Q F W++P+ L  IDL E     FL  PLFA+A+PR P 
Sbjct  444   VLLGSTLTVMLLARLLQCFNWKIPSGLSQIDLAEGMDAGFLAKPLFAVAEPRFPQ  498



>ref|XP_010431975.1| PREDICTED: tryptophan N-monooxygenase 1 [Camelina sativa]
Length=542

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 350/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  57    LPPGPTGWPIIGMIPAMLKSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREM  116

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+G+++ K R+++ + ++ PA   WL  KR
Sbjct  117   LKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKR  176

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  177   SEENDHLTAWVYNMVKNSGS------VDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGG  230

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+ ++ A+  K+ D  +DE
Sbjct  231   PTVEDVEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDE  290

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD  G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  291   RIKMWREGKRTQIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  350

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  351   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  410

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  411   LADTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  470

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  471   FSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPKNETRVELMESSHDMFLAKPLVMVGQ  530

Query  1588  PRLPSNLY  1611
             PRLP NLY
Sbjct  531   PRLPENLY  538



>gb|KDP45699.1| hypothetical protein JCGZ_17306 [Jatropha curcas]
Length=465

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/467 (55%), Positives = 339/467 (73%), Gaps = 8/467 (2%)
 Frame = +1

Query  208   RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAG  387
             +N+PAFRWIH +M +M TEIAC RLG  +VI VT P ++ EFLK QDS F++RP  +S+G
Sbjct  3     KNEPAFRWIHHLMKQMNTEIACFRLGNVHVITVTCPNISCEFLKAQDSNFATRPITISSG  62

Query  388   LISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKIS  567
             + S  YL++   P G++W K +RIL + +L PA Q W   KRVEEA+HL+R++Y QC   
Sbjct  63    VTSKEYLTTALTPCGDQWKKMKRILVTQMLCPAKQLWFYGKRVEEAEHLVRYVYKQC---  119

Query  568   EASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYL  747
                + G +VDVR A RHYCGNV +KM+FNKR+FG G  +GGPG  +EE + A+F IL Y+
Sbjct  120   ---SEGGLVDVRIAARHYCGNVIRKMVFNKRFFGKGKKNGGPGFEEEEHVDALFRILDYI  176

Query  748   YGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDV  927
             +   ++D++P L  FDL GH+ II +A  +  K+ D  +++R+Q WK+G K   ED++DV
Sbjct  177   FSFCLSDFLPCLKGFDLGGHERIIKEANGIIGKYHDPIIEDRVQQWKNGAKKEAEDLLDV  236

Query  928   LVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDN  1107
             L+ LKD++G P+LS  EIK Q+ EIM+A +DNPSNAVEWA+AEMINQPK+ EKAVEE+D 
Sbjct  237   LITLKDDNGNPLLSGDEIKAQITEIMLATVDNPSNAVEWAIAEMINQPKIFEKAVEELDK  296

Query  1108  VVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVII  1287
             VVG+ERLVQESDL  LNYI AC +E FRLHP+ PF  PH+S  D  V  YFIPKGS V++
Sbjct  297   VVGKERLVQESDLSQLNYITACAREAFRLHPVGPFNLPHVSIADATVANYFIPKGSHVLL  356

Query  1288  SRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMS  1461
             SR GLGRN + W +P KFKPERH+  +G  V LT+ +L+ +SFS GRRGC GV +G+ M+
Sbjct  357   SRMGLGRNPKVWNEPYKFKPERHIKNDGSGVTLTEPDLRFISFSTGRRGCAGVTMGTSMT  416

Query  1462  VMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPS  1602
             +ML ARL+QGFTW VP +   IDL ES   L L  PL AL KPRLP+
Sbjct  417   LMLFARLLQGFTWNVPPNQASIDLKESDSSLTLAKPLVALVKPRLPA  463



>ref|XP_010446562.1| PREDICTED: tryptophan N-monooxygenase 1-like [Camelina sativa]
Length=542

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 350/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  57    LPPGPTGWPIIGMIPAMLQSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREM  116

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+G+++ K R+++ + ++ PA   WL  KR
Sbjct  117   LKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKR  176

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  177   SEENDHLTAWVYNMAKNSGS------VDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGG  230

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+ ++ A+  K+ D  +DE
Sbjct  231   PTVEDVEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDE  290

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD  G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  291   RIKMWREGKRTQIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  350

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  351   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  410

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  411   LADTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  470

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LGS ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  471   FSTGKRGCAAPALGSALTTMMLARLLQGFTWKLPKNETRVELMESSHDMFLAKPLVMVGQ  530

Query  1588  PRLPSNLY  1611
             PRLP +LY
Sbjct  531   PRLPEHLY  538



>ref|XP_010446588.1| PREDICTED: tryptophan N-monooxygenase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010446589.1| PREDICTED: tryptophan N-monooxygenase 1-like isoform X2 [Camelina 
sativa]
Length=542

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 350/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  57    LPPGPTGWPIIGMIPAMLQSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREM  116

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+G+++ K R+++ + ++ PA   WL  KR
Sbjct  117   LKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKR  176

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  177   SEENDHLTAWVYNMVKNSGS------VDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGG  230

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+ ++ A+  K+ D  +DE
Sbjct  231   PTVEDVEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDE  290

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD  G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  291   RIKMWREGKRTQIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  350

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  351   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  410

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  411   LADTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  470

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LGS ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  471   FSTGKRGCAAPALGSALTTMMLARLLQGFTWKLPKNETRVELMESSHDMFLAKPLVMVGQ  530

Query  1588  PRLPSNLY  1611
             PRLP +LY
Sbjct  531   PRLPEHLY  538



>ref|XP_010437120.1| PREDICTED: tryptophan N-monooxygenase 1-like [Camelina sativa]
Length=542

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 350/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  57    LPPGPTGWPIIGMIPAMLQSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREM  116

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+G+++ K R+++ + ++ PA   WL  KR
Sbjct  117   LKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKR  176

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  177   SEENDHLTAWVYNMVKNSGS------VDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGG  230

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+ ++ A+  K+ D  +DE
Sbjct  231   PTVEDVEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDE  290

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD  G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  291   RIKMWREGKRTQIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  350

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  351   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  410

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  411   LADTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  470

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LGS ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  471   FSTGKRGCAAPALGSALTTMMLARLLQGFTWKLPKNETRVELMESSHDMFLAKPLVMVGQ  530

Query  1588  PRLPSNLY  1611
             PRLP +LY
Sbjct  531   PRLPEHLY  538



>gb|AGN12803.1| tryptophan N-hydroxylase 1 [Leavenworthia alabamica]
Length=543

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/488 (50%), Positives = 348/488 (71%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP+VG +P +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  56    LPPGPTGWPIVGMVPAMLKSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREI  115

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  116   LKQQDALFASRPLTYAQKILSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKR  175

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  176   AEENDHLTAWVYNMVKNSGS------VDFRFVTRHYCGNAIKKLMFGTRTFSKNTAPDGG  229

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+ ++ A+  K+ D  +DE
Sbjct  230   PTIEDVEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDE  289

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW+ G +T  ED +D+ + +KD DG P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  290   RIKMWRQGKRTQIEDFLDIFISIKDQDGSPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  349

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  350   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  409

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  410   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  469

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ ML+ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  470   FSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMIGE  529

Query  1588  PRLPSNLY  1611
              RLP  LY
Sbjct  530   LRLPEPLY  537



>gb|AAN76810.1|AF453287_1 cytochrome P450 [Brassica napus]
 emb|CDY63895.1| BnaA01g34610D [Brassica napus]
Length=540

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/522 (47%), Positives = 361/522 (69%), Gaps = 8/522 (2%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             F  + L T + +     L+   KK + +    LS+PPGP  WP++G +P +L+++P FRW
Sbjct  21    FSNMYLLTTLQAFAAITLVMLLKKVFTTDKKKLSLPPGPTGWPIIGMVPTMLKSRPVFRW  80

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             +H +M ++ TEIAC+RLG T+VI VT P++ARE LK+QD++F+SRP   +  ++SNGY +
Sbjct  81    LHSIMKQLNTEIACVRLGNTHVITVTCPKIAREILKQQDALFASRPMTYAQNVLSNGYKT  140

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
              +  P+GE++ K R+++ + ++ PA   WL  KR EE DHL  ++YN  K S +      
Sbjct  141   CVITPFGEQFKKMRKVVMTELVCPARHRWLHQKRAEENDHLTAWVYNLVKNSGS------  194

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGGPGAVDEELLKAVFTILRYLYGLGVAD  768
             VD R  TRHYCGN  KK++F  R F    A DGGP A D E ++A+F  L + +   ++D
Sbjct  195   VDFRFVTRHYCGNAIKKLMFGTRTFSENTAPDGGPTAEDIEHMEAMFEALGFTFSFCISD  254

Query  769   YIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDN  948
             Y+P L+  DL+GH+ I+  + A+  K+ D  VD RI+MW++G +T  ED +D+ + +KD 
Sbjct  255   YLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIVDARIKMWREGKRTQIEDFLDIFISIKDE  314

Query  949   DGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERL  1128
              G P+L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+EE+D VVG+ERL
Sbjct  315   QGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILHKAMEEIDRVVGKERL  374

Query  1129  VQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGR  1308
             VQESD+P LNY+KA ++E FRLHP+A F  PH++  D  V GY IPKGSQV++SR GLGR
Sbjct  375   VQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYHIPKGSQVLLSRYGLGR  434

Query  1309  NKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLI  1485
             N + W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+
Sbjct  435   NPKVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTALTTMMLARLL  494

Query  1486  QGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             QGFTW++P +   ++L ES HD+FL  PL  + + RLP +LY
Sbjct  495   QGFTWKLPENETRVELMESSHDMFLAKPLVMVGELRLPEHLY  536



>gb|ACR10253.1| cytochrome P450 79b2 [Brassica rapa subsp. pekinensis]
Length=540

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/522 (47%), Positives = 360/522 (69%), Gaps = 8/522 (2%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             F  + L T + +     L+   KK + +    LS+PPGP  WP++G +P +L+++P FRW
Sbjct  21    FSNMYLLTTLQAFAAITLVMLLKKVFTTDKKKLSLPPGPTGWPIIGMVPTMLKSRPVFRW  80

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             +H +M ++ TEIAC+RLG T+VI VT P++ARE LK+QD++F+SRP   +  ++SNGY +
Sbjct  81    LHSIMKQLNTEIACVRLGNTHVITVTCPKIAREILKQQDALFASRPMTYAQNVLSNGYKT  140

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
              +  P+GE++ K R+++ + ++ PA   WL  KR EE DHL  ++YN  K S +      
Sbjct  141   CVITPFGEQFKKMRKVVMTELVCPARHRWLHQKRAEENDHLTAWVYNLVKNSGS------  194

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGGPGAVDEELLKAVFTILRYLYGLGVAD  768
             VD R  TRHYCGN  KK++F  R F    A DGGP A D E ++A+F  L + +   ++D
Sbjct  195   VDFRFVTRHYCGNAIKKLMFGTRTFSENTAPDGGPTAEDIEHMEAMFEALGFTFSFCISD  254

Query  769   YIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDN  948
             Y+P L+  DL+GH+ I+  + A+  K+ D  VD RI+MW++G +T  ED +D+ + +KD 
Sbjct  255   YLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIVDARIKMWREGKRTQIEDFLDIFISIKDE  314

Query  949   DGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERL  1128
              G P+L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+EE+D VVG+ERL
Sbjct  315   QGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILHKAMEEIDRVVGKERL  374

Query  1129  VQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGR  1308
             VQESD+P LNY+KA ++E FRLHP+A F  PH++  D  V GY IPKGSQV++SR GLGR
Sbjct  375   VQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYHIPKGSQVLLSRYGLGR  434

Query  1309  NKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLI  1485
             N + W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+
Sbjct  435   NPKVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTALTTMMLARLL  494

Query  1486  QGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             QGFTW++P +   ++L ES HD+FL  PL  + + RLP  LY
Sbjct  495   QGFTWKLPENETRVELMESSHDMFLAKPLVMVGELRLPEQLY  536



>emb|CDX69373.1| BnaC01g00800D [Brassica napus]
Length=540

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/522 (47%), Positives = 361/522 (69%), Gaps = 8/522 (2%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             F  + L T + +     L+   KK + +    LS+PPGP  WP++G +P +L+++P FRW
Sbjct  21    FSNMYLLTTLQAFVAISLVMLLKKVFTTDKKKLSLPPGPTGWPIIGMVPTMLKSRPVFRW  80

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             +H +M ++ TEIAC+RLG T+VI VT P++ARE LK+QD++F+SRP   +  ++SNGY +
Sbjct  81    LHSIMKQLNTEIACVRLGNTHVITVTCPKIAREILKQQDALFASRPMTYAQNVLSNGYKT  140

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
              +  P+GE++ K R+++ + ++ PA   WL  KR EE DHL  ++YN  K S +      
Sbjct  141   CVITPFGEQFKKMRKVVMTELVCPARHRWLHQKRAEENDHLTAWVYNLVKNSGS------  194

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGGPGAVDEELLKAVFTILRYLYGLGVAD  768
             VD R  TRHYCGN  KK++F  R F    A DGGP A D E ++A+F  L + +   ++D
Sbjct  195   VDFRFVTRHYCGNAIKKLMFGTRTFSENTAPDGGPTAEDIEHMEAMFEALGFTFSFCISD  254

Query  769   YIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDN  948
             Y+P L+  DL+GH+ I+  + A+  K+ D  VD RI+MW++G +T  ED +D+ + +KD 
Sbjct  255   YLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIVDARIKMWREGKRTQIEDFLDIFISIKDE  314

Query  949   DGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERL  1128
              G P+L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+EE+D VVG+ERL
Sbjct  315   QGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEEIDRVVGKERL  374

Query  1129  VQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGR  1308
             VQESD+P LNY+KA ++E FRLHP+A F  PH++  D  V GY IPKGSQV++SR GLGR
Sbjct  375   VQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYHIPKGSQVLLSRYGLGR  434

Query  1309  NKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLI  1485
             N + W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+
Sbjct  435   NPKVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTALTTMMLARLL  494

Query  1486  QGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             QGFTW++P +   ++L ES HD+FL  PL  + + RLP +LY
Sbjct  495   QGFTWKLPENETRVELMESSHDMFLAKPLVMVGELRLPEHLY  536



>gb|KDP45693.1| hypothetical protein JCGZ_17300 [Jatropha curcas]
Length=494

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/470 (55%), Positives = 342/470 (73%), Gaps = 8/470 (2%)
 Frame = +1

Query  208   RNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAG  387
             +N+PAFRWIH +M +M TEIAC RLG  +VI VT P ++ EFLK QDS F++RP  MS+G
Sbjct  24    KNEPAFRWIHNLMKQMNTEIACFRLGNVHVITVTCPNISCEFLKAQDSNFATRPITMSSG  83

Query  388   LISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKIS  567
             + +  Y++++  P G++W K +RIL + +L PA Q W   KRVEEA+HL+R++Y QC   
Sbjct  84    VTTKEYITTVLTPCGDQWKKMKRILVTQMLCPAKQLWFYGKRVEEAEHLVRYVYKQC---  140

Query  568   EASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYL  747
                + G +VDVR A RHYCGNV +KM+FNKR+FG G  +GGPG  +EE + A+F IL Y+
Sbjct  141   ---SEGGLVDVRIAARHYCGNVIRKMVFNKRFFGKGKKNGGPGFEEEEHVDALFRILDYI  197

Query  748   YGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDV  927
             +   ++DY+P L IFDL GH+ II  A  +  K+ D  +++R+Q WK+G K   ED++DV
Sbjct  198   FSFCLSDYLPCLKIFDLGGHEKIIKAADGIIGKYHDPIIEDRVQQWKNGAKKEAEDLLDV  257

Query  928   LVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDN  1107
             L+ LKD++G P+LS  EIK Q+ EIM+A +DNPSNAVEWA+AEMINQ K+ +KAVEE+D 
Sbjct  258   LITLKDDNGNPLLSGDEIKAQITEIMLATVDNPSNAVEWAIAEMINQTKIFKKAVEELDK  317

Query  1108  VVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVII  1287
             VVG+ERLVQESDL  LNYI AC +E FRLHP+ PF  PH+S  D  V  YFIPKGS V++
Sbjct  318   VVGKERLVQESDLSQLNYITACAREAFRLHPVGPFNLPHVSIADATVANYFIPKGSHVLL  377

Query  1288  SRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMS  1461
             SR GLG N + W++P KFKPERH+  +G  V LT+ +L+ +SFS GRRGC GV +G+ M+
Sbjct  378   SRMGLGWNPKVWKEPHKFKPERHIKNDGSGVTLTEPDLRFISFSTGRRGCAGVTMGTSMT  437

Query  1462  VMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             +ML ARL+QGFTW VP +   IDL ES+  L L  PL AL KPRLP+ +Y
Sbjct  438   LMLFARLLQGFTWNVPPNQTSIDLKESESSLTLAKPLVALVKPRLPAYVY  487



>gb|AGM16417.1| cytochrome P450 79B2 [Eruca vesicaria subsp. sativa]
Length=542

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/488 (49%), Positives = 349/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G +P +L+ +P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  57    LPPGPTGWPIIGMVPAMLKGRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREI  116

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  117   LKQQDALFASRPMTYAQNVLSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKR  176

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S++      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  177   AEENDHLTAWVYNMVKNSDS------VDFRFMTRHYCGNAIKKLMFGTRTFSQNTAPDGG  230

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P A D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+  + A+  ++ D  +D 
Sbjct  231   PTAEDIEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRDSSAIMDRYHDPIIDA  290

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD +G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  291   RIKMWREGKRTQIEDFLDIFISIKDEEGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  350

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNYIKA ++E FRLHP+A F  PH++
Sbjct  351   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYIKAILREAFRLHPVAAFNLPHVA  410

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  411   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  470

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  471   FSTGKRGCAAPALGTALTTMMLARLLQGFTWKMPENETRVELMESSHDMFLAKPLVMVGE  530

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  531   LRLPEHLY  538



>emb|CDY63922.1| BnaC07g51280D [Brassica napus]
Length=541

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 349/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T VI VT P++ARE 
Sbjct  56    LPPGPTGWPIIGMIPAMLKSRPVFRWLHSIMKQLNTEIACVRLGNTNVITVTCPKIAREI  115

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  116   LKQQDALFASRPMTYAQNVLSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKR  175

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSG-AADGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    AADGG
Sbjct  176   AEENDHLTAWVYNMVKNSGS------VDFRFVTRHYCGNAIKKLMFGTRTFSENTAADGG  229

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P A D + ++A+F  L + +   ++DY+P L+  DL+GH+ I+  + A+  K+ D  +D 
Sbjct  230   PTAEDIDHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIIDG  289

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MWK+G +T  ED +D+ + +KD +G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  290   RIKMWKEGKRTQIEDFLDIFISIKDEEGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  349

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  350   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  409

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  410   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  469

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  470   FSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGE  529

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  530   LRLPEHLY  537



>gb|KFK30571.1| hypothetical protein AALP_AA7G279100 [Arabis alpina]
Length=541

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/488 (50%), Positives = 348/488 (71%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+N+P FRW+H +M ++ TEIAC+RLG T VI VT P++ARE 
Sbjct  56    LPPGPTGWPIIGMIPAMLKNRPVFRWLHSIMKQLNTEIACVRLGNTNVITVTCPKIAREI  115

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  116   LKQQDALFASRPMTYAQKILSNGYKTCVITPFGEQFKKMRKVIMTELICPARHKWLHTKR  175

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  176   AEENDHLTGWVYNMVKNSGS------VDFRFMTRHYCGNAIKKLMFGTRTFSENTAPDGG  229

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+  + A+  K+ D  ++E
Sbjct  230   PTKEDIEHMEAMFEGLGFTFAFCISDYLPILTGLDLNGHEKIMRDSSAIMDKYHDPIINE  289

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD +G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  290   RIKMWREGKRTQIEDFLDIFISIKDEEGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  349

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH+S
Sbjct  350   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVS  409

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  410   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHLNECSEVTLTENDLRFIS  469

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ ML+ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  470   FSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPGNETRVELMESSHDMFLAKPLVMVGE  529

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  530   LRLPEHLY  537



>gb|ADW54459.1| cytochrome P450 79B1 [Brassica oleracea var. botrytis]
Length=541

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 349/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T VI VT P++ARE 
Sbjct  56    LPPGPTGWPIIGMIPAMLKSRPVFRWLHSIMKQLNTEIACVRLGNTNVITVTCPKIAREI  115

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  116   LKQQDALFASRPMTYAQNVLSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKR  175

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSG-AADGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    AADGG
Sbjct  176   AEENDHLTAWVYNMVKNSGS------VDFRFVTRHYCGNAIKKLMFGTRTFSENTAADGG  229

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P A D + ++A+F  L + +   ++DY+P L+  DL+GH+ I+  + A+  K+ D  +D 
Sbjct  230   PTAEDIDHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIIDG  289

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MWK+G +T  ED +D+ + +KD +G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  290   RIKMWKEGKRTQIEDFLDIFISIKDEEGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  349

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  350   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  409

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  410   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  469

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  470   FSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGE  529

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  530   LRLPEHLY  537



>ref|XP_010025546.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=528

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/484 (52%), Positives = 348/484 (72%), Gaps = 13/484 (3%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG  P++ RNKPA RWI   M+EM T IAC R+G T+VIPVT P++A+E LKKQD+ F+
Sbjct  49    VVGCAPDMFRNKPAARWILRWMEEMDTGIACFRIGNTHVIPVTDPKIAQEILKKQDATFA  108

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             SRP  M+A   S GY++++  PYGE+W K RR+LTS ++ PA   WL +KR EEAD+L++
Sbjct  109   SRPVSMAARAFSGGYVTAVISPYGEQWKKMRRVLTSEIICPARHKWLHDKRAEEADNLVK  168

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
              ++NQCK     ++G V ++R  TRHYCGN  ++++FNKRYFG    DGG    +E+ + 
Sbjct  169   HVFNQCK-----SLGQV-NLRHTTRHYCGNAIRRLVFNKRYFGKARKDGGQTIDEEQHVD  222

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGT-  897
             A+F  L YLY   V+DY P+L   DLDGH+ ++       R+  +  ++ERI+ W+D + 
Sbjct  223   ALFNALNYLYAFCVSDYFPFLVGLDLDGHEKVVKDCTRTFRRLHEPIINERIKQWRDDSS  282

Query  898   ----KTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMIN  1065
                 +T  +D++DVL+ LKD+ G+P+L+  E+K Q  EIM+AA+DNPSNAVEWA+AEMIN
Sbjct  283   SQSNRTEPQDLLDVLIMLKDSQGKPLLTPHEVKAQATEIMMAAVDNPSNAVEWAMAEMIN  342

Query  1066  QPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTV  1245
             +P+LL+KA EE+D VVG+ERLVQESD+  LNYIKAC +E  RLHPIAPF  PH++  D V
Sbjct  343   RPELLKKAKEEIDRVVGKERLVQESDICQLNYIKACAREALRLHPIAPFNVPHVALSDAV  402

Query  1246  VGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAG  1419
             + GY IPKGS +++SR GLGRN + W++PLKFKPERH+  + E+V+L +  L+ +SFS G
Sbjct  403   MAGYRIPKGSHILVSRMGLGRNPKVWDEPLKFKPERHITSDTEEVLLAEPNLRFISFSMG  462

Query  1420  RRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLP  1599
             RRGC   +LG+ M+VML+ARLIQGF W   A+   I+L ESK+DL L  PL A +KP L 
Sbjct  463   RRGCIAAQLGTTMTVMLLARLIQGFNWSPLANDSSINLNESKNDLSLAKPLVAQSKPCLA  522

Query  1600  SNLY  1611
             ++LY
Sbjct  523   NHLY  526



>gb|AAV97888.1| N-hydroxylating cytochrome P450 CYP79D2 [Manihot esculenta]
Length=541

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/477 (51%), Positives = 343/477 (72%), Gaps = 6/477 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             L+G+IPE++R +P FRWIH +M +M T+I  IR G T V+P++ P +ARE LKK D++FS
Sbjct  67    LIGNIPEMIRYRPTFRWIHQLMKDMNTDICLIRFGKTNVVPISCPVIAREILKKHDAVFS  126

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             +RP+ + A  +S GYL+++ +PY ++W K R++LTS ++SPA   WL +KR EEAD L+ 
Sbjct  127   NRPKILCAKTMSGGYLTTIVVPYNDQWKKMRKVLTSEIISPARHKWLHDKRAEEADQLVF  186

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             +I NQ K ++       V+VR A RHY GNV +KM+F+KRYFG G  DGGPG  +   + 
Sbjct  187   YINNQYKSNKN------VNVRIAARHYGGNVIRKMMFSKRYFGKGMPDGGPGPEEIMHVD  240

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+FT L+YLYG  ++DY+P+L   DLDG + I+  A    R   +  ++ERIQ W+ G +
Sbjct  241   AIFTALKYLYGFCISDYLPFLEGLDLDGQEKIVLNANKTIRDLQNPLIEERIQQWRSGER  300

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++DV + L+D+DG+P+L+  EIK Q+ EIMIA +DNP+NAVEWA+ E+INQP+LL
Sbjct  301   KEMEDLLDVFITLQDSDGKPLLNPDEIKNQIAEIMIATIDNPANAVEWAMGELINQPELL  360

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
              KA EE+D VVG++RLVQESD+PNLNY+KAC +E FRLHP+A F  PH++ +D V+G YF
Sbjct  361   AKATEELDRVVGKDRLVQESDIPNLNYVKACAREAFRLHPVAYFNVPHVAMEDAVIGDYF  420

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKMMSFSAGRRGCPGV  1440
             IPKGS  I+SR GLGRN + W DPLK+ PERHLN  +VVLT+ +L+ ++FS GRRGC   
Sbjct  421   IPKGSWAILSRYGLGRNPKTWPDPLKYDPERHLNEGEVVLTEHDLRFVTFSTGRRGCVAA  480

Query  1441  KLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              LG+ M  M++AR++Q FTW  P ++  IDL+E+  +L    P+   AKPRL  +LY
Sbjct  481   LLGTTMITMMLARMLQCFTWTPPPNVTKIDLSENIDELTPSTPITGFAKPRLAPHLY  537



>ref|XP_006411796.1| hypothetical protein EUTSA_v10024861mg [Eutrema salsugineum]
 gb|ESQ53249.1| hypothetical protein EUTSA_v10024861mg [Eutrema salsugineum]
Length=541

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 348/488 (71%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  57    LPPGPSGWPIIGMIPAMLKSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREI  116

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  117   LKQQDALFASRPMTYAQKILSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKR  176

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  177   AEENDHLTAWVYNMVKNSGS------VDFRFVTRHYCGNAIKKLMFGTRTFSQNTAPDGG  230

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P A D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+  + A+  K+ D  +D 
Sbjct  231   PTAEDIEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIIDA  290

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD  G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  291   RIKMWREGKRTQIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  350

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  351   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  410

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  411   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  470

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  471   FSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPKNETRVELMESSHDMFLAKPLVMVGE  530

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  531   LRLPEHLY  538



>sp|Q9M7B7.1|C79D2_MANES RecName: Full=Valine N-monooxygenase 2; AltName: Full=Cytochrome 
P450 79D2 [Manihot esculenta]
 gb|AAF27290.1|AF140614_1 N-hydroxylating cytochrome P450 [Manihot esculenta]
Length=541

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/477 (51%), Positives = 343/477 (72%), Gaps = 6/477 (1%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             L+G+IPE++R +P FRWIH +M +M T+I  IR G T V+P++ P +ARE LKK D++FS
Sbjct  67    LIGNIPEMIRYRPTFRWIHQLMKDMNTDICLIRFGKTNVVPISCPVIAREILKKHDAVFS  126

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             +RP+ + A  +S GYL+++ +PY ++W K R++LTS ++SPA   WL +KR EEAD L+ 
Sbjct  127   NRPKILCAKTMSGGYLTTIVVPYNDQWKKMRKVLTSEIISPARHKWLHDKRAEEADQLVF  186

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             +I NQ K ++       V+VR A RHY GNV +KM+F+KRYFG G  DGGPG  +   + 
Sbjct  187   YINNQYKSNKN------VNVRIAARHYGGNVIRKMMFSKRYFGKGMPDGGPGPEEIMHVD  240

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTK  900
             A+FT L+YLYG  ++DY+P+L   DLDG + I+  A    R   +  ++ERIQ W+ G +
Sbjct  241   AIFTALKYLYGFCISDYLPFLEGLDLDGQEKIVLNANKTIRDLQNPLIEERIQQWRSGER  300

Query  901   TVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLL  1080
                ED++DV + L+D+DG+P+L+  EIK Q+ EIMIA +DNP+NAVEWA+ E+INQP+LL
Sbjct  301   KEMEDLLDVFITLQDSDGKPLLNPDEIKNQIAEIMIATIDNPANAVEWAMGELINQPELL  360

Query  1081  EKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYF  1260
              KA EE+D VVG++RLVQESD+PNLNY+KAC +E FRLHP+A F  PH++ +D V+G YF
Sbjct  361   AKATEELDRVVGKDRLVQESDIPNLNYVKACAREAFRLHPVAYFNVPHVAMEDAVIGDYF  420

Query  1261  IPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKMMSFSAGRRGCPGV  1440
             IPKGS  I+SR GLGRN + W DPLK+ PERHLN  +VVLT+ +L+ ++FS GRRGC   
Sbjct  421   IPKGSWAILSRYGLGRNPKTWPDPLKYDPERHLNEGEVVLTEHDLRFVTFSTGRRGCVAA  480

Query  1441  KLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              LG+ M  M++AR++Q FTW  P ++  IDL+E+  +L    P+   AKPRL  +LY
Sbjct  481   LLGTTMITMMLARMLQCFTWTPPPNVTRIDLSENIDELTPATPITGFAKPRLAPHLY  537



>gb|AGC13081.1| cytochrome P450 79B2 [Brassica oleracea var. italica]
Length=540

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/522 (47%), Positives = 361/522 (69%), Gaps = 8/522 (2%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             F  + L T + +     L+   KK + +    LS+PPGP  WP++G +P +L+++P FRW
Sbjct  21    FSNMYLLTTLQAFVAITLVMLLKKVFTTDKKKLSLPPGPTGWPIIGMVPTMLKSRPVFRW  80

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             +H +M ++ TEIAC+RLG T+VI VT P++ARE LK+QD++F+SRP   +  ++SNGY +
Sbjct  81    LHSIMKQLNTEIACVRLGNTHVITVTCPKIAREILKQQDALFASRPMTYAQNVLSNGYKA  140

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
              +  P+GE++ K R+++ + ++ PA   WL  KR EE +HL  ++YN  K S +      
Sbjct  141   CVITPFGEQFKKMRKVVMTELVCPARHRWLHQKRAEENNHLTAWVYNLVKNSGS------  194

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGGPGAVDEELLKAVFTILRYLYGLGVAD  768
             VD R  TRHYCGN  KK++F  R F    A DGGP A D E ++A+F  L + +   ++D
Sbjct  195   VDFRFVTRHYCGNAIKKLVFGTRTFSENTAPDGGPTAEDIEHMEAMFEALGFTFSFCISD  254

Query  769   YIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDN  948
             Y+P L+  DL+GH+ I+  + A+  K+ D  VD RI+MW++G +T  ED +D+ + +KD 
Sbjct  255   YLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIVDARIKMWREGKRTQIEDFLDIFISIKDE  314

Query  949   DGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERL  1128
              G P+L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+EE+D VVG+ERL
Sbjct  315   QGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEEIDRVVGKERL  374

Query  1129  VQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGR  1308
             VQESD+P LNY+KA ++E FRLHP+A F  PH++  D  V GY IPKGSQV++SR GLGR
Sbjct  375   VQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYHIPKGSQVLLSRYGLGR  434

Query  1309  NKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLI  1485
             N + W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+
Sbjct  435   NPKVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTALTTMMLARLL  494

Query  1486  QGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             QGFTW++P +   ++L ES HD+FL  PL  + + RLP +LY
Sbjct  495   QGFTWKLPENETRVELMESSHDMFLAKPLVMVGELRLPEHLY  536



>ref|XP_002866896.1| CYP79B2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43155.1| CYP79B2 [Arabidopsis lyrata subsp. lyrata]
Length=541

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/488 (49%), Positives = 349/488 (72%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  56    LPPGPTGWPIIGMIPTMLKSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREM  115

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+G+++ K R+++ + ++ PA   WL  KR
Sbjct  116   LKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKR  175

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  176   SEENDHLTAWVYNMVKNSGS------VDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGG  229

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+ ++ A+  K+ D  +DE
Sbjct  230   PTVEDVEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDE  289

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD  G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  290   RIKMWREGKRTQIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  349

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  350   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  409

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  410   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  469

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  470   FSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGE  529

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  530   LRLPEHLY  537



>ref|XP_004966053.1| PREDICTED: tyrosine N-monooxygenase-like [Setaria italica]
Length=545

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/482 (52%), Positives = 344/482 (71%), Gaps = 7/482 (1%)
 Frame = +1

Query  181   LVGSIPE-ILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIF  357
             +VG++PE +L +KPAFRWIH +M +M T+IAC++LGG +VIP+T P +ARE LKKQD+ F
Sbjct  61    VVGNLPEMLLSDKPAFRWIHLIMIKMGTDIACVKLGGVHVIPITCPMIAREVLKKQDANF  120

Query  358   SSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLL  537
             + RP  +++   S GY+ ++  PYG++W K RR+L S V+ P+   WL +KR  EAD+L 
Sbjct  121   ACRPLSLASKTFSRGYMDAVMSPYGDQWRKMRRVLASEVVCPSRHRWLHDKRAAEADNLT  180

Query  538   RFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELL  717
             RF+YN      A + GA VDVR   RHYCGNV ++++FN+RYFG    DGG G ++ + +
Sbjct  181   RFVYNL--AGGAGSGGAAVDVRHVARHYCGNVVRRLVFNRRYFGEPRPDGGQGPLEVQHV  238

Query  718   KAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGT  897
              AVFT L  LY   V+DY+PWL   DLDGH+ ++ +A     +  DT ++ER + WK G 
Sbjct  239   DAVFTSLGLLYSFSVSDYLPWLLGLDLDGHEKMVREAQETVSRLHDTFINERWRQWKSGE  298

Query  898   KTVEEDIVDVLVKLKDNDG-RPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPK  1074
             +   ED++DVL+ LKD +G R +L+  E++ Q+ +I  AA+DNPSNAVEWA+AEM+N P+
Sbjct  299   RQELEDLLDVLITLKDAEGKRSVLTVDEVRAQLQDITFAAMDNPSNAVEWAMAEMVNAPE  358

Query  1075  LLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGG  1254
              + KAV E+D VVGR+RLVQESD+P LNY+KAC++E FRLHP+APF  PH++  D  V G
Sbjct  359   TMRKAVAELDAVVGRDRLVQESDIPRLNYLKACIREAFRLHPVAPFNVPHVALADATVAG  418

Query  1255  YFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGE---DVVLTDSELKMMSFSAGRR  1425
             Y +PKGS VI+SR GLGRN   W+DPL+F P+RHL+     DV L +++L+ +SFS GRR
Sbjct  419   YHVPKGSHVILSRIGLGRNPAVWDDPLRFDPDRHLDANPEADVTLAENDLRFISFSTGRR  478

Query  1426  GCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSN  1605
             GC    LG+ MSVML  RL+QGF W  PA +  IDL+ES+HD+F+  PL   A+PRLP+N
Sbjct  479   GCIAASLGTAMSVMLFGRLLQGFAWSKPAGMAAIDLSESRHDMFMAKPLVLNAEPRLPAN  538

Query  1606  LY  1611
             LY
Sbjct  539   LY  540



>sp|O81345.1|C79B1_SINAL RecName: Full=Cytochrome P450 79B1 [Sinapis alba]
 gb|AAD03415.1| cytochrome P450 [Sinapis alba]
Length=542

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/488 (49%), Positives = 348/488 (71%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G +P +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE 
Sbjct  57    LPPGPTGWPIIGMVPTMLKSRPVFRWLHSIMKQLNTEIACVRLGSTHVITVTCPKIAREV  116

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  117   LKQQDALFASRPMTYAQNVLSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKR  176

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN    S++      VD R  TRHYCGN  KK++F  R F    A +GG
Sbjct  177   AEENDHLTAWVYNMVNNSDS------VDFRFVTRHYCGNAIKKLMFGTRTFSQNTAPNGG  230

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P A D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+  + A+  K+ D  +D 
Sbjct  231   PTAEDIEHMEAMFEALGFTFSFCISDYLPILTGLDLNGHEKIMRDSSAIMDKYHDPIIDA  290

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G KT  ED +D+ + +KD +G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  291   RIKMWREGKKTQIEDFLDIFISIKDEEGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  350

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  351   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  410

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               D  V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  411   LSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFIS  470

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ ML+ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  471   FSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGE  530

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  531   LRLPEHLY  538



>ref|XP_009129057.1| PREDICTED: cytochrome P450 79B1 [Brassica rapa]
Length=540

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/522 (47%), Positives = 359/522 (69%), Gaps = 8/522 (2%)
 Frame = +1

Query  52    FLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRW  231
             F  + L T + +     L+   KK + +    LS+PPGP  WP++G +P +L+++P FRW
Sbjct  21    FSNMYLLTTLQAFAAITLVMLLKKVFTTDKKKLSLPPGPTGWPIIGMVPTMLKSRPVFRW  80

Query  232   IHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLS  411
             +H +M ++ TEIAC+RLG T+VI VT P++ARE LK+QD++F+SRP   +  ++SNGY +
Sbjct  81    LHSIMKQLNTEIACVRLGNTHVITVTCPKIAREILKQQDALFASRPMTYAQNVLSNGYKT  140

Query  412   SLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAV  591
              +  P+GE++ K R+++ + ++ PA   WL  KR EE DHL  ++YN  K S +      
Sbjct  141   CVITPFGEQFKKMRKVVMTELVCPARHRWLHQKRAEENDHLTAWVYNLVKNSGS------  194

Query  592   VDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGGPGAVDEELLKAVFTILRYLYGLGVAD  768
             VD R  TRHYCGN  KK++F  R F    A DGGP A D E ++A+F  L + +   ++D
Sbjct  195   VDFRFVTRHYCGNAIKKLMFGTRTFSENTAPDGGPTAEDIEHMEAMFEALGFTFSFCISD  254

Query  769   YIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDN  948
             Y+P L+  DL+GH+ I+  + A+  K+ D  VD RI+MW++G +T  ED +D+ + +KD 
Sbjct  255   YLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIVDARIKMWREGKRTQIEDFLDIFISIKDE  314

Query  949   DGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERL  1128
              G P+L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+EE+D VVG+ERL
Sbjct  315   QGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILHKAMEEIDRVVGKERL  374

Query  1129  VQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGR  1308
             VQESD+P LNY+KA ++E FRLHP+A F  PH++  D  V GY IPKGSQV++SR GLGR
Sbjct  375   VQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYHIPKGSQVLLSRYGLGR  434

Query  1309  NKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLI  1485
             N + W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+
Sbjct  435   NPKVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTALTTMMLARLL  494

Query  1486  QGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             QGFT ++P +   ++L ES HD+FL  PL  + + RLP  LY
Sbjct  495   QGFTSKLPENETRVELMESSHDMFLAKPLVMVGELRLPEQLY  536



>ref|XP_006480303.1| PREDICTED: uncharacterized protein LOC102610907 [Citrus sinensis]
Length=1231

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/488 (53%), Positives = 349/488 (72%), Gaps = 15/488 (3%)
 Frame = +1

Query  181   LVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFS  360
             +VG++P++ R KPAF WIH +M E+ T+IACIRLG  +VIPVTSPE+A E LK  DS F+
Sbjct  743   IVGNLPDMWRKKPAFNWIHDLMKELNTDIACIRLGNVHVIPVTSPEIALEALKDNDSTFA  802

Query  361   SRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLR  540
             +RP  M     S G+LS   +P G++W K R+++ SHVL  A  H L+ KR EEAD+L+R
Sbjct  803   TRPLTMGTEYSSRGFLSIAVVPLGQQWKKMRKVVASHVLCSARLHSLLFKRREEADNLVR  862

Query  541   FIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLK  720
             F+YNQC     S  G+VV+VR A R YCGNV + M+FN+RYFG G  DGGPG  +EE ++
Sbjct  863   FVYNQCC---KSGSGSVVNVRHAARQYCGNVMRNMMFNRRYFGEGNEDGGPGFEEEEHVE  919

Query  721   AVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQM------  882
             ++F +L++LY   ++DY+PW+ +FDL+GH+ +I+ A+    K+ D  ++ERIQ       
Sbjct  920   SLFIVLQHLYSFILSDYLPWMRVFDLEGHEKLISDAIRTVSKYHDPIIEERIQQRSHHHG  979

Query  883   -WKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEM  1059
              +K G+    +D++D L+  KD  GRP LS  EIK Q +++M+A +DNPSNAVEWAL EM
Sbjct  980   NYKKGSDD-HQDLLDALISAKDETGRPSLSVDEIKAQCMDLMLATVDNPSNAVEWALGEM  1038

Query  1060  INQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKD  1239
             INQP++L+KA EEVD  VG+ERLVQE D+P LNY+KAC++E  RLHP+APF  PH+ST+D
Sbjct  1039  INQPEILKKAKEEVDMFVGKERLVQEYDIPQLNYVKACLREALRLHPVAPFNLPHVSTRD  1098

Query  1240  TVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVLTDSELKMMS  1407
               + GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D    V LT+ EL+ +S
Sbjct  1099  ATIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVELTEPELRFVS  1158

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             F  GRRGC GV LGS MSV+L+ARL+QGF W +P+    IDL ESK+DL +  P+ A AK
Sbjct  1159  FGRGRRGCMGVALGSEMSVILLARLLQGFDWSLPSHEEKIDLAESKYDLLMAKPMHARAK  1218

Query  1588  PRLPSNLY  1611
             PRL + LY
Sbjct  1219  PRLAAELY  1226



>gb|KCW74950.1| hypothetical protein EUGRSUZ_E03692, partial [Eucalyptus grandis]
Length=515

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/469 (53%), Positives = 340/469 (72%), Gaps = 13/469 (3%)
 Frame = +1

Query  226   RWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGY  405
             RWI   M+ M T IAC R+G T+VIPV+ P++AREFLKKQD+ F+SRP  M+A   S  Y
Sbjct  51    RWILRWMEAMDTGIACFRIGNTHVIPVSDPKIAREFLKKQDARFASRPVSMAAQAFSGSY  110

Query  406   LSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMG  585
             ++++  PYGE+W K R +LTS ++ PA   WL  KR EEAD+L++ ++NQCK     ++G
Sbjct  111   MTAVISPYGEQWKKMRHVLTSQIICPARHKWLYGKRAEEADNLVKHVFNQCK-----SLG  165

Query  586   AVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILRYLYGLGVA  765
              V ++R  TRHYCGNV ++++FNKRYFG G  DGGP   +EE + A+F  L YLY   ++
Sbjct  166   QV-NLRHTTRHYCGNVIRRLVFNKRYFGEGREDGGPTIDEEEHVDAMFNALNYLYAFCIS  224

Query  766   DYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVE-----EDIVDVL  930
             DY P+L  FDLDGH+ ++ +     R+  +  ++ERI+ W+D + +       +D++DVL
Sbjct  225   DYFPFLVGFDLDGHEKVVRECTRTFRRLHEPIINERIKQWRDDSSSDSNGKEPQDLLDVL  284

Query  931   VKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNV  1110
             + LKD+DG+P+L+  E+K Q  EIM+AA+DNPSNAVEWA+AEMI +P+LL+KA EE+D V
Sbjct  285   IMLKDSDGKPLLTSHEVKAQATEIMMAAVDNPSNAVEWAMAEMIYRPELLKKAKEEIDRV  344

Query  1111  VGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIIS  1290
             VG+ERLVQESD+P LNY+KAC +E FRLHPIAPF  PH++  D VV GY IPKGS +++S
Sbjct  345   VGKERLVQESDIPQLNYVKACAREAFRLHPIAPFNVPHVALSDAVVAGYRIPKGSHILVS  404

Query  1291  RTGLGRNKRAWEDPLKFKPERHLNGE--DVVLTDSELKMMSFSAGRRGCPGVKLGSLMSV  1464
             R GLGRN + W++PLKFKPERH   +  +VVLTD +L+++SFS GRRGC  ++LG+ M+V
Sbjct  405   RMGLGRNPKVWDEPLKFKPERHFMNDAVEVVLTDPDLRLISFSTGRRGCIAMQLGTTMTV  464

Query  1465  MLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             ML+ARLIQGF W  P  +  I+L ES  DL L  PL   A+P LP++LY
Sbjct  465   MLLARLIQGFNWSKPPSVSSINLIESMDDLSLAEPLILQAEPCLPNHLY  513



>ref|XP_006367899.1| PREDICTED: isoleucine N-monooxygenase 2-like [Solanum tuberosum]
Length=485

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/538 (51%), Positives = 355/538 (66%), Gaps = 64/538 (12%)
 Frame = +1

Query  31    LRFSSIIFLPLALFTVMLSVTIQWLIYKT---KKWYGssssslsIPPGPKPWPLVGSIPE  201
             ++ S+I+ + ++  T    ++I   I+ +   KKW  S  ++  +PPGPK WP++G  P+
Sbjct  2     MKISNILLIVISNNTTFFIISILLTIFISFILKKWNSSVRNNKPLPPGPKSWPIIGCFPQ  61

Query  202   I-LRNKPAF-RWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRC  375
             I L+NK A    IH +M+EM TEIACIR+G  +VIPVTSPELA EFLK  DSIFSSRP C
Sbjct  62    IILKNKHALTHRIHKIMEEMNTEIACIRVGNYHVIPVTSPELACEFLKIHDSIFSSRPIC  121

Query  376   MSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQ  555
             MSA L+SNGYL+S+FLP G++W K + +LTSHVLSP +  WL  KR EEADHL RF+YNQ
Sbjct  122   MSANLVSNGYLTSIFLPSGDQWMKMKNMLTSHVLSPKSFQWLRPKRDEEADHLHRFVYNQ  181

Query  556   CKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTI  735
             C      +   V+++R+ TR+YCGNV + M+F+KR         G     EE   A+FTI
Sbjct  182   C------SNQLVINLREVTRYYCGNVIRNMIFSKRSL------FGIIEEQEEQFDALFTI  229

Query  736   LRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEED  915
             L Y+Y   ++DY+PWLS+FDLDGHK+++ KA A   KH+D +VD                
Sbjct  230   LEYVYSFSISDYLPWLSVFDLDGHKAVLKKAYAKATKHIDIEVD----------------  273

Query  916   IVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVE  1095
                                       L +M+A++DNPSN VEWAL EM+NQPKL++KA++
Sbjct  274   --------------------------LVLMLASVDNPSNTVEWALTEMLNQPKLMQKAIK  307

Query  1096  EVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVG-GYFIPKG  1272
             E++ VVG  R VQESDL  LNY+KAC+KE FRLHP   F  PH+S  DT+VG  YFIPKG
Sbjct  308   ELNIVVGINRWVQESDLSRLNYVKACIKETFRLHPAITFNVPHVSVSDTIVGEKYFIPKG  367

Query  1273  SQVIISRTGLGRNKRAWEDPLKFKPERHLNGED---VVLTDSELKMMSFSAGRRGCPGVK  1443
             S V++SR GLGRN R WEDPLKFKPERHL  ED   VVLTDS L+++SF AGRR CP VK
Sbjct  368   SIVLLSRLGLGRNSRVWEDPLKFKPERHLKMEDGGEVVLTDSNLRLLSFGAGRRSCPAVK  427

Query  1444  LGSLMSVMLMARLIQGFTWRVPADLPCIDLTE-SKHDLFLENPLFALAKPRLPSNLYM  1614
             LGS ++ ML+ARL+Q FTW +P +LPC DL E SK + F   P  A AKPRL   +Y+
Sbjct  428   LGSTITTMLLARLLQEFTWNLPPNLPCNDLNESSKINHFSALPFLAQAKPRLAKAMYL  485



>ref|NP_195705.1| tryptophan N-monooxygenase 1 [Arabidopsis thaliana]
 sp|O81346.2|C79B2_ARATH RecName: Full=Tryptophan N-monooxygenase 1; AltName: Full=Cytochrome 
P450 79B2; AltName: Full=Tryptophan N-hydroxylase 1 
[Arabidopsis thaliana]
 emb|CAB38908.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80658.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AAK76691.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM14376.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE87143.1| tryptophan N-monooxygenase 1 [Arabidopsis thaliana]
Length=541

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/488 (49%), Positives = 348/488 (71%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC++LG T+VI VT P++ARE 
Sbjct  56    LPPGPTGWPIIGMIPTMLKSRPVFRWLHSIMKQLNTEIACVKLGNTHVITVTCPKIAREI  115

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+G+++ K R+++ + ++ PA   WL  KR
Sbjct  116   LKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKR  175

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    A DGG
Sbjct  176   SEENDHLTAWVYNMVKNSGS------VDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGG  229

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P   D E ++A+F  L + +   ++DY+P L+  DL+GH+ I+ ++ A+  K+ D  +DE
Sbjct  230   PTVEDVEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDE  289

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MW++G +T  ED +D+ + +KD  G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  290   RIKMWREGKRTQIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  349

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++
Sbjct  350   AEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVA  409

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  410   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLCFKPERHLNECSEVTLTENDLRFIS  469

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  +  
Sbjct  470   FSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGD  529

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  530   LRLPEHLY  537



>gb|AFV31131.1| cytochrome P450 79B1 [Brassica napus]
Length=541

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/517 (48%), Positives = 359/517 (69%), Gaps = 8/517 (2%)
 Frame = +1

Query  67    LFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGVM  246
             L T+   V I  +I   K     +   L +PPGP  WP++G IP +L+++P FRW+H +M
Sbjct  27    LTTLQAFVAITLVILLKKMITNPNKKKLYLPPGPTGWPIIGMIPAMLKSRPVFRWLHSIM  86

Query  247   DEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFLP  426
              ++ TEIAC+RLG T VI VT P++ARE LK+QD++F+SRP   +  ++SNGY + +  P
Sbjct  87    KQLNTEIACVRLGNTNVITVTCPKIAREILKQQDALFASRPMTYAQNVLSNGYKTCVITP  146

Query  427   YGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVRQ  606
             +GE++ K R+++ + ++ PA   WL  KR EE DHL  ++YN  K S +      VD R 
Sbjct  147   FGEQFKKMRKVVMTGLVCPARHRWLHQKRAEENDHLTAWVYNMVKNSGS------VDFRF  200

Query  607   ATRHYCGNVTKKMLFNKRYFGSG-AADGGPGAVDEELLKAVFTILRYLYGLGVADYIPWL  783
              TRHYCGN  KK++F  R F    AADGGP A D + ++A+F  L + +   ++DY+P L
Sbjct  201   VTRHYCGNAIKKLMFGTRTFSENTAADGGPTAEDIDHMEAMFEALGFTFAFCISDYLPML  260

Query  784   SIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRPM  963
             +  DL+GH+ I+  + A+  K+ D  +D RI+MWK+G +T  ED +D+ + +KD +G P+
Sbjct  261   TGLDLNGHEKIMRDSSAIMDKYHDPIIDGRIKMWKEGKRTQIEDFLDIFISIKDEEGNPL  320

Query  964   LSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESD  1143
             L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+EE+D VVG+ER+VQESD
Sbjct  321   LTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEEIDRVVGKERIVQESD  380

Query  1144  LPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAW  1323
             +P LNY+KA ++E FRLHP+A F  PH++  DT V GY IPKGSQV++SR GLGRN + W
Sbjct  381   IPKLNYVKAILREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVW  440

Query  1324  EDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTW  1500
              DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+QGFTW
Sbjct  441   ADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTW  500

Query  1501  RVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             ++P +   ++L ES +D+FL  PL  + + RLP +LY
Sbjct  501   KLPENETRVELMESSYDMFLAKPLVMVGELRLPEHLY  537



>ref|XP_009138546.1| PREDICTED: cytochrome P450 79B1-like [Brassica rapa]
 gb|ACR10254.1| cytochrome P450 79b2 [Brassica rapa subsp. pekinensis]
Length=541

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/488 (49%), Positives = 347/488 (71%), Gaps = 8/488 (2%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP  WP++G IP +L+++P FRW+H +M ++ TEIAC+RLG T VI VT P++ARE 
Sbjct  56    LPPGPIGWPIIGMIPAMLKSRPVFRWLHSIMKQLNTEIACVRLGNTNVITVTCPKIAREV  115

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK+QD++F+SRP   +  ++SNGY + +  P+GE++ K R+++ + ++ PA   WL  KR
Sbjct  116   LKQQDALFASRPMTYAQNVLSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKR  175

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSG-AADGG  690
              EE DHL  ++YN  K S +      VD R  TRHYCGN  KK++F  R F    AADGG
Sbjct  176   AEENDHLTAWVYNMVKNSGS------VDFRFVTRHYCGNAIKKLMFGTRTFSENTAADGG  229

Query  691   PGAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDE  870
             P A D + + A+F  L + +   ++DY+P L+  DL+GH+ I+  + A+  K+ D  +D 
Sbjct  230   PTAEDSDHMDAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIIDG  289

Query  871   RIQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWAL  1050
             RI+MWK+G +T  ED +D+ + +KD +G P+L+  EIK  + E+++AA DNPSNAVEWA+
Sbjct  290   RIKMWKEGKRTQIEDFLDIFISIKDEEGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAM  349

Query  1051  AEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLS  1230
             AEM+N+P++L KA+EE+D VVG+ER+VQESD+P LN +KA ++E FRLHP+A F  PH++
Sbjct  350   AEMVNKPEILRKAMEEIDRVVGKERIVQESDIPKLNNVKAILREAFRLHPVAAFNLPHVA  409

Query  1231  TKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMS  1407
               DT V GY IPKGSQV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +S
Sbjct  410   LSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWTDPLSFKPERHLNECSEVTLTENDLRFIS  469

Query  1408  FSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAK  1587
             FS G+RGC    LG+ ++ M++ARL+QGFTW++P +   ++L ES HD+FL  PL  + +
Sbjct  470   FSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGE  529

Query  1588  PRLPSNLY  1611
              RLP +LY
Sbjct  530   LRLPEHLY  537



>emb|CDY39472.1| BnaC03g60820D [Brassica napus]
Length=518

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/520 (47%), Positives = 363/520 (70%), Gaps = 9/520 (2%)
 Frame = +1

Query  61    LALFTVMLS-VTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIH  237
             + L T++ + VTI  ++   K     +   +S+PPGP  WP++G IP +L+++P FRW+H
Sbjct  1     MYLLTILQAFVTITLVMLLKKLITNRNKKKISLPPGPTGWPIIGMIPAMLKSRPVFRWLH  60

Query  238   GVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSL  417
              +M ++ TEIAC++LG T+V+ VT P++ARE LK+QD++F+SRP   +  ++SNGY + +
Sbjct  61    SIMKQLNTEIACVKLGNTHVVTVTCPKIAREILKQQDALFASRPMTYAQNVLSNGYKTCV  120

Query  418   FLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVD  597
               P+GE++ K R+++ + ++ PA   WL  KR EE DHL  ++YN  K S +      VD
Sbjct  121   ITPFGEQFKKMRKVVMTELVCPARHRWLHLKRAEENDHLTAWLYNMVKNSGS------VD  174

Query  598   VRQATRHYCGNVTKKMLFNKRYFGSGAA-DGGPGAVDEELLKAVFTILRYLYGLGVADYI  774
              R  TRHYCGN  KK++F  R F   AA DGGP A D E ++A+F  L + +   ++DY+
Sbjct  175   FRFVTRHYCGNAIKKLMFGTRTFSENAAPDGGPTAEDIEHMEAMFEALGFTFAFCISDYL  234

Query  775   PWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDG  954
             P L+  DL+GH+ I+  + A+  K+ D  +D RI+MW++G +T  ED +D+ + +KD  G
Sbjct  235   PMLTGLDLNGHEKIMRDSSAIMDKYHDPIIDARIKMWREGKRTQIEDFLDIFISIKDEQG  294

Query  955   RPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQ  1134
              P+L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+EE+D VVG+ERLVQ
Sbjct  295   NPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEELDRVVGKERLVQ  354

Query  1135  ESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNK  1314
             ESD+P LNY+KA ++E FRLHP+A F  PH++  D  V GY IPKGSQV++SR GLGRN 
Sbjct  355   ESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYHIPKGSQVLLSRYGLGRNP  414

Query  1315  RAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQG  1491
             + W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+QG
Sbjct  415   KVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTALTTMMLARLLQG  474

Query  1492  FTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             FTW++P +   ++L ES HD+FL  PL  + + RLP +LY
Sbjct  475   FTWKLPENETRVELMESSHDMFLCKPLVMVGELRLPEHLY  514



>ref|XP_006283476.1| hypothetical protein CARUB_v10004524mg [Capsella rubella]
 gb|EOA16374.1| hypothetical protein CARUB_v10004524mg [Capsella rubella]
Length=547

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/533 (47%), Positives = 364/533 (68%), Gaps = 9/533 (2%)
 Frame = +1

Query  22    MRYLRFSSIIFLP-LALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIP  198
             M    FS++  L  L  F  ++ VT+   +  T     SS+   S+PPGP  WP++G IP
Sbjct  17    METSSFSTLYLLTTLQAFVAIILVTLLKKMMSTTTTDPSSAKKPSLPPGPTGWPIIGMIP  76

Query  199   EILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCM  378
              +L+++P FRW+H +M ++ TEIAC+RLG T+VI VT P++ARE LK+QDS+F+SRP   
Sbjct  77    AMLKSRPVFRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREMLKQQDSLFASRPLTY  136

Query  379   SAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQC  558
             +  ++SNGY + +  P+G+++ K R+++ + ++ PA   WL  KR EE DHL  ++YN  
Sbjct  137   AQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKRSEENDHLTAWVYNMV  196

Query  559   KISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAA-DGGPGAVDEELLKAVFTI  735
             K S +      VD R  TRHYCGN  KK++F  R F    A DG P   D E ++A+F  
Sbjct  197   KNSGS------VDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGAPTVEDVEHMEAMFEA  250

Query  736   LRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEED  915
             L + +   ++DY+P L+  DL+GH+ I+  + A+  K+ D  +DERI+MW++G +T  ED
Sbjct  251   LGFTFAFCISDYLPMLTGLDLNGHEKIMRDSSAIMDKYHDPIIDERIKMWREGKRTQIED  310

Query  916   IVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVE  1095
              +D+ + +KD  G P+L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+E
Sbjct  311   FLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAME  370

Query  1096  EVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGS  1275
             E+D VVG+ERLVQESD+  LNY+KA ++E FRLHP+A F  PH++  +T V GY IPKGS
Sbjct  371   EIDRVVGKERLVQESDISKLNYVKAILREAFRLHPVAAFNLPHVALSETTVAGYHIPKGS  430

Query  1276  QVIISRTGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGS  1452
             QV++SR GLGRN + W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+
Sbjct  431   QVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGT  490

Query  1453  LMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              ++ ML+ARL+QGFTW++P     ++L ES HD+FL  PL  + + RLP +LY
Sbjct  491   ALTTMLLARLLQGFTWKLPESETRVELIESSHDMFLAKPLVMVGELRLPEHLY  543



>emb|CDY25587.1| BnaA04g12790D [Brassica napus]
Length=543

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/527 (47%), Positives = 363/527 (69%), Gaps = 11/527 (2%)
 Frame = +1

Query  37    FSSIIFLPLALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNK  216
             FS++ FL      V++S+    +I K  K    +     +PPGP  +P+VG +P +L+N+
Sbjct  22    FSNMYFLTTLQALVVISL---LMIIKKIKSSSHNKKLHPLPPGPSGFPIVGMLPAMLKNR  78

Query  217   PAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLIS  396
             P FRW+H +M E+ TEIAC+RLG T+VIPVT P++ARE  K+QD++F+SRP   +  ++S
Sbjct  79    PVFRWLHSLMKELNTEIACVRLGNTHVIPVTCPKIAREIFKQQDALFASRPLTYAQKILS  138

Query  397   NGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEAS  576
             NGY + +  P+GE++ K R+++ + ++ PA   WL + R EE DHL  ++YN  K SE  
Sbjct  139   NGYKTCVITPFGEQFKKMRKVIMTEIVCPARHRWLHDNRAEETDHLTAWLYNMVKNSEP-  197

Query  577   AMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGA-ADGGPGAVDEELLKAVFTILRYLYG  753
                  VD+R  TRHYCGN  K+++F  R F      DGGP   D E ++A+F  L + + 
Sbjct  198   -----VDLRFVTRHYCGNAIKRLMFGTRTFSEKTKTDGGPTMEDIEHMEAMFEGLGFTFA  252

Query  754   LGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLV  933
               V+DY+P L+  DL+GH+ I+ +A A+  K+ D  +DE+I+MW++G +T  ED +D+ +
Sbjct  253   FCVSDYLPMLTGLDLNGHEKIMREASAIMDKYHDPIIDEKIKMWREGKRTQIEDFLDIFI  312

Query  934   KLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVV  1113
              +KD DG P+L+  EIK  + E+++AA DNPSNAVEWA+AEMIN+P++L+KA+EE++ VV
Sbjct  313   SIKDADGHPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMINKPEILQKAIEEIERVV  372

Query  1114  GRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISR  1293
             G+ERLVQESD+P LNY+KA ++E FRLHP+A F  PH++  DT V GY IPKGSQV++SR
Sbjct  373   GKERLVQESDIPKLNYLKAIIREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQVLLSR  432

Query  1294  TGLGRNKRAWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVML  1470
              GLGRN + W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++VM+
Sbjct  433   YGLGRNPKVWSDPLSFKPERHLNECLEVTLTENDLRFISFSTGKRGCAAPALGTAITVMM  492

Query  1471  MARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             +ARL+QGF W++      ++L ES HD+FL  PL  + + RL   LY
Sbjct  493   LARLLQGFKWKLAGGETRVELMESSHDMFLAKPLVMVGELRLSEELY  539



>gb|KDO39922.1| hypothetical protein CISIN_1g035533mg [Citrus sinensis]
Length=503

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 257/497 (52%), Positives = 340/497 (68%), Gaps = 29/497 (6%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP P P+VG++ ++ R KPAF WIH VM E+ T+IACIRLG  ++IPVTSP++A E 
Sbjct  20    LPPGPSPCPIVGNLQDMWRKKPAFNWIHDVMKELNTDIACIRLGNVHIIPVTSPKIALEV  79

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LK  DS F++RP  M     S G+LS   +P G++W K R+++ SHVL  A  H L+ KR
Sbjct  80    LKDNDSTFATRPLTMGTEYSSRGFLSIAVVPLGQQWKKMRKVVASHVLCSARLHSLLFKR  139

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
              EEAD+L+RF+YNQC     S  G+VV+VR A R YCGNV + M+FN+RYFG G  DGGP
Sbjct  140   REEADNLVRFVYNQCC---KSGSGSVVNVRHAARQYCGNVMRNMMFNRRYFGEGIEDGGP  196

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE ++++F +L++LY   ++DY+P                A+    K+ D  ++ER
Sbjct  197   GFEEEEHVESLFIVLQHLYSFTLSDYLP--------------CDAIRTVSKYHDPIIEER  242

Query  874   IQM-------WKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSN  1032
             IQ        +K G+    +D++D L+  KD  GRP LS  EIK Q +++M+A +DNPSN
Sbjct  243   IQQRSHHHGNYKKGSDD-HQDLLDALISAKDETGRPSLSVDEIKAQCMDLMLATVDNPSN  301

Query  1033  AVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPF  1212
             AVEWAL EMINQP +L+KA E VD  VG+ERLVQE D+P LNY+KAC++E  RLHP+APF
Sbjct  302   AVEWALGEMINQPDILKKAKEGVDMFVGKERLVQEYDIPQLNYVKACLREALRLHPVAPF  361

Query  1213  TPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGED----VVL  1380
               PH+ST+D  + GYFIPKGS V++SR GLGRN   W+DPLKF PERH+   D    V L
Sbjct  362   NLPHVSTRDATIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVEL  421

Query  1381  TDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFL  1560
             T+ EL+ +SF  GRRGC GV LGS MSV+L+ARL+QGF W +P+    IDL ESK+DL +
Sbjct  422   TEPELRFVSFGRGRRGCMGVALGSEMSVILLARLLQGFDWSLPSHEEKIDLAESKYDLLM  481

Query  1561  ENPLFALAKPRLPSNLY  1611
               P+ A AKPRL + LY
Sbjct  482   AKPMHARAKPRLAAELY  498



>emb|CBI25374.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   533 bits (1374),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 248/486 (51%), Positives = 337/486 (69%), Gaps = 42/486 (9%)
 Frame = +1

Query  154   IPPGPKPWPLVGSIPEILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREF  333
             +PPGP PWPLVG++PE+   KP FRWI G+++E+ TEIACI+LG  +VIPV SPE+AREF
Sbjct  131   LPPGPTPWPLVGNLPELFTKKPVFRWILGLLEELNTEIACIKLGNVHVIPVISPEIAREF  190

Query  334   LKKQDSIFSSRPRCMSAGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKR  513
             LKK D++F+SRP  M++  +S G+L++   P+GE                          
Sbjct  191   LKKHDAVFASRPITMASHHLSRGFLTTALSPWGE--------------------------  224

Query  514   VEEADHLLRFIYNQCKISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGP  693
                  H   F+ +           +VV+VR A R Y GN+ +KM+F++RYFG G  DGGP
Sbjct  225   -----HTDNFMDS-----------SVVNVRNAVRQYTGNIVRKMMFSRRYFGEGRKDGGP  268

Query  694   GAVDEELLKAVFTILRYLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDER  873
             G  +EE + ++FT L YLY    +DY+P L +FDLDGH+ ++ +AL++  KH D  VD+R
Sbjct  269   GLEEEEHVNSLFTSLAYLYAFSPSDYLPCLRVFDLDGHEKMVKEALSIISKHHDPIVDDR  328

Query  874   IQMWKDGTKTVEEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALA  1053
             I  W++G K   EDI+DV + + D  G+P+LS +EIK Q++E+MI  +DNP++A EWA+A
Sbjct  329   IIQWRNGEKKEVEDILDVFITISDTKGKPLLSVEEIKAQLIELMIEIVDNPAHAAEWAMA  388

Query  1054  EMINQPKLLEKAVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLST  1233
             EMINQP++++KAVEE+D VVG++RLVQESD+  L Y+KAC +E  RLHPIAPF  PH+S 
Sbjct  389   EMINQPEIMQKAVEEIDRVVGKDRLVQESDIAQLKYVKACAREALRLHPIAPFNVPHVSM  448

Query  1234  KDTVVGGYFIPKGSQVIISRTGLGRNKRAWEDPLKFKPERHLNGEDVVLTDSELKMMSFS  1413
              D VV GYFIPKGS V++SR GLGRN R WE+PLKFKPERH+N E V L +SEL+ +SFS
Sbjct  449   ADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEVVDLAESELRFISFS  508

Query  1414  AGRRGCPGVKLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPR  1593
              GRRGCPG  LG+ ++V L+ARL+Q F+W VP +   IDL ES ++LFL  PL A AKPR
Sbjct  509   TGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQNQIDLKESMNELFLAKPLHAHAKPR  568

Query  1594  LPSNLY  1611
               +++Y
Sbjct  569   FHASMY  574



>gb|KCW62253.1| hypothetical protein EUGRSUZ_H04913 [Eucalyptus grandis]
Length=473

 Score =   530 bits (1364),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 249/477 (52%), Positives = 343/477 (72%), Gaps = 13/477 (3%)
 Frame = +1

Query  202   ILRNKPAFRWIHGVMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMS  381
             + RNKPA RWI   M+EM T IAC R+G T+VIPVT P++A+E LKKQD+ F+SRP  M+
Sbjct  1     MFRNKPAARWILRWMEEMDTGIACFRIGNTHVIPVTDPKIAQEILKKQDATFASRPVSMA  60

Query  382   AGLISNGYLSSLFLPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCK  561
             A   S GY++++  PYGE+W K RR+LTS ++ PA   WL +KR EEAD+L++ ++NQCK
Sbjct  61    ARAFSGGYVTAVISPYGEQWKKMRRVLTSEIICPARHKWLHDKRAEEADNLVKHVFNQCK  120

Query  562   ISEASAMGAVVDVRQATRHYCGNVTKKMLFNKRYFGSGAADGGPGAVDEELLKAVFTILR  741
                  ++G V ++R  TRHYCGN  ++++FNKRYFG    DGG    +E+ + A+F  L 
Sbjct  121   -----SLGQV-NLRHTTRHYCGNAIRRLVFNKRYFGKARKDGGQTIDEEQHVDALFNALN  174

Query  742   YLYGLGVADYIPWLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGT-----KTV  906
             YLY   V+DY P+L   DLDGH+ ++       R+  +  ++ERI+ W+D +     +T 
Sbjct  175   YLYAFCVSDYFPFLVGLDLDGHEKVVKDCTRTFRRLHEPIINERIKQWRDDSSSQSNRTE  234

Query  907   EEDIVDVLVKLKDNDGRPMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEK  1086
              +D++DVL+ LKD+ G+P+L+  E+K Q  EIM+AA+DNPSNAVEWA+AEMIN+P+LL+K
Sbjct  235   PQDLLDVLIMLKDSQGKPLLTPHEVKAQATEIMMAAVDNPSNAVEWAMAEMINRPELLKK  294

Query  1087  AVEEVDNVVGRERLVQESDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIP  1266
             A EE+D VVG+ERLVQESD+  LNYIKAC +E  RLHPIAPF  PH++  D V+ GY IP
Sbjct  295   AKEEIDRVVGKERLVQESDICQLNYIKACAREALRLHPIAPFNVPHVALSDAVMAGYRIP  354

Query  1267  KGSQVIISRTGLGRNKRAWEDPLKFKPERHL--NGEDVVLTDSELKMMSFSAGRRGCPGV  1440
             KGS +++SR GLGRN + W++PLKFKPERH+  + E+V+L +  L+ +SFS GRRGC   
Sbjct  355   KGSHILVSRMGLGRNPKVWDEPLKFKPERHITSDTEEVLLAEPNLRFISFSMGRRGCIAA  414

Query  1441  KLGSLMSVMLMARLIQGFTWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             +LG+ M+VML+ARLIQGF W   A+   I+L ESK+DL L  PL A +KP L ++LY
Sbjct  415   QLGTTMTVMLLARLIQGFNWSPLANDSSINLNESKNDLSLAKPLVAQSKPCLANHLY  471



>emb|CDX90374.1| BnaA08g16100D [Brassica napus]
Length=518

 Score =   531 bits (1368),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 244/518 (47%), Positives = 359/518 (69%), Gaps = 14/518 (3%)
 Frame = +1

Query  64    ALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHGV  243
             A  T+ L + ++ LI    K        +S+PPGP  WP++G IP +L+++P FRW+H +
Sbjct  9     AFVTITLVMLLKKLITNRNK------KKISLPPGPTGWPIIGMIPAMLKSRPVFRWLHSI  62

Query  244   MDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLFL  423
             M ++ TEIAC++LG T+VI VT P++ARE LK+QD++F+SRP   +  ++SNGY + +  
Sbjct  63    MKQLNTEIACVKLGNTHVITVTCPKIAREILKQQDALFASRPMTYAQNVLSNGYKTCVIT  122

Query  424   PYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDVR  603
             P+GE++ K R+++ + ++ PA   WL  KR EE DHL  ++YN  K S +      VD R
Sbjct  123   PFGEQFKKMRKVVMTELVCPARHRWLHQKRAEENDHLTAWLYNMVKNSGS------VDFR  176

Query  604   QATRHYCGNVTKKMLFNKRYFGSGAA-DGGPGAVDEELLKAVFTILRYLYGLGVADYIPW  780
               TRHYCGN  KK++F  R F    A DGGP A D E ++A+F  L + +   ++DY+P 
Sbjct  177   FVTRHYCGNAIKKLMFGTRTFSENTAPDGGPTAEDIEHMEAMFEALGFTFAFCISDYLPM  236

Query  781   LSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGRP  960
             L+  DL+GH+ I+  + A+  K+ D  +D RI+MW++G +T  ED +D+ + +KD  G P
Sbjct  237   LTGLDLNGHEKIMRDSSAIMDKYHDPIIDARIKMWREGKRTQIEDFLDIFISIKDEQGNP  296

Query  961   MLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQES  1140
             +L+  EIK  + E+++AA DNPSNAVEWA+AEM+N+P++L KA+EE++ VVG+ERLVQES
Sbjct  297   LLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEELERVVGKERLVQES  356

Query  1141  DLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKRA  1320
             D+P LNY+KA ++E FRLHP+A F  PH++  D  V GY IPKGSQV++SR GLGRN + 
Sbjct  357   DIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKV  416

Query  1321  WEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGFT  1497
             W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+QGFT
Sbjct  417   WADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPTLGTALTTMMLARLLQGFT  476

Query  1498  WRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
             W++P +   ++L ES HD+FL  PL  + + RLP +LY
Sbjct  477   WKLPENETRVELMESSHDMFLCKPLVMVGELRLPEHLY  514



>ref|XP_002878610.1| CYP79B3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54869.1| CYP79B3 [Arabidopsis lyrata subsp. lyrata]
Length=543

 Score =   531 bits (1369),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 244/519 (47%), Positives = 356/519 (69%), Gaps = 9/519 (2%)
 Frame = +1

Query  61    LALFTVMLSVTIQWLIYKTKKWYGssssslsIPPGPKPWPLVGSIPEILRNKPAFRWIHG  240
             L  F  ++++++  +I K  K    +     +PPGP  +P+VG IP +L+N+P FRW+H 
Sbjct  28    LTTFQALVAISL-LMILKKLKSSSRNKKLHPLPPGPTGFPIVGMIPAMLKNRPVFRWLHS  86

Query  241   VMDEMKTEIACIRLGGTYVIPVTSPELAREFLKKQDSIFSSRPRCMSAGLISNGYLSSLF  420
             +M E+ TEIAC+RLG TYVIPVT P++ARE  K+QD++F+SRP   +  ++SNGY + + 
Sbjct  87    LMKELNTEIACVRLGNTYVIPVTCPKIAREIFKQQDALFASRPLTYAQKILSNGYKTCVI  146

Query  421   LPYGEEWTKKRRILTSHVLSPATQHWLVNKRVEEADHLLRFIYNQCKISEASAMGAVVDV  600
              P+GE++ K R+++ + ++ PA   WL + R EE DHL  ++YN  K SE       VD+
Sbjct  147   TPFGEQFKKMRKVIMTEIVCPARHRWLHDNRAEETDHLTAWLYNMVKNSEP------VDL  200

Query  601   RQATRHYCGNVTKKMLFNKRYFGSGA-ADGGPGAVDEELLKAVFTILRYLYGLGVADYIP  777
             R  TRHYCGN  K+++F  R F      DGGP   D E +  +F  L + +   V+DY+P
Sbjct  201   RFVTRHYCGNAIKRLMFGTRTFSEKTETDGGPTLEDIEHMDGMFEGLGFTFAFCVSDYLP  260

Query  778   WLSIFDLDGHKSIITKALAVTRKHLDTQVDERIQMWKDGTKTVEEDIVDVLVKLKDNDGR  957
              L+  DL+GH+ I+ +A A+  K+ D  +DERI+MW++G +T  ED +D+ + +KD  G+
Sbjct  261   ILTGLDLNGHEKIMREASAIMDKYHDPIIDERIKMWREGQRTKIEDFLDIFISIKDEAGQ  320

Query  958   PMLSDKEIKTQVLEIMIAALDNPSNAVEWALAEMINQPKLLEKAVEEVDNVVGRERLVQE  1137
             P+L+  EIK  + E+++AA DNPSNAVEWA+AEMIN+P++L KA+EE+D VVG+ER VQE
Sbjct  321   PLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMINKPEILHKAMEEIDRVVGKERFVQE  380

Query  1138  SDLPNLNYIKACVKEGFRLHPIAPFTPPHLSTKDTVVGGYFIPKGSQVIISRTGLGRNKR  1317
             SD+P LNY+KA ++E FRLHP+A F  PH++  DT V GY IPKGSQV++SR GLGRN +
Sbjct  381   SDIPKLNYLKAIIREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPK  440

Query  1318  AWEDPLKFKPERHLN-GEDVVLTDSELKMMSFSAGRRGCPGVKLGSLMSVMLMARLIQGF  1494
              W DPL FKPERHLN   +V LT+++L+ +SFS G+RGC    LG+ ++ M++ARL+QGF
Sbjct  441   VWSDPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTAITTMMLARLLQGF  500

Query  1495  TWRVPADLPCIDLTESKHDLFLENPLFALAKPRLPSNLY  1611
              W++      ++L ES HD+FL  PL  + + RL  +LY
Sbjct  501   KWKLAGSETRVELMESSHDMFLSKPLVMVGELRLSEDLY  539



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4791533042520