BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16366_g2_i2 len=1205 path=[1130:0-629 1760:630-1006 2137:1007-1030
2557:1031-1204]

Length=1205
                                                                      Score     E

ref|XP_009625854.1|  PREDICTED: agamous-like MADS-box protein AGL...    294   4e-94   
gb|AAO12211.1|AF385746_1  MADS11                                        293   2e-93   Nicotiana tabacum [American tobacco]
ref|NP_001289508.1|  agamous-like MADS-box protein AGL8 homolog         292   3e-93   
gb|AAF19721.1|AF176782_1  MADS box transcription factor                 289   4e-92   Petunia x hybrida [garden petunia]
gb|AAF19164.1|AF176783_1  floral binding protein 26                     286   5e-91   Petunia x hybrida [garden petunia]
gb|AAD01421.1|  NAP1-1                                                  285   2e-90   Nicotiana tabacum [American tobacco]
gb|AHW58040.1|  FUL                                                     284   4e-90   
gb|AGT21643.1|  PFFUL2                                                  283   1e-89   
ref|XP_010318872.1|  PREDICTED: agamous-like MADS-box protein AGL...    280   1e-88   
dbj|BAK20018.1|  PgMADS protein3                                        279   3e-88   
gb|AAF22139.2|AF130118_1  MADS box protein                              278   1e-87   Capsicum annuum
ref|XP_006345101.1|  PREDICTED: agamous-like MADS-box protein AGL...    275   1e-86   
ref|NP_001275142.1|  agamous-like MADS-box protein AGL8 homolog         271   6e-85   
gb|KDP31379.1|  hypothetical protein JCGZ_11755                         270   1e-84   
ref|NP_001234173.1|  TDR4 transcription factor                          266   3e-83   
ref|XP_009603844.1|  PREDICTED: agamous-like MADS-box protein AGL...    265   1e-82   
dbj|BAG68947.1|  APETALA1/FRUITFUL like protein                         265   2e-82   Hydrangea macrophylla
ref|XP_008393256.1|  PREDICTED: truncated transcription factor CA...    265   2e-82   
ref|XP_010678364.1|  PREDICTED: truncated transcription factor CA...    264   3e-82   
gb|AAC83170.1|  MADS-box protein 2                                      263   7e-82   Malus domestica [apple tree]
gb|ABF82231.1|  fruitfull-like MADS-box protein                         263   8e-82   Nicotiana tabacum [American tobacco]
ref|NP_001281024.1|  truncated transcription factor CAULIFLOWER A...    263   1e-81   
gb|AGT21642.1|  PFFUL1                                                  261   2e-81   
ref|XP_008393257.1|  PREDICTED: truncated transcription factor CA...    261   4e-81   
emb|CDP17843.1|  unnamed protein product                                259   1e-80   
gb|AGA01526.1|  SQUA-like protein                                       259   1e-80   
ref|XP_011086917.1|  PREDICTED: truncated transcription factor CA...    259   2e-80   
gb|AEJ76845.1|  MADS22                                                  258   8e-80   
ref|NP_001268210.1|  apetala1                                           257   1e-79   
gb|AFW15783.1|  APL1                                                    257   1e-79   
gb|AAT07447.1|  AP1-like protein                                        256   2e-79   Vitis vinifera
ref|XP_008453689.1|  PREDICTED: truncated transcription factor CA...    256   3e-79   
ref|XP_011013299.1|  PREDICTED: truncated transcription factor CA...    255   4e-79   
sp|O22328.1|AGL8_SOLCO  RecName: Full=Agamous-like MADS-box prote...    255   1e-78   Solanum commersonii
emb|CAX65663.1|  GSQUA5 protein                                         254   1e-78   Gerbera hybrid cultivar
ref|XP_007037634.1|  AGAMOUS-like 8 isoform 1                           254   2e-78   
gb|ABG49518.1|  FUL-like protein 1                                      254   2e-78   Euptelea pleiosperma
dbj|BAM37621.1|  MASDS-box protein                                      253   4e-78   
gb|ABG49519.1|  FUL-like protein 2                                      250   6e-77   Euptelea pleiosperma
ref|XP_002263017.1|  PREDICTED: truncated transcription factor CA...    250   6e-77   Vitis vinifera
ref|XP_008374664.1|  PREDICTED: truncated transcription factor CA...    250   6e-77   
emb|CAX65664.1|  GSQUA6 protein                                         249   7e-77   Gerbera hybrid cultivar
gb|ABQ85945.1|  MADS-box transcription factor FUL-like 2                249   9e-77   Trochodendron aralioides
ref|XP_009337966.1|  PREDICTED: truncated transcription factor CA...    249   1e-76   
gb|ACD62902.1|  fruitfull-like protein                                  249   1e-76   Ipomoea nil [qian niu]
ref|XP_010257957.1|  PREDICTED: truncated transcription factor CA...    249   2e-76   
gb|AFX72884.1|  MADS-box protein FL1A                                   249   2e-76   
gb|ACE75945.2|  FRUITFULL                                               249   2e-76   Spinacia oleracea
gb|AGX01589.1|  FRUITFULL-like protein                                  248   3e-76   
emb|CAA67967.1|  MADS3 protein                                          248   4e-76   Betula pendula [white birch]
ref|XP_008374663.1|  PREDICTED: truncated transcription factor CA...    248   6e-76   
ref|XP_008453619.1|  PREDICTED: truncated transcription factor CA...    248   7e-76   
ref|XP_010260844.1|  PREDICTED: truncated transcription factor CA...    247   9e-76   
gb|AGX01553.1|  FRUITFULL-like protein                                  246   1e-75   
gb|ABB22022.1|  MdMads2.2 protein                                       247   2e-75   Malus domestica [apple tree]
gb|AEX58637.1|  FUL-like protein                                        247   2e-75   
ref|XP_009337973.1|  PREDICTED: truncated transcription factor CA...    247   2e-75   
ref|XP_010037260.1|  PREDICTED: truncated transcription factor CA...    246   3e-75   
gb|AFX72885.1|  MADS-box protein FL1B                                   245   4e-75   
emb|CAA67969.1|  MADS5 protein                                          245   5e-75   Betula pendula [white birch]
dbj|BAK20017.1|  PgMADS protein2                                        245   5e-75   
ref|XP_007138377.1|  hypothetical protein PHAVU_009G203400g             245   6e-75   
gb|ADC79705.1|  FRUITFULL-like protein                                  243   2e-74   Akebia trifoliata
dbj|BAL14660.1|  APETALA1 and FRUITFULL like protein                    243   2e-74   
gb|ABG49526.1|  FUL-like protein 2                                      244   2e-74   Sinofranchetia chinensis
ref|XP_004299280.1|  PREDICTED: agamous-like MADS-box protein AGL...    244   2e-74   
gb|AGX01542.1|  FRUITFULL-like protein                                  243   3e-74   
gb|KCW83765.1|  hypothetical protein EUGRSUZ_B00634                     243   3e-74   
gb|ABQ85944.1|  MADS-box transcription factor FUL-like 1                243   3e-74   Trochodendron aralioides
ref|XP_007209500.1|  hypothetical protein PRUPE_ppa010308mg             243   3e-74   
gb|AGX01556.1|  FRUITFULL-like protein                                  243   4e-74   
gb|AGX01552.1|  FRUITFULL-like protein                                  243   4e-74   
ref|XP_008240080.1|  PREDICTED: truncated transcription factor CA...    243   5e-74   
gb|AHI42988.1|  MADS-box protein                                        243   5e-74   
gb|AAU29514.1|  MADS6                                                   243   6e-74   Prunus persica
dbj|BAN89458.1|  FUL-like MADS-box transcription factor                 243   6e-74   
ref|XP_009346308.1|  PREDICTED: truncated transcription factor CA...    243   7e-74   
gb|AAO22981.1|  MADS-box transcription factor CDM8                      242   7e-74   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006581051.1|  PREDICTED: uncharacterized protein LOC100816...    242   9e-74   
gb|ABK92820.1|  unknown                                                 242   9e-74   Populus trichocarpa [western balsam poplar]
gb|KDP41335.1|  hypothetical protein JCGZ_15742                         242   9e-74   
gb|AFV92462.1|  Mads-box protein                                        242   9e-74   
ref|XP_011013298.1|  PREDICTED: truncated transcription factor CA...    242   1e-73   
gb|AGX01535.1|  FRUITFULL-like protein                                  241   1e-73   
gb|AGX01554.1|  FRUITFULL-like protein                                  241   1e-73   
ref|XP_002514623.1|  mads box protein, putative                         241   1e-73   Ricinus communis
gb|AGX01541.1|  FRUITFULL-like protein                                  241   2e-73   
gb|ACZ36916.1|  MADS-box transcription factor 3                         241   2e-73   Hevea brasiliensis [jebe]
gb|ADK94172.1|  AP1-like protein                                        241   2e-73   
gb|AGY54940.1|  APETALA1                                                241   3e-73   
ref|XP_004137449.1|  PREDICTED: agamous-like MADS-box protein AGL...    241   3e-73   
gb|AAY30857.1|  MADS-box transcription factor                           241   3e-73   Prunus dulcis [sweet almond]
ref|XP_011013297.1|  PREDICTED: truncated transcription factor CA...    240   3e-73   
emb|CAC81068.1|  MADS box transcription factor                          240   4e-73   Daucus carota subsp. sativus
gb|ADU15472.1|  FUL                                                     240   4e-73   
gb|AGX01534.1|  FRUITFULL-like protein                                  240   4e-73   
gb|AGX01538.1|  FRUITFULL-like protein                                  240   4e-73   
ref|XP_008240081.1|  PREDICTED: truncated transcription factor CA...    240   5e-73   
ref|NP_001242674.1|  uncharacterized protein LOC100816836               240   5e-73   
gb|AGX01568.1|  FRUITFULL-like protein                                  239   7e-73   
emb|CAA56659.1|  SLM5                                                   239   1e-72   Silene latifolia
gb|AAP83371.1|  euFUL FRUITFULL-like MADS-box                           238   1e-72   Corylopsis sinensis
gb|AAG30923.1|AF306349_1  MADS box protein AP2L                         239   1e-72   Eucalyptus globulus [blue gum]
gb|AHI85952.1|  AP1                                                     239   1e-72   
gb|AEU08959.1|  APETALA1                                                239   1e-72   
dbj|BAC80249.1|  MADS-box transcription factor                          239   2e-72   Houttuynia cordata [chameleon-plant]
gb|AGX01544.1|  FRUITFULL-like protein                                  239   2e-72   
dbj|BAH36884.1|  APETALA1/FRUITFULL                                     238   2e-72   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGH61290.1|  apetala 1                                               238   3e-72   
gb|AGX01574.1|  FRUITFULL-like protein                                  238   3e-72   
gb|ACR19996.1|  TDR4/Ful-like MADS-box protein                          238   4e-72   Vaccinium myrtillus [bilberry]
gb|AGX01565.1|  FRUITFULL-like protein                                  237   6e-72   
ref|XP_007045796.1|  K-box region and MADS-box transcription fact...    237   6e-72   
gb|AGW23344.1|  MADS box protein MADS42                                 237   6e-72   
gb|AGA61753.1|  apetala 1                                               237   9e-72   
gb|ABV60386.1|  FRUITFUL-like protein                                   236   1e-71   Carica papaya [mamon]
gb|AAP83396.1|  euFUL FRUITFULL-like MADS-box                           235   1e-71   Petunia x hybrida [garden petunia]
gb|AGX01551.1|  FRUITFULL-like protein                                  236   1e-71   
ref|NP_568929.1|  agamous-like MADS-box protein AGL8                    236   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AGX01575.1|  FRUITFULL-like protein                                  236   2e-71   
gb|AGX01543.1|  FRUITFULL-like protein                                  236   2e-71   
gb|AAX53099.1|  AP1-like protein                                        235   2e-71   Magnolia grandiflora [southern magnolia]
ref|NP_001234543.1|  agamous-like MADS-box protein AGL8 homolog         235   3e-71   
ref|XP_009380134.1|  PREDICTED: truncated transcription factor CA...    235   3e-71   
gb|AGA61756.1|  fruitful 2                                              236   3e-71   
gb|AEZ63951.1|  APETALA 1-1                                             235   4e-71   
ref|XP_003522984.1|  PREDICTED: agamous-like MADS-box protein AGL...    235   5e-71   
gb|AEI73137.1|  FRUITFULL-like MADS-box protein                         234   5e-71   
gb|AFV13866.1|  fruitfull-like protein FUL                              234   6e-71   
ref|XP_006477715.1|  PREDICTED: agamous-like MADS-box protein AGL...    234   7e-71   
ref|XP_010660493.1|  PREDICTED: FUL-like protein isoform X1             234   7e-71   
gb|AGX01546.1|  FRUITFULL-like protein                                  234   8e-71   
gb|AGE15496.1|  MADS1                                                   234   9e-71   
ref|NP_001268211.1|  FUL-like protein                                   234   9e-71   
gb|AGA61755.1|  fruitful 1                                              234   1e-70   
ref|XP_010456827.1|  PREDICTED: agamous-like MADS-box protein AGL8      234   1e-70   
ref|XP_010443902.1|  PREDICTED: agamous-like MADS-box protein AGL8      234   1e-70   
ref|XP_004488426.1|  PREDICTED: agamous-like MADS-box protein AGL...    233   2e-70   
gb|AAT07448.1|  FUL-like protein                                        234   2e-70   Vitis vinifera
ref|XP_010031068.1|  PREDICTED: truncated transcription factor CA...    233   2e-70   
gb|AAG24909.1|AF305076_1  MADS-box protein EAP1                         233   2e-70   Eucalyptus globulus [blue gum]
ref|XP_002866402.1|  hypothetical protein ARALYDRAFT_919330             233   2e-70   
gb|AAP32475.1|  MADS-box protein 6                                      233   2e-70   Vitis vinifera
gb|ADM21461.1|  apetala 1                                               233   3e-70   
ref|XP_010037261.1|  PREDICTED: agamous-like MADS-box protein AGL...    231   3e-70   
ref|XP_010316206.1|  PREDICTED: truncated transcription factor CA...    233   3e-70   
gb|AFK43328.1|  unknown                                                 232   4e-70   
ref|XP_009388901.1|  PREDICTED: truncated transcription factor CA...    232   5e-70   
gb|AIX02981.1|  MADS-box protein 1S                                     233   5e-70   
ref|XP_009130138.1|  PREDICTED: agamous-like MADS-box protein AGL8      232   6e-70   
gb|AGX01536.1|  FRUITFULL-like protein                                  232   6e-70   
gb|AGX01587.1|  FRUITFULL-like protein                                  231   8e-70   
gb|ACJ85368.1|  unknown                                                 231   8e-70   Medicago truncatula
dbj|BAP28174.1|  MADS-box transcription factor                          232   1e-69   
gb|ACG70964.1|  APETALA1-like protein                                   231   1e-69   Ziziphus jujuba [Chinese jujube]
ref|XP_003547792.1|  PREDICTED: floral homeotic protein APETALA 1...    231   1e-69   
gb|AGW23343.1|  MADS box protein MADS41                                 231   1e-69   
dbj|BAC53738.1|  PnSAH1                                                 231   1e-69   Ipomoea nil [qian niu]
gb|ACS74808.1|  APETALA1/FUL-like protein                               231   2e-69   Rosa hybrid cultivar
gb|AGT21640.1|  MC                                                      231   2e-69   
ref|XP_009398247.1|  PREDICTED: truncated transcription factor CA...    231   2e-69   
gb|AFV13860.1|  fruitfull-like protein FUL                              230   2e-69   
gb|ABQ08573.1|  MADS-box protein 1                                      231   2e-69   Dendrobium nobile
emb|CBY05400.1|  FRUITFULL-like protein                                 231   2e-69   
ref|XP_010029407.1|  PREDICTED: truncated transcription factor CA...    230   3e-69   
gb|AET74058.1|  MADS23                                                  230   3e-69   
gb|AFR54472.1|  apetala 1-1                                             229   3e-69   
gb|AAP83372.1|  euAP1 APETALA1-like MADS-box                            230   3e-69   Heuchera americana
ref|XP_006394555.1|  hypothetical protein EUTSA_v10004769mg             231   4e-69   
gb|AGX01555.1|  FRUITFULL-like protein                                  229   4e-69   
gb|AEJ76846.1|  MADS23                                                  230   4e-69   
gb|AAQ83693.1|  MADS-box protein                                        229   4e-69   Chloranthus spicatus [cha-ran]
emb|CAA67968.1|  MADS4 protein                                          230   5e-69   Betula pendula [white birch]
ref|XP_006338337.1|  PREDICTED: agamous-like MADS-box protein AGL...    230   5e-69   
gb|AAX13296.1|  MADS box protein AP1a                                   229   5e-69   Lotus japonicus
gb|ACS45102.1|  APETALA1-like protein                                   229   5e-69   Mangifera indica
gb|ADA77531.1|  APETALA1 protein                                        229   6e-69   Solanum tuberosum [potatoes]
ref|NP_001234665.1|  MADS-box transcription factor MADS-MC              229   7e-69   
emb|CAD47852.1|  MADS-box protein FUL-d                                 229   9e-69   Brassica oleracea var. botrytis [cauliflower]
dbj|BAJ22385.1|  APETALA1                                               229   1e-68   
ref|XP_007032866.1|  Agamous-like MADS-box protein AGL8 isoform 1       229   1e-68   
gb|AGW23346.1|  MADS box protein MADS44                                 228   1e-68   
gb|AFA42327.1|  AP1-like transcription factor                           228   1e-68   
gb|AFU81352.1|  FRUITFULLa                                              228   1e-68   
emb|CDP00463.1|  unnamed protein product                                228   1e-68   
emb|CBY05406.1|  FRUITFULL-like protein                                 228   2e-68   
gb|AHW58038.1|  AP1                                                     228   2e-68   
ref|XP_006437876.1|  hypothetical protein CICLE_v10032490mg             228   2e-68   
ref|XP_004144163.1|  PREDICTED: floral homeotic protein APETALA 1...    227   2e-68   
gb|AIC75372.1|  MADS-box transcription factor APETALA1-like protein     228   2e-68   
dbj|BAL70391.1|  apetala1/squamosa protein                              228   2e-68   
gb|AAX69065.1|  MADS box protein M2                                     228   2e-68   Pisum sativum [garden pea]
ref|XP_004508656.1|  PREDICTED: agamous-like MADS-box protein AGL...    228   2e-68   
gb|ACT67688.1|  APETALA1-like protein                                   228   2e-68   Prunus serrulata var. lannesiana [Japanese flowering cherry]
gb|AGW23367.1|  MADS box protein MADS65                                 226   2e-68   
ref|XP_003531957.1|  PREDICTED: floral homeotic protein APETALA 1...    228   3e-68   
gb|AGX01545.1|  FRUITFULL-like protein                                  228   3e-68   
ref|XP_006281003.1|  hypothetical protein CARUB_v10027017mg             228   3e-68   
gb|AGT21646.1|  MPF3                                                    228   3e-68   
ref|XP_009111965.1|  PREDICTED: agamous-like MADS-box protein AGL...    228   3e-68   
gb|AFU81355.1|  FRUITFULLa                                              227   3e-68   
gb|AGR88913.1|  APETALA1-like MADS-box AP1-2                            228   4e-68   
ref|XP_002316076.1|  AP1-like family protein                            228   4e-68   Populus trichocarpa [western balsam poplar]
gb|AAP83389.1|  FRUITFULL-like MADS-box                                 227   4e-68   Pachysandra terminalis
gb|AGX01548.1|  FRUITFULL-like protein                                  227   4e-68   
gb|AGW23345.1|  MADS box protein MADS43                                 227   4e-68   
emb|CBY05413.1|  FRUITFULL-like protein                                 226   4e-68   
gb|AAT46099.1|  FRUITFULL-like protein                                  227   5e-68   Akebia trifoliata
gb|ADU15471.1|  FUL-like protein                                        227   6e-68   
gb|AFD36437.1|  MADS1                                                   227   6e-68   
gb|AFI08227.1|  MADS-box protein                                        226   6e-68   
gb|AIP93871.1|  anthocyanin MADS transcription factor                   227   6e-68   
dbj|BAG71406.1|  transcription factor PnAP1                             227   7e-68   Ipomoea nil [qian niu]
gb|ABS83558.1|  APETALA1-like protein                                   227   7e-68   Alpinia oblongifolia
gb|ACL68407.1|  MAP1                                                    227   7e-68   Mangifera indica
gb|AAP83384.1|  euAP1 APETALA1-like MADS-box                            226   7e-68   Phytolacca americana [common pokeberry]
ref|XP_004297215.1|  PREDICTED: floral homeotic protein APETALA 1...    226   7e-68   
ref|XP_007037635.1|  K-box region and MADS-box transcription fact...    226   7e-68   
ref|XP_011011648.1|  PREDICTED: truncated transcription factor CA...    227   7e-68   
emb|CAD12068.2|  putative MADS600 protein                               228   8e-68   Asarum caudigerum
gb|AAG27459.1|AF305696_1  MADS-box protein EAP2S                        225   9e-68   Eucalyptus globulus [blue gum]
ref|XP_011008142.1|  PREDICTED: truncated transcription factor CA...    226   1e-67   
gb|AAZ76263.1|  AP1-related protein                                     226   1e-67   Phalaenopsis amabilis
dbj|BAK20016.1|  PgMADS protein1                                        226   1e-67   
gb|AAK21258.1|AF335245_1  MADS-box transcription factor FBP29           226   1e-67   Petunia x hybrida [garden petunia]
emb|CAD47851.1|  MADS-box protein FUL-c                                 226   2e-67   Brassica oleracea var. botrytis [cauliflower]
gb|AIU94288.1|  APETALA1-like protein                                   225   2e-67   
gb|ACS74807.2|  APETALA1-like protein 2                                 225   2e-67   Rosa hybrid cultivar
ref|NP_001275828.1|  APETALA1                                           225   3e-67   
gb|AFU81354.1|  FRUITFULLa                                              224   3e-67   
gb|AFX74875.1|  MADS domain transcription factor APL2                   225   3e-67   
gb|AJC01936.1|  MADS-box protein                                        225   4e-67   
gb|AAD01422.1|  NAP1-2                                                  224   4e-67   Nicotiana tabacum [American tobacco]
gb|AAF13261.1|AF198175_1  MADS box protein DOMADS2                      224   4e-67   Dendrobium grex Madame Thong-In
ref|XP_008243811.1|  PREDICTED: truncated transcription factor CA...    224   4e-67   
gb|AFU81353.1|  FRUITFULLa                                              223   5e-67   
emb|CDY02185.1|  BnaA03g39820D                                          224   5e-67   
gb|AFU81349.1|  FRUITFULLa                                              224   5e-67   
gb|AAD39035.1|AF068724_1  MADS-box protein MADS5                        224   6e-67   Nicotiana tabacum [American tobacco]
ref|XP_009778843.1|  PREDICTED: truncated transcription factor CA...    224   6e-67   
sp|Q41274.1|AGL8_SINAL  RecName: Full=Agamous-like MADS-box prote...    224   6e-67   Sinapis alba [bai jie]
gb|AGX01557.1|  FRUITFULL-like protein                                  224   7e-67   
gb|AGX01550.1|  FRUITFULL-like protein                                  224   7e-67   
gb|AGX01539.1|  FRUITFULL-like protein                                  224   8e-67   
ref|XP_008445435.1|  PREDICTED: truncated transcription factor CA...    223   8e-67   
emb|CDY58690.1|  BnaC07g49790D                                          224   8e-67   
gb|AFU81368.1|  FRUITFULLb                                              223   8e-67   
dbj|BAK20019.1|  PgMADS protein4                                        224   9e-67   
gb|AAY82244.1|  SAP1                                                    224   9e-67   Salix discolor [American pussy willow]
gb|AAY82245.1|  SAP1                                                    224   9e-67   Salix discolor [American pussy willow]
gb|ACS74806.2|  APETALA1-like protein                                   224   9e-67   Rosa hybrid cultivar
gb|AFU81360.1|  FRUITFULLb                                              223   1e-66   
ref|XP_007223821.1|  hypothetical protein PRUPE_ppa010723mg             223   1e-66   
emb|CAJ44135.1|  squamosa protein                                       223   1e-66   Misopates orontium
dbj|BAG68946.1|  APETALA1/FRUITFUL like protein                         223   1e-66   Hydrangea macrophylla
gb|AFU81366.1|  FRUITFULLb                                              223   1e-66   
ref|XP_002311353.2|  AP1-like family protein                            223   2e-66   Populus trichocarpa [western balsam poplar]
gb|AAT39554.1|  APETALA1-like MADS-box PTAP1-1                          223   2e-66   Populus trichocarpa [western balsam poplar]
gb|AGR88912.1|  APETALA1-like MADS-box AP1-1                            223   3e-66   
ref|XP_004509754.1|  PREDICTED: floral homeotic protein APETALA 1...    222   3e-66   
gb|AFV13861.1|  fruitfull-like protein FUL                              222   3e-66   
gb|KEH32047.1|  MADS-box transcription factor                           222   4e-66   
ref|XP_004137262.1|  PREDICTED: agamous-like MADS-box protein AGL...    222   4e-66   
gb|AAZ77749.1|  AGL2-like MADS box 4                                    222   4e-66   Castanea mollissima
gb|AFU81367.1|  FRUITFULLb                                              221   4e-66   
ref|XP_010552551.1|  PREDICTED: floral homeotic protein APETALA 1...    222   4e-66   
ref|XP_006578520.1|  PREDICTED: agamous-like MADS-box protein AGL...    222   4e-66   
gb|AGX01537.1|  FRUITFULL-like protein                                  222   4e-66   
ref|XP_009136412.1|  PREDICTED: agamous-like MADS-box protein AGL...    222   5e-66   
gb|AAF12699.2|  PTM1                                                    222   5e-66   Populus tremuloides
gb|AFU81371.1|  FRUITFULLb                                              219   5e-66   
ref|XP_006373396.1|  apetala1 family protein                            222   5e-66   
emb|CAD47850.1|  MADS-box protein FUL-b                                 222   5e-66   Brassica oleracea var. botrytis [cauliflower]
ref|XP_003628742.1|  MADS-box protein BM5A                              222   5e-66   
gb|AFU81351.1|  FRUITFULLa                                              221   5e-66   
gb|AAY84827.1|  transcription factor SQUA                               221   5e-66   Ipomoea batatas [batate]
gb|AAL66379.1|AF461740_1  MADS-box transcription factor MADS4           221   5e-66   Pisum sativum [garden pea]
gb|AGX01560.1|  FRUITFULL-like protein                                  221   5e-66   
gb|AGX01547.1|  FRUITFULL-like protein                                  222   6e-66   
ref|XP_009356440.1|  PREDICTED: truncated transcription factor CA...    221   6e-66   
gb|AGX01558.1|  FRUITFULL-like protein                                  221   6e-66   
ref|XP_006856356.1|  hypothetical protein AMTR_s00047p00181740          221   6e-66   
gb|AAS00057.1|  APETALA-like protein AP1                                221   8e-66   
ref|NP_001289497.1|  truncated transcription factor CAULIFLOWER A...    221   1e-65   
gb|AHB33337.1|  APETALA1                                                221   1e-65   
gb|AGT21641.1|  MSM3                                                    221   1e-65   
ref|XP_002317945.2|  hypothetical protein POPTR_0012s05960g             217   1e-65   
emb|CAD47849.1|  MADS-box protein FUL-a                                 220   1e-65   
ref|XP_009608614.1|  PREDICTED: truncated transcription factor CA...    221   1e-65   
emb|CDY47002.1|  BnaC02g41870D                                          221   1e-65   
ref|XP_010551359.1|  PREDICTED: floral homeotic protein APETALA 1...    221   2e-65   
ref|XP_009608611.1|  PREDICTED: truncated transcription factor CA...    221   2e-65   
gb|AGT21644.1|  PFFL                                                    221   2e-65   
ref|XP_009380135.1|  PREDICTED: truncated transcription factor CA...    220   2e-65   
gb|ABD62862.1|  AP1                                                     220   2e-65   
gb|AGC13077.1|  APETALA 1-2                                             220   2e-65   
emb|CAA45228.1|  SQUA                                                   220   2e-65   
gb|AFU81356.1|  FRUITFULLa                                              219   3e-65   
ref|XP_011021074.1|  PREDICTED: truncated transcription factor CA...    220   3e-65   
ref|XP_009109916.1|  PREDICTED: transcription factor CAULIFLOWER ...    219   3e-65   
gb|AGX01576.1|  FRUITFULL-like protein                                  219   4e-65   
ref|XP_009111964.1|  PREDICTED: agamous-like MADS-box protein AGL...    219   4e-65   
gb|ABG85297.1|  MADS-box protein 5                                      219   5e-65   
gb|AAZ67068.1|  MADS box protein PIM                                    219   6e-65   
dbj|BAG71405.1|  transcription factor PnSAH3                            219   6e-65   
ref|XP_011018990.1|  PREDICTED: truncated transcription factor CA...    219   6e-65   
gb|AFU81369.1|  FRUITFULLb                                              217   6e-65   
gb|ADG59811.1|  SQUAMOSA                                                219   7e-65   
ref|XP_004490236.1|  PREDICTED: floral homeotic protein APETALA 1...    218   8e-65   
gb|AFU81357.1|  FRUITFULLa                                              218   9e-65   
dbj|BAB70749.1|  putative MADS-domain transcription factor MpMADS15     218   9e-65   
gb|AGX01570.1|  FRUITFULL-like protein                                  219   9e-65   
dbj|BAG24491.1|  squamosa                                               219   1e-64   
gb|AAR32118.1|  MADS-box protein                                        218   1e-64   
gb|ABS83559.1|  APETALA1-like protein                                   218   1e-64   
gb|ABD78851.1|  MADS-box transcription factor APETALA1                  216   2e-64   
dbj|BAK18783.2|  MASDS-box protein                                      218   2e-64   
sp|Q9SBK9.1|CAL_BRARP  RecName: Full=Transcription factor CAULIFL...    218   2e-64   
ref|XP_009109914.1|  PREDICTED: transcription factor CAULIFLOWER ...    218   3e-64   
gb|AAX14151.1|  apetala1                                                217   3e-64   
gb|ABS83560.1|  APETALA1-like protein                                   216   3e-64   
gb|AFU81365.1|  FRUITFULLb                                              216   3e-64   
gb|ABD66305.1|  MADS10                                                  217   3e-64   
ref|XP_003549579.1|  PREDICTED: agamous-like MADS-box protein AGL...    217   3e-64   
gb|AAM65504.1|  homeotic protein boi1AP1, putative                      218   3e-64   
emb|CDY34564.1|  BnaC03g56640D                                          216   3e-64   
gb|AGX01579.1|  FRUITFULL-like protein                                  217   4e-64   
gb|AAO22980.1|  MADS-box transcription factor CDM41                     217   4e-64   
ref|XP_007032868.1|  Agamous-like MADS-box protein AGL8 isoform 3       216   4e-64   
dbj|BAA94342.1|  AP1-like MADS box protein                              217   4e-64   
ref|XP_009616788.1|  PREDICTED: truncated transcription factor CA...    217   4e-64   
gb|ABP93401.1|  AP1-1                                                   216   4e-64   
ref|XP_006600606.1|  PREDICTED: agamous-like MADS-box protein AGL...    216   6e-64   
ref|XP_002888703.1|  hypothetical protein ARALYDRAFT_476039             217   6e-64   
ref|XP_010511937.1|  PREDICTED: floral homeotic protein APETALA 1       217   6e-64   
ref|XP_006437877.1|  hypothetical protein CICLE_v10032490mg             217   6e-64   
ref|XP_008794203.1|  PREDICTED: MADS-box transcription factor 14-...    216   7e-64   
gb|KFK41337.1|  floral homeotic protein apetala 1                       217   7e-64   
ref|XP_010681126.1|  PREDICTED: truncated transcription factor CA...    217   7e-64   
emb|CDY07357.1|  BnaA07g24360D                                          218   8e-64   
gb|ACS45103.1|  APETALA1-like protein                                   216   8e-64   
emb|CAA04321.1|  MADS-box protein                                       216   8e-64   
gb|AAF12700.2|  PTM2                                                    216   9e-64   
gb|ADG27452.1|  cauliflower-like protein                                216   9e-64   
gb|ABB59990.1|  MADS-box protein                                        216   9e-64   
ref|XP_010522467.1|  PREDICTED: agamous-like MADS-box protein AGL8      216   1e-63   
ref|XP_010470885.1|  PREDICTED: floral homeotic protein APETALA 1...    216   1e-63   
ref|XP_009105010.1|  PREDICTED: floral homeotic protein APETALA 1...    216   1e-63   
gb|AAM28458.1|AF466782_1  apetala 1                                     216   1e-63   
gb|AAM28447.1|AF466771_1  apetala 1                                     216   1e-63   
gb|ACJ84407.1|  unknown                                                 214   1e-63   
gb|AIX02982.1|  MADS-box protein 1L                                     215   1e-63   
gb|AAM28450.1|AF466774_1  apetala 1                                     216   1e-63   
gb|AAD20329.1|  MADS C-2 protein                                        216   1e-63   
gb|AFU81370.1|  FRUITFULLb                                              215   1e-63   
emb|CAA78909.1|  AP1                                                    216   1e-63   
gb|AIS82596.1|  APETALA 1                                               216   1e-63   
ref|XP_009333659.1|  PREDICTED: truncated transcription factor CA...    216   1e-63   
ref|XP_009105460.1|  PREDICTED: floral homeotic protein APETALA 1       216   1e-63   
gb|ADR83586.1|  FUL-like protein                                        215   2e-63   
ref|XP_006301567.1|  hypothetical protein CARUB_v10022005mg             216   2e-63   
gb|AFU81363.1|  FRUITFULLb                                              214   2e-63   
ref|NP_177074.1|  Floral homeotic protein APETALA 1                     216   2e-63   
gb|AAM28451.1|AF466775_1  apetala 1                                     215   2e-63   
ref|XP_009408635.1|  PREDICTED: truncated transcription factor CA...    215   2e-63   
sp|Q8GTF4.1|AP1C_BRAOB  RecName: Full=Floral homeotic protein APE...    216   2e-63   
ref|XP_006430951.1|  hypothetical protein CICLE_v10012594mg             215   2e-63   
ref|XP_006391056.1|  hypothetical protein EUTSA_v10019025mg             216   2e-63   
emb|CDX95960.1|  BnaA07g27710D                                          215   2e-63   
gb|ACT68282.1|  MADS box protein 1                                      215   2e-63   
gb|AAR32119.1|  MADS-box protein                                        215   2e-63   
sp|Q41276.1|AP1_SINAL  RecName: Full=Floral homeotic protein APET...    215   2e-63   
gb|AAM28449.1|AF466773_1  apetala 1                                     215   2e-63   
sp|Q39375.1|CAL_BRAOT  RecName: Full=Transcription factor CAULIFL...    215   2e-63   
ref|XP_004304203.1|  PREDICTED: agamous-like MADS-box protein AGL...    215   3e-63   
sp|Q8GTF5.1|AP1A_BRAOB  RecName: Full=Floral homeotic protein APE...    215   3e-63   
gb|AGX01569.1|  FRUITFULL-like protein                                  214   3e-63   
gb|AAD10625.1|  MADS-box protein 1                                      214   3e-63   
ref|XP_010415539.1|  PREDICTED: floral homeotic protein APETALA 1...    215   3e-63   
gb|AAO22979.1|  MADS-box transcription factor CDM111                    214   3e-63   
emb|CAX65661.1|  GSQUA2 protein                                         214   3e-63   
sp|A2IB53.1|AP1_CITSI  RecName: Full=Floral homeotic protein APET...    215   3e-63   
ref|XP_009373777.1|  PREDICTED: truncated transcription factor CA...    215   4e-63   
ref|XP_009127703.1|  PREDICTED: floral homeotic protein APETALA 1...    215   4e-63   
gb|AGX01591.1|  FRUITFULL-like protein                                  214   4e-63   
gb|AFU81359.1|  FRUITFULLb                                              214   4e-63   
ref|XP_003524491.1|  PREDICTED: agamous-like MADS-box protein AGL...    214   4e-63   
ref|XP_007153481.1|  hypothetical protein PHAVU_003G039200g             214   5e-63   
ref|XP_010547743.1|  PREDICTED: agamous-like MADS-box protein AGL...    214   5e-63   
gb|AAM28462.1|AF466786_1  apetala 1                                     214   5e-63   
gb|AAM28459.1|AF466783_1  apetala 1                                     214   5e-63   
gb|AAO18232.1|  MADS-box transcriptional factor HAM92                   214   5e-63   
gb|ACG35179.1|  MADS-box transcription factor 15                        215   5e-63   
emb|CDY04265.1|  BnaC06g25500D                                          215   5e-63   
dbj|BAD43696.1|  unknown protein                                        214   6e-63   
gb|AAT39555.1|  APETALA1-like MADS-box PTAP1-1a                         211   6e-63   
gb|AFU81364.1|  FRUITFULLb                                              213   6e-63   
gb|AHM92088.1|  MADS-box protein 12                                     213   7e-63   
gb|ACL68408.1|  MAP1                                                    214   7e-63   
gb|AAK72467.1|  MADS-box transcription factor DEFH28                    214   7e-63   
ref|XP_009333658.1|  PREDICTED: truncated transcription factor CA...    214   7e-63   
ref|XP_003516454.1|  PREDICTED: floral homeotic protein APETALA 1...    213   8e-63   
ref|XP_007215844.1|  hypothetical protein PRUPE_ppa010249mg             214   8e-63   
ref|XP_009373776.1|  PREDICTED: truncated transcription factor CA...    214   8e-63   
ref|NP_001241037.1|  uncharacterized protein LOC100786580               213   8e-63   
emb|CDP02340.1|  unnamed protein product                                213   8e-63   
gb|AAP83402.1|  FRUITFULL-like MADS-box                                 213   1e-62   
ref|XP_006482432.1|  PREDICTED: agamous-like MADS-box protein AGL...    213   1e-62   
ref|XP_007032867.1|  Agamous-like MADS-box protein AGL8 isoform 2       213   1e-62   
gb|ABP93402.1|  AP1-2                                                   213   1e-62   
gb|EYU42112.1|  hypothetical protein MIMGU_mgv1a012370mg                213   1e-62   
ref|XP_006579700.1|  PREDICTED: agamous-like MADS-box protein AGL...    213   1e-62   
ref|NP_001105333.1|  zea apetala homolog1                               214   1e-62   
dbj|BAJ09452.1|  MADS-box transcription factor                          213   1e-62   
ref|XP_006600605.1|  PREDICTED: agamous-like MADS-box protein AGL...    212   1e-62   
ref|XP_009402830.1|  PREDICTED: truncated transcription factor CA...    211   1e-62   
dbj|BAN89469.1|  floral-meristem identity protein                       213   2e-62   
gb|AFU81361.1|  FRUITFULLb                                              211   2e-62   
emb|CAA56658.1|  SLM4                                                   213   2e-62   
dbj|BAN19222.1|  APETALA1 like protein                                  212   3e-62   
gb|ADT78583.1|  MADS box protein                                        212   3e-62   
gb|AGX01540.1|  FRUITFULL-like protein                                  212   3e-62   
gb|ACE75943.2|  APETALA1-1                                              213   3e-62   
gb|ABG80456.1|  fruitful-like MADS-box transcription factor             211   3e-62   
dbj|BAL14662.1|  APETALA1 like protein                                  212   3e-62   
gb|AGX01588.1|  FRUITFULL-like protein                                  212   4e-62   
sp|Q39371.1|3AP1_BRAOL  RecName: Full=Floral homeotic protein APE...    212   4e-62   
gb|AAM28456.1|AF466780_1  apetala 1                                     212   4e-62   
dbj|BAN19225.1|  APETALA1 like protein                                  212   4e-62   
gb|AHM92070.1|  MADS-box protein 14                                     212   4e-62   
ref|XP_004981741.1|  PREDICTED: MADS-box transcription factor 14-...    211   5e-62   
ref|XP_006365654.1|  PREDICTED: agamous-like MADS-box protein AGL...    211   5e-62   
ref|XP_006304696.1|  hypothetical protein CARUB_v10011954mg             212   6e-62   
gb|KHN29957.1|  Floral homeotic protein APETALA 1                       211   6e-62   
gb|AES97192.2|  MADS-box transcription factor                           210   6e-62   
dbj|BAD38887.1|  MADS box transcription factor                          212   6e-62   
ref|XP_002463864.1|  hypothetical protein SORBIDRAFT_01g007790          211   8e-62   
gb|AFQ31623.1|  AP1-like MADS-box protein                               211   9e-62   
ref|XP_008230294.1|  PREDICTED: truncated transcription factor CA...    211   9e-62   
gb|ADA72020.1|  MADS1 protein                                           211   1e-61   
gb|AHM92087.1|  MADS-box protein 11                                     210   1e-61   
ref|XP_006482431.1|  PREDICTED: agamous-like MADS-box protein AGL...    211   1e-61   
ref|NP_001280866.1|  truncated transcription factor CAULIFLOWER A       210   1e-61   
gb|ABB59991.1|  MADS-box protein                                        211   1e-61   
gb|ACD69426.1|  APETALA1                                                210   1e-61   
gb|AFI93492.1|  AP1-like protein                                        211   1e-61   
gb|AAP83380.1|  euFUL FRUITFULL-like MADS-box                           209   1e-61   
ref|XP_010547744.1|  PREDICTED: agamous-like MADS-box protein AGL...    207   1e-61   
ref|XP_010091613.1|  Floral homeotic protein APETALA 1                  211   1e-61   
ref|XP_003614234.1|  MADS-box protein BM5A                              213   1e-61   
gb|AAO45873.1|  MADS1                                                   210   2e-61   
gb|ACT68283.1|  MADS box protein 1                                      210   2e-61   
gb|AAP83387.1|  euFUL FRUITFULL-like MADS-box                           209   2e-61   
gb|AAX53098.1|  AP1-like protein                                        209   3e-61   
ref|XP_010477872.1|  PREDICTED: truncated transcription factor CA...    209   3e-61   
ref|XP_010477871.1|  PREDICTED: truncated transcription factor CA...    209   3e-61   
gb|AAP83419.1|  euAP1 APETALA1-like MADS-box                            209   3e-61   
ref|XP_011071269.1|  PREDICTED: floral homeotic protein APETALA 1       216   3e-61   
ref|NP_001105147.1|  m15 protein                                        209   3e-61   
ref|XP_010460326.1|  PREDICTED: truncated transcription factor CA...    208   4e-61   
ref|XP_010460327.1|  PREDICTED: truncated transcription factor CA...    208   4e-61   
ref|XP_004981740.1|  PREDICTED: MADS-box transcription factor 14-...    209   4e-61   
ref|NP_001051300.1|  Os03g0752800                                       209   4e-61   
ref|XP_009774316.1|  PREDICTED: truncated transcription factor CA...    208   5e-61   
ref|XP_002890666.1|  hypothetical protein ARALYDRAFT_890115             209   5e-61   
gb|ADJ67240.1|  MADS box transcription factor 10                        208   7e-61   
gb|AEV22381.1|  VRN1                                                    208   7e-61   
ref|XP_010460325.1|  PREDICTED: truncated transcription factor CA...    209   7e-61   
emb|CAA08805.2|  MADS-box protein, GSQUA1                               207   9e-61   
gb|AET25527.1|  APETALA1-like MADS-box protein                          208   9e-61   
gb|ACU24531.1|  unknown                                                 207   1e-60   
gb|AFD36438.1|  MADS2                                                   208   1e-60   
ref|XP_003518787.1|  PREDICTED: floral homeotic protein APETALA 1...    207   1e-60   
ref|XP_010477869.1|  PREDICTED: truncated transcription factor CA...    208   1e-60   
gb|ACX85614.1|  AP1                                                     207   2e-60   
dbj|BAL70392.1|  apetala1/squamosa protein                              207   2e-60   
ref|XP_004233393.1|  PREDICTED: truncated transcription factor CA...    207   2e-60   
gb|KCW56319.1|  hypothetical protein EUGRSUZ_I02059                     205   2e-60   
gb|AAA64789.1|  amino acid feature: K-box, bp 283..480; amino aci...    207   2e-60   
ref|NP_564243.1|  transcription factor CAULIFLOWER                      207   2e-60   
ref|XP_006650602.1|  PREDICTED: MADS-box transcription factor 14-...    207   2e-60   
ref|XP_010460324.1|  PREDICTED: truncated transcription factor CA...    207   2e-60   
ref|XP_009774315.1|  PREDICTED: truncated transcription factor CA...    207   2e-60   
ref|XP_009774314.1|  PREDICTED: truncated transcription factor CA...    207   2e-60   
gb|AAP83379.1|  euFUL FRUITFULL-like MADS-box                           206   2e-60   
gb|AAX13297.1|  MADS box protein AP1b                                   207   3e-60   
sp|P0C5B1.1|MAD14_ORYSI  RecName: Full=MADS-box transcription fac...    207   3e-60   
dbj|BAK09614.1|  MADS-box transcription factor                          207   3e-60   
gb|AAP68361.1|  putative MADS box protein                               207   4e-60   
ref|NP_001290521.1|  MADS-box transcription factor 14                   206   5e-60   
ref|NP_001288319.1|  MADS-box transcription factor 14-like              206   6e-60   
gb|AGX01581.1|  FRUITFULL-like protein                                  205   6e-60   
gb|ABW84393.1|  ZMM15 MADS-box protein                                  206   6e-60   
ref|XP_011085591.1|  PREDICTED: truncated transcription factor CA...    206   8e-60   
sp|Q6R4R9.2|CALA_BRAOB  RecName: Full=Truncated transcription fac...    202   8e-60   
gb|AAF19047.1|AF058697_1  MADS14 protein                                206   8e-60   
gb|AHM92073.1|  MADS-box protein 18                                     206   9e-60   
ref|XP_009333660.1|  PREDICTED: truncated transcription factor CA...    206   1e-59   
ref|XP_006584554.1|  PREDICTED: uncharacterized protein LOC100786...    205   1e-59   
sp|Q6R4R8.1|CALB_BRAOB  RecName: Full=Truncated transcription fac...    202   1e-59   



>ref|XP_009625854.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog [Nicotiana 
tomentosiformis]
Length=245

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/240 (63%), Positives = 184/240 (77%), Gaps = 16/240 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+  +W+LE+AKLKARIE L++++RHY GEDLDSLS +E
Sbjct  65   RILERYERYSYAERQLTTTDHETPGSWTLEHAKLKARIEVLQRNQRHYAGEDLDSLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESISELQKK              +KEREKE+A+Q  
Sbjct  125  LQNLEHQVDSALKHIRSRKNQLMHESISELQKKDKALQEQNNKLSKQVKEREKELAQQTQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIE-DAQLPPPNIVMPQWLLPHL  848
             EQQ     N SS++V  QP++S +LGE Y  AG+  E+E  ++    N VMP W+L HL
Sbjct  185  WEQQSHDHLN-SSTFVLSQPLSSLHLGEAYSTAGDNGEVEGSSRQQQQNTVMPPWMLRHL  243



>gb|AAO12211.1|AF385746_1 MADS11 [Nicotiana tabacum]
Length=245

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 183/240 (76%), Gaps = 16/240 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+  +W+LE+AKLKAR E L++++RHY GEDLDSLS +E
Sbjct  65   RILERYERYSYAERQLTATDHETPGSWTLEHAKLKARFEVLQRNQRHYAGEDLDSLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESISELQKK              +KEREKE+A+Q  
Sbjct  125  LQNLEHQVDSALKHIRSRKNQLMHESISELQKKDKALQEQNNKLSKQVKEREKELAQQTQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIE-DAQLPPPNIVMPQWLLPHL  848
             EQQ     N SS++V  QP++S +LGE Y  AG+  E+E  ++    N VMP W+L HL
Sbjct  185  WEQQSHDHLN-SSTFVLSQPLSSLHLGEAYSTAGDNGEVEGSSRQQQQNTVMPPWMLRHL  243



>ref|NP_001289508.1| agamous-like MADS-box protein AGL8 homolog [Nicotiana sylvestris]
 gb|AAD39036.1|AF068725_1 MADS-box protein MADS1 [Nicotiana sylvestris]
Length=245

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 184/242 (76%), Gaps = 16/242 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKR SGLLKKA+EISVLCDA+VG+IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRASGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+  +W+LE+AKLKAR+E L++++RHY GEDLDSLS +E
Sbjct  65   RILERYERYSYAERQLTATDDETPGSWTLEHAKLKARLEVLQRNQRHYAGEDLDSLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESISELQKK              +KEREKE+A+Q  
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMHESISELQKKDKALQEQNNNLSKQVKEREKELAQQTQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIE-DAQLPPPNIVMPQWLLPHL  848
             EQQ     N SSS+V  QP++S +LGE Y  AG+  E+E  ++    N VMP W+L HL
Sbjct  185  WEQQSHDHLN-SSSFVLTQPLSSLHLGEAYPTAGDNGEVEGSSRQQQQNTVMPPWMLRHL  243

Query  849  TG  854
             G
Sbjct  244  NG  245



>gb|AAF19721.1|AF176782_1 MADS box transcription factor [Petunia x hybrida]
Length=246

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 183/242 (76%), Gaps = 15/242 (6%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQ+KRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQMKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD  S  +W+LE+AKLKARIE +++++RHYMGEDLDSLS ++
Sbjct  65   RILERYERYSYAERQLVSTDHSSPGSWNLEHAKLKARIEVVQRNQRHYMGEDLDSLSMKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+DSS+KHIRS+KNQLM ESISELQ              KK+KEREKE+A+Q  
Sbjct  125  LQNLEQQLDSSLKHIRSRKNQLMHESISELQKKDKSLQEQNNLLSKKVKEREKELAQQTQ  184

Query  672  LEQQEK-QDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHL  848
             EQQ    + NSSSS+V  QP++S +LGE Y+   +  E+E A    P   MP W+L HL
Sbjct  185  WEQQNNHHEINSSSSFVLPQPLDSPHLGEAYQSTVDNGEVEGASQQQPANTMPPWMLRHL  244

Query  849  TG  854
             G
Sbjct  245  NG  246



>gb|AAF19164.1|AF176783_1 floral binding protein 26 [Petunia x hybrida]
Length=245

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 186/243 (77%), Gaps = 18/243 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLL+KA+EISVLCDA+VG+IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLRKAHEISVLCDAEVGLIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER SY E  L   TD ++  +W+LE+AKLKAR+E L+++++HY GEDLDSLS +
Sbjct  65   RILERYERYSYAERQLSGATDNDTPGSWTLEHAKLKARLEVLQRNQKHYAGEDLDSLSMK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQP  668
            ELQNLE Q+DS++K IRS+KNQLM ESISELQKK              +KEREKE+A+Q 
Sbjct  125  ELQNLEQQLDSALKQIRSRKNQLMHESISELQKKDKALQEQNNKLSKQVKEREKELAQQS  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIE-DAQLPPPNIVMPQWLLPH  845
              E Q   D N SSS+V  QP+NS +LGE Y  AG+  E+E  ++  PPN VMP W+L H
Sbjct  185  QWEPQ-SHDLN-SSSFVLSQPLNSLHLGEAYPSAGDNGEVEGSSRQQPPNTVMPPWMLRH  242

Query  846  LTG  854
            L G
Sbjct  243  LNG  245



>gb|AAD01421.1| NAP1-1 [Nicotiana tabacum]
Length=245

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/242 (61%), Positives = 181/242 (75%), Gaps = 16/242 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+  +W+LE+AKLK R+E L++++ HY GEDLDSL  +E
Sbjct  65   RILERYERYSYAERQLTATDHETPGSWTLEHAKLKGRLEVLQRNQGHYAGEDLDSLCMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESISELQKK              +KE EKE+A+Q  
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMHESISELQKKDEALQEQNNNLSKQVKEGEKELAQQTQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIE-DAQLPPPNIVMPQWLLPHL  848
             EQQ     N SSS+V  QP++S +LGE Y  AG+  E+E  ++    N VMP W+L HL
Sbjct  185  WEQQSHDHLN-SSSFVLTQPLSSLHLGEAYPTAGDNGELEGSSRQQQQNTVMPPWMLRHL  243

Query  849  TG  854
             G
Sbjct  244  NG  245



>gb|AHW58040.1| FUL [Coffea arabica]
Length=242

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 179/240 (75%), Gaps = 16/240 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER +Y E      + ESQ  WSLE+AKLKARIE L++++RHYMGEDLD+LS RE
Sbjct  65   RILERYERYAYAERQLGGAEIESQGCWSLEHAKLKARIEVLQRNQRHYMGEDLDNLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+D+++KHIRS+KNQLM ESI+ELQ              KK+K++EKE A+QP 
Sbjct  125  LQNLEHQLDTALKHIRSRKNQLMFESIAELQKKDKALQEQNNVLAKKVKDKEKEQAQQPQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHLT  851
             E+Q + D N SSS V  QP+NS ++ ETY   G+  E E  Q    N VM  W+L  + 
Sbjct  185  WERQNRHDLN-SSSLVRSQPINSLSISETYHRGGDN-EAEGTQSSQTNAVMHPWMLRQMN  242



>gb|AGT21643.1| PFFUL2 [Physalis pubescens]
Length=249

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 182/245 (74%), Gaps = 18/245 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSNKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E   N TD E+  +W+LE+AKLKAR+E L +++RHY GEDLDSL  +E
Sbjct  65   RILERYERYSYAERQLNATDIETPGSWTLEHAKLKARLEVLLRNQRHYAGEDLDSLGMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESISELQ              KK+KEREKE+A++  
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMHESISELQKKDKALQEQNNNLTKKVKEREKELAQRTP  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSF-NLGETYEIAGEGREIEDAQLPPPNI---VMPQWLL  839
             EQQ+  D  +SSS+V   P+NS  +LGE Y  AG+  E+E +          VMP W+L
Sbjct  185  WEQQQSHDHLNSSSFVLPHPLNSLHHLGEAYPTAGDNGEVEGSSQQQQQQNTSVMPPWML  244

Query  840  PHLTG  854
             HL G
Sbjct  245  RHLNG  249



>ref|XP_010318872.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog [Solanum 
lycopersicum]
Length=247

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 182/244 (75%), Gaps = 18/244 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E   N TD  +  +W+LE+AKLKAR+E L+++++HY GE+LD+LS +E
Sbjct  65   RILERYERYSYAERQLNATDIITPGSWTLEHAKLKARLEVLQRNQKHYAGEELDTLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESISELQKK              +KEREKEMA+Q  
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMHESISELQKKDKALQEQNNNLSKQVKEREKEMAQQTP  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDA---QLPPPNIVMPQWLLP  842
             EQQ     N SSS+V   P N+ ++GE Y  AG+  E+E +   Q      VMP W+L 
Sbjct  185  WEQQSHDHLN-SSSFVLPHPFNNLHIGEAYPNAGDNGEVEGSSRQQQQNSASVMPPWMLR  243

Query  843  HLTG  854
            HL G
Sbjct  244  HLNG  247



>dbj|BAK20018.1| PgMADS protein3 [Panax ginseng]
Length=240

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 184/242 (76%), Gaps = 21/242 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKL +YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLCEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+Q +W+LE+AKLKARIE L+++ R+YMGEDLDSL+ +E
Sbjct  65   RILERYERYSYAEKQLVATDTETQGSWTLEHAKLKARIEVLQRNLRNYMGEDLDSLNLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESIS LQ              KK+K++EKE+A+QP+
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMFESISLLQKKDKVLQEQNNLLAKKVKDKEKEIAQQPH  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDA-QLPPPNIVMPQWLLPHL  848
            LE +  +    SSSY+  QP+   N+G+ Y+ AGE  EIE+  Q    N VMP W+L HL
Sbjct  185  LEHENYE----SSSYMP-QPLQPMNIGDVYQ-AGEDGEIEETLQQNQANTVMPSWMLRHL  238

Query  849  TG  854
             G
Sbjct  239  NG  240



>gb|AAF22139.2|AF130118_1 MADS box protein [Capsicum annuum]
Length=247

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/243 (60%), Positives = 182/243 (75%), Gaps = 16/243 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQL+RIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLRRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E   N TD E+  +W+LE+AKLKAR+E L++++RHY GEDLDSLS +E
Sbjct  65   RILERYERYSYAERQLNATDVETPGSWTLEHAKLKARLEVLQRNQRHYAGEDLDSLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+DS++KHIRS+KNQLM ESISELQKK              +KEREK++A+Q  
Sbjct  125  LQNLEQQLDSALKHIRSRKNQLMHESISELQKKDKALQEQNNNLSKQMKEREKQLAQQHT  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDA--QLPPPNIVMPQWLLPH  845
              +Q+  D  +SSS+    P N+ +LGE Y  AG+  E+E +  Q      VMP W+L H
Sbjct  185  PWEQQNHDHLNSSSFGLPHPFNNNHLGEVYPTAGDNGEVEGSSRQQQQNAAVMPPWMLRH  244

Query  846  LTG  854
            L G
Sbjct  245  LNG  247



>ref|XP_006345101.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog [Solanum 
tuberosum]
Length=248

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 182/245 (74%), Gaps = 19/245 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER SY E  L   TD E+  +W+LE+AKLKAR+E L+++++HY GE+L++LS +
Sbjct  65   RILERYERYSYAERQLNAATDIETPGSWTLEHAKLKARLEVLQRNQKHYAGEELNTLSMK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQP  668
            E QNLEHQ+DS++KHIRS+KNQLM ESIS LQKK              +KEREKEM++Q 
Sbjct  125  EFQNLEHQLDSALKHIRSRKNQLMHESISALQKKDKALQEQNNNLSKQVKEREKEMSQQT  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDA---QLPPPNIVMPQWLL  839
              EQQ     N SSS+V   P N+ ++GE Y  AG+  E+E +   Q    + VMP W+L
Sbjct  185  PWEQQSHDHLN-SSSFVLPHPFNNLHMGEAYPTAGDNGEVEGSSRQQQQNTSSVMPPWML  243

Query  840  PHLTG  854
             HL G
Sbjct  244  RHLNG  248



>ref|NP_001275142.1| agamous-like MADS-box protein AGL8 homolog [Solanum tuberosum]
 sp|Q42429.1|AGL8_SOLTU RecName: Full=Agamous-like MADS-box protein AGL8 homolog; AltName: 
Full=POTM1-1 [Solanum tuberosum]
 gb|AAA92839.1| transcription factor [Solanum tuberosum]
 gb|AAA92840.1| transcription factor [Solanum tuberosum]
Length=250

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 182/248 (73%), Gaps = 23/248 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYANDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            R+L RYER S+ E    PTD  S  +W+LE+AKLKAR+E L+++++HY+GEDL+SL+ +E
Sbjct  65   RLLERYERYSFAERQLVPTDHTSPGSWTLEHAKLKARLEVLQRNQKHYVGEDLESLNMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESIS LQ              KK+KEREKE+A+Q  
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMHESISVLQKQDRALQEQNNQLSKKVKEREKEVAQQNQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAG-------EGREIEDAQLPPPNIVMPQ  830
             +QQ  +   +SS++V  Q ++S +LGE Y+          EG      Q    N VMPQ
Sbjct  185  WDQQNHEI--NSSTFVLPQQLDSPHLGEAYQNTNVVDNGEVEGGNSSQQQGAANNTVMPQ  242

Query  831  WLLPHLTG  854
            W+L HL G
Sbjct  243  WMLRHLNG  250



>gb|KDP31379.1| hypothetical protein JCGZ_11755 [Jatropha curcas]
Length=246

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 177/241 (73%), Gaps = 17/241 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+  +W+LE+AKLKAR+E L++++RH+MGEDLDSLS +E
Sbjct  65   RILERYERYSYAERQLVATDTETNGSWTLEHAKLKARVEVLQRNQRHFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE--------------MAEQPN  671
            LQNLE QIDS++KHIRS+KNQ M ESISELQKK K  +++              MA+Q N
Sbjct  125  LQNLEQQIDSALKHIRSRKNQQMYESISELQKKDKALQEQNNQLAKKIKEKEKAMAQQTN  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLP--PPNIVMPQWLLPH  845
            LEQQ+ Q  NSS   +  Q + SFNL  +Y   G   E E +Q+       ++P W+LPH
Sbjct  185  LEQQQNQAVNSSPVLIP-QSMQSFNLSSSYSARGIRGEDETSQIHHRANGGLLPAWMLPH  243

Query  846  L  848
            L
Sbjct  244  L  244



>ref|NP_001234173.1| TDR4 transcription factor [Solanum lycopersicum]
 gb|AAM33098.1| TDR4 transcription factor [Solanum lycopersicum]
Length=245

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/247 (58%), Positives = 177/247 (72%), Gaps = 28/247 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V LKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVHLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYANDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E    PTD  S  +W+LE+AKLKAR+E L+++++HY+GEDL+SLS +E
Sbjct  65   RILERYERYSFAEKQLVPTDHTSPVSWTLEHAKLKARLEVLQRNQKHYVGEDLESLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESIS LQ              KK+KEREKE+A+Q  
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMHESISVLQKKDRALQEQNNQLSKKVKEREKEVAQQNQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAG-------EGREIEDAQLPPPNIVMPQ  830
             E        +SSS+V  Q ++S +LGE Y+          EG      Q    N VMPQ
Sbjct  185  WEI-------NSSSFVLPQQLDSPHLGEAYQSTNVIDNGEVEGGSSSQQQGAANNTVMPQ  237

Query  831  WLLPHLT  851
            W+L HL 
Sbjct  238  WMLRHLN  244



>ref|XP_009603844.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog [Nicotiana 
tomentosiformis]
Length=244

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 182/242 (75%), Gaps = 19/242 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER SY E  L   TD     +W+LE+AKLKAR+E L++++RHYMGEDLDSLS +
Sbjct  65   RILERYERYSYAERQLVATTDHSCPGSWTLEHAKLKARLEVLQRNQRHYMGEDLDSLSTK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQP  668
            ELQNLEHQ+DS++KHIRS KNQLM ESISELQ              KK+KEREKE+A+Q 
Sbjct  125  ELQNLEHQLDSALKHIRSSKNQLMHESISELQKKDKALQEQNNQLCKKVKEREKELAQQN  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYE-IAGEGREIEDA-QLPPPNIVMPQWLLP  842
              +++++    +S S++  Q ++S NLGE Y+  A E  E+E   Q    N VMP W++ 
Sbjct  185  --QREQQNQELNSPSFIFQQQLDSPNLGEAYQSTAEENGEVEGGSQQQTANTVMPPWMIR  242

Query  843  HL  848
            HL
Sbjct  243  HL  244



>dbj|BAG68947.1| APETALA1/FRUITFUL like protein [Hydrangea macrophylla]
Length=250

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 178/251 (71%), Gaps = 29/251 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+D+ ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDTCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD ESQ +W+LE+AKLKAR+E L++S+RHYMGEDLD+L  +E
Sbjct  65   RILERYERYSYSERQLKATDLESQGSWTLEHAKLKARVEVLQRSQRHYMGEDLDTLGLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE------------------MA  659
            LQNLEHQID+++KH+R++KNQLM ESIS LQKK K  ++                   MA
Sbjct  125  LQNLEHQIDNALKHMRTRKNQLMYESISALQKKDKGLQEHNNLLAKKVKEKKKENEKEMA  184

Query  660  EQPNLEQQEKQDTNSSSSYVALQPVNSFNL------GETYEIAGEGREIEDAQLPPPNIV  821
            +Q   +Q +    N SS ++  QP++S N+      G + E+ G   +++D      N V
Sbjct  185  QQTQWDQHQSHGLN-SSPFILSQPLHSLNIGGGCQEGTSGEVEGTPNQLDD----QTNTV  239

Query  822  MPQWLLPHLTG  854
            MP W+L H++G
Sbjct  240  MPAWMLHHISG  250



>ref|XP_008393256.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X1 [Malus domestica]
 gb|ABB22023.1| MdMads2.1 protein [Malus domestica]
Length=255

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 181/251 (72%), Gaps = 26/251 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGL+KKA+EISVLCDA+V +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLMKKAHEISVLCDAEVALIIFSTKGKLFEYSNDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L++++RHYMGEDL SLS +E
Sbjct  65   RILERYERYSYTERQLLANDNESTGSWTLEHAKLKARVEVLQRNQRHYMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQ              KK+KE+E  +A+Q  
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKKDKALQEQNNLLAKKVKEKENAVAQQAQ  184

Query  672  LEQQEKQDTNSSSSYV--ALQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNI  818
            LE  ++Q  NSSSS +  ALQ +N F  G  Y+       I G+ ++  D    P  PN+
Sbjct  185  LEHVQEQRLNSSSSLLPRALQSLN-FGSGSNYQAIRSSEGIPGDNQQYGDETPTPHRPNM  243

Query  819  VMPQWLLPHLT  851
            ++P W+L HL 
Sbjct  244  LLPAWMLRHLN  254



>ref|XP_010678364.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Beta 
vulgaris subsp. vulgaris]
Length=244

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 174/244 (71%), Gaps = 26/244 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EIS+LCDADV +I+FSTKGKLF+YASD+ ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRIGLLKKAHEISILCDADVALIIFSTKGKLFEYASDTCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D  S  + +LE+AKLKAR++ L+K++RHYMGE+LD+LS +E
Sbjct  65   RILERYERHSYAERQLTAPDPGSHVSLTLEHAKLKARLDILQKNQRHYMGEELDTLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQIDS++KHIRSKKNQLM ESIS+LQ              KK+KEREK +A+Q  
Sbjct  125  LQNLEHQIDSALKHIRSKKNQLMHESISQLQRKDKALKEHNNLLSKKVKEREKVLAQQAE  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNI-----VMPQWL  836
            L+QQ     N+SS +V  Q + S N G T   A     +ED    PPN+      +P W+
Sbjct  185  LDQQNHD--NNSSGFVMSQALPSLNTGGTSSSA-----VEDEATQPPNLNSNSAQIPSWM  237

Query  837  LPHL  848
            L H+
Sbjct  238  LQHI  241



>gb|AAC83170.1| MADS-box protein 2 [Malus domestica]
Length=255

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 181/251 (72%), Gaps = 26/251 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGL+KKA+EISVLCDA+V +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLMKKAHEISVLCDAEVALIIFSTKGKLFEYSNDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L++++RHYMGEDL SLS +E
Sbjct  65   RILERYERYSYTERQLLANDNESTGSWTLEHAKLKARVEVLQRNQRHYMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQ              KK+KE+E  +A+Q  
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKKDKALQEQNNLLAKKVKEKENAVAQQAQ  184

Query  672  LEQQEKQDTNSSSSYV--ALQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNI  818
            LE  ++Q  NSSSS +  ALQ +N F  G  Y+       I G+ ++  D    P  PN+
Sbjct  185  LEHVQEQRLNSSSSLLPRALQSLN-FGSGSNYQAIRSSEGIPGDNQQYGDETPTPHRPNM  243

Query  819  VMPQWLLPHLT  851
            ++P W++ HL 
Sbjct  244  LLPAWIVRHLN  254



>gb|ABF82231.1| fruitfull-like MADS-box protein [Nicotiana tabacum]
Length=244

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 181/242 (75%), Gaps = 19/242 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER SY E  L   TD     +W+LE+AKLKAR+E L++++RHY GEDLDSLS +
Sbjct  65   RILERYERYSYAERQLVATTDHSCPGSWTLEHAKLKARLEVLQRNQRHYTGEDLDSLSTK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQP  668
            ELQNLEHQ+DS++KHIRS KNQLM ESISELQ              KK+KEREKE+A+Q 
Sbjct  125  ELQNLEHQLDSALKHIRSSKNQLMHESISELQKKDKALQEQNNQLCKKVKEREKELAQQN  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYE-IAGEGREIEDA-QLPPPNIVMPQWLLP  842
              +++++    +S S++  Q ++S NLGE Y+  A E  E+E   Q    N VMP W++ 
Sbjct  185  --QREQQNQELNSPSFIFQQQLDSPNLGEAYQSTAEENGEVEGGSQQQTANTVMPPWMIR  242

Query  843  HL  848
            HL
Sbjct  243  HL  244



>ref|NP_001281024.1| truncated transcription factor CAULIFLOWER A-like [Malus domestica]
 gb|ADL36742.1| MADS domain class transcription factor [Malus domestica]
Length=253

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 180/249 (72%), Gaps = 24/249 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGL+KKA+EISVLCDA+V +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLMKKAHEISVLCDAEVALIIFSTKGKLFEYSNDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L++++RHYMGEDL SLS +E
Sbjct  65   RILERYERYSYTERQLLANDNESTGSWTLEHAKLKARVEVLQRNQRHYMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK------------IKEREKEMAEQPNLE  677
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQKK             KE+E  +A+Q  LE
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKKDKALQEQNNLLAKKEKENAVAQQAQLE  184

Query  678  QQEKQDTNSSSSYV--ALQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNIVM  824
              ++Q  NSSSS +  ALQ +N F  G  Y+       I G+ ++  D    P  PN+++
Sbjct  185  HVQEQRLNSSSSLLPRALQSLN-FGSGSNYQAIRSSEGIPGDNQQYGDETPTPHRPNMLL  243

Query  825  PQWLLPHLT  851
            P W+L HL 
Sbjct  244  PAWMLRHLN  252



>gb|AGT21642.1| PFFUL1 [Physalis pubescens]
Length=237

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 174/239 (73%), Gaps = 22/239 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYANDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E  P PT Q S  +W+LE+AKLKAR+E ++++++HY GEDL+SLS +E
Sbjct  65   RILERYERYSFAERQPVPTAQTSMGSWTLEHAKLKARLEVVQRNQKHYAGEDLESLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+ S++KHIRS+K QLM ESIS LQ              KK+KEREKE+AEQ  
Sbjct  125  LQNLEGQLGSALKHIRSRKYQLMHESISMLQKKDKLLQEQNNQLSKKVKEREKELAEQ--  182

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHL  848
                  Q+TN SSS+V  Q ++S +LG      GE       Q    N VMPQW+L HL
Sbjct  183  -----NQETN-SSSFVLPQHLDSPHLGGEAYDNGEVEGGNSQQETATNTVMPQWMLRHL  235



>ref|XP_008393257.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X2 [Malus domestica]
Length=254

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 181/251 (72%), Gaps = 27/251 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGL+KKA+EISVLCDA+V +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLMKKAHEISVLCDAEVALIIFSTKGKLFEYSNDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L++++RHYMGEDL SLS +E
Sbjct  65   RILERYERYSYTERQLLANDNESTGSWTLEHAKLKARVEVLQRNQRHYMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQ              KK+KE+E  +A+Q  
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKKDKALQEQNNLLAKKVKEKENAVAQQAQ  184

Query  672  LEQQEKQDTNSSSSYV--ALQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNI  818
            LE  ++Q  NSSSS +  ALQ +N F  G  Y+       I G+ ++  D    P  PN+
Sbjct  185  LEHVQEQRLNSSSSLLPRALQSLN-FG-GSNYQAIRSSEGIPGDNQQYGDETPTPHRPNM  242

Query  819  VMPQWLLPHLT  851
            ++P W+L HL 
Sbjct  243  LLPAWMLRHLN  253



>emb|CDP17843.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 174/243 (72%), Gaps = 24/243 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER +Y E      + ESQ  WSLE+AKLKARIE L++++RH MGEDLD+LS RE
Sbjct  65   RILERYERYAYAERQLGGAEIESQGCWSLEHAKLKARIEVLQRNQRHCMGEDLDNLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLEHQ+D+++KHIRS+KNQLM ESI+ELQKK    +K + EQ N+             
Sbjct  125  LQNLEHQLDTALKHIRSRKNQLMFESIAELQKK----DKALQEQNNVLAKKVKEKEKEQA  180

Query  675  -----EQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
                 EQQ + D N SSS V  QP++S ++ ETY   G+  E E  Q    N VM  W+L
Sbjct  181  QQPQWEQQNRHDLN-SSSLVRSQPIHSLSISETYHRGGDN-EAEGTQSSQTNAVMHPWML  238

Query  840  PHL  848
              +
Sbjct  239  RQM  241



>gb|AGA01526.1| SQUA-like protein [Gossypium hirsutum]
Length=249

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 175/248 (71%), Gaps = 27/248 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y+SDS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSSDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      + E   +W+LE+AKLKAR+E L++++RHYMGEDL++LS RE
Sbjct  65   RILERYERYSYAERQLAANENERTGSWTLEHAKLKARMEVLQRNQRHYMGEDLENLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLEHQ+DS++KHIRS+KNQLM ESISELQKK    +K + EQ N              
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMFESISELQKK----DKALQEQNNVLAKKVKEKEKEKE  180

Query  672  ------LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIED---AQLPPPNIVM  824
                  +  Q +Q+    SS +  QP+ S N+ +TYE    GRE  +   AQ    N+++
Sbjct  181  KEKEKEMTHQPQQNNCQDSSSMLPQPLQSLNISDTYEARSNGREEGNPSAAQHRNSNVLL  240

Query  825  PQWLLPHL  848
            P W++P +
Sbjct  241  PPWMIPRI  248



>ref|XP_011086917.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Sesamum 
indicum]
 ref|XP_011086918.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Sesamum 
indicum]
Length=257

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 176/252 (70%), Gaps = 31/252 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDADVG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVGLIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      + ES  +W+LE+AKLKARIE L+K++RHYMGE+LD+LS +E
Sbjct  65   RILERYERYSYAERQLKEPELESPVSWTLEHAKLKARIEVLQKNQRHYMGEELDNLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            L NLEHQ+D S+KHIR++KNQ+M ESISELQ              KKIKEREKE A    
Sbjct  125  LHNLEHQLDVSLKHIRTRKNQIMNESISELQKKDKALQEQNNLLAKKIKEREKESARTTT  184

Query  672  LEQ-------------QEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGR-EIEDAQL--  803
             EQ             Q+ QD N+S   VA QP++S N+ E Y   GE   E+E  Q   
Sbjct  185  WEQQNHDLNSSHFGLPQQNQDLNTSCFDVA-QPLSSVNVSEIYLGPGENNGEVEATQRQN  243

Query  804  PPPNIVMPQWLL  839
               N V+P W+L
Sbjct  244  QSSNSVIPPWML  255



>gb|AEJ76845.1| MADS22 [Gossypium hirsutum]
Length=249

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 174/248 (70%), Gaps = 27/248 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            + QLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y+SDS ME
Sbjct  5    RXQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSSDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      + E   +W+LE+AKLKAR+E L++++RHYMGEDL++LS RE
Sbjct  65   RILXRYERYSYAERQLAANENERTGSWTLEHAKLKARMEVLQRNQRHYMGEDLENLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLEHQ+DS++KHIRS+KNQLM ESISELQKK    +K + EQ N              
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMFESISELQKK----DKALQEQNNVLAKKVKEKEKEKE  180

Query  672  ------LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIED---AQLPPPNIVM  824
                  +  Q +Q+    SS +  QP+ S N+ +TYE    GRE  +   AQ    N+++
Sbjct  181  KEKEKEMTHQPQQNNCQDSSSMLPQPLQSLNISDTYEARSNGREEGNPSAAQHRNSNVLL  240

Query  825  PQWLLPHL  848
            P W++P +
Sbjct  241  PPWMIPRI  248



>ref|NP_001268210.1| apetala1 [Vitis vinifera]
 gb|ACZ26528.1| apetala1 [Vitis vinifera]
Length=241

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 170/228 (75%), Gaps = 18/228 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD ESQ NWSLEY+KLKA+IE L++S+RH++GEDLDSLS +E
Sbjct  65   KILDRYERYSYAERQLTATDPESQGNWSLEYSKLKAKIELLQRSQRHFLGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+DS++KHIRS+KNQLM ESISELQ+K              IKE+EK +A+Q +
Sbjct  125  LQNLEQQLDSALKHIRSRKNQLMYESISELQRKEKAMQEQNNMLAKEIKEKEKTVAQQTH  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETY--EIAGEGREIEDAQLPP  809
             EQQ      ++SS++  Q +   N+G TY  E  G  R   D  L P
Sbjct  185  WEQQ--NHGLNTSSFLLPQQLPCLNMGGTYQGEAHGARRNELDLTLEP  230



>gb|AFW15783.1| APL1 [Camellia japonica]
Length=246

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/247 (55%), Positives = 175/247 (71%), Gaps = 25/247 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EIS+LCDA++ +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISILCDAEIALIIFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E     TD ESQ +W+LE AKLKAR+E L+K++RH MGED+D+L+ +E
Sbjct  65   RILERYERYSHAERQLIATDTESQGSWTLENAKLKARLEVLQKNQRHLMGEDIDTLNLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLEHQ+DS++KHIR++KNQLM ESISELQKK    +K + EQ N              
Sbjct  125  LQNLEHQLDSALKHIRTRKNQLMYESISELQKK----DKALQEQNNLLTKQIKEKEKKEK  180

Query  672  -----LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDA-QLPPPNIVMPQW  833
                 LEQ +  D NSSS  ++ Q ++S N+G +        ++E A      N VMP W
Sbjct  181  EQQAQLEQHQNHDLNSSSVVIS-QSLHSLNIGGSGAYQAAVGDVEGAPHQIQNNAVMPPW  239

Query  834  LLPHLTG  854
            ++ H+ G
Sbjct  240  MISHING  246



>gb|AAT07447.1| AP1-like protein [Vitis vinifera]
 emb|CAN71708.1| hypothetical protein VITISV_013455 [Vitis vinifera]
 emb|CBI27320.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 170/228 (75%), Gaps = 18/228 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD ESQ NWSLEY+KLKA+IE L++S+RH++GEDLDSLS +E
Sbjct  65   KILDRYERYSYAERQLTATDPESQGNWSLEYSKLKAKIELLQRSQRHFLGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D+++KHIRS+KNQLM ESISELQ+K              IKE+EK +A+Q +
Sbjct  125  LQNLEQQLDTALKHIRSRKNQLMYESISELQRKEKAMQEQNNMLAKEIKEKEKTVAQQTH  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETY--EIAGEGREIEDAQLPP  809
             EQQ      ++SS++  Q +   N+G TY  E  G  R   D  L P
Sbjct  185  WEQQ--NHGLNTSSFLLPQQLPCLNMGGTYQGEAHGARRNELDLTLEP  230



>ref|XP_008453689.1| PREDICTED: truncated transcription factor CAULIFLOWER A isoform 
X2 [Cucumis melo]
Length=248

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 171/243 (70%), Gaps = 16/243 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D +S  NW+LE+AKLKARIE L+K+ RH+MGEDLDSLS +E
Sbjct  65   KILERYERYSYAERRLVANDSQSNGNWTLEHAKLKARIEVLQKNHRHFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQN+E Q+DS++KHIR++KNQLM ESI+ELQ              KKIKE+EK  A  P 
Sbjct  125  LQNIEQQLDSALKHIRARKNQLMHESITELQKKGKVLQEHNNMLGKKIKEKEKSRAHNPL  184

Query  672  LEQQEKQDTNS--SSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPH  845
            +EQQ++QD+N+  SS  +  QP  S ++   Y                 + ++P W+L H
Sbjct  185  MEQQQQQDSNAIESSPLLLPQPFQSLSMSCPYTTHVPEENDSTVNHDRSDTLLPPWMLRH  244

Query  846  LTG  854
              G
Sbjct  245  HLG  247



>ref|XP_011013299.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X3 [Populus euphratica]
Length=233

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 175/232 (75%), Gaps = 12/232 (5%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            ++QLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+DS ME
Sbjct  5    RIQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQC---NWSLEYAKLKARIEFLEKSKRHYMGEDLDSL  521
            RIL RYER SY E  L    D E+ C   +W+LEYAKLKAR++ L+K++RH+MGEDLDSL
Sbjct  65   RILERYERYSYAERQLLANDDPENHCFQGSWTLEYAKLKARVDVLQKNQRHFMGEDLDSL  124

Query  522  SFRELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQEKQDTN  701
            + +ELQNLEHQIDS++KH+RS+KNQLM ESISELQKK+KE+EK +  Q    +Q+  D +
Sbjct  125  NIKELQNLEHQIDSALKHVRSRKNQLMYESISELQKKVKEKEKAIIAQQAPWEQQNPDLD  184

Query  702  SSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLP---PPNIVMPQWLLPHL  848
             S + +  QP+   N+  ++   G    IE+   P     N ++P W+L +L
Sbjct  185  -SPTILRPQPMQPLNISSSHLATG----IEEEPTPIQNRANALLPAWMLRYL  231



>sp|O22328.1|AGL8_SOLCO RecName: Full=Agamous-like MADS-box protein AGL8 homolog [Solanum 
commersonii]
 gb|AAB65161.1| MADS box transcription factor [Solanum commersonii]
Length=250

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 177/248 (71%), Gaps = 23/248 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            R+L RYER S+ E    PTD  S  +W+LE AKLKAR+E L+++++ Y+GEDL+SL+ +E
Sbjct  65   RLLERYERYSFAEKQLVPTDHTSPGSWTLENAKLKARLEVLQRNEKLYVGEDLESLNMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+ S++KHIRS+KNQLM ESIS LQ              KK+KEREKE+ +Q  
Sbjct  125  LQNLEHQLASALKHIRSRKNQLMHESISVLQKQDRALQEQNNQLSKKVKEREKEVEQQNQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAG-------EGREIEDAQLPPPNIVMPQ  830
             +QQ  +   +SS++V  Q ++S +LGE  +          EG      Q    N VMPQ
Sbjct  185  WDQQNHEI--NSSTFVLPQQLDSPHLGEASQNTNVVDNGEVEGGNSSQXQGAANNTVMPQ  242

Query  831  WLLPHLTG  854
            W++ HL G
Sbjct  243  WMVRHLNG  250



>emb|CAX65663.1| GSQUA5 protein [Gerbera hybrid cultivar]
Length=237

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 171/241 (71%), Gaps = 26/241 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V LKRIENKINRQVTFSKRRSGLLKKA+EISVLCDADV +IVFST+GKL +YA+D+ ME
Sbjct  5    RVMLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTRGKLCEYATDASME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD ES  +W++E+AKLK+R E L+K++RH+MGE+LDSLS +E
Sbjct  65   RILERYERYSYAERQLTATDNESHGSWTMEHAKLKSRTELLQKTQRHFMGEELDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+D+++KHIR +KNQLM ESIS LQ              KK+KE EKE+A+QP 
Sbjct  125  LQNLEQQLDTALKHIRLRKNQLMFESISVLQKKDKALQNQNNFLSKKVKEVEKELAQQPP  184

Query  672  LEQQEKQDTNS--SSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPH  845
            LEQQ  ++ +S   S+Y+      S   GE     G+G   E  +   P+  MP W+L H
Sbjct  185  LEQQNPENMSSFQFSAYI------SIGCGE----GGDGAVAEMEKQAQPSTSMPPWMLQH  234

Query  846  L  848
            +
Sbjct  235  M  235



>ref|XP_007037634.1| AGAMOUS-like 8 isoform 1 [Theobroma cacao]
 gb|EOY22135.1| AGAMOUS-like 8 isoform 1 [Theobroma cacao]
Length=239

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 175/242 (72%), Gaps = 25/242 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      + +   +W+LE+AKLKAR+E L++++RH+MGEDLD+LS RE
Sbjct  65   RILERYERYSYAERQLAGNEVDQNGSWTLEHAKLKARMEVLQRNQRHFMGEDLDNLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+DS++KH+RS+KNQLM ESISELQ              KK+KE+E+ +A+Q  
Sbjct  125  LQNLEQQLDSALKHVRSRKNQLMFESISELQKKDKALQEQNNMLAKKVKEKEQAVAQQAQ  184

Query  672  LEQQEK-QDTNSSSSYVALQPVNSFNLGETYEIAGEGREIED--AQLPPPNIVMPQWLLP  842
             EQQ   QDT   S+ +  QP++      TYE    GRE E   AQ    N ++P W++ 
Sbjct  185  WEQQNNCQDT---SAILLPQPMSG-----TYEARSSGREEEGNPAQHRGANALLPPWMIR  236

Query  843  HL  848
            HL
Sbjct  237  HL  238



>gb|ABG49518.1| FUL-like protein 1 [Euptelea pleiosperma]
Length=238

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 174/236 (74%), Gaps = 15/236 (6%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER S  E      D ESQ +WSLEYAKLKA++E L++++RH+MGE++DSLS +E
Sbjct  65   MILDRYERYSSAERELVAHDPESQGSWSLEYAKLKAKLEVLQRNQRHFMGENVDSLSSKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN----------LEQQ  683
            LQNLE Q+DS++KHIR++KN LM ESI+ELQ+K    EK + EQ N          L QQ
Sbjct  125  LQNLEQQLDSALKHIRTRKNHLMYESIAELQRK----EKTLQEQNNQLEKKLKEKELTQQ  180

Query  684  EKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQ-LPPPNIVMPQWLLPHL  848
               +  SS+S++  Q + + N+G TY++ G G E E AQ     N +MP W+L H+
Sbjct  181  AHWEHQSSTSFLLSQTLPTLNIGGTYQVRGSGSEEEVAQPHARTNTLMPPWMLRHV  236



>dbj|BAM37621.1| MASDS-box protein [Pyrus pyrifolia var. culta]
Length=255

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 179/251 (71%), Gaps = 26/251 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGL+KKA EISVLCDA+V +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLMKKAQEISVLCDAEVALIIFSTKGKLFEYSNDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L++++RHYMGEDL SLS +E
Sbjct  65   RILERYERYSYAERQLLANDNESTGSWTLEHAKLKARVEVLQRNQRHYMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE--------------MAEQPN  671
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQKK K  +++              +A+QP 
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKKDKALQEQNNLLAKKVKEKEKAVAQQPQ  184

Query  672  LEQQEKQDTNSSSSYV--ALQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNI  818
            LE  ++Q  +SSSS +  ALQ +N F  G  Y        I G+ ++  D    P  PN+
Sbjct  185  LEHAQEQRLDSSSSLLPQALQSLN-FGSGSNYRAIRSSEGIPGDNQQDGDETPTPRRPNM  243

Query  819  VMPQWLLPHLT  851
            ++P W+L HL 
Sbjct  244  LLPPWMLRHLN  254



>gb|ABG49519.1| FUL-like protein 2 [Euptelea pleiosperma]
Length=244

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 173/240 (72%), Gaps = 17/240 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRRSGLLKKA+EISVLC+ADV VIVFSTKGKLF+Y+++S ME
Sbjct  5    RVQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCEADVAVIVFSTKGKLFEYSTNSGME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER  Y E     TD ES  NWS+EYAKLKA+++ L++++RH+MGEDLDSLS +E
Sbjct  65   GILERYERYYYAEQEVVATDPESLGNWSMEYAKLKAKVDVLQRTQRHFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LE Q+D+++K IRS+KNQLM ES+ ELQ              KKIKE EK +A+Q +
Sbjct  125  LQHLEQQLDTAMKQIRSRKNQLMYESVVELQRKDKVLQEQNSMLEKKIKEMEKSIAQQRH  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP-NIVMPQWLLPHL  848
             EQQ +    +S S++  Q + S  +G TY+    G E E+A+     N  MP W+L HL
Sbjct  185  WEQQNQ--GQNSPSFLLSQTLPSLTIGGTYQARCTGGEEEEARTQSRFNTHMPPWMLRHL  242



>ref|XP_002263017.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Vitis 
vinifera]
 emb|CBI15339.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 175/242 (72%), Gaps = 22/242 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENK+NRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKL++Y++DS ME
Sbjct  5    RVQLKRIENKVNRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER +Y +S    TD ESQ +W+LEYAKLKAR+E L+KS+R++MGEDLDSLS +E
Sbjct  65   RILERYERYAYAQSQLIATDLESQGSWTLEYAKLKARMEVLQKSQRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPN  671
            LQNLE Q+D+S+K  R++KNQLM ES+SEL K              K++E+EKE AEQ  
Sbjct  125  LQNLEQQLDNSLKSTRTRKNQLMYESLSELHKKGKALQEEHDLLTAKVQEKEKEQAEQAQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP---PNIVMPQWLLP  842
              QQ  QD + S S++  QP+++ N+         G   +D  +PP    N  +P W+L 
Sbjct  185  WNQQ-NQDLD-SPSFLLQQPLHALNISGNCLARDSG---DDQGIPPQNRTNTPLPAWMLR  239

Query  843  HL  848
            H+
Sbjct  240  HV  241



>ref|XP_008374664.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X2 [Malus domestica]
Length=254

 Score =   250 bits (639),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 172/249 (69%), Gaps = 25/249 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKR SGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRTSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E      D ES  NW+LE+AKLKAR+E L++++ HYMGEDL  LSF+E
Sbjct  65   RILERYERYSHAERQLLANDNESTGNWTLEHAKLKARVEVLQRNQSHYMGEDLQILSFQE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+DS+++ IRS+KNQ+M ESISELQKK              +KE+EK +  Q  
Sbjct  125  LQNLEQQLDSALRRIRSRKNQVMYESISELQKKDKALQEQNNLLAKNVKEKEKAVTSQAQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE--------IAGEGREIEDAQLPP--PNIV  821
            LE  +KQ  +SSS+ +  Q +   N    Y         I+G+ ++  D    P  PN +
Sbjct  185  LEHAQKQSLDSSSTLLP-QELQYLNFRSNYHQAIRSSNGISGDNQQDGDETATPHRPNTL  243

Query  822  MPQWLLPHL  848
            +P W+L HL
Sbjct  244  LPPWMLRHL  252



>emb|CAX65664.1| GSQUA6 protein [Gerbera hybrid cultivar]
Length=214

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 164/227 (72%), Gaps = 19/227 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V LKRIENKINRQVTFSKRRSGLLKKA+EISVLCDADV +I+FSTKGKL +YA+DS ME
Sbjct  5    RVTLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVALIIFSTKGKLCEYATDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     T  ESQ NW++E+AKLKARIE L+K +RH+MGE++DSLS +E
Sbjct  65   KILERYERYSYAEMQLTATHNESQGNWTMEHAKLKARIELLQKKQRHFMGEEVDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQEKQDTNSSSS  713
            LQNLE Q+D+S+K IR +KNQLMLESI++LQKKIKE+E+E+A+Q ++             
Sbjct  125  LQNLEQQLDTSLKRIRLRKNQLMLESITDLQKKIKEKERELAQQNHVN------------  172

Query  714  YVALQPVNSFNLGETYEIAGEGRE-IEDAQLPPPNIVMPQWLLPHLT  851
                 P+    +    +  GE  E    AQL     VMP W++ H+T
Sbjct  173  ----MPLFQLGMLNNRDAYGEVEEYTRQAQLLST--VMPPWIVRHMT  213



>gb|ABQ85945.1| MADS-box transcription factor FUL-like 2 [Trochodendron aralioides]
Length=243

 Score =   249 bits (637),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 173/241 (72%), Gaps = 20/241 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ESQ +WSLEY KLKAR E L++++RH++GEDL SLS RE
Sbjct  65   RILERYERYSYAERELVAIDAESQGSWSLEYTKLKARFEVLQRNQRHFLGEDLGSLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPN  671
            LQN E Q+DS++K IRS+K+QLM ESISELQ+              K+KE+ K +A+Q +
Sbjct  125  LQNFEQQLDSALKLIRSRKSQLMYESISELQRKEKALQQQNNLLAEKLKEK-KALAQQAH  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWLLPH  845
             EQ  +    + S+++  Q + S N+  TY+  G G E E +Q P    N +MP W+L H
Sbjct  184  WEQGNQ--VQNPSTFLLPQSLPSLNISGTYQARGTGGEDEGSQ-PHNRTNTLMPPWMLRH  240

Query  846  L  848
            +
Sbjct  241  M  241



>ref|XP_009337966.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X1 [Pyrus x bretschneideri]
Length=255

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 179/251 (71%), Gaps = 26/251 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQ TFSKRRSGL+KKA EISVLCDA+V +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQGTFSKRRSGLMKKAQEISVLCDAEVALIIFSTKGKLFEYSNDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L++++RHYMGEDL SLS +E
Sbjct  65   RILERYERYSYAERQLLANDNESTGSWTLEHAKLKARVEVLQRNQRHYMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE--------------MAEQPN  671
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQKK K  +++              +A++P 
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKKDKALQEQNNLLAKKVKEKEKAVAQRPQ  184

Query  672  LEQQEKQDTNSSSSYV--ALQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNI  818
            LE  ++Q  +SSSS +  ALQ +N F  G  Y+       I G+ ++  D    P  PN+
Sbjct  185  LEHAQEQRLDSSSSLLPQALQSLN-FGSGSNYQAIRSSEGIPGDNQQDGDETPTPRRPNM  243

Query  819  VMPQWLLPHLT  851
            ++P W+L HL 
Sbjct  244  LLPPWMLRHLN  254



>gb|ACD62902.1| fruitfull-like protein [Ipomoea nil]
Length=250

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 177/246 (72%), Gaps = 19/246 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKLF+YA++S ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATESCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E   N TDQ SQ +W+LE+AKLKAR+E L++++RHY GEDLDSLS +E
Sbjct  65   KILERYERYSYAERQLNSTDQNSQGSWTLEHAKLKARMEVLQRNQRHYEGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+DS++K+IRSKKNQLM ESIS LQ              KKIKEREKEMA Q  
Sbjct  125  LQNLERQLDSALKNIRSKKNQLMYESISVLQKKDKALQDQNNQLSKKIKEREKEMATQQQ  184

Query  672  LEQQEKQ---DTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPN--IVMPQWL  836
             +Q+ +    + + +SSYV   P+   +    Y+  GE  E E  Q    N    MPQW+
Sbjct  185  QQQEVQWEQPNDDINSSYVVPPPLVHLSSEGEYQGEGEYGETEGTQRQQQNNTSAMPQWM  244

Query  837  LPHLTG  854
            L HL G
Sbjct  245  LSHLQG  250



>ref|XP_010257957.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Nelumbo 
nucifera]
Length=248

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 174/247 (70%), Gaps = 27/247 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V VIVFSTKGKLF+YA++S ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSTKGKLFEYATNSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RI+ RYER SY E      D ESQ +WSLE+ KLKA+IE L++++RHY+GEDL SLS +E
Sbjct  65   RIIERYERYSYAERELLAADPESQGSWSLEHTKLKAKIEILQRNQRHYVGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLE Q+D+++KHIR++KNQL+ ESISELQKK    EK + EQ N+             
Sbjct  125  LQNLEQQLDTALKHIRARKNQLVYESISELQKK----EKALQEQNNMLTKKLKEKEKEKE  180

Query  675  --------EQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQ-LPPPNIVMP  827
                     +Q+ Q  N S +++  QP+ S N+ ETY+      E E+A+  P  N  MP
Sbjct  181  KALAQQSHWEQQNQGRN-SPTFLPSQPLPSLNMNETYQERSTACEDEEARPHPRTNTQMP  239

Query  828  QWLLPHL  848
             W+L HL
Sbjct  240  PWMLRHL  246



>gb|AFX72884.1| MADS-box protein FL1A [Aquilegia coerulea]
Length=245

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 170/244 (70%), Gaps = 24/244 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EIS+LCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISILCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD ESQ NWSLEY KLKA+IE L+K++RHY GEDL+++S +E
Sbjct  65   KILERYERYSYAERELAGTDSESQGNWSLEYVKLKAKIEILQKNQRHYNGEDLENMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLE------------  677
            LQNLE Q+DS++K IR++KNQLM ESISELQKK    E+ + EQ N              
Sbjct  125  LQNLEQQLDSALKQIRARKNQLMHESISELQKK----ERALTEQNNQLGKKLKEKEKELA  180

Query  678  -----QQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWL  836
                 +Q  Q  NSSS  ++ Q + S N+G  YE      E E  +  P  P  +MP W+
Sbjct  181  QQTPWEQPNQGQNSSSMLIS-QTLPSLNIGVNYEARSTRAEEEGTRPQPARPTTLMPPWM  239

Query  837  LPHL  848
            L H+
Sbjct  240  LRHV  243



>gb|ACE75945.2| FRUITFULL [Spinacia oleracea]
Length=245

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 178/242 (74%), Gaps = 19/242 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EIS+LCDADVG+I+FSTKGKLF+YASDS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRIGLLKKAHEISILCDADVGLIIFSTKGKLFEYASDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D ES+ +W+LE+AKLKAR++ L+K++R+YMGE+LD+LS +E
Sbjct  65   KILERYERYSYAEKQLTTPDPESRVSWTLEHAKLKARLKILQKNQRNYMGEELDTLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRSKKNQ+M ESIS+LQ              KK+KE+EK +A+Q  
Sbjct  125  LQNLEHQLDSALKHIRSKKNQVMHESISQLQKKDKALQEHNNMLIKKVKEKEKALAKQSE  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREI--EDAQLPPPNIVMPQWLLPH  845
             + QE  D N SS +++ Q + S N   T   A E  +   + ++    + +MP W+L H
Sbjct  185  TD-QETYDLN-SSGFLS-QALPSLNTVGTCSSAVEDDQTTQQPSRTNNNSTIMPSWMLRH  241

Query  846  LT  851
            ++
Sbjct  242  IS  243



>gb|AGX01589.1| FRUITFULL-like protein, partial [Menispermum canadense]
Length=233

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 174/236 (74%), Gaps = 21/236 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V+LKRIENKINRQVTF+KRRSGLLKKA E+SVLCDA+V +IVFSTKGKL +YA+DS ME
Sbjct  5    RVELKRIENKINRQVTFAKRRSGLLKKAYELSVLCDAEVSLIVFSTKGKLCEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+Q +W+LE+AKL+ARIE L+K++RHYMGEDLDSLS +E
Sbjct  65   RILERYERYSYAERELVATDIETQGSWNLEHAKLQARIEVLKKNERHYMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            L NLEHQ+DS++KHIRS+K+QLM ESIS+LQ+K              +K + KE+ + P 
Sbjct  125  LHNLEHQLDSALKHIRSRKSQLMFESISQLQRKDKSLQEHNNLLVKQVKGKGKEIDQPPP  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
            +EQQ   D NSS++     P    ++G+  + AGE RE+E+ +    +  MP W+L
Sbjct  185  VEQQ--NDENSSTAL----PHQLRSVGDACQ-AGEEREVEETRQHQASSTMPAWML  233



>emb|CAA67967.1| MADS3 protein [Betula pendula]
Length=243

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 160/211 (76%), Gaps = 14/211 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V VIVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVAVIVFSHKGKLFEYATDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E+     D E Q +W++E+A+LK ++E L+++ RHY+G+DL+SLS +E
Sbjct  65   KILERYERYSYAEAQLVAADSEGQGSWTMEFARLKGKVELLQRNHRHYLGDDLESLSHKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+D+++KH+R++KNQLM ESIS+LQ              KKIKE+EK +A+  +
Sbjct  125  LQNLEQQLDTALKHVRTRKNQLMYESISQLQKKEKAIQEQNTILAKKIKEKEKTVAQHVD  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
             EQQ +   N SSS++  QP+   N+G  Y+
Sbjct  185  WEQQNQGAPNGSSSFLLPQPLPCLNIGGNYQ  215



>ref|XP_008374663.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X1 [Malus domestica]
Length=255

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 176/250 (70%), Gaps = 26/250 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKR SGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRTSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E      D ES  NW+LE+AKLKAR+E L++++ HYMGEDL  LSF+E
Sbjct  65   RILERYERYSHAERQLLANDNESTGNWTLEHAKLKARVEVLQRNQSHYMGEDLQILSFQE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+DS+++ IRS+KNQ+M ESISELQKK              +KE+EK +  Q  
Sbjct  125  LQNLEQQLDSALRRIRSRKNQVMYESISELQKKDKALQEQNNLLAKNVKEKEKAVTSQAQ  184

Query  672  LEQQEKQDTNSSSSYVA--LQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNI  818
            LE  +KQ  +SSS+ +   LQ +N F+    ++       I+G+ ++  D    P  PN 
Sbjct  185  LEHAQKQSLDSSSTLLPQELQYLN-FSRSNYHQAIRSSNGISGDNQQDGDETATPHRPNT  243

Query  819  VMPQWLLPHL  848
            ++P W+L HL
Sbjct  244  LLPPWMLRHL  253



>ref|XP_008453619.1| PREDICTED: truncated transcription factor CAULIFLOWER A isoform 
X1 [Cucumis melo]
Length=261

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 171/256 (67%), Gaps = 29/256 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDS---  344
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS   
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCEM  64

Query  345  ----------RMERILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRH  494
                       ME+IL RYER SY E      D +S  NW+LE+AKLKARIE L+K+ RH
Sbjct  65   NMSQNLNFHFSMEKILERYERYSYAERRLVANDSQSNGNWTLEHAKLKARIEVLQKNHRH  124

Query  495  YMGEDLDSLSFRELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KK  632
            +MGEDLDSLS +ELQN+E Q+DS++KHIR++KNQLM ESI+ELQ              KK
Sbjct  125  FMGEDLDSLSLKELQNIEQQLDSALKHIRARKNQLMHESITELQKKGKVLQEHNNMLGKK  184

Query  633  IKEREKEMAEQPNLEQQEKQDTNS--SSSYVALQPVNSFNLGETYEIAGEGREIEDAQLP  806
            IKE+EK  A  P +EQQ++QD+N+  SS  +  QP  S ++   Y               
Sbjct  185  IKEKEKSRAHNPLMEQQQQQDSNAIESSPLLLPQPFQSLSMSCPYTTHVPEENDSTVNHD  244

Query  807  PPNIVMPQWLLPHLTG  854
              + ++P W+L H  G
Sbjct  245  RSDTLLPPWMLRHHLG  260



>ref|XP_010260844.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Nelumbo 
nucifera]
Length=250

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 171/248 (69%), Gaps = 27/248 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V VIVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSTKGKLFEYATDSGME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ESQ NWSLEY KLK +IE L++++RHY+GEDL+SLS +E
Sbjct  65   RILERYERYSYAERELIAADSESQGNWSLEYTKLKNKIEILQRNQRHYVGEDLESLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IR++KNQL+ +SISELQKK    EK + EQ N              
Sbjct  125  LQNLEQQLDTALKQIRTRKNQLIYDSISELQKK----EKALQEQNNILTKKLKEKEKEKE  180

Query  672  ----LEQQEKQD----TNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP-PNIVM  824
                L QQ   D      SS S++  QP+ S  +  TY+  G   + E+A+     N +M
Sbjct  181  KEKALAQQAHWDQQNQGQSSPSFLLSQPLPSLAISGTYQGRGAACDDEEARSHARTNSLM  240

Query  825  PQWLLPHL  848
            P W+L HL
Sbjct  241  PPWMLRHL  248



>gb|AGX01553.1| FRUITFULL-like protein, partial [Aquilegia coerulea]
Length=240

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 168/241 (70%), Gaps = 24/241 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EIS+LCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISILCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD ESQ NWSLEY KLKA+IE L+K++RHY GEDL+++S +E
Sbjct  65   KILERYERYSYAERELAGTDSESQGNWSLEYVKLKAKIEILQKNQRHYNGEDLENMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLE------------  677
            LQNLE Q+DS++K IR++KNQLM ESISELQKK    E+ + EQ N              
Sbjct  125  LQNLEQQLDSALKQIRARKNQLMHESISELQKK----ERALTEQNNQLGKKLKEKEKELA  180

Query  678  -----QQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWL  836
                 +Q  Q  NSSS  ++ Q + S N+G  YE      E E  +  P  P  +MP W+
Sbjct  181  QQTPWEQPNQGQNSSSMLIS-QTLPSLNIGVNYEARSTRAEEEGTRPQPARPTTLMPPWM  239

Query  837  L  839
            L
Sbjct  240  L  240



>gb|ABB22022.1| MdMads2.2 protein [Malus domestica]
Length=255

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 176/250 (70%), Gaps = 26/250 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKR SGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRTSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E      D ES  NW+LE+AKLKAR+E L++++ HYMGEDL  LSF+E
Sbjct  65   RILERYERYSHAERQLLANDNESTGNWTLEHAKLKARVEVLQRNQSHYMGEDLQILSFQE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+DS+++ IRS+KNQ+M ESISELQKK              +KE+EK +  Q  
Sbjct  125  LQNLEQQLDSALRRIRSRKNQVMYESISELQKKDKALQEQNNLLAKNVKEKEKAVTSQAQ  184

Query  672  LEQQEKQDTNSSSSYVA--LQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNI  818
            L+  +KQ  +SSS+ +   LQ +N F+    ++       I+G+ ++  D    P  PN 
Sbjct  185  LDHAQKQSLDSSSTLLPQELQYLN-FSRSNYHQAIRSSNGISGDNQQDGDETATPHRPNT  243

Query  819  VMPQWLLPHL  848
            ++P W+L HL
Sbjct  244  LLPPWMLRHL  253



>gb|AEX58637.1| FUL-like protein [Epimedium sagittatum]
Length=253

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/251 (54%), Positives = 172/251 (69%), Gaps = 30/251 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+Q NWSLEY+KLKA+IE L+K++RH++GE LD++S +E
Sbjct  65   RILERYERYSYAERELVATDVETQGNWSLEYSKLKAKIEVLQKNQRHFLGEGLDAMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+DS++K IR++KNQLM ESISELQ+K    EK + EQ N              
Sbjct  125  LQNLEQQLDSALKQIRTRKNQLMYESISELQRK----EKALQEQNNQLGKKLKEKEKALA  180

Query  672  ----------LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDA--QLPPPN  815
                       + Q +    +S S++  Q + S N+G  Y+ +G   E E A  Q  P  
Sbjct  181  QQAQWDQQNQNQNQNQNQDQTSPSFLLQQSLPSLNIGGAYQASGSSVEEEAARPQSRPNT  240

Query  816  IVMPQWLLPHL  848
             +MP W+L H+
Sbjct  241  SLMPPWMLRHV  251



>ref|XP_009337973.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X2 [Pyrus x bretschneideri]
Length=254

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 178/250 (71%), Gaps = 25/250 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQ TFSKRRSGL+KKA EISVLCDA+V +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQGTFSKRRSGLMKKAQEISVLCDAEVALIIFSTKGKLFEYSNDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L++++RHYMGEDL SLS +E
Sbjct  65   RILERYERYSYAERQLLANDNESTGSWTLEHAKLKARVEVLQRNQRHYMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE--------------MAEQPN  671
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQKK K  +++              +A++P 
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKKDKALQEQNNLLAKKVKEKEKAVAQRPQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGET-YE-------IAGEGREIEDAQLPP--PNIV  821
            LE  ++Q  +SSSS +  Q + S N G + Y+       I G+ ++  D    P  PN++
Sbjct  185  LEHAQEQRLDSSSSLLP-QALQSLNFGGSNYQAIRSSEGIPGDNQQDGDETPTPRRPNML  243

Query  822  MPQWLLPHLT  851
            +P W+L HL 
Sbjct  244  LPPWMLRHLN  253



>ref|XP_010037260.1| PREDICTED: truncated transcription factor CAULIFLOWER A isoform 
X1 [Eucalyptus grandis]
 gb|KCW48936.1| hypothetical protein EUGRSUZ_K02547 [Eucalyptus grandis]
Length=245

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 173/247 (70%), Gaps = 30/247 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDADV +IVFSTKGKLF+YA+D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRCGLLKKAHEISVLCDADVALIVFSTKGKLFEYATDCCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY ES     + E+  NW+LE+AKLKAR+E L+K++++ MGE+LDSLS +E
Sbjct  65   RILERYERYSYAESQVLTNNAETNGNWTLEHAKLKARMEILQKNQKNLMGEELDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQ-----------  680
            LQNLEHQ+D+++KHIRS+KNQLM ESISELQ+K    +K + EQ N+             
Sbjct  125  LQNLEHQLDTALKHIRSRKNQLMYESISELQRK----DKALQEQNNMLAKKVKEKEKALA  180

Query  681  QEKQ------DTNSSSSYVALQPVNSFNLGETYEIAGEGREIED-AQLPPPN----IVMP  827
            Q+ Q      D  +SSS +  Q +   N+G  Y  +G    IE+ A L PP      ++P
Sbjct  181  QQTQWDNPQDDGLTSSSVILSQSLQPVNIGGPYHPSG----IEEGAALGPPQHRNATLLP  236

Query  828  QWLLPHL  848
             W+L HL
Sbjct  237  SWMLSHL  243



>gb|AFX72885.1| MADS-box protein FL1B [Aquilegia coerulea]
Length=245

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 167/244 (68%), Gaps = 24/244 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +I+FSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E     TD ESQ NWSLEY KLKA+IE L+K++RHY GEDL+ +S +E
Sbjct  65   NILERYERYSYAERELAGTDSESQGNWSLEYVKLKAKIEILQKNQRHYNGEDLEKMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLE------------  677
            LQNLE Q+DS++K IR++KNQLM ESISELQKK    E+ + EQ N              
Sbjct  125  LQNLEQQLDSALKQIRARKNQLMHESISELQKK----ERALTEQNNQLGKKLKEKEKELA  180

Query  678  -----QQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWL  836
                 +Q  +  NS S  ++ Q + S N+G  YE      E E  Q  P  P  +MP W+
Sbjct  181  QQSPWEQPNRGQNSPSMLIS-QTLPSLNIGVNYETRSTRAEEEGTQPQPARPTTLMPPWM  239

Query  837  LPHL  848
            L H+
Sbjct  240  LRHV  243



>emb|CAA67969.1| MADS5 protein [Betula pendula]
Length=244

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 173/243 (71%), Gaps = 21/243 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY +      D E   +W+LE+AKLKARIE L+++++H++GEDLDSLS +E
Sbjct  65   RILERYERYSYADRQLLANDLEQNGSWTLEHAKLKARIEVLQRNQKHFVGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE--------------MAEQPN  671
            LQNLE Q+DS++KHIRS+KNQLM ESISELQ+K K  +++              +A+Q  
Sbjct  125  LQNLEQQLDSALKHIRSRKNQLMYESISELQRKDKALQEQNNVLAKKVKEKEKELAQQAQ  184

Query  672  LEQQEKQDTNSSSSYVALQPV-NSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWLLP  842
             EQQ    T  S   +  QP+ +S N+G + +  G GR   D   PP   N ++P W+L 
Sbjct  185  WEQQSH--TLDSVPSLLPQPLQSSLNIGGSQQARGNGR--VDEGTPPHRANALLPPWMLR  240

Query  843  HLT  851
            HL 
Sbjct  241  HLN  243



>dbj|BAK20017.1| PgMADS protein2 [Panax ginseng]
Length=242

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 169/243 (70%), Gaps = 25/243 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDA V +IVFSTKGKLF+Y++DS M 
Sbjct  5    RVQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCDAQVALIVFSTKGKLFEYSTDSSMN  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER S  E     TD E Q NWSLE+A L A+IE L+++ RHY GE+LD L+ RE
Sbjct  65   TILERYERYSSAEKQLGATDAEPQDNWSLEFANLTAKIEVLQRNIRHYAGEELDPLNLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ LE Q+D+++K IR++KNQLM ESI ELQ              KKIKE+EK MAE+  
Sbjct  125  LQCLEQQLDTALKRIRTRKNQLMHESIYELQKKEKALQGHNNQLAKKIKEKEKTMAEREQ  184

Query  672  LEQQEKQDTNSSSSYV---ALQPVNSFNLGETYEIAGEGREIEDAQLPPPNI-VMPQWLL  839
            LEQQ +    SSS+++      P  S  +G T+++ G+G     AQ PP N  +MP W+L
Sbjct  185  LEQQNR--GQSSSTFILPQPPPPFPSLTIGGTFQVTGDG-----AQAPPCNTSLMPPWML  237

Query  840  PHL  848
             H+
Sbjct  238  RHV  240



>ref|XP_007138377.1| hypothetical protein PHAVU_009G203400g [Phaseolus vulgaris]
 gb|ESW10371.1| hypothetical protein PHAVU_009G203400g [Phaseolus vulgaris]
Length=247

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 172/239 (72%), Gaps = 18/239 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y+SD  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     +DQ    NW+LE+AKLKAR+E L+K++R++MG+DLD LS +E
Sbjct  65   RILERYERYSYAERQLVVSDQPQSENWTLEHAKLKARLEVLQKNQRNFMGQDLDGLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE---------------MAEQP  668
            LQNLEHQ+DS++KHIRS+KNQLM ESISEL KK K  +++                A+Q 
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMYESISELNKKDKALQEQNNTLAKKIKEKEKALAAQQA  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP--NIVMPQWLL  839
              E+Q   + + +SS +  QP+ + N+  + ++ G+G + E +   P   N ++P W+L
Sbjct  185  QFERQ-ADEMDLASSVLVPQPLETSNIRGSSQVIGDGGDNEGSATTPSRVNAILPPWML  242



>gb|ADC79705.1| FRUITFULL-like protein [Akebia trifoliata]
Length=241

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 169/242 (70%), Gaps = 20/242 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQLKRIENKINRQVTFSKR+SGL+KKA+EISVLCDADV +IVFS+KGKL++Y++DS M+
Sbjct  3    KVQLKRIENKINRQVTFSKRKSGLMKKAHEISVLCDADVSLIVFSSKGKLYEYSTDSGMD  62

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E     T+ ESQ NWSLEY KLKA+IE L+K++R+YMGE+L S+S +E
Sbjct  63   RILERYERYSFAERELVATEIESQGNWSLEYTKLKAKIEVLQKNQRYYMGEELSSMSLKE  122

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQ-----------  680
            LQNLEHQ+D+++KHIRS++NQLM ESISELQ+K    EK + EQ N              
Sbjct  123  LQNLEHQLDNALKHIRSRRNQLMYESISELQRK----EKALQEQNNQLGKKLKEKEKALE  178

Query  681  -----QEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPH  845
                 +      +   ++  Q + S N+G  +   G G E E A+  P + +MP W+L H
Sbjct  179  QMGNLEHPNQGQNGPPFLLSQTLPSLNIGGPHLPRGNGGEDESARPEPRHTLMPPWMLRH  238

Query  846  LT  851
            + 
Sbjct  239  VN  240



>dbj|BAL14660.1| APETALA1 and FRUITFULL like protein [Chrysanthemum seticuspe 
f. boreale]
Length=236

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 164/240 (68%), Gaps = 25/240 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V LKRIENKINRQVTFSKRR+GLLKKA+EISVLCDADVG++VFS KGKL ++A+D+ ME
Sbjct  5    RVTLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDADVGLVVFSAKGKLCEFATDASME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD ES   W+LE+AKLK R E L+K++RH  GEDLDSLS +E
Sbjct  65   RILERYERYSYAERQLTATDNESHGRWTLEHAKLKCRFELLQKTQRHLKGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEM-AEQP  668
            LQNLEHQID+++KHIR +KNQ+M ESIS LQ              KK+KE EK++ A+QP
Sbjct  125  LQNLEHQIDTALKHIRLRKNQMMFESISVLQKKDKELQNQNNVLSKKVKEVEKDLAAQQP  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHL  848
             +EQQ          Y++  P      G   +I G+ +         P+IV+P W+L H+
Sbjct  185  LVEQQNPDKMLHLDPYIS-APCQVGGDGVVEKIPGQAQ---------PSIVLPPWMLQHM  234



>gb|ABG49526.1| FUL-like protein 2 [Sinofranchetia chinensis]
Length=245

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 172/243 (71%), Gaps = 22/243 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKR++GLLKKA+EISVLCDADV +IVFSTKGKL++Y+++S M+
Sbjct  5    RVQLKRIENKINRQVTFSKRKTGLLKKAHEISVLCDADVALIVFSTKGKLYEYSTESGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL +YER SY E     TD ESQ NW LEY KLKA+IE L+K++RH+MG++L+S+SF+E
Sbjct  65   RILEKYERYSYAERELVATDSESQGNWPLEYTKLKAKIEVLQKNQRHFMGQELNSMSFKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN------------LE  677
            LQNLE Q+D+++K IRSK+NQLM ESISELQKK    EK + EQ N            L 
Sbjct  125  LQNLEQQLDTALKQIRSKRNQLMNESISELQKK----EKALQEQNNQLGKKLKEKEKTLA  180

Query  678  Q----QEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWLL  839
            Q    +      +S S++  Q + S N+G   +  G G E E  + P   PN ++P W+L
Sbjct  181  QLAHWEHPNQGQNSPSFLLSQTLPSLNIGGPSQTRGSGCEEERTRRPETRPNTLLPPWML  240

Query  840  PHL  848
             H+
Sbjct  241  RHI  243



>ref|XP_004299280.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog [Fragaria 
vesca subsp. vesca]
Length=264

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/267 (52%), Positives = 175/267 (66%), Gaps = 51/267 (19%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVES--LPNPTDQESQ----CNWSLEYAKLKARIEFLEKSKRHYMGEDLD  515
            RIL RYER SY E   L N  +Q+ Q     NW+LE+AKLKAR+E L+K++ H+MGEDL 
Sbjct  65   RILERYERYSYAERQLLGNNHEQQDQDQSNGNWTLEHAKLKARVEVLQKNQSHFMGEDLQ  124

Query  516  SLSFRELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------  674
            SLS ++LQNLE Q+DS++KH+RS+KNQLM ESIS LQKK    +K + EQ NL       
Sbjct  125  SLSMKQLQNLEQQLDSALKHVRSRKNQLMYESISTLQKK----DKALQEQNNLLTKKVNV  180

Query  675  --------------------EQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIED  794
                                EQ ++Q  +SS+S +  Q + S N G        G   +D
Sbjct  181  KEKEKAVAGSAPQSQAQSQWEQMQRQSFDSSTSALLPQALPSMNFG-----GSSGGYDQD  235

Query  795  AQLPPP---------NIVMPQWLLPHL  848
             ++PPP         N ++P W+L HL
Sbjct  236  EEIPPPPQHQAAANSNTLLPPWMLRHL  262



>gb|AGX01542.1| FRUITFULL-like protein, partial [Macleaya cordata]
Length=242

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 170/243 (70%), Gaps = 26/243 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     ++ + Q NWSLEY KLKA+IE L+K++RH+MGEDL+S+SF+E
Sbjct  65   RILERYERYSYAERELVASELD-QGNWSLEYTKLKAKIEILQKNQRHFMGEDLESMSFKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IRS+KNQLM ESI+ELQ+K    EK + EQ N              
Sbjct  124  LQNLEQQLDTALKQIRSRKNQLMYESIAELQRK----EKALQEQNNQLGKKLKEKEKEVA  179

Query  672  ---LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP----NIVMPQ  830
                +  ++    SS S++  Q + S N+G +Y++ G     E+   P        +MPQ
Sbjct  180  QQQTQWDQQNQGQSSPSFLLSQSLPSLNIGGSYQVRGSNGSEEEGTQPQTTRTNTTLMPQ  239

Query  831  WLL  839
            W+L
Sbjct  240  WML  242



>gb|KCW83765.1| hypothetical protein EUGRSUZ_B00634 [Eucalyptus grandis]
Length=228

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 168/226 (74%), Gaps = 4/226 (2%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            ++QLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +I+FS KGKLF+Y++DS ME
Sbjct  5    RLQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIIFSAKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     ++ ES  +W+LE+AKLKAR+E L ++ RH+MGEDLDSLS ++
Sbjct  65   RILERYERYSYSEHQVLASETESIGSWTLEHAKLKARLEVLHRNYRHFMGEDLDSLSLKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQEKQDTNSSSS  713
            LQNLE Q++S++KHIRS+KNQLM ESIS LQKK+KE+E+ +A+Q    Q E+QD    S 
Sbjct  125  LQNLEQQLESALKHIRSRKNQLMHESISVLQKKVKEKERALAQQA---QWEQQDHALDSP  181

Query  714  YVALQPVNSFNLGETYEIAGEGR-EIEDAQLPPPNIVMPQWLLPHL  848
             V    + S ++  +Y+    G  + E+   P    ++P W+L  L
Sbjct  182  VVLPHYLPSLDINGSYQARHNGHDDGENLTQPRAGTLLPPWMLHRL  227



>gb|ABQ85944.1| MADS-box transcription factor FUL-like 1 [Trochodendron aralioides]
Length=230

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 167/231 (72%), Gaps = 18/231 (8%)
 Frame = +3

Query  201  KINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILARYERC  380
            KINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME IL RYER 
Sbjct  1    KINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSMEMILERYERY  60

Query  381  SYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLEHQID  560
            SY E     TD ESQ NWSLEY KLKARI+ L++++ H++GE+L SLS +ELQNLE Q+D
Sbjct  61   SYAERELVATDPESQGNWSLEYTKLKARIDLLQRNQSHFLGEELSSLSLKELQNLEQQLD  120

Query  561  SSIKHIRSKKNQLMLESISELQKK----------IKEREKE---MAEQPNLEQQEKQDTN  701
            +S+KHIRS+KNQLM ESISELQKK          + E+ KE   +A+Q + EQQ +    
Sbjct  121  NSLKHIRSRKNQLMYESISELQKKEKALQQQNNSLAEKLKETKALAQQAHWEQQNQ--VQ  178

Query  702  SSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWLLPHL  848
            +S S++  Q + S N+G TY+  G G E ED   P    N ++P W+L H+
Sbjct  179  NSPSFLLSQSLPSLNIGGTYQARGSGGE-EDGPRPQNRTNTLIPPWMLRHM  228



>ref|XP_007209500.1| hypothetical protein PRUPE_ppa010308mg [Prunus persica]
 emb|CAJ28929.1| putative MADS box protein [Prunus persica]
 gb|EMJ10699.1| hypothetical protein PRUPE_ppa010308mg [Prunus persica]
Length=255

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 172/254 (68%), Gaps = 34/254 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAQEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L+++  H+MGEDL SLS +E
Sbjct  65   RILERYERYSYSEKQLLANDHESTGSWTLEHAKLKARVEVLQRNCSHFMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQKK    +K + EQ NL             
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKK----DKALQEQNNLLAKKVKEKEKALA  180

Query  675  -------EQQEKQDTNSSSSYV--ALQPVNSFNLGETYEIA---GEGREIEDAQLPP---  809
                   +Q + Q  + SS+ +  ALQ +N F  G  Y+     G G + ED    P   
Sbjct  181  PQAESWEQQVQNQGLDCSSTLLPEALQSLN-FGSGSNYQGIRNDGSGGDHEDENETPTAN  239

Query  810  -PNIVMPQWLLPHL  848
             PN ++P W+L HL
Sbjct  240  RPNTLLPPWMLRHL  253



>gb|AGX01556.1| FRUITFULL-like protein, partial [Nigella sativa]
Length=241

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 168/238 (71%), Gaps = 17/238 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D ESQ NWSLEY KLK ++E L+K++RHYMGEDLD++S +E
Sbjct  65   KILERYERYSYAERELVAHDPESQGNWSLEYTKLKTKVEILQKNQRHYMGEDLDNMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE--------------MAEQPN  671
            LQNLE Q+DS++K IRS+KNQLM ESIS+LQKK K  +++              +A+Q  
Sbjct  125  LQNLEQQLDSALKQIRSRKNQLMHESISDLQKKEKALQEQNSQLGKKLKEKEKEIAQQGQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE--IAGEGREIEDAQLPPPNIVMPQWLL  839
             E Q  Q  +S +  +  Q + S N+G  Y+    G G E   A  P P  +MP W+L
Sbjct  185  WE-QPNQSQSSMTFLLPSQSLPSLNIGGNYQGRSNGGGEEEASAAQPRPISLMPPWIL  241



>gb|AGX01552.1| FRUITFULL-like protein, partial [Aquilegia coerulea]
Length=240

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 165/241 (68%), Gaps = 24/241 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +I+FSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E     TD ESQ NWSLEY KLKA+IE L+K++RHY GEDL+ +S +E
Sbjct  65   NILERYERYSYAERELAGTDSESQGNWSLEYVKLKAKIEILQKNQRHYNGEDLEKMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLE------------  677
            LQNLE Q+DS++K IR++KNQLM ESISELQKK    E+ + EQ N              
Sbjct  125  LQNLEQQLDSALKQIRARKNQLMHESISELQKK----ERALTEQNNQLGKKLKEKEKELA  180

Query  678  -----QQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWL  836
                 +Q  +  NS S  ++ Q + S N+G  YE      E E  Q  P  P  +MP W+
Sbjct  181  QQSPWEQPNRGQNSPSMLIS-QTLPSLNIGVNYETRSTRAEEEGTQPQPARPTTLMPPWM  239

Query  837  L  839
            L
Sbjct  240  L  240



>ref|XP_008240080.1| PREDICTED: truncated transcription factor CAULIFLOWER A isoform 
X1 [Prunus mume]
Length=255

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 172/254 (68%), Gaps = 34/254 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAQEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L+++  H+MGEDL SLS +E
Sbjct  65   RILERYERYSYSEKQLLANDNESTGSWTLEHAKLKARVEVLQRNHSHFMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQKK    +K + EQ NL             
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKK----DKALQEQNNLLAKKVKEKEKALA  180

Query  675  -------EQQEKQDTNSSSSYV--ALQPVNSFNLGETYEIA---GEGREIEDAQLPP---  809
                   +Q + Q  + SS+ +  ALQ +N F  G  Y+     G G + ED    P   
Sbjct  181  PQAQSWEQQVQNQGLDCSSTLLPEALQSLN-FGSGSNYQGIRSDGFGGDHEDENETPTAN  239

Query  810  -PNIVMPQWLLPHL  848
             PN ++P W+L HL
Sbjct  240  RPNTLLPPWMLRHL  253



>gb|AHI42988.1| MADS-box protein [Vaccinium vitis-idaea]
Length=249

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 177/253 (70%), Gaps = 34/253 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD ++Q +WSLE++KLKAR+E L++++RHYMGEDLD+L+ RE
Sbjct  65   RILERYERYSYAERELIATDLDTQGSWSLEHSKLKARLELLQRNQRHYMGEDLDTLTLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLEHQ+D+++KH+R+KKNQLM ESISELQKK    +K + +Q NL             
Sbjct  125  LQNLEHQLDTALKHVRTKKNQLMHESISELQKK----DKALIDQNNLLAKKIKEKEKEQA  180

Query  675  --EQQEKQDTNSSSSYVALQPV----NSFN--LGETYE----IAG-EGREIEDAQLPPPN  815
               Q E+Q+++   S V   P+    + FN   G  Y+    I G +G  I++   P   
Sbjct  181  KEAQLEQQNSDLMISSVGAMPLPHLTDPFNNIGGANYQEDGGIGGVQGNPIQNLNTP---  237

Query  816  IVMPQWLLPHLTG  854
             +MP W+   L+G
Sbjct  238  -MMPPWMFRRLSG  249



>gb|AAU29514.1| MADS6 [Prunus persica]
Length=255

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 171/253 (68%), Gaps = 34/253 (13%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQLKRIENKINRQVTFSKRRSGLLKKA EISVLCDA+V +IVFSTKGKLF+Y++DS MER
Sbjct  6    VQLKRIENKINRQVTFSKRRSGLLKKAQEISVLCDAEVALIVFSTKGKLFEYSTDSCMER  65

Query  357  ILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFREL  536
            IL RYER SY E      D ES  +W+LE+AKLKAR+E L+++  H+MGEDL SLS +EL
Sbjct  66   ILERYERYSYSEKQLLANDHESTGSWTLEHAKLKARVEVLQRNCSHFMGEDLQSLSLKEL  125

Query  537  QNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL--------------  674
            QNLE Q+DS++KHIRS+KNQ+M ESISELQKK    +K + EQ NL              
Sbjct  126  QNLEQQLDSALKHIRSRKNQVMYESISELQKK----DKALQEQNNLLAKKVKEKEKALAP  181

Query  675  ------EQQEKQDTNSSSSYV--ALQPVNSFNLGETYEIA---GEGREIEDAQLPP----  809
                  +Q + Q  + SS+ +  ALQ +N F  G  Y+     G G + ED    P    
Sbjct  182  QAESWEQQVQNQGLDCSSTLLPEALQSLN-FGSGSNYQGIRNDGSGGDHEDENETPTANR  240

Query  810  PNIVMPQWLLPHL  848
            PN ++P W+L HL
Sbjct  241  PNTLLPPWMLRHL  253



>dbj|BAN89458.1| FUL-like MADS-box transcription factor [Shorea beccariana]
Length=254

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 172/254 (68%), Gaps = 31/254 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQL+RIENKI+RQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLRRIENKISRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSNKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER +Y E    P D ESQ NWSLE+ KLK+RIE L+K+ +H++GE+L  LS RE
Sbjct  65   RILERYERNAYAERQLLPNDSESQTNWSLEFPKLKSRIEALQKNVKHFVGEELAPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LE QID+++K IRS+KNQLM ESISELQ              KK+KE +K +AE+P 
Sbjct  125  LQHLEQQIDTALKRIRSRKNQLMHESISELQKKEKLLREQNDTLSKKLKENDKTVAEKPP  184

Query  672  LEQQEKQDTNSSSSYV-------------ALQPVNSFNLGETYEIAGEGREIEDAQLPPP  812
              Q +    +SSS ++             A  P  S  +G  ++++ EG E       P 
Sbjct  185  QPQLQHVGQSSSSQFIQPPPLPLPLPPRTATLPFPSLTIGGRFQVS-EGAE---GTSRPS  240

Query  813  NIVMPQWLLPHLTG  854
            N +MP W+L HL G
Sbjct  241  NSLMPAWMLRHLNG  254



>ref|XP_009346308.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Pyrus x bretschneideri]
Length=255

 Score =   243 bits (619),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 176/250 (70%), Gaps = 26/250 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENK+NRQVTFSKRRSGLLKKA+EISVLCDA+V +I+FSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKVNRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E      D ES  +W+LE+AKLKAR+E L++++ HYMGEDL  LS +E
Sbjct  65   RILERYERYSHAERQLLANDNESTGSWTLEHAKLKARVEVLQRNQSHYMGEDLQILSLQE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+DS++K IRS+KNQ+M ESISELQKK              +KE+EK +A Q  
Sbjct  125  LQNLEQQLDSALKRIRSRKNQVMYESISELQKKDKALQEQNNLLAKNVKEKEKAVAPQAQ  184

Query  672  LEQQEKQDTNSSSSYV--ALQPVNSFNLGETYE-------IAGEGREIEDAQLPP--PNI  818
            L+  +KQ  + SS+ +  ALQ +N F+    ++       I+G  ++  D    P  P+ 
Sbjct  185  LDHAQKQSLDFSSTLLPQALQSLN-FSRSNYHQAIRSSDGISGVNQQDGDETATPHRPHT  243

Query  819  VMPQWLLPHL  848
            ++P W+L HL
Sbjct  244  LLPPWMLRHL  253



>gb|AAO22981.1| MADS-box transcription factor CDM8 [Chrysanthemum x morifolium]
 dbj|BAN13566.1| apetala1/fruitful-like protein [Chrysanthemum seticuspe f. boreale]
Length=237

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 171/237 (72%), Gaps = 16/237 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V LKRIENKINRQVTFSKRRSGLLKKA+EISVLCDADV +IVFSTKGKL +Y++DS M+
Sbjct  5    RVTLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTKGKLCEYSTDSSMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     T  ESQ +W+LE+AKLKARIE L+KSKRH MGE+LDSL+ +E
Sbjct  65   RILERYERYSYAEMQLTSTHNESQGSWTLEHAKLKARIELLQKSKRHLMGEELDSLTLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQEKQDTNSSSS  713
            LQ LE Q+D+++KH+R +KNQLM ESIS LQKK    +K+M E+ N+  ++ ++    ++
Sbjct  125  LQGLEQQLDTALKHVRLRKNQLMFESISALQKK----DKDMQERNNILSKQIKEKEKDAA  180

Query  714  YVALQP-----VNSFNLG-----ETYEIAGEGREIEDAQLPP-PNIVMPQWLLPHLT  851
            +   +P     V S +LG     + ++ AG   E+ED   P  P   MP W++ H++
Sbjct  181  HHDKEPQIHAAVPSLHLGILNNCDAHQ-AGSDWEVEDIPRPAQPLTFMPPWMVQHMS  236



>ref|XP_006581051.1| PREDICTED: uncharacterized protein LOC100816836 isoform X1 [Glycine 
max]
 gb|KHN19592.1| Agamous-like MADS-box protein AGL8 like [Glycine soja]
Length=244

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 170/242 (70%), Gaps = 27/242 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y+SD  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     +DQ    NW+LE+AKLKAR+E L+K++R++MG+DL+ LS +E
Sbjct  65   RILERYERYSYAERQLVASDQPQTENWTLEHAKLKARLEVLQKNQRNFMGQDLEGLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLE------------  677
            LQNLEHQ+DS++KHIRS+KNQ+M ESISEL KK    +K + EQ N              
Sbjct  125  LQNLEHQLDSALKHIRSRKNQIMHESISELHKK----DKVLQEQNNTLAKKIKEKEKALA  180

Query  678  -----QQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP---NIVMPQW  833
                 +Q   + + +SS +   P+ + N+ E+ +I GEG   ++   P P   N ++P W
Sbjct  181  QHAQMEQRGDEMDLTSSALVPHPLETSNIRESSQIRGEG---DNEGTPTPTRANAILPSW  237

Query  834  LL  839
            +L
Sbjct  238  ML  239



>gb|ABK92820.1| unknown [Populus trichocarpa]
Length=244

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 175/245 (71%), Gaps = 25/245 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            ++QLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+DS ME
Sbjct  5    RIQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER SY E  L    D E+  +W+LEYAKLKAR++ L++++RH+MGEDLDSL+ +
Sbjct  65   RILERYERYSYAERQLLANDDPENHGSWTLEYAKLKARVDVLQRNQRHFMGEDLDSLNIK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE---------------MAEQ  665
            ELQNLEHQIDS++KH+RS+KNQLM ESISELQKK K  +++               +A+Q
Sbjct  125  ELQNLEHQIDSALKHVRSRKNQLMYESISELQKKDKALQEQNNMLAKKVKEKEKAIIAQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLP---PPNIVMPQWL  836
             + EQQ   D + S + +  QP+   N+  ++   G    IE+   P     N ++P W+
Sbjct  185  ASWEQQNP-DLD-SPTILRPQPMQPLNISSSHLATG----IEEEPAPIQHRANALLPAWM  238

Query  837  LPHLT  851
            L +L 
Sbjct  239  LRYLN  243



>gb|KDP41335.1| hypothetical protein JCGZ_15742 [Jatropha curcas]
Length=243

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 158/211 (75%), Gaps = 15/211 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D  SQ NW+LEY +LKA++E LE++ RHY+GEDLDSLS +E
Sbjct  65   KILERYERYSYAERQLIANDLNSQENWTLEYNRLKAKVELLERNHRHYLGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D+++KHIR++ NQLM ESISE QKK              IKE+EK +A+Q  
Sbjct  125  LQNLEQQLDTALKHIRARNNQLMHESISEYQKKEKAIEAQNSMLAKQIKEKEKAVAQQAL  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
             EQQ + +T+ S   V  QP+   N+G TY+
Sbjct  185  WEQQNR-NTHMSPFLVPQQPLPCLNIGGTYQ  214



>gb|AFV92462.1| Mads-box protein [Betula platyphylla]
Length=243

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 159/211 (75%), Gaps = 14/211 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V VIVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVAVIVFSHKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D E Q +W++E+A+LK ++E L+++ RHY+G+ L+SLS +E
Sbjct  65   KILERYERYSYAERQLVAADSEGQGSWTMEFARLKGKVELLQRNHRHYLGDGLESLSQKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q+D+++KH+R++KN+LM ESIS+LQ              KKIKE+EK +A+Q +
Sbjct  125  LQNLEQQLDTALKHVRTRKNRLMYESISQLQRKEKAIQEQNTILAKKIKEKEKTVAQQVD  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
             EQQ +   N SSS++  QP+   N+G  Y+
Sbjct  185  WEQQNQGAPNGSSSFLLPQPLPCLNIGGNYQ  215



>ref|XP_011013298.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X2 [Populus euphratica]
Length=244

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 174/245 (71%), Gaps = 25/245 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            ++QLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+DS ME
Sbjct  5    RIQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER SY E  L    D E+  +W+LEYAKLKAR++ L+K++RH+MGEDLDSL+ +
Sbjct  65   RILERYERYSYAERQLLANDDPENHGSWTLEYAKLKARVDVLQKNQRHFMGEDLDSLNIK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE---------------MAEQ  665
            ELQNLEHQIDS++KH+RS+KNQLM ESISELQKK K  +++               +A+Q
Sbjct  125  ELQNLEHQIDSALKHVRSRKNQLMYESISELQKKDKALQEQNNMLAKKVKEKEKAIIAQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLP---PPNIVMPQWL  836
               EQQ   D + S + +  QP+   N+  ++   G    IE+   P     N ++P W+
Sbjct  185  APWEQQNP-DLD-SPTILRPQPMQPLNISSSHLATG----IEEEPTPIQNRANALLPAWM  238

Query  837  LPHLT  851
            L +L 
Sbjct  239  LRYLN  243



>gb|AGX01535.1| FRUITFULL-like protein, partial [Pseudofumaria lutea]
Length=241

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 167/241 (69%), Gaps = 23/241 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD + Q NWSLEY KLKA+IE L+K++RH+MGEDL+S+S +E
Sbjct  65   RILERYERYSYAERELVTTDLDPQGNWSLEYTKLKAKIEILQKNQRHFMGEDLESMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLE Q+D+++K IRS+KNQLM ESISELQ+K    EK + EQ N              
Sbjct  125  LQNLEQQLDTALKQIRSRKNQLMYESISELQRK----EKALQEQNNQLGKKLKEKEKEAA  180

Query  675  --EQQEKQDTNSSS-SYVALQPVNSFNLGETYEI---AGEGREIEDAQLPPPNIVMPQWL  836
               Q E Q+   +S S++  Q + S N+G  Y      G G E  +      N +MP W+
Sbjct  181  QKSQWENQNQGQNSPSFLLSQSLPSLNIGGNYPTRNNTGGGEEEGNRAQTQTNSLMPPWM  240

Query  837  L  839
            +
Sbjct  241  V  241



>gb|AGX01554.1| FRUITFULL-like protein, partial [Helleborus x hybridus]
Length=241

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 171/239 (72%), Gaps = 19/239 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFS RRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSIRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SYVE     TD E Q NWSLEY KLKA++E L+K++RH+MGEDL ++S +E
Sbjct  65   KILERYERYSYVERECVGTDAELQGNWSLEYTKLKAKVEILQKNQRHFMGEDLANMSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE--------------MAEQPN  671
            LQNLE Q+DS++K IRS+KNQLM ESIS LQKK KE + +              +A+Q N
Sbjct  125  LQNLEQQVDSALKQIRSRKNQLMHESISNLQKKEKELQDQNNQLGKKLKEKEKEIAQQAN  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP-PNI--VMPQWLL  839
             E Q  Q  NS S  ++ + V S N+G  Y+    G + E A+  P P+   +MP W++
Sbjct  185  WE-QPNQGQNSQSLALS-RTVPSLNIGGNYQARNTGGDDEGARAQPRPSTLNLMPPWMV  241



>ref|XP_002514623.1| mads box protein, putative [Ricinus communis]
 gb|EEF47729.1| mads box protein, putative [Ricinus communis]
Length=244

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 171/242 (71%), Gaps = 21/242 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD E+  +W+LE+AKLKAR+E L++++RH+MGE+LD+L+ ++
Sbjct  65   RILERYERYSYAERQLLATDTETNGSWTLEHAKLKARVEVLQRNQRHFMGEELDTLTLKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE QIDS++KH+RS+KNQLM ESISELQKK    +K + EQ N              
Sbjct  125  LQNLEQQIDSALKHVRSRKNQLMYESISELQKK----DKALQEQNNQLAKKVKEKEKAKA  180

Query  672  -LEQQEKQDTNSSSSYVAL-QPVNSFNLGETYEIAGEGREIEDAQLPP-PNIVMPQWLLP  842
               Q E+Q+    SS V L QP+ S N+  T+   G   E E   +    N ++P W+L 
Sbjct  181  QQTQWEQQNQGVDSSPVLLPQPIQSMNIRSTHPARGSTGEDETTPIHNRANALLPAWMLT  240

Query  843  HL  848
            H 
Sbjct  241  HF  242



>gb|AGX01541.1| FRUITFULL-like protein, partial [Eomecon chionantha]
Length=242

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 171/245 (70%), Gaps = 30/245 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            RIL RYERCSY E   + N  D   Q NWSLEY+KLKA+IE L+K++RHYMGEDLDS+S 
Sbjct  65   RILERYERCSYAERELVANELD---QGNWSLEYSKLKAKIEILQKNQRHYMGEDLDSMSL  121

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN------------  671
            +ELQNLE Q+D+++K IRS+KNQLM ESISELQKK    EK + EQ N            
Sbjct  122  KELQNLEQQLDTALKQIRSRKNQLMYESISELQKK----EKALQEQNNQLGKKLKEKEKE  177

Query  672  -----LEQQEKQDTNSSSSYVALQPVNSFNLGETY-EIAGEGREIEDA--QLPPPN-IVM  824
                  +  ++    SS +++  Q + S N+G +Y E  G G E E    Q    N  +M
Sbjct  178  VAQQQAQWDQQNQGQSSPTFLLSQSLPSLNIGGSYQEQRGNGGEEERTRPQTTRTNTTLM  237

Query  825  PQWLL  839
            P W++
Sbjct  238  PPWMV  242



>gb|ACZ36916.1| MADS-box transcription factor 3 [Hevea brasiliensis]
Length=239

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 172/243 (71%), Gaps = 28/243 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY +     T  E+  +W+LE+AKLKAR+E L++++RH+MGEDLD+LS +E
Sbjct  65   RILERYERYSYADRQLVATGSETNGSWTLEHAKLKARMEVLQRNQRHFMGEDLDTLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK---IKEREKEMAE------------QP  668
            LQ++E QIDS++KHIRS+KNQLM ESI+ELQKK   ++E+  + A+            Q 
Sbjct  125  LQSVEQQIDSALKHIRSRKNQLMYESIAELQKKSKALQEQNNQFAKTVKEKEKEKEIAQQ  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP---PNIVMPQWLL  839
            N  Q+E+Q+    SS V   P+ S N+         G   ED   P     N V+P W++
Sbjct  185  N--QKEQQNHIIDSSTVLPPPMQSLNI--------RGNRDEDETTPMQHLANAVLPSWMI  234

Query  840  PHL  848
            P+L
Sbjct  235  PYL  237



>gb|ADK94172.1| AP1-like protein [Chrysanthemum lavandulifolium]
Length=237

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 171/236 (72%), Gaps = 16/236 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V LKRIENKINRQVTFSKRRSGLLKKA+EISVLCDADV +IVFSTKGKL +Y++DS M+
Sbjct  5    RVTLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTKGKLCEYSTDSSMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     T  ESQ +W+LE+AKLKARIE L+KSKRH MGE+LDSL+ +E
Sbjct  65   RILERYERYSYAEMQLTSTHNESQGSWTLEHAKLKARIELLQKSKRHLMGEELDSLTLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQEKQDTNSSSS  713
            LQ LE Q+D+++KH+R +KNQLM ESIS LQKK    +K+M E+ N+  ++ ++    ++
Sbjct  125  LQGLEQQLDTALKHVRLRKNQLMFESISALQKK----DKDMQERNNILSKQIKEKEKDAA  180

Query  714  YVALQP-----VNSFNLG-----ETYEIAGEGREIEDAQLPP-PNIVMPQWLLPHL  848
            +   +P     V S +LG     + ++ AG   E+E+   P  P  +MP W++ H+
Sbjct  181  HHDKEPQIHAAVPSLHLGILNNCDAHQ-AGSDWEVEEIPRPAQPLTIMPPWMVQHM  235



>gb|AGY54940.1| APETALA1 [Nelumbo nucifera]
Length=264

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 172/248 (69%), Gaps = 27/248 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V VIVFSTKGKLF+YA++S ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSTKGKLFEYATNSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RI+ RYER SY E      D ESQ +WSLE+ KLKA+IE L++++RHY+GEDL+SLS +E
Sbjct  65   RIIERYERYSYAERELLAADPESQGSWSLEHTKLKAKIEILQRNQRHYVGEDLESLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IR++KNQL+ +SISELQKK    EK + EQ N              
Sbjct  125  LQNLEQQLDTALKQIRTRKNQLIYDSISELQKK----EKALQEQNNILTKKLKEKEKEKE  180

Query  672  ----LEQQEKQD----TNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP-PNIVM  824
                L QQ   D      SS S++  QP+ S  +  TY+  G   + E+A+     N +M
Sbjct  181  KEKALAQQAHWDQQNQGQSSPSFLLSQPLPSLAISGTYQGRGAACDDEEARSHARTNSLM  240

Query  825  PQWLLPHL  848
            P W+L HL
Sbjct  241  PPWMLRHL  248



>ref|XP_004137449.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog [Cucumis 
sativus]
Length=261

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 173/260 (67%), Gaps = 37/260 (14%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDS---  344
            +VQLKRIENKI RQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS   
Sbjct  5    RVQLKRIENKIIRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCEM  64

Query  345  ----------RMERILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRH  494
                       ME+IL RYER SY E      D +   NW+LE+AKLKARIE L+K+ RH
Sbjct  65   NMSQNLNFHFSMEKILERYERYSYAERRLVANDSQPNGNWTLEHAKLKARIEVLQKNHRH  124

Query  495  YMGEDLDSLSFRELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KK  632
            +MGEDLDSLS +ELQN+E Q+DS++KHIR++KNQLM ESI+EL+              KK
Sbjct  125  FMGEDLDSLSLKELQNIEQQLDSALKHIRARKNQLMHESITELKKKGKVLQEHNNILGKK  184

Query  633  IKEREKEMAEQPNLEQQEKQDTN--SSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLP  806
            IKE+EK  A  P +EQQ+ Q++N   SS  +  QP  S ++   Y   G    +E+ +  
Sbjct  185  IKEKEKSRAHNPQMEQQQHQNSNVIESSPLLLPQPFQSLSMSCPYPTHG----LEENESA  240

Query  807  P----PNIVMPQWLLPHLTG  854
            P     + ++P W+L H  G
Sbjct  241  PNHERSDTLLPPWMLRHHLG  260



>gb|AAY30857.1| MADS-box transcription factor [Prunus dulcis]
Length=255

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 171/254 (67%), Gaps = 34/254 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAQEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L+++  H+MGEDL SLS +E
Sbjct  65   RILERYERYSYSEKQLLANDHESTGSWTLEHAKLKARVEVLQRNCSHFMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLE Q+DS+ KHIRS+KNQ+M ESISELQKK    +K + EQ NL             
Sbjct  125  LQNLEQQLDSAPKHIRSRKNQVMYESISELQKK----DKALQEQNNLLAKKVKEKEKALA  180

Query  675  -------EQQEKQDTNSSSSYV--ALQPVNSFNLGETYEIA---GEGREIEDAQLPP---  809
                   +Q + Q  + SS+ +  ALQ +N F  G  Y+     G G + ED    P   
Sbjct  181  PQAESWEQQVQNQGLDCSSTLLPEALQSLN-FGSGSNYQGIRNDGAGGDHEDENETPTAS  239

Query  810  -PNIVMPQWLLPHL  848
             PN ++P W+L HL
Sbjct  240  RPNTLLPPWMLRHL  253



>ref|XP_011013297.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X1 [Populus euphratica]
Length=247

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/248 (55%), Positives = 175/248 (71%), Gaps = 28/248 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            ++QLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+DS ME
Sbjct  5    RIQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQC---NWSLEYAKLKARIEFLEKSKRHYMGEDLDSL  521
            RIL RYER SY E  L    D E+ C   +W+LEYAKLKAR++ L+K++RH+MGEDLDSL
Sbjct  65   RILERYERYSYAERQLLANDDPENHCFQGSWTLEYAKLKARVDVLQKNQRHFMGEDLDSL  124

Query  522  SFRELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE---------------M  656
            + +ELQNLEHQIDS++KH+RS+KNQLM ESISELQKK K  +++               +
Sbjct  125  NIKELQNLEHQIDSALKHVRSRKNQLMYESISELQKKDKALQEQNNMLAKKVKEKEKAII  184

Query  657  AEQPNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLP---PPNIVMP  827
            A+Q   EQQ   D + S + +  QP+   N+  ++   G    IE+   P     N ++P
Sbjct  185  AQQAPWEQQNP-DLD-SPTILRPQPMQPLNISSSHLATG----IEEEPTPIQNRANALLP  238

Query  828  QWLLPHLT  851
             W+L +L 
Sbjct  239  AWMLRYLN  246



>emb|CAC81068.1| MADS box transcription factor [Daucus carota subsp. sativus]
Length=242

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 155/212 (73%), Gaps = 18/212 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    KVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSNKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E      D ES  NW+LEY KLKARI+ L++  RHYMGEDLDSL+ +E
Sbjct  65   EILERYERYSYAERQVIANDPESTGNWTLEYTKLKARIDLLQRDHRHYMGEDLDSLTLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            +QNLE Q+D+++KHIRS+KNQL+ ESIS+LQ              KKIKEREK M +Q  
Sbjct  125  IQNLEQQLDTALKHIRSRKNQLIFESISDLQKKEKAIQEENGKLTKKIKEREKTMVQQA-  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSF-NLGETYE  764
              Q EKQ+ + + S   +   N F N+G T++
Sbjct  184  --QWEKQNPSPNLSTFLMPQENPFLNIGGTFQ  213



>gb|ADU15472.1| FUL [Actinidia chinensis]
Length=238

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 171/243 (70%), Gaps = 25/243 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA EIS+LCDA+VG+I+FSTKGKLF YASDS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAREISILCDAEVGLIIFSTKGKLFDYASDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S  +      D +SQ +W+LE AKLKAR+E L++++RH+MGE+LDSLS +E
Sbjct  65   RILERYERYSDAQRQLIAPDLQSQGSWNLEIAKLKARLEVLQRNQRHFMGEELDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQEKQDTN----  701
            LQ LEHQ D+++KHIRS+KNQLM ESIS+LQKK    +K + EQ NL  ++ ++      
Sbjct  125  LQTLEHQHDTALKHIRSRKNQLMHESISQLQKK----DKALQEQNNLLAKKIKEKKKEQA  180

Query  702  ------------SSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPH  845
                        SSSS    QP+ SFN+G+      E   IE+ Q+ P   +MP W+  H
Sbjct  181  QQAQMEQQNHELSSSSIFMSQPLQSFNIGDANANTEEA-PIEN-QISP---MMPPWMFRH  235

Query  846  LTG  854
            + G
Sbjct  236  ING  238



>gb|AGX01534.1| FRUITFULL-like protein, partial [Dicentra eximia]
Length=243

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 168/243 (69%), Gaps = 25/243 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD + Q NWSLEY KLKA+IE L+K++RHYMGEDL+S+S +E
Sbjct  65   RILERYERYSYAERELVATDLDPQGNWSLEYTKLKAKIEILQKNQRHYMGEDLESMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IRS+KNQLM ESISELQ+K    EK + EQ N              
Sbjct  125  LQNLEQQLDTALKQIRSRKNQLMYESISELQRK----EKALQEQNNQLGKKLKEKEKEAA  180

Query  672  ----LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGE-GREIEDAQLPP--PNIVMPQ  830
                 E Q +    +S +++  Q + S N+G  Y+     G E+ +   P    N +MP 
Sbjct  181  QQAQWENQNQNQGQNSPTFLISQSLPSLNIGGNYQTRNNTGGEVLEGTRPQTRTNSLMPP  240

Query  831  WLL  839
            W+L
Sbjct  241  WML  243



>gb|AGX01538.1| FRUITFULL-like protein, partial [Corydalis cheilanthifolia]
Length=249

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 170/245 (69%), Gaps = 23/245 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     T+ + Q NWSLEY KLKA+IE L+K++RH+MGEDL+++S +E
Sbjct  65   RILERYERYSYAERELVTTELDPQGNWSLEYTKLKAKIEILQKNQRHFMGEDLETMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPN  671
            LQNLE Q+D+++K IRS+KNQLM ESISELQ+              K+KE+EKE A++  
Sbjct  125  LQNLEQQLDTALKQIRSRKNQLMYESISELQRKEKALQEQNKQLGNKLKEKEKEAAQKAQ  184

Query  672  L------EQQEKQDTNSSSSYVALQPVNSFNLGETYEI---AGEGREIEDAQLPPPNIVM  824
                   + Q +    +S S++  Q + S N+G  Y      G G E  +      N +M
Sbjct  185  WENQNQNQNQNQNQEQNSPSFLLSQSLPSLNIGGNYPTRNNTGGGEEEGNRTQARTNSLM  244

Query  825  PQWLL  839
            P W+L
Sbjct  245  PPWML  249



>ref|XP_008240081.1| PREDICTED: truncated transcription factor CAULIFLOWER A isoform 
X2 [Prunus mume]
Length=254

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/252 (54%), Positives = 167/252 (66%), Gaps = 31/252 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAQEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D ES  +W+LE+AKLKAR+E L+++  H+MGEDL SLS +E
Sbjct  65   RILERYERYSYSEKQLLANDNESTGSWTLEHAKLKARVEVLQRNHSHFMGEDLQSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLE Q+DS++KHIRS+KNQ+M ESISELQKK    +K + EQ NL             
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMYESISELQKK----DKALQEQNNLLAKKVKEKEKALA  180

Query  675  ------EQQEKQDTNSSSSYVALQPVNSFNLG----ETYEIAGEGREIEDAQLPP----P  812
                  EQQ +      SS +  + + S N G    +     G G + ED    P    P
Sbjct  181  PQAQSWEQQVQNQGLDCSSTLLPEALQSLNFGGSNYQGIRSDGFGGDHEDENETPTANRP  240

Query  813  NIVMPQWLLPHL  848
            N ++P W+L HL
Sbjct  241  NTLLPPWMLRHL  252



>ref|NP_001242674.1| uncharacterized protein LOC100816836 [Glycine max]
 gb|ABZ80361.1| MADS box protein AP1a [Glycine max]
 gb|AHI43155.1| FULa [Glycine max]
Length=244

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 170/242 (70%), Gaps = 27/242 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y+SD  +E
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSSDPCVE  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     +DQ    NW+LE+AKLKAR+E L+K++R++MG+DL+ LS +E
Sbjct  65   RILERYERYSYAERQLVASDQPQTENWTLEHAKLKARLEVLQKNQRNFMGQDLEGLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLE------------  677
            LQNLEHQ+DS++KHIRS+KNQ+M ESISEL KK    +K + EQ N              
Sbjct  125  LQNLEHQLDSALKHIRSRKNQIMHESISELHKK----DKVLQEQNNTLAKKIKEKEKALA  180

Query  678  -----QQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP---NIVMPQW  833
                 +Q   + + +SS +   P+ + N+ E+ +I GEG   ++   P P   N ++P W
Sbjct  181  QHAQMEQRGDEMDLTSSALVPHPLETSNIRESSQIRGEG---DNEGTPTPTRANAILPSW  237

Query  834  LL  839
            +L
Sbjct  238  ML  239



>gb|AGX01568.1| FRUITFULL-like protein, partial [Berberis thunbergii]
Length=241

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 167/241 (69%), Gaps = 23/241 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAQEISVLCDAEVALIVFSTKGKLFEYSTDSGME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E     TD ESQ NWSLEY+KLKA+IE L+K++RH++GE L+++S +E
Sbjct  65   GILERYERYSYAEKELVATDAESQGNWSLEYSKLKAKIEVLQKNQRHFLGEGLNAMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D ++K IRS+KNQLM ESISELQ+K    EK + EQ N              
Sbjct  125  LQNLEQQLDVALKQIRSRKNQLMNESISELQRK----EKALQEQNNQLGKKLKEKEKTLA  180

Query  672  --LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP---PNIVMPQWL  836
               + +++    +S S++  + + S N+G  Y+        E+A  P    PN +MP W+
Sbjct  181  QQAQWEQQSQGQNSPSFLLTKSLPSLNIGGAYQATDTSAAEEEAAGPQQNRPNSLMPPWM  240

Query  837  L  839
            L
Sbjct  241  L  241



>emb|CAA56659.1| SLM5 [Silene latifolia subsp. alba]
Length=257

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDADVG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDADVGLIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D +S  +W+LE+AKLKAR+E L+K+ RHYMGEDLD+LS +E
Sbjct  65   KILERYERYSYAERQLTAPDPDSHVSWTLEHAKLKARLEILQKNHRHYMGEDLDTLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIK  638
            LQN EHQ+D+++KHIRSKKNQLM ESI ELQKK K
Sbjct  125  LQNFEHQLDTALKHIRSKKNQLMYESIHELQKKDK  159



>gb|AAP83371.1| euFUL FRUITFULL-like MADS-box [Corylopsis sinensis]
Length=229

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 166/238 (70%), Gaps = 23/238 (10%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQLKR+ENKINRQVTFSKRR+GLLKKANEISVLCDA+VG+IVFSTKGKL+       MER
Sbjct  1    VQLKRMENKINRQVTFSKRRAGLLKKANEISVLCDAEVGLIVFSTKGKLYD------MER  54

Query  357  ILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFREL  536
            I  RYER SY E     T+ ESQ +W++E+AKLKAR+E L++++RH+MGE+LDS+S +EL
Sbjct  55   IFDRYERYSYAERQLVVTNHESQGSWTIEHAKLKARMEVLQRNQRHFMGENLDSVSLKEL  114

Query  537  QNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPNL  674
            QNLEHQ+D+++KHIRS+KN LM ESISELQ              KKIKE+E  +A +   
Sbjct  115  QNLEHQLDNALKHIRSRKNLLMQESISELQRKDKSLQEENNSLSKKIKEKENALAHRAQW  174

Query  675  EQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHL  848
            EQQ  Q  NS    ++ QP  S N+G       EG E    Q   PN ++P W++ HL
Sbjct  175  EQQ-NQGLNSFPILLS-QPPQSLNIGTYQTGCSEGEEGTPFQ-QRPNTLLPHWMVSHL  229



>gb|AAG30923.1|AF306349_1 MADS box protein AP2L [Eucalyptus globulus]
Length=245

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 169/246 (69%), Gaps = 28/246 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDADV +IVFSTKGKLF+YA+D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRCGLLKKAHEISVLCDADVALIVFSTKGKLFEYATDCCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY ES     + E+  NW+LE+AKLKAR+E L+K++++ MGE+LDSLS +E
Sbjct  65   RILERYERYSYAESQVLTNNAETNGNWTLEHAKLKARMEILQKNQKNLMGEELDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQ-----------  680
            LQNLEHQ+D+++K+IRS+K QLM ESISELQ+K    +K + EQ N+             
Sbjct  125  LQNLEHQLDTALKNIRSRKIQLMCESISELQRK----DKALQEQNNMLAKKVKEKEKALA  180

Query  681  QEKQ------DTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPN----IVMPQ  830
            Q+ Q      D  +SSS +  Q +   N+G  Y  +G     E A L PP      + P 
Sbjct  181  QQTQWDNPQDDGLTSSSVILSQSLQPLNIGGPYHPSGIE---EGAALGPPQHRNATLFPS  237

Query  831  WLLPHL  848
            W+L HL
Sbjct  238  WMLSHL  243



>gb|AHI85952.1| AP1 [Carya cathayensis]
Length=248

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 172/245 (70%), Gaps = 22/245 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGK+F+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKVFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      D E   +W+LE+AKLKAR+E L+++++++MGEDLDSLS +E
Sbjct  65   RILERYERYSYAERQLIAHDLEQNGSWTLEHAKLKARMEILQRNQKYFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKE-MAEQP  668
            LQNLE Q+DS++KHIRS+KNQ+M ESIS+LQKK              +KE+EKE +AEQ 
Sbjct  125  LQNLEQQLDSALKHIRSRKNQVMHESISDLQKKDKALQEQNNVLAKQVKEKEKELLAEQA  184

Query  669  NLEQQEKQDTNSSSSY-VALQPVNSFNLGETYEIAGEGREIEDAQLPPPN----IVMPQW  833
              + Q  Q  ++SS     L P+++        I    R  ED   P  +    +++P W
Sbjct  185  QWDIQHNQTLDTSSILPQTLLPLDTIGTASYQAIRSSER--EDEARPSRHRANAVLLPPW  242

Query  834  LLPHL  848
            +L HL
Sbjct  243  MLSHL  247



>gb|AEU08959.1| APETALA1 [Litchi chinensis]
 gb|AEY55406.1| APETALA1-like protein, partial [Litchi chinensis]
Length=245

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 175/243 (72%), Gaps = 22/243 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDA+V +IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIVFSTKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQ-CNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER SY +      + E Q  +W+LE+AKLKAR+E L+++++HYMGEDLDSLS +
Sbjct  65   RILERYERYSYNDRQLIANEVEPQNGSWTLEHAKLKARVEVLQRNQKHYMGEDLDSLSLK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-----EQQEKQD  695
            ELQ+LE Q+DS++KHIR++KNQLM ESIS+LQKK    +K + EQ NL     +++EK  
Sbjct  125  ELQSLEQQLDSALKHIRTRKNQLMFESISDLQKK----DKLLQEQNNLLAKKVKEKEKTI  180

Query  696  TN-----------SSSSYVALQPVNSFNLGETYEIA-GEGREIEDAQLPPPNIVMPQWLL  839
            T            +SS+ +  QP  S N   TY++A   G + ++      N ++P W+L
Sbjct  181  TQQQQWEQQNPGPNSSTILLGQPPQSLNNSATYQMARTSGGDDDETPQNRANTILPPWML  240

Query  840  PHL  848
             +L
Sbjct  241  RNL  243



>dbj|BAC80249.1| MADS-box transcription factor [Houttuynia cordata]
Length=245

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 170/240 (71%), Gaps = 18/240 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQ+KRIENKINRQVTFSKRR GLLKKA+EISVLCDADV +IVFSTKGKL++YA+DS M 
Sbjct  5    RVQMKRIENKINRQVTFSKRRMGLLKKAHEISVLCDADVALIVFSTKGKLYEYATDSSMT  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER S+ E      D ES+  WSLE+ KLKAR+E L+K+ RHY+GEDLDSL  +E
Sbjct  65   KILERYERYSFAEREFALADNESEGAWSLEFGKLKARVEALQKTHRHYLGEDLDSLKVKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LE Q+DS++KH+R +KNQ++ E+ISELQ              KK++E++K  A+Q  
Sbjct  125  LQHLEQQLDSALKHVRLRKNQVIQETISELQKKEKALQEQNNMLEKKVQEKQKAKAQQTR  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAG-EGREIEDAQ-LPPPNIVMPQWLLPH  845
             E Q  Q+ NS+    +L P+ + N+G  ++  G E RE E A+ L   N  MP W+L H
Sbjct  185  WENQ-SQNQNSAPFLFSL-PLPNLNMGTYHQENGTEIREQEAARPLAHSNSQMPAWMLRH  242



>gb|AGX01544.1| FRUITFULL-like protein, partial [Stylophorum diphyllum]
Length=242

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 168/243 (69%), Gaps = 26/243 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     ++ + Q NWSLEY KLKA+IE L+K++RH+MGEDL+S+S +E
Sbjct  65   RILERYERYSYAERELVASELD-QGNWSLEYTKLKAKIEILQKNQRHFMGEDLESMSLKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IRS+KNQLM ESIS+LQKK    EK + EQ N              
Sbjct  124  LQNLEQQLDTALKQIRSRKNQLMYESISDLQKK----EKVLQEQNNQLGKKLKEKEKEIA  179

Query  672  ---LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP----NIVMPQ  830
                +  ++    SS S++  Q + S N+G +Y + G     E+   P        +MPQ
Sbjct  180  QQQAQWDQQNQGQSSPSFLLSQSLPSLNIGGSYHVRGSNGSEEEGVRPQTTRTNTSLMPQ  239

Query  831  WLL  839
            W+L
Sbjct  240  WML  242



>dbj|BAH36884.1| APETALA1/FRUITFULL [Chrysanthemum x morifolium]
Length=236

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 162/240 (68%), Gaps = 25/240 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V LKRIENKINRQVTFSKRR+GLLKKA+EISVLCDADVG++VFS KGKL ++A+D+ ME
Sbjct  5    RVTLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDADVGLVVFSAKGKLCEFATDASME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E     TD ES   W+LE+AKLK R E L+K++ H  GEDLDSLS +E
Sbjct  65   GILERYERYSYAERQLTTTDNESHGRWTLEHAKLKCRFELLQKTQTHLKGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEM-AEQP  668
            LQNLEHQID+++KHIR +KNQ+M ESIS LQ              KK+KE EK++ A+QP
Sbjct  125  LQNLEHQIDTALKHIRLRKNQMMFESISVLQKKDKELQNQNNVLSKKVKEVEKDLAAQQP  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHL  848
             +EQQ          Y++  P      G   +I G+ +         P+IV+P W+L H+
Sbjct  185  LVEQQNPDKMLHLDPYIS-APCQVGGDGVVEKIPGQAQ---------PSIVLPPWMLQHM  234



>gb|AGH61290.1| apetala 1 [Paeonia lactiflora]
Length=242

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 165/226 (73%), Gaps = 21/226 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER S  E   +  P    SQ NWSLEY+KL+A+IE L++++RH+MGEDLDSLS 
Sbjct  65   KILDRYERYSIAERQLVEEPG---SQGNWSLEYSKLRAKIELLQRNQRHFMGEDLDSLSP  121

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQ  665
            ++LQN+E Q+D S+K+IRS+KNQLM ESISELQKK              IKE+EK MA+Q
Sbjct  122  KDLQNMEQQLDVSLKNIRSRKNQLMYESISELQKKETAMQEQNNLLAKQIKEKEKTMAQQ  181

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL  803
               EQQ +   N+S+  ++     + N+G  Y+  GE  E+   +L
Sbjct  182  AQWEQQIRHGPNASAYILSPHEFTTLNMGGNYQ--GEPTEMRRNEL  225



>gb|AGX01574.1| FRUITFULL-like protein, partial [Dicentra eximia]
Length=240

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 168/240 (70%), Gaps = 22/240 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQL+RIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++++ M+
Sbjct  5    RVQLRRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTNASMD  64

Query  354  RILARYERCSYV-ESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER S V E  P  +  +SQ +WSLE+ KLKA+IE L++++RHYMG+DL+SLS +
Sbjct  65   RILERYERNSSVEEEQPTASHLKSQASWSLEHTKLKAKIEVLQRTQRHYMGQDLESLSLK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN------------L  674
            ELQ LE  +D S+KHIRS+KNQL+  SI+ELQKK    EK + EQ N            L
Sbjct  125  ELQQLEQHLDVSLKHIRSRKNQLLYGSIAELQKK----EKALQEQNNLLGKKIKDKEDEL  180

Query  675  EQQEKQDTNSSS-SYVALQPVNSFNLGETYEIAGEGREIEDAQLPP----PNIVMPQWLL  839
              +E+Q+    S ++V  Q + S  +G TY+     R  E+  +       N +MPQW++
Sbjct  181  AHREQQNQGKDSLTFVLAQALPSLTIGGTYQTGSGSRGEEEGGVRALTQQHNTIMPQWMV  240



>gb|ACR19996.1| TDR4/Ful-like MADS-box protein [Vaccinium myrtillus]
Length=255

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 169/252 (67%), Gaps = 32/252 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQ+KRIENK++RQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++ S ME
Sbjct  5    RVQMKRIENKVSRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTHSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL +YE  SY E     T+ ESQ NW+LEY KLKARIE L+++ RHY+GEDLD+L+ RE
Sbjct  65   SILEKYESYSYAERQLVATNSESQTNWNLEYPKLKARIEVLQRNIRHYVGEDLDTLTLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ++E QID+++K IRSKKNQL+ ESIS+LQ              KKIKE EK +AE+  
Sbjct  125  LQSVEQQIDTALKRIRSKKNQLVHESISDLQKKQKLLQEQNNQLAKKIKENEKTLAERA-  183

Query  672  LEQQEKQDTNSSSSYV--------------ALQPVNSFNLGETYEIAGEGREIEDAQLPP  809
              +Q+ Q   SSS+ V                 P +S  +G  ++  G G     +  PP
Sbjct  184  --EQQNQGGQSSSTLVLPQLPPQPPQPPRPRPPPFHSLTIGGPFQARGTGDGGAQSH-PP  240

Query  810  PNIVMPQWLLPH  845
             N +MP W+L H
Sbjct  241  SNTLMPPWMLRH  252



>gb|AGX01565.1| FRUITFULL-like protein, partial [Jeffersonia diphylla]
Length=238

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 166/236 (70%), Gaps = 16/236 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     +D ESQ NWSLEY+KLK +IE L+K++RH++GE LD++S +E
Sbjct  65   RILERYERYSYAERELVASDVESQGNWSLEYSKLKTKIEVLQKNQRHFLGEGLDAMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK---IKEREKEMA-----------EQPN  671
            LQNLE Q+D+++K IRS+KNQLM ESISELQKK   ++E+  ++            +QP 
Sbjct  125  LQNLEQQLDAALKQIRSRKNQLMHESISELQKKEKALQEQNNQLGKKLKEKEKALAQQPQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             EQ  +    +  S++  Q + S N+G   +      E    Q   P  +MP W+L
Sbjct  185  WEQPNQ--GQNLPSFLLSQSLPSLNIGGACQGRTSAEEEAVRQQSRPTTLMPPWML  238



>ref|XP_007045796.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY01628.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=241

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 155/211 (73%), Gaps = 16/211 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y+SDS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSSDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     T   SQ NW++EY +LKA++E L+K+ RHYMGEDLD LS +E
Sbjct  65   KILERYERYSYAERQLVATQPGSQGNWTMEYNRLKAKVELLQKNHRHYMGEDLDFLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D+++KHIRSKKNQLM ESISELQ+K              IKE+EK +A+Q  
Sbjct  125  LQNLEQQLDTALKHIRSKKNQLMYESISELQRKEKAIQEQNTMLAKQIKEKEKTVAQQSQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
              QQ      ++S ++  QP    N+  TY+
Sbjct  185  WGQQ--GHGLNTSPFLLPQPHPCLNISGTYQ  213



>gb|AGW23344.1| MADS box protein MADS42 [Gossypium hirsutum]
Length=248

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 161/215 (75%), Gaps = 18/215 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     T+ + Q NWS+EY +LKA+++ L+K+ RHYMGEDLDSLS +E
Sbjct  65   KILERYERYSYAERQLVATESQPQGNWSMEYNRLKAKVDLLQKNHRHYMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D++IKHIRSKKNQL+ ESISELQ+K              IKEREK +A+   
Sbjct  125  LQNLEQQLDTAIKHIRSKKNQLISESISELQRKEKAIQEQNAMLAKQIKEREKTVAQAQQ  184

Query  672  LEQQEKQ---DTNSSSSYVALQPVNS-FNLGETYE  764
             +  + Q     N+S+S++  QP +   N+G TY+
Sbjct  185  SQWGQHQQQLGLNTSTSFLLPQPPHPCLNIGGTYQ  219



>gb|AGA61753.1| apetala 1 [Cornus kousa]
Length=245

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 146/186 (78%), Gaps = 5/186 (3%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQ++RIENKINRQVTFSKRR GLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    KVQMRRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYERCSY E      D ES  NWSLE+ KLKARIE LEK+ RHYMGEDLDSLS +E
Sbjct  65   KILERYERCSYAERQQTVYDPESPENWSLEHVKLKARIELLEKNHRHYMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN-LEQQEKQDTNSSS  710
            LQNLE QID+++K IRS KNQLM ESIS+LQKK    EK + EQ N L ++ K+      
Sbjct  125  LQNLEQQIDTALKRIRSGKNQLMYESISQLQKK----EKAIQEQNNMLAKKIKEKEKEKE  180

Query  711  SYVALQ  728
             Y ALQ
Sbjct  181  KYTALQ  186



>gb|ABV60386.1| FRUITFUL-like protein [Carica papaya]
Length=238

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 165/237 (70%), Gaps = 23/237 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQ-ESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER SY +     T++     NW+L+YAKLKARIE L++++RH++GEDLDSLS +
Sbjct  65   RILERYERYSYTDQRQTVTNEIGPNGNWNLQYAKLKARIEVLQRNERHFLGEDLDSLSLK  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQP  668
            ELQ+LEHQ+DS++KH+RS+KNQLMLESISELQ              KK+KE EKE+A+Q 
Sbjct  125  ELQSLEHQLDSALKHVRSRKNQLMLESISELQKRDKALQEQNNALAKKVKEWEKELAQQA  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             +  +        SS +   P  S    E   +A + R      LPP       W+L
Sbjct  185  QITWEPHAPALHPSSNIRSYPPMSNGEDEEGNVA-QQRATGSTLLPP-------WML  233



>gb|AAP83396.1| euFUL FRUITFULL-like MADS-box [Petunia x hybrida]
Length=214

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 159/216 (74%), Gaps = 18/216 (8%)
 Frame = +3

Query  255  ANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILARYERCSYVE-SLPNPTDQESQCN  431
            A+E+SVLCDA+VG+IVFSTKGKLF+Y++DS MERIL RYER SY E  L   TD ++  +
Sbjct  1    AHELSVLCDAEVGLIVFSTKGKLFEYSTDSCMERILERYERYSYAERQLSGATDNDTPGS  60

Query  432  WSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLEHQIDSSIKHIRSKKNQLMLES  611
            W+LE+AKLKAR+E L+++++HY GEDLDSLS +ELQNLE Q+DS++K IRS+KNQLM ES
Sbjct  61   WTLEHAKLKARLEVLQRNQKHYAGEDLDSLSMKELQNLEQQLDSALKQIRSRKNQLMHES  120

Query  612  ISELQKK--------------IKEREKEMAEQPNLEQQEKQDTNSSSSYVALQPVNSFNL  749
            ISELQKK              +KEREKE+A+Q   E Q   D N SSS+V  QP+NS +L
Sbjct  121  ISELQKKDKALQEQNNKLSKQVKEREKELAQQSQWEPQ-SHDLN-SSSFVLSQPLNSLHL  178

Query  750  GETYEIAGEGREIE-DAQLPPPNIVMPQWLLPHLTG  854
            GE Y  AG+  E+E  ++  PPN VMP W+L HL G
Sbjct  179  GEAYPSAGDNGEVEGSSRQQPPNTVMPPWMLRHLNG  214



>gb|AGX01551.1| FRUITFULL-like protein, partial [Papaver atlanticum]
Length=244

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 169/242 (70%), Gaps = 22/242 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     T+ + Q NWSLEY+KLK++IE L+K++RH+MGEDL S+S +E
Sbjct  65   RILERYERYSYAERELVTTEID-QGNWSLEYSKLKSKIEILQKNQRHFMGEDLRSMSLKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D ++K IRS+KNQLM ESISELQKK              +KE+EKE+A +  
Sbjct  124  LQNLEQQLDVALKQIRSRKNQLMYESISELQKKEKALQEQNNKLGKQLKEKEKEVAAKQQ  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGE-TYEIAGEGREIEDA-----QLPPPNIVMPQW  833
               Q  Q   SS S++  Q + S N+G  +Y+  G     E+             +MPQW
Sbjct  184  QASQFSQG-QSSPSFLLSQSLPSLNIGSGSYQARGGDNGNEEGNRTQTTRTNTATLMPQW  242

Query  834  LL  839
            +L
Sbjct  243  ML  244



>ref|NP_568929.1| agamous-like MADS-box protein AGL8 [Arabidopsis thaliana]
 sp|Q38876.1|AGL8_ARATH RecName: Full=Agamous-like MADS-box protein AGL8; AltName: Full=Floral 
homeotic protein AGL8; AltName: Full=Transcription 
factor FRUITFULL [Arabidopsis thaliana]
 gb|AAK62374.1|AF386929_1 floral homeotic protein AGL8 [Arabidopsis thaliana]
 gb|AAA97403.1| AGL8 [Arabidopsis thaliana]
 dbj|BAB10640.1| floral homeotic protein AGL8 [Arabidopsis thaliana]
 gb|AAL66878.1| floral homeotic protein AGL8 [Arabidopsis thaliana]
 gb|AED97395.1| agamous-like MADS-box protein AGL8 [Arabidopsis thaliana]
Length=242

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 163/236 (69%), Gaps = 19/236 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK+  +Q  
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKTGQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             E Q  Q +NSSS  +    V S   G    + GE      + L  PN ++P W+L
Sbjct  183  -EGQLVQCSNSSSVLLPQYCVTSSRDGFVERVGGENGGA--SSLTEPNSLLPAWML  235



>gb|AGX01575.1| FRUITFULL-like protein, partial [Stylophorum diphyllum]
Length=234

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 168/239 (70%), Gaps = 26/239 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+++S++ M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEFSSEASMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER  + E     T  ES+ NWSLE+ KLKARIE L+KS+RH+MGEDLD LS +E
Sbjct  65   NILERYERQCFAEEELKTTHSESEGNWSLEHTKLKARIEILQKSQRHFMGEDLDPLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+D++ KHIRS+KNQL+  SI+EL+              KKIK++E+++A+   
Sbjct  125  LQNLEHQLDTAPKHIRSRKNQLLYASIAELRKKEKALHEQNTLLGKKIKQKEEQIAQ---  181

Query  672  LEQQEKQDTNSSSSYVALQP---VNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             + Q+ Q  NS S      P   + + N      + GE    E A+    N+VMPQW+L
Sbjct  182  CDAQQNQTQNSPSFLTQALPSLTLRTDNYQTARVVVGEE---EGAR---SNMVMPQWML  234



>gb|AGX01543.1| FRUITFULL-like protein, partial [Macleaya cordata]
Length=240

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 168/243 (69%), Gaps = 28/243 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     ++ + Q NWSLEY KLKA+IE L+K++RH+MGEDL+S+S +E
Sbjct  65   RILERYERYSYAERELVASELD-QGNWSLEYTKLKAKIEILQKNQRHFMGEDLESMSLKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IRS+KNQLM ESI+ELQ+K    EK + EQ N              
Sbjct  124  LQNLEQQLDTALKRIRSRKNQLMYESIAELQRK----EKALQEQNNQLGKKLKEKEKEVA  179

Query  672  ---LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP----NIVMPQ  830
                +  ++    SS S++  Q + S N+G  Y++ G     E+   P        +MPQ
Sbjct  180  QQQTQWDQQNQGQSSPSFLLSQSLPSLNIG--YQVRGSNGSEEEGTQPQTTRTNTTLMPQ  237

Query  831  WLL  839
            W+L
Sbjct  238  WML  240



>gb|AAX53099.1| AP1-like protein [Magnolia grandiflora]
Length=236

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 172/242 (71%), Gaps = 27/242 (11%)
 Frame = +3

Query  180  QLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERI  359
            QLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V VIVFSTKGKL++Y++DSRM RI
Sbjct  1    QLKRIENKINRQVTFSKRRMGLLKKAHEISVLCDAEVAVIVFSTKGKLYEYSTDSRMSRI  60

Query  360  LARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQ  539
            L RYER SY E     +  ES+ +W LEY KLKA++E L+++ RH+ GEDLD+LS +ELQ
Sbjct  61   LERYERYSYAERELVLSGPESEGSWCLEYGKLKAKVESLQRNLRHFTGEDLDTLSLKELQ  120

Query  540  NLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQEKQD--------  695
             LEHQ+D+++KHIRS+KNQ+M +SI+ELQ+K    EK + EQ N+ ++E Q+        
Sbjct  121  QLEHQLDAALKHIRSRKNQIMFDSIAELQRK----EKSLREQNNMLEKEIQEKEKAMAQQ  176

Query  696  --------TNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP---NIVMPQWLLP  842
                    + SS S++   P+ + N+G TY    +G E+E+    PP   N +MP W++ 
Sbjct  177  AQWEQQNQSQSSPSFLLASPLPTLNIG-TYH---QGNEVEEEGARPPARTNSLMPPWMVR  232

Query  843  HL  848
            H+
Sbjct  233  HV  234



>ref|NP_001234543.1| agamous-like MADS-box protein AGL8 homolog [Solanum lycopersicum]
 sp|Q40170.1|AGL8_SOLLC RecName: Full=Agamous-like MADS-box protein AGL8 homolog; AltName: 
Full=TM4 [Solanum lycopersicum]
 emb|CAA43169.1| TDR4 [Solanum lycopersicum]
Length=227

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 155/211 (73%), Gaps = 27/211 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+VG+IVFSTKGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYANDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S+ E    PTD  S  +W+LE+ KLKAR+E L+++++HY+GEDL+SLS +E
Sbjct  65   RILERYERYSFAEKQLVPTDHTSPVSWTLEHRKLKARLEVLQRNQKHYVGEDLESLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+DS++KHIRS+KNQLM ESIS LQ              KK+KEREK       
Sbjct  125  LQNLEHQLDSALKHIRSRKNQLMHESISVLQKKDRALQEQNNQLSKKVKEREKSA-----  179

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
               Q+    NSSS +        F LG TY+
Sbjct  180  ---QQISGINSSSLFAH----TDFYLG-TYQ  202



>ref|XP_009380134.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=238

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 169/240 (70%), Gaps = 19/240 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +I+FS KGKL++YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSAKGKLYEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER  Y E     ++ E Q NW  EYAKLKA+IE L KS+RH MGE LDSLS +E
Sbjct  65   KILERYERYCYAEKALTSSEPEFQGNWYQEYAKLKAKIEALHKSQRHLMGEQLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKE-------REKEMAEQPNL----EQ  680
            LQ LEHQ+D+S+K IRS+K+++ML+SI+ELQ+K+K+        EKE+ E+  L    +Q
Sbjct  125  LQQLEHQLDTSLKQIRSRKHKVMLDSITELQRKVKQLQEQNKGLEKELMEKQKLKVVAQQ  184

Query  681  QEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPN--IVMPQWLLPHLTG  854
             + +  N  SS++  +   +  +G +Y   GEG    DAQ    N   ++P W+  HL G
Sbjct  185  AQWEQQNPPSSFLVAESHPTLCIGTSYH--GEG----DAQAHVRNSSSLLPPWMHRHLNG  238



>gb|AGA61756.1| fruitful 2, partial [Cornus kousa]
Length=270

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 176/272 (65%), Gaps = 50/272 (18%)
 Frame = +3

Query  183  LKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERIL  362
            LKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+D+ MERIL
Sbjct  1    LKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDACMERIL  60

Query  363  ARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQN  542
             RY+R SY E     T  ESQ +WSLEYAKLKAR+E L+K++ H+MGEDLD+LS +ELQN
Sbjct  61   ERYDRYSYAERQLTATGNESQGSWSLEYAKLKARLEVLQKNQSHFMGEDLDTLSLKELQN  120

Query  543  LEHQIDSSIKHIRSKK-----------------------------NQLMLESISELQKKI  635
            LEHQ+DS++KH+RS+K                             NQLM ESISELQKK 
Sbjct  121  LEHQLDSALKHVRSRKVKSATSLKVLCSFCFMEMQMTELRLICLQNQLMQESISELQKKD  180

Query  636  KEREKE--------------MAEQPNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAG  773
            K  ++E              +A+QP L++Q+    NS+S   +L P++S ++G  Y+  G
Sbjct  181  KALQEENNLLAKKVKEKEKELAQQPQLQEQD-HGQNSTSVAQSL-PLHSLSIGGAYQGGG  238

Query  774  EGREIEDAQLPP-----PNIVMPQWLLPHLTG  854
                  + +  P      N VMP W+L H+ G
Sbjct  239  GNGGEVEEEEVPCQQQKTNTVMPPWMLRHING  270



>gb|AEZ63951.1| APETALA 1-1 [Dimocarpus longan]
Length=241

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 159/211 (75%), Gaps = 16/211 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER +Y E     TD ESQ NW++EY +LKA+IE L+++ RHYMGEDLDSLS +E
Sbjct  65   KILERYERHNYTERRLVATDPESQVNWAMEYNRLKAKIELLQRNHRHYMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            +QNLE Q+D+S+KHIRS+KNQLM +SISELQ+K              IKE+EK MA+Q  
Sbjct  125  IQNLEQQLDTSLKHIRSRKNQLMYDSISELQRKEKAILEQNNMLAKQIKEKEKTMAQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
            ++ +++    ++ S++   P     +G  Y+
Sbjct  183  VQWEQQNQGPNTLSFLVPMPPPCLKMGGIYQ  213



>ref|XP_003522984.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform 
X1 [Glycine max]
Length=244

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 172/239 (72%), Gaps = 21/239 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISV CDA+V +IVFSTKGKLF+Y+SD  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVHCDAEVALIVFSTKGKLFEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     +DQ    NW+LE+AKLKAR+E L+K++R++MG+DL+ LS +E
Sbjct  65   KILERYERYSYAERQLVASDQPLTENWTLEHAKLKARLEVLQKNQRNFMGQDLEGLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE--------------MAEQPN  671
            LQNLEHQ++S++KHIRS+KNQLM ESISEL KK K  +++              +A+Q  
Sbjct  125  LQNLEHQLESALKHIRSRKNQLMYESISELHKKDKALQEQNNTLAKKIKEKEKALAQQAQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPP---NIVMPQWLL  839
            LE+    + + +SS +  QP+ + N+  + +I GEG   ++   P P   N ++P W+L
Sbjct  185  LERL-GDEVDLTSSALVPQPLVTSNIRTSSQIRGEG---DNEGTPTPTQANAILPPWML  239



>gb|AEI73137.1| FRUITFULL-like MADS-box protein [Eschscholzia californica]
Length=245

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 168/249 (67%), Gaps = 32/249 (13%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQL+R+ENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKL++Y++DS M+R
Sbjct  1    VQLRRMENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSTDSGMDR  60

Query  357  ILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFREL  536
            IL RYER SY E     TD +SQ NWSLEY KLKA++E L++++RH+MGEDL+S+S +EL
Sbjct  61   ILERYERYSYSEREVVATDIDSQGNWSLEYHKLKAKVELLQRNQRHFMGEDLESVSLKEL  120

Query  537  QNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN---------------  671
            Q LE Q+D+++K IRS+KNQLM ESI+ LQKK    EK + EQ N               
Sbjct  121  QILEQQLDTALKQIRSRKNQLMYESIAALQKK----EKLLQEQNNQLGKKLKEKEKEITQ  176

Query  672  ---------LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGE-GREIEDA---QLPPP  812
                       Q ++  T SS S++  Q + S N+G +Y+  G   R  ED        P
Sbjct  177  QQQQQQQQQQVQDQQNLTQSSPSFLLSQSLPSLNIGASYQAQGSCNRSEEDGAQTHTTRP  236

Query  813  NIVMPQWLL  839
            N VMP W+L
Sbjct  237  NTVMPPWML  245



>gb|AFV13866.1| fruitfull-like protein FUL, partial [Erucaria erucarioides]
Length=236

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 162/238 (68%), Gaps = 25/238 (11%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQLKR+ENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS MER
Sbjct  1    VQLKRMENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSSMER  60

Query  357  ILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFREL  536
            IL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +EL
Sbjct  61   ILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKEL  120

Query  537  QNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPNL  674
            Q+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK      N 
Sbjct  121  QSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNTLLKKIKEREK------NT  174

Query  675  EQQEKQDTNSSSSYVALQP---VNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             QQE Q   SS++   LQP   + S   G    + GE      + L  PN ++P W+L
Sbjct  175  GQQEGQIIQSSNNSSVLQPQYCMTSSRDGFVGRVGGENGVA--SSLTEPNSLLPAWML  230



>ref|XP_006477715.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform 
X1 [Citrus sinensis]
 ref|XP_006477716.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform 
X2 [Citrus sinensis]
 ref|XP_006477717.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform 
X3 [Citrus sinensis]
 ref|XP_006477718.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform 
X4 [Citrus sinensis]
 dbj|BAF34913.1| MADS-box protein [Citrus unshiu]
Length=244

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 167/249 (67%), Gaps = 34/249 (14%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER  Y E      + E   NW+LEY+KLKAR+E L+++++H+MGEDL  LS +E
Sbjct  65   RILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQKHFMGEDLADLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQ++E QIDS +K IRS+KNQLML+SISELQKK    +K + EQ NL             
Sbjct  125  LQSVEQQIDSGLKLIRSRKNQLMLQSISELQKK----DKLLKEQNNLLAKKVKEKEKLLS  180

Query  675  --------EQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP---PNIV  821
                    +QQ   D NSS+ ++     NS     +Y++ G G   ED   P     N +
Sbjct  181  QEAQCREQQQQLNHDWNSSNVHLMQTLTNS-----SYQMGG-GSGEEDEDTPTGHRANAL  234

Query  822  MPQWLLPHL  848
            +P W+L HL
Sbjct  235  LPAWMLRHL  243



>ref|XP_010660493.1| PREDICTED: FUL-like protein isoform X1 [Vitis vinifera]
 emb|CBI16934.3| unnamed protein product [Vitis vinifera]
Length=247

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 164/245 (67%), Gaps = 24/245 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y+SDS ME
Sbjct  5    RVQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSSDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S  E     TD + Q NWS++Y KL ARIE L+++ RH++GEDLD LS RE
Sbjct  65   RILERYERYSLSERQLLSTDPDPQGNWSMDYPKLTARIEVLQRNLRHFVGEDLDPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IR++KNQLM ESISELQKK    EK + EQ N              
Sbjct  125  LQNLEQQLDTALKRIRTRKNQLMHESISELQKK----EKSLVEQNNALAKKVKEKEKVEQ  180

Query  672  -----LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL-PPPNIVMPQW  833
                  EQQ     NSS+  V   P+   +L       G   E + A+  P PN +MP W
Sbjct  181  NNRAQWEQQNNIGQNSSAYVVPPPPLQLPSLTIGGSFVGRAVEEDGAEARPSPNTLMPPW  240

Query  834  LLPHL  848
            +L H+
Sbjct  241  MLRHV  245



>gb|AGX01546.1| FRUITFULL-like protein, partial [Argemone mexicana]
Length=247

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 173/249 (69%), Gaps = 33/249 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     T+ + Q NWSLEY+KLKA+IE L+K++RH+MGEDL S+S +E
Sbjct  65   RILERYERYSYAERELVATELD-QGNWSLEYSKLKAKIEILQKNQRHFMGEDLQSMSLKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQN+E Q+D+++K IRS+KNQLM ESISELQKK    EK + EQ                
Sbjct  124  LQNIEQQLDTALKQIRSRKNQLMYESISELQKK----EKALQEQNTQLGKKLKEKEKEVA  179

Query  672  ---LEQQEKQDTNSSSSYVALQPVNSFNL--GETYEIAG--------EGREIEDAQLPPP  812
                +  ++  T SS+S++  Q + S N+  G +Y++ G        EG + + ++    
Sbjct  180  QQQSQWDQQNQTQSSASFLLSQSLPSLNIGSGSSYQVGGGINRREEEEGIQTQTSRTNTT  239

Query  813  NIVMPQWLL  839
            ++ MP W+L
Sbjct  240  SL-MPPWML  247



>gb|AGE15496.1| MADS1 [Cymbidium faberi]
Length=247

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 161/243 (66%), Gaps = 16/243 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y++++ ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSTEASME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      +   Q +W LEY KLKAR+E L+KSKRH MGE LDSLS +E
Sbjct  65   KILERYERHSYAEKALFSNEANLQADWRLEYNKLKARVESLQKSKRHLMGEQLDSLSTKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK----------------IKEREKEMAEQ  665
            LQ+LE Q++SS+KHIRS+KNQLML+SISELQKK                 KE+ K + + 
Sbjct  125  LQHLEQQLESSLKHIRSRKNQLMLDSISELQKKEKLLLDQNKTLEKEIMAKEKAKALVQN  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPH  845
               E+Q +   +S+ S+  +    S     T        E    QL   N ++P W+L H
Sbjct  185  APWEKQNQCQYSSAPSHAVISNFGSTPASRTLRARASEEESPQPQLRLGNTLLPPWMLTH  244

Query  846  LTG  854
            + G
Sbjct  245  MNG  247



>ref|NP_001268211.1| FUL-like protein [Vitis vinifera]
 gb|ACZ26529.1| fruitful [Vitis vinifera]
Length=247

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 164/245 (67%), Gaps = 24/245 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S  E     TD + Q NWS++Y KL ARIE L+++ RH++GEDLD LS RE
Sbjct  65   RILERYERYSLSERQLLSTDPDPQGNWSMDYPKLTARIEVLQRNLRHFVGEDLDPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IR++KNQLM ESISELQKK    EK + EQ N              
Sbjct  125  LQNLEQQLDTALKRIRTRKNQLMHESISELQKK----EKSLVEQNNALAKKVKEKEKVEQ  180

Query  672  -----LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL-PPPNIVMPQW  833
                  EQQ     NSS+  V   P+   +L       G   E + A+  P PN +MP W
Sbjct  181  NNRAQWEQQNNIGQNSSAYVVPPPPLQLPSLTMGGSFVGRAVEEDGAEARPSPNTLMPPW  240

Query  834  LLPHL  848
            +L H+
Sbjct  241  MLRHV  245



>gb|AGA61755.1| fruitful 1 [Cornus kousa]
Length=250

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 167/246 (68%), Gaps = 23/246 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDADV +IVFSTKGKLF+Y +DS ME
Sbjct  5    RVQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTKGKLFEYXTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E     +D +SQ +WSLEY KL A+ E L+++ RHY+GEDLD +S RE
Sbjct  65   SILERYERYSYAEQRLIASDSDSQVSWSLEYRKLMAKNEVLQRNIRHYVGEDLDPMSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            L++LE QID+++K IR++KNQLM ESISELQ              KK+KE EK +A +  
Sbjct  125  LESLEQQIDTALKRIRTRKNQLMRESISELQKREKALQEQNNLLSKKLKENEKTLAARAQ  184

Query  672  LEQQEKQDTNSSSSYVALQ----PVNSFNLGETYEIAGEGREIEDAQLP---PPNIVMPQ  830
             EQQ   D N S +++  Q    P+ S  +G  ++  G     ED  L      N +MP 
Sbjct  185  WEQQ-GLDQN-SPTFMLPQPQSLPLPSLTIGGNFQARGGATSKEDGPLQGRRGSNSLMPP  242

Query  831  WLLPHL  848
            WL+ H+
Sbjct  243  WLIRHV  248



>ref|XP_010456827.1| PREDICTED: agamous-like MADS-box protein AGL8 [Camelina sativa]
 ref|XP_010483747.1| PREDICTED: agamous-like MADS-box protein AGL8 [Camelina sativa]
Length=242

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 162/236 (69%), Gaps = 19/236 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      +     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGREVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK+  +Q  
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKTGQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             E Q  Q +NSSS  +    V S   G    + GE        L  PN ++P W+L
Sbjct  183  -EGQLNQFSNSSSVLLPQYCVTSSRDGFVERVGGENGSA--PSLTEPNSLLPAWML  235



>ref|XP_010443902.1| PREDICTED: agamous-like MADS-box protein AGL8 [Camelina sativa]
Length=243

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 162/236 (69%), Gaps = 19/236 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      +     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGREVTQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK+  +Q  
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKTGQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             E Q  Q +NSSS  +    V S   G    + GE        L  PN ++P W+L
Sbjct  183  -EGQLNQFSNSSSVLLPQYCVTSSRDGFVERVGGENGSA--PSLTEPNSLLPAWML  235



>ref|XP_004488426.1| PREDICTED: agamous-like MADS-box protein AGL8-like [Cicer arietinum]
Length=240

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 167/236 (71%), Gaps = 19/236 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TDQ    NW +E+AKLKAR+E +++++R++MGE+LD LS +E
Sbjct  65   RILERYERYSYAERQLVATDQPQNENWIIEHAKLKARLEIIQRNQRNFMGEELDGLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQNLEHQ+DS++K IRS+KNQLM ESISEL KK    +K + E+ NL             
Sbjct  125  LQNLEHQLDSALKQIRSRKNQLMYESISELHKK----DKALQEKNNLLVKKIKEKEKELA  180

Query  675  -EQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
              +Q+    + +S+ +A QP+ + N+G + +  G+G + E  Q    N + P W+L
Sbjct  181  QLEQQYDAIDLTSTVLASQPLETLNIGGSPQGRGDGEDNEGNQ-TRVNTLFPPWML  235



>gb|AAT07448.1| FUL-like protein [Vitis vinifera]
Length=247

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 164/245 (67%), Gaps = 24/245 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S  E     TD + Q NWS++Y KL ARIE L+++ RH++GEDLD LS RE
Sbjct  65   RILERYERYSLSERQLLSTDPDPQGNWSMDYPKLTARIEVLQRNLRHFVGEDLDPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IR++KNQLM ESISELQKK    EK + EQ N              
Sbjct  125  LQNLEQQLDTALKRIRTRKNQLMHESISELQKK----EKSLVEQNNALAKKVKEKEKVEQ  180

Query  672  -----LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL-PPPNIVMPQW  833
                  EQQ     NSS+  V   P+   +L       G   E + A+  P PN +MP W
Sbjct  181  NNRAQWEQQNNIGQNSSAYVVPPPPLQLPSLTIGGSFVGRAVEEDGAEARPSPNTLMPPW  240

Query  834  LLPHL  848
            +L H+
Sbjct  241  MLRHV  245



>ref|XP_010031068.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Eucalyptus grandis]
 gb|KCW83764.1| hypothetical protein EUGRSUZ_B00634 [Eucalyptus grandis]
Length=242

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 168/240 (70%), Gaps = 18/240 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            ++QLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +I+FS KGKLF+Y++DS ME
Sbjct  5    RLQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIIFSAKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     ++ ES  +W+LE+AKLKAR+E L ++ RH+MGEDLDSLS ++
Sbjct  65   RILERYERYSYSEHQVLASETESIGSWTLEHAKLKARLEVLHRNYRHFMGEDLDSLSLKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPN  671
            LQNLE Q++S++KHIRS+KNQLM ESIS LQK              K+KE+E+ +A+Q  
Sbjct  125  LQNLEQQLESALKHIRSRKNQLMHESISVLQKKDRALQEQNNLLTRKVKEKERALAQQA-  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGR-EIEDAQLPPPNIVMPQWLLPHL  848
              Q E+QD    S  V    + S ++  +Y+    G  + E+   P    ++P W+L  L
Sbjct  184  --QWEQQDHALDSPVVLPHYLPSLDINGSYQARHNGHDDGENLTQPRAGTLLPPWMLHRL  241



>gb|AAG24909.1|AF305076_1 MADS-box protein EAP1 [Eucalyptus globulus]
Length=244

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 166/236 (70%), Gaps = 18/236 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            ++QLKRIENKINRQ+TFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RLQLKRIENKINRQITFSKRRAGLLKKAHEISVLCDAEVALIVFSAKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     ++ ES  +W+LE+AKLKAR+E L ++ RH+MGEDLDSLS ++
Sbjct  65   RILERYERYSYAEHQVLASETESIGSWTLEHAKLKARLEVLHRNYRHFMGEDLDSLSLKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLE Q++S++KHIRS+KNQLM ESIS LQ              KKIKE+E+ +A+Q  
Sbjct  125  LQNLEQQLESALKHIRSRKNQLMHESISVLQKKDRALQEQNNLLTKKIKEKERALAQQA-  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGR-EIEDAQLPPPNIVMPQWL  836
              Q E+QD    S  V    + S ++  +Y+    G  + E+   P    ++P W+
Sbjct  184  --QWEQQDHALDSPVVLPHYLPSLDINGSYQARHNGHDDGENLTQPRAGTLLPPWI  237



>ref|XP_002866402.1| hypothetical protein ARALYDRAFT_919330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42661.1| hypothetical protein ARALYDRAFT_919330 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 162/236 (69%), Gaps = 19/236 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK+  +Q  
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKTGQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             E Q  Q +NSSS  +    V S   G    + G       + L  PN ++P W++
Sbjct  183  -EGQLVQCSNSSSVLLPQYCVTSSRDGFVERVGGGNGGA--SSLTEPNSLLPAWMI  235



>gb|AAP32475.1| MADS-box protein 6 [Vitis vinifera]
Length=247

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 164/245 (67%), Gaps = 24/245 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S  E     TD + Q NWS++Y KL ARIE L+++ RH++GEDLD LS RE
Sbjct  65   RILERYERYSLSERQLLSTDPDPQGNWSMDYPKLTARIEVLQRNLRHFVGEDLDPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IR++KNQLM ESISELQKK    EK + EQ N              
Sbjct  125  LQNLELQLDTALKRIRTRKNQLMHESISELQKK----EKSLVEQNNALAKKVKEKEKVEQ  180

Query  672  -----LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL-PPPNIVMPQW  833
                  EQQ     NSS+  V   P+   +L       G   E + A+  P PN +MP W
Sbjct  181  NNRAQWEQQNNIGQNSSAYVVPPPPLQLPSLTMGGSFVGRAVEEDGAEARPSPNTLMPPW  240

Query  834  LLPHL  848
            +L H+
Sbjct  241  MLRHV  245



>gb|ADM21461.1| apetala 1 [Paeonia suffruticosa]
Length=242

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 164/226 (73%), Gaps = 21/226 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYE+ S  E   +  P    SQ NWSLEY+KL+A+IE L++++R +MGEDLDSLS 
Sbjct  65   KILDRYEQYSIAERQLVEEPG---SQGNWSLEYSKLRAKIELLQRNQRRFMGEDLDSLSP  121

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQ  665
            ++LQN+E Q+D S+K+IRS+KNQLM ESISELQKK              IKE+EK MA+Q
Sbjct  122  KDLQNMEQQLDVSLKNIRSRKNQLMYESISELQKKERAIQEQNNLLAKQIKEKEKTMAQQ  181

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL  803
               EQQ     N+S+  ++   + + N+G  Y+  GE  E+   +L
Sbjct  182  AQWEQQIHHGPNASAYLLSPHELTTLNMGGNYQ--GEPTEVRRNEL  225



>ref|XP_010037261.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform 
X2 [Eucalyptus grandis]
 gb|KCW48937.1| hypothetical protein EUGRSUZ_K02547 [Eucalyptus grandis]
Length=205

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 141/167 (84%), Gaps = 4/167 (2%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDADV +IVFSTKGKLF+YA+D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRCGLLKKAHEISVLCDADVALIVFSTKGKLFEYATDCCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY ES     + E+  NW+LE+AKLKAR+E L+K++++ MGE+LDSLS +E
Sbjct  65   RILERYERYSYAESQVLTNNAETNGNWTLEHAKLKARMEILQKNQKNLMGEELDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL  674
            LQNLEHQ+D+++KHIRS+KNQLM ESISELQ+K    +K + EQ N+
Sbjct  125  LQNLEHQLDTALKHIRSRKNQLMYESISELQRK----DKALQEQNNM  167



>ref|XP_010316206.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Solanum 
lycopersicum]
Length=250

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 167/247 (68%), Gaps = 25/247 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYAS-DSRM  350
            +V+LKRIENKI+RQVTFSKRRSGLLKKANEISVLCDADV +IVFSTKGKLF+Y+S DS M
Sbjct  5    RVELKRIENKISRQVTFSKRRSGLLKKANEISVLCDADVALIVFSTKGKLFEYSSNDSSM  64

Query  351  ERILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            E IL RYERCSY E   N  D + + NWS+EY KL +RIE L+++ RHYMG+DLD LS R
Sbjct  65   ESILERYERCSYAERQMNANDSDPKENWSVEYPKLMSRIELLQRNIRHYMGQDLDPLSLR  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN-----LEQQEKQD  695
            ELQ++E QID+S+K IRS+KNQLM ESISELQKK    EK + EQ N     L++ EK  
Sbjct  125  ELQSIEQQIDTSLKRIRSRKNQLMHESISELQKK----EKALQEQNNLITKKLKENEKTQ  180

Query  696  TNSS---SSYVALQPVNSF----NLGETYEIAGEGREIEDAQLPPPN--------IVMPQ  830
             NSS   S+ V + P +S     NL       G  R+        P          ++P 
Sbjct  181  PNSSGQNSATVHVFPSHSHHQLPNLTIGGAFGGMNRDGSGQAHHYPGSNNNNNNSSLIPP  240

Query  831  WLLPHLT  851
            W+L H++
Sbjct  241  WMLRHVS  247



>gb|AFK43328.1| unknown [Medicago truncatula]
Length=236

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 168/236 (71%), Gaps = 19/236 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLK+IENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME
Sbjct  5    RVQLKKIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      DQ    NW +E+A+LK R+E ++K++R++MGE+LD LS +E
Sbjct  65   KILERYERYSYAERQHVANDQPQNENWIVEHARLKTRLEVIQKNQRNFMGEELDGLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPN  671
            LQ+LEHQ+DS++K IRS+KNQLM ESISEL K              KIKE+EK +A+   
Sbjct  125  LQHLEHQLDSALKQIRSRKNQLMYESISELSKKDKALQEKNKLLTTKIKEKEKALAQ---  181

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
            LEQQ  +D N +S+ +  Q + + N+G + E   +G   E++Q    N  +P W+L
Sbjct  182  LEQQ-NEDMNLASTVLVPQSLKTLNIGSSLEDRDDGGNNEESQ-THGNAHLPPWML  235



>ref|XP_009388901.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Musa acuminata subsp. malaccensis]
Length=246

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 170/245 (69%), Gaps = 21/245 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKL++Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYE  SY E     +DQ+ Q NW  EY KLKA++E L KS+RH MGE L++L+ +E
Sbjct  65   KILERYEYYSYAEKALMSSDQDYQGNWCQEYGKLKAKVEALSKSQRHLMGEQLEALNLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK----------------IKEREKEMAEQ  665
            LQ LEHQ++ S+KHIRS+KNQ+M +SI+ELQKK                 K++ K + +Q
Sbjct  125  LQQLEHQLEISLKHIRSRKNQVMFDSIAELQKKEKALQAANKTLEQELMEKQKIKAITQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWLL  839
             + EQ   Q ++SS   +  +P  + N+G    +A   RE E ++LP    N ++P W+L
Sbjct  185  AHWEQ--AQTSSSSPPPLIAEPQPTLNIGCYQGMALAVRE-EASRLPVRISNSLLPPWML  241

Query  840  PHLTG  854
             HL G
Sbjct  242  RHLNG  246



>gb|AIX02981.1| MADS-box protein 1S [Betula luminifera]
Length=254

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 168/251 (67%), Gaps = 25/251 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKLF+++SDS M+
Sbjct  5    RVQLKRIENKISRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSTKGKLFEFSSDSSMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY +     T+ ESQ +WSLE+ KL ARIE LE++ R+ +GEDLD LS RE
Sbjct  65   RILERYERYSYADRHLMATESESQGSWSLEFPKLSARIEVLERNIRNLLGEDLDPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQN+E Q+D+ +K +R++KNQ+M ESI ELQ              KKIKE EK +AE  +
Sbjct  125  LQNMEQQLDTGLKRLRTRKNQVMHESIMELQKKEKALQEQNNLLSKKIKENEKAVAEHAH  184

Query  672  LEQQEKQDTNSS---------SSYVALQPVNSFNLGETYEIAGEGREIEDAQL-PPPNIV  821
            LEQ       S+                P+ S  +G T++ AG G E   AQ  P  N +
Sbjct  185  LEQPSIGQNLSTFMLSLPQQPQPQPPTLPLPSLTIGGTFQ-AGAGDEDAGAQTRPSANRL  243

Query  822  MPQWLLPHLTG  854
            MP W+L H+ G
Sbjct  244  MPPWMLSHING  254



>ref|XP_009130138.1| PREDICTED: agamous-like MADS-box protein AGL8 [Brassica rapa]
 emb|CDY42841.1| BnaAnng06660D [Brassica napus]
Length=240

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 160/238 (67%), Gaps = 21/238 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK+      
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNTLLKKIKEREKKTG----  180

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDA-QLPPPNIVMPQWLLP  842
               QE Q  + S++   +QP           +   G E   A  L  PN ++P W+LP
Sbjct  181  --HQEGQLNHCSNNSSIVQPQYCLTSSRDGFVGRVGAENGGASSLTQPNSLLPAWMLP  236



>gb|AGX01536.1| FRUITFULL-like protein, partial [Pseudofumaria lutea]
Length=245

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 164/245 (67%), Gaps = 27/245 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER S  E     TD + Q NWSLEY KLKA+IE L+K++RH+MGEDL+S+S +E
Sbjct  65   RILERYERYSCAERELVTTDLDPQGNWSLEYTKLKAKIEILQKNQRHFMGEDLESMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN--------------  671
            LQNLE Q+D+++K IRS+KNQLM ESISEL +K    EK + EQ N              
Sbjct  125  LQNLEQQLDTALKQIRSRKNQLMYESISELHRK----EKALQEQNNQLGKKLKEKEKGVA  180

Query  672  ------LEQQEKQDTNSSSSYVALQPVNSFNLGETYEI---AGEGREIEDAQLPPPNIVM  824
                   + Q +    +S S++  Q + S N+G  Y      G G E  +      N +M
Sbjct  181  QKAQWENQNQNQNHGQNSPSFLLSQSLPSLNIGGIYPTRNNTGGGEEEGNRTQTRTNSLM  240

Query  825  PQWLL  839
            P W+L
Sbjct  241  PPWML  245



>gb|AGX01587.1| FRUITFULL-like protein, partial [Eschscholzia californica]
Length=235

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 170/237 (72%), Gaps = 21/237 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V+LKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++D+ ME
Sbjct  5    RVELKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDTSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SYVE     T+ ESQ N SLE+ +LKA+I+ L++S+RH+MGEDL+ LS RE
Sbjct  65   NILERYERQSYVEENLVVTNPESQRNLSLEHTRLKAKIDMLQQSQRHFMGEDLEPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            +QNLE ++DS++KHIRS+KNQLM  SI++LQ              KK KE+E E+    +
Sbjct  125  IQNLEQELDSALKHIRSRKNQLMSASIADLQRKEKVLKEQNMGLMKKFKEKEDEVG---S  181

Query  672  LEQQEKQDTNSSSSYVA-LQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
            LE++E+    SSSS+++   P  +   G      G G E    QL   N+++P+W+L
Sbjct  182  LEREEQNKNGSSSSFLSQCLPSLAIRSGNYQMGGGVGSEERVQQL---NMIVPRWML  235



>gb|ACJ85368.1| unknown [Medicago truncatula]
Length=236

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 167/236 (71%), Gaps = 19/236 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLK+IENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME
Sbjct  5    RVQLKKIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      DQ    NW +E+A+LK R+E ++K++R++MGE+LD LS +E
Sbjct  65   KILERYERYSYAERQHVANDQPQNENWIIEHARLKTRLEVIQKNQRNFMGEELDGLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPN  671
            LQ+LEHQ+DS++K IRS+KNQLM ESISEL K              KIKE+EK +A+   
Sbjct  125  LQHLEHQLDSALKQIRSRKNQLMYESISELSKKDKALQEKNKLLTTKIKEKEKALAQ---  181

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
            LEQQ  +D N +S+ +  Q + + N+G + E   +G   E++Q    N   P W+L
Sbjct  182  LEQQ-NEDMNLASTVLVPQSLETLNIGSSLEDRDDGGNNEESQ-THGNAHFPPWML  235



>dbj|BAP28174.1| MADS-box transcription factor [Fagus crenata]
Length=260

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 166/245 (68%), Gaps = 33/245 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD E Q NW++EY++LKA++E L+++ R YMGEDLDSLSF++
Sbjct  65   KILERYERYSYAERQLVATDSELQGNWTMEYSRLKAKVELLQRNHRQYMGEDLDSLSFKQ  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPN  671
            LQNLE Q+D+++KHIRS+KNQLM ESIS+LQ+              KIKE+EK +A+   
Sbjct  125  LQNLEQQLDTALKHIRSRKNQLMYESISDLQRKEKAIQEQNNMLANKIKEKEKTVAQVQV  184

Query  672  LE----------------QQEKQDTNSSSSYVALQPVNSFNLG--ETYEIAGEGREIE-D  794
                              +Q+    N SSS++  QP+   N+G    +E A E R  E D
Sbjct  185  QAQAQAQAQAQAQAQAHWEQQNHGPNGSSSFLFQQPLPCLNIGGNHHHEEAPEVRRNELD  244

Query  795  AQLPP  809
              L P
Sbjct  245  LTLEP  249



>gb|ACG70964.1| APETALA1-like protein [Ziziphus jujuba]
Length=245

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 160/216 (74%), Gaps = 23/216 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSK+R+GLLKKA+EISVLCDA+V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKKRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCME  64

Query  354  RILARYERCSYVE-----SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDS  518
            +IL RYER SY E     S+  P  +  Q NW+LE+++LKA+IE L++++RHY GEDLDS
Sbjct  65   KILERYERYSYAERQLVASVSEP--EAVQGNWTLEFSRLKAKIELLQRNRRHYFGEDLDS  122

Query  519  LSFRELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEM  656
            L+ +ELQNLE Q+D+++K IRS+KNQLM  SISELQ+K              IKE+EK +
Sbjct  123  LNLKELQNLEQQLDTALKQIRSRKNQLMYNSISELQRKEKAMQEQNNLLAKEIKEKEKLV  182

Query  657  AEQPNLEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
            A+Q   EQQ      +SSS++  QP+   N+G  Y+
Sbjct  183  AQQMQWEQQ--NHCPASSSFLLPQPLPCLNIGGNYQ  216



>ref|XP_003547792.1| PREDICTED: floral homeotic protein APETALA 1-like [Glycine max]
 gb|KHN34480.1| Floral homeotic protein APETALA 1 [Glycine soja]
Length=236

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 162/228 (71%), Gaps = 21/228 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER +Y E      D ESQ NW++EY +LKA+I+ L+++ RHYMGEDL S+S +E
Sbjct  65   KILERYERYAYAERQLVANDSESQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LE Q+D+++K IR+++NQLM ESISELQ              KKIKE+EK  A+Q  
Sbjct  125  LQSLEQQLDTALKQIRTRRNQLMYESISELQKKEKVIQEQNNMLAKKIKEKEKVAAQQA-  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETY--EIAGEGREIEDAQLPP  809
              Q E  +   ++S++  QP+   N+G  Y  E +  GR   D  L P
Sbjct  184  --QWEHPNHGVNASFLLPQPL--LNMGGNYREEASEVGRNELDLTLEP  227



>gb|AGW23343.1| MADS box protein MADS41 [Gossypium hirsutum]
Length=245

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 168/230 (73%), Gaps = 18/230 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EIS+LCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISILCDAEVALIVFSHKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     T+ ESQ NWS++Y +LKA++E L+++ RHYMGE+L+SLS +E
Sbjct  65   KILERYERYSYAERQLVATEPESQGNWSMDYNRLKAKVELLQRNHRHYMGEELESLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D+++K IRSKKNQLM ESISELQ+K              IKEREK +A+Q  
Sbjct  125  LQNLEQQLDTALKLIRSKKNQLMYESISELQRKEKAIQEQNTMLAKQIKEREKTVAQQQQ  184

Query  672  LEQQEKQDTN--SSSSYVALQPVNSFNLGETY-EIAGEGREIE-DAQLPP  809
             + Q  Q  +  ++SS++  QP    N+G TY E A E R  E D  L P
Sbjct  185  QQPQWGQQDHGLNTSSFLLPQPPPCLNIGGTYQEEATEMRRNELDLTLEP  234



>dbj|BAC53738.1| PnSAH1 [Ipomoea nil]
Length=247

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 172/246 (70%), Gaps = 22/246 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKLF+YA++S ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATESCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E   N TDQ SQ +W+LE+AKLKAR+E L++++RHY GEDLDSLS +E
Sbjct  65   KILERYERYSYAERQLNSTDQNSQGSWTLEHAKLKARMEVLQRNQRHYEGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKH--IRSKKNQLMLESI------------SELQKKIKEREKEMAEQPN  671
            LQNLE  +   I+H  IRSK+NQLM ESI             +L KKIKEREKEMA Q  
Sbjct  125  LQNLERNL---IQHSNIRSKRNQLMYESILCSEKDKHCRTKYQLSKKIKEREKEMATQQQ  181

Query  672  LEQQEKQ---DTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPN--IVMPQWL  836
             +Q+ +    + + +SSYV   P+   +    Y+  GE  E E  Q    N    MPQW+
Sbjct  182  QQQEVQWEQPNDDINSSYVVPPPLVHLSSEGEYQGEGEYGETEGTQRQQQNNTSAMPQWM  241

Query  837  LPHLTG  854
            L HL G
Sbjct  242  LSHLQG  247



>gb|ACS74808.1| APETALA1/FUL-like protein [Rosa hybrid cultivar]
Length=257

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 172/258 (67%), Gaps = 40/258 (16%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQLKRIENKI+RQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKLF+YA+DS ME
Sbjct  5    KVQLKRIENKISRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSTKGKLFEYATDSSME  64

Query  354  RILARYERCSYVE--SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
             IL RYE+ SY E  S+  P   ESQ NWS+E+ KL ARIE L++  R+Y GEDLD LS 
Sbjct  65   GILERYEQYSYAERQSMGVPAS-ESQGNWSMEFPKLTARIEILQRKIRNYTGEDLDPLSL  123

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQ  665
            RELQ+LE QID+++K +R++KNQ+M ESISE+Q              KK+KE EK + E+
Sbjct  124  RELQSLEQQIDTALKRVRARKNQVMHESISEMQKKHRTLQEQNNSLAKKLKENEKLLQEE  183

Query  666  PNLEQQEKQDTNSSSSYVALQP---------VNSFNLGETYEIAGEGREIEDAQ------  800
            PN  QQ      + S+ V + P         ++S  +G  ++  G+  + EDA+      
Sbjct  184  PNNNQQP-----NPSTLVLMPPLQATSPPALLSSLTIGGAFQGRGDAMD-EDAEDHQGSA  237

Query  801  --LPPPNIVMPQWLLPHL  848
               P  N +MP W++ HL
Sbjct  238  QTRPASNTLMPPWMVRHL  255



>gb|AGT21640.1| MC [Solanum tuberosum]
Length=244

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 159/220 (72%), Gaps = 19/220 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KV+L++IENKINRQVTFSKRR GL+KKA+EISVLCDA+V +IVFS KGK+F+Y+SDS ME
Sbjct  5    KVELRKIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVALIVFSQKGKIFEYSSDSCME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER SY E   L N ++   Q NWSLEY KLKARI+ L+++ +HYMGEDLDS+S 
Sbjct  65   QILGRYERYSYAERRLLANNSESPVQENWSLEYTKLKARIDLLQRNHKHYMGEDLDSMSL  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQ  665
            ++LQNLE Q+DS++K IRS+KNQLM ESISELQ              KKIKE++K + +Q
Sbjct  125  KDLQNLEQQLDSALKLIRSRKNQLMHESISELQKKERAILEENNMLTKKIKEKDKIVEQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEI-AGEGR  782
                QQ  Q + S+S    LQP    N+G  Y+  A E R
Sbjct  185  GEWHQQTNQVSTSTS--FLLQPHQCLNMGGNYQDEAAEAR  222



>ref|XP_009398247.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Musa acuminata subsp. malaccensis]
Length=248

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 173/248 (70%), Gaps = 26/248 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +I+FSTKGKL++Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYE+ SY E     +D ESQ NW  EY KLKA++E L KS+RH MGE LDSL+ +E
Sbjct  65   KILGRYEQYSYAEKAIASSDLESQGNWCHEYGKLKAKVEALSKSQRHLMGEQLDSLNVKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQ-PNLEQQ--EKQD---  695
            LQ LE+Q+++S++HIRS+K+Q+M +SI+ELQ K    EK + EQ  NLE+Q  EKQ    
Sbjct  125  LQQLENQLETSLRHIRSRKSQVMFDSIAELQTK----EKALREQNKNLEKQITEKQKAKV  180

Query  696  -------------TNSSSSYVALQPVNSFNLGETYE--IAGEGREIEDAQLPPPNIVMPQ  830
                         ++   +++  +P ++ N+  +Y+     EG E  + Q+   N ++P 
Sbjct  181  LIQQAQWEHPQTISSPPPAFLMAEPHSTLNI-RSYQGRATMEGEEAAEPQVRIGNSLLPP  239

Query  831  WLLPHLTG  854
            W+L HL G
Sbjct  240  WMLTHLNG  247



>gb|AFV13860.1| fruitfull-like protein FUL, partial [Cakile lanceolata]
Length=236

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 161/238 (68%), Gaps = 25/238 (11%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQLKR+ENKINRQVTFSKR SGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS MER
Sbjct  1    VQLKRMENKINRQVTFSKRGSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSSMER  60

Query  357  ILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFREL  536
            IL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +EL
Sbjct  61   ILERYDRYLYSDKQLVGRDTSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKEL  120

Query  537  QNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPNL  674
            Q+LEHQ+ ++IK IRS+KNQ M E+IS LQ              KKIKEREK      N 
Sbjct  121  QSLEHQLAAAIKSIRSRKNQAMFETISALQKKDKALQDHNNTLLKKIKEREK------NR  174

Query  675  EQQEKQDTNSSSSYVALQP---VNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             QQE Q   SS++   LQP   V S   G    + GE   +  + L  PN ++P W+L
Sbjct  175  GQQEGQLIQSSNNSSVLQPQYCVASSRDGLVGRVGGEN--VGASSLMEPNSLLPAWML  230



>gb|ABQ08573.1| MADS-box protein 1 [Dendrobium nobile]
Length=246

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 162/243 (67%), Gaps = 17/243 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V VIVFS KGKL+++++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVAVIVFSNKGKLYEFSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      +   Q +W LEY KLKAR+E L+KS+RH MGE LDSLS +E
Sbjct  65   KILERYERYSYAERALFSNEANPQADWHLEYHKLKARVESLQKSQRHLMGEQLDSLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK----------------IKEREKEMAEQ  665
            LQ+LE Q++SS+KHIRS+K QL+L+SISELQKK                 KE+ K + + 
Sbjct  125  LQHLEQQLESSMKHIRSRKTQLILDSISELQKKEKILLEQNKTLEKEIIAKEKAKALTQI  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPH  845
               E+Q     +S+  +V    V +     T++      E   AQL   N ++P W+L H
Sbjct  185  APWEKQNLSQYSSAPLHVISDSVPTPT-SRTFQAIANEEESPQAQLRVSNTLLPPWMLGH  243

Query  846  LTG  854
            + G
Sbjct  244  MNG  246



>emb|CBY05400.1| FRUITFULL-like protein [Lepidium appelianum]
Length=242

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 168/238 (71%), Gaps = 22/238 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK+IRS+KNQ MLESIS LQ              KKIKEREK+  +Q  
Sbjct  125  LQSLEHQLDAAIKNIRSRKNQAMLESISALQKKDKALQDHNNSLLKKIKEREKKTDQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQ-PVNSFNLGETYEIAGEGREIEDA-QLPPPNIVMPQWLL  839
             E Q  Q +NSS+S +  Q  V S   G    I   G+E   A  L  PN ++P W+L
Sbjct  183  -EGQFIQCSNSSNSLLLPQYCVTSSRDGFVERI---GQENGGAPSLTEPNSLLPAWML  236



>ref|XP_010029407.1| PREDICTED: truncated transcription factor CAULIFLOWER A isoform 
X1 [Eucalyptus grandis]
 gb|KCW56318.1| hypothetical protein EUGRSUZ_I02059 [Eucalyptus grandis]
Length=249

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 162/240 (68%), Gaps = 18/240 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRR+GLLKKA+EISVLCDADV +IVFSTKGKLF++++DS ME
Sbjct  5    RVQLKRIENKISRQVTFSKRRTGLLKKAHEISVLCDADVALIVFSTKGKLFEFSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQ-ESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
             IL RYER +Y E     TD  + Q +WSLEY KL ARIE L+++ R+  GE+LD LS R
Sbjct  65   SILERYERYTYAERQQVATDSPQVQGSWSLEYPKLVARIEVLQRNIRNLSGEELDPLSLR  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQP  668
            ELQ LE Q+D+++K IR++KNQLM ESIS+LQ              KKIKE EK M E  
Sbjct  125  ELQYLEQQLDTALKRIRTRKNQLMHESISQLQKKEKSLQEQNNVLSKKIKENEKVMRESG  184

Query  669  NLEQQEKQDTNSSSSYVALQPVNSFNLGETYE---IAGEGREIEDAQLPPPNIVMPQWLL  839
              EQQ    T SS       P+ S  +G T++   + G   + E +Q  P N +MP W++
Sbjct  185  QWEQQTPAPTTSSFMLQPTLPLPSLTIGNTFQTPHVLGGAEQEERSQARPANTLMPPWMI  244



>gb|AET74058.1| MADS23 [Gossypium hirsutum]
Length=245

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 161/213 (76%), Gaps = 16/213 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EIS+LCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISILCDAEVALIVFSHKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     ++ ESQ NWS++Y +LKA++E L+++ RHYMGE+L+SLS +E
Sbjct  65   KILERYERYSYAERQLVASEPESQGNWSMDYNRLKAKVELLQRNHRHYMGEELESLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D+++K IRSKKNQLM ESISELQ+K              IKEREK +A+Q  
Sbjct  125  LQNLEQQLDTALKLIRSKKNQLMYESISELQRKEKAIQEQNTMLAKQIKEREKTVAQQQQ  184

Query  672  LEQQEKQDTN--SSSSYVALQPVNSFNLGETYE  764
             + Q  Q  +  ++SS++  QP    N+G TY+
Sbjct  185  QQPQWGQQNHGLNTSSFLLPQPPPCLNIGGTYQ  217



>gb|AFR54472.1| apetala 1-1 [Tagetes patula]
Length=225

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 160/226 (71%), Gaps = 7/226 (3%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V LKRIENKINRQVTFSKRR+GLLKK++EISVLCDADV +IVFSTKGKL +YAS+S ME
Sbjct  5    RVTLKRIENKINRQVTFSKRRAGLLKKSHEISVLCDADVALIVFSTKGKLAEYASNSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYE+ SY E     T+ ESQ   +L+  KLKARIE L+K +RH MGE+LDSL+ +E
Sbjct  65   RILERYEKQSYAEMQHTSTNNESQEILTLDPGKLKARIELLQKRERHLMGEELDSLNLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQEKQDTNSSSS  713
            +Q+LE QID+ +KHIR +KNQLM+E++S+LQKKIK++EKE+  Q  L  Q  +    S  
Sbjct  125  IQSLEQQIDTGLKHIRLRKNQLMVETVSQLQKKIKDKEKEVT-QHELVHQTHEMMTPSYH  183

Query  714  YVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHLT  851
               L   ++F  G+  E+    RE        P  V+P W++  +T
Sbjct  184  VGMLSNCDTFLAGDDGEVEENPRE------GQPATVIPSWMVKLMT  223



>gb|AAP83372.1| euAP1 APETALA1-like MADS-box [Heuchera americana]
Length=236

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 155/212 (73%), Gaps = 20/212 (9%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQL+R+ENKINRQVTFSKRR GL+KKA+EISVLCD +V +IVFS KGKLF+Y++DS ME+
Sbjct  1    VQLRRMENKINRQVTFSKRRGGLVKKAHEISVLCDVEVALIVFSNKGKLFEYSTDSCMEK  60

Query  357  ILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFREL  536
            IL RYER SY E     T  ESQ NWSLEY KLKA+IE L++S+R +MGEDLD LS REL
Sbjct  61   ILERYERYSYAERRLVATGSESQENWSLEYTKLKAKIELLQRSQRQFMGEDLDLLSLREL  120

Query  537  QNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL--------------  674
            QNLE Q+D+++KHIRS+KNQLM +SIS+LQKK    EK + EQ NL              
Sbjct  121  QNLEQQLDTALKHIRSRKNQLMNQSISDLQKK----EKAIQEQNNLLAKKIKEKEKAMSQ  176

Query  675  --EQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
              E +++ +  S+S+++  QP+   N+  TY+
Sbjct  177  QAEWEQQNNGASTSNFLNPQPLPCLNISSTYQ  208



>ref|XP_006394555.1| hypothetical protein EUTSA_v10004769mg [Eutrema salsugineum]
 gb|ESQ31841.1| hypothetical protein EUTSA_v10004769mg [Eutrema salsugineum]
Length=269

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 165/239 (69%), Gaps = 25/239 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  33   RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  92

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  93   RILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  152

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK+  +Q  
Sbjct  153  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNTLLKKIKEREKKSGQQ--  210

Query  672  LEQQEKQDTNSSSSYVALQP---VNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             E Q  Q +N+SS    LQP   V +   G    + GE      + L  PN ++P W+L
Sbjct  211  -EGQLIQCSNNSS---ILQPQYCVTATRDGFEGRVGGENGGA--SSLTEPNSLLPAWML  263



>gb|AGX01555.1| FRUITFULL-like protein, partial [Hydrastis canadensis]
Length=223

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 162/227 (71%), Gaps = 22/227 (10%)
 Frame = +3

Query  213  QVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILARYERCSYVE  392
            QVTFSKRRSGLLKKA+EISVLCDADV +IVFSTKGKLF+Y++DS M+RIL RYER SY E
Sbjct  1    QVTFSKRRSGLLKKAHEISVLCDADVALIVFSTKGKLFEYSTDSGMDRILERYERYSYAE  60

Query  393  SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLEHQIDSSIK  572
                 TD ESQ NWSLEY KLKA+IE L+K++RH+MGE+LD++S +ELQNLE Q+D+++K
Sbjct  61   RELVGTDLESQGNWSLEYCKLKAKIEVLQKNQRHFMGEELDNMSLKELQNLEQQLDTALK  120

Query  573  HIRSKKNQLMLESISELQKKIKEREKEMAEQPN-------------LEQQEKQDTN---S  704
             IRS+KNQLM ESISELQ+K    EK + EQ N              +Q + + +N   +
Sbjct  121  QIRSRKNQLMYESISELQRK----EKALQEQNNQLGKKLKEKEKASAQQTQWEQSNQGQN  176

Query  705  SSSYVALQPVNSFNLGETYEIAGEGREIED--AQLPPPNIVMPQWLL  839
            S S++  Q + S N+G +Y+    G E E+  AQ+   N +MP W+L
Sbjct  177  SPSFLLSQTLPSLNIGGSYQGRSNGGEEEEGRAQIGHRNTLMPPWML  223



>gb|AEJ76846.1| MADS23 [Gossypium hirsutum]
Length=248

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 162/216 (75%), Gaps = 19/216 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EIS+LCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISILCDAEVALIVFSHKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     T+ ESQ NWS++Y +LKA++E L+++ RHYMGE+L+SLS +E
Sbjct  65   KILERYERYSYAERQLVATEPESQGNWSMDYNRLKAKVELLQRNHRHYMGEELESLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D+++K IRSKKNQLM ESISELQ+K              IKEREK +A+Q  
Sbjct  125  LQNLEQQLDTALKLIRSKKNQLMYESISELQRKEKAIQEQNTMLAKQIKEREKTVAQQQQ  184

Query  672  LEQQEKQDTN-----SSSSYVALQPVNSFNLGETYE  764
             +QQ+ Q        ++SS++  QP    N+G TY+
Sbjct  185  QQQQQPQWGQQNHGLNTSSFLLPQPPPCLNIGGTYQ  220



>gb|AAQ83693.1| MADS-box protein [Chloranthus spicatus]
Length=235

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 165/241 (68%), Gaps = 24/241 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL +Y++DSRM+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSAKGKLSEYSTDSRMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD     NW+LEY+KLKA++E L++ +RHYMGEDL+ LS +E
Sbjct  65   RILERYERISYAERELRSTDHRPDGNWNLEYSKLKAKLEGLQRXQRHYMGEDLEKLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ LE+Q+D+++KHIR++K Q+M++SI+ELQ              KKI+E+   +A Q +
Sbjct  125  LQPLENQLDNALKHIRTRKTQVMMDSIAELQAREKLLQEQNSMLEKKIQEKNA-LAHQAH  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHLT  851
             EQQ +  T S   ++      + N   TY+  GE   +        N +MP W+L H+ 
Sbjct  184  WEQQNQ--TQSPPPFLLTHQHPTIN-NSTYQARGEEDRVR------TNSLMPPWMLRHVN  234

Query  852  G  854
            G
Sbjct  235  G  235



>emb|CAA67968.1| MADS4 protein [Betula pendula]
 gb|AFN70906.1| MADS4 [Plant transformation vector pAKE1::35S BpMADS4]
Length=260

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 169/257 (66%), Gaps = 31/257 (12%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKLF+++SDS M+
Sbjct  5    RVQLKRIENKISRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSTKGKLFEFSSDSSMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY +     T+ ESQ +WSLE+ KL ARIE LE++ R+ +GEDLD LS RE
Sbjct  65   RILERYERYSYADRHLMATESESQGSWSLEFPKLSARIEVLERNIRNLLGEDLDPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQN+E Q+D+ +K +R++KNQ+M ESI ELQ              KKIKE EK +AE  +
Sbjct  125  LQNMEQQLDTGLKRLRTRKNQVMHESIMELQKKEKALQEQNNLLSKKIKENEKAVAEHAH  184

Query  672  LEQ---------------QEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL-  803
            LEQ               Q+ Q            P+ S  +G T++ AG G E   AQ  
Sbjct  185  LEQPSIGQNLSTFMLSLPQQPQPQPQLQPQPPTLPLPSLTIGGTFQ-AGAGDEDAGAQTR  243

Query  804  PPPNIVMPQWLLPHLTG  854
            P  N +MP W+L H+ G
Sbjct  244  PSANRLMPPWMLSHING  260



>ref|XP_006338337.1| PREDICTED: agamous-like MADS-box protein AGL8 homolog [Solanum 
tuberosum]
Length=247

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 167/247 (68%), Gaps = 28/247 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYAS-DSRM  350
            +V+LKRIENKI+RQVTFSKRRSGLLKKANEISVLCDADV +IVFSTKGKLFQY+S DS M
Sbjct  5    RVELKRIENKISRQVTFSKRRSGLLKKANEISVLCDADVALIVFSTKGKLFQYSSTDSSM  64

Query  351  ERILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            E IL RYER SY E+  N  D + + NWS+EY KL +RIE L+++ RHYMG+DLD LS R
Sbjct  65   ESILERYERYSYAETQMNANDSDPKENWSVEYPKLMSRIELLQRNIRHYMGQDLDPLSLR  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN-----LEQQEKQD  695
            ELQ++E QID+S+K IRS+KNQLM ESISELQKK    E+ + EQ N     L++ EK  
Sbjct  125  ELQSIEQQIDTSLKRIRSRKNQLMHESISELQKK----ERALQEQNNLITKKLKENEKTQ  180

Query  696  TNSSSSYV---------------ALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQ  830
             NSS+ +V               A   +N    G+ ++  G      +      + ++P 
Sbjct  181  PNSSTFHVPPSHSHHLPNLTIGGAFGGMNRDGSGQVHQYPGSNNNNNNNSN---SSLIPP  237

Query  831  WLLPHLT  851
            W+L H++
Sbjct  238  WMLRHVS  244



>gb|AAX13296.1| MADS box protein AP1a [Lotus japonicus]
Length=241

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 161/232 (69%), Gaps = 24/232 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER +Y E      D ESQ NW++EY +LKA+I+ L+++ RHYMGEDL S+S +E
Sbjct  65   KILERYERYAYAERQLVANDSESQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQ+LE Q+D+++KHIR+++NQLM ESISELQKK    EK + EQ N+             
Sbjct  125  LQSLEQQLDTALKHIRTRRNQLMYESISELQKK----EKVIQEQNNMLAKKIKEKEKIAA  180

Query  675  EQQEKQ----DTNSSSSYVALQPVNSFNLGETY---EIAGEGREIEDAQLPP  809
            +QQ  Q    +   ++ ++  QP+ + N+G  Y        GR   D  L P
Sbjct  181  QQQHAQWDHPNHGVNAPFLMQQPLPTLNMGGNYREDHAPDVGRNELDLTLEP  232



>gb|ACS45102.1| APETALA1-like protein [Mangifera indica]
Length=247

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 144/178 (81%), Gaps = 7/178 (4%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDADV +IVFS +GKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDADVALIVFSHRGKLFEYATDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E        ES  NWSLE+ KLK++IE L++S+RHY+GEDLDSLS R+
Sbjct  65   RILERYERYSYAERQLVDPGPESTGNWSLEFHKLKSKIELLQRSQRHYLGEDLDSLSVRD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL---EQQEKQDT  698
            +QNLE Q+D+++KHIRS+KNQLM ESISELQ+K    EK + EQ N+   E +EK+ T
Sbjct  125  IQNLEQQLDTALKHIRSRKNQLMYESISELQRK----EKAIQEQNNMLAKEIKEKEKT  178



>gb|ADA77531.1| APETALA1 protein [Solanum tuberosum]
Length=244

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 157/213 (74%), Gaps = 18/213 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KV+L++IENKINRQVTFSKRR GL+KKA+EISVLCDA+V +IVFS KGK+F+Y+SDS ME
Sbjct  5    KVELRKIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVALIVFSQKGKIFEYSSDSCME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER SY E   L N ++   Q NWSLEY KLKARI+ L+++ +HYMGEDLDS+S 
Sbjct  65   QILERYERYSYAERRLLANNSESPVQENWSLEYTKLKARIDLLQRNHKHYMGEDLDSMSL  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQ  665
            ++LQNLE Q+DS++K IRS+KNQLM ESI+ELQ              KKIKE++K + +Q
Sbjct  125  KDLQNLEQQLDSALKLIRSRKNQLMHESITELQKKERAILEENNMLTKKIKEKDKIVEQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
                QQ  Q + S+S +  LQP    N+G  Y+
Sbjct  185  GEWHQQPNQVSTSTSFF--LQPHQCLNMGGNYQ  215



>ref|NP_001234665.1| MADS-box transcription factor MADS-MC [Solanum lycopersicum]
 gb|AAM15774.1|AF448521_1 MADS-box transcription factor MADS-MC [Solanum lycopersicum]
Length=244

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 156/213 (73%), Gaps = 18/213 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KV+L++IENKINRQVTFSKRR GL+KKA+EISVLCDA+V +IVFS KGK+F+Y+SDS ME
Sbjct  5    KVELRKIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVALIVFSQKGKIFEYSSDSCME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER SY E   L N ++   Q NWSLEY KLKARI+ L+++ +HYMGEDLDS+S 
Sbjct  65   QILERYERYSYAERRLLANNSESPVQENWSLEYTKLKARIDLLQRNHKHYMGEDLDSMSL  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQ  665
            ++LQNLE Q+DS++K IRS+KNQLM ESISELQ              KKIKE++K + +Q
Sbjct  125  KDLQNLEQQLDSALKLIRSRKNQLMHESISELQKKERAILEENNMLTKKIKEKDKIVEQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
                QQ  Q + S+S    LQP    N+G  Y+
Sbjct  185  GEWHQQTNQVSTSTS--FLLQPHQCLNMGGNYQ  215



>emb|CAD47852.1| MADS-box protein FUL-d [Brassica oleracea var. botrytis]
 gb|ABD67165.1| Ful-like protein [Brassica napus]
Length=242

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 160/235 (68%), Gaps = 15/235 (6%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V ++VFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALVVFSSKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE----------MAEQPNLEQQ  683
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQKK K  +              ++ N  QQ
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNTLLKKIKEKEKEKNTGQQ  184

Query  684  EKQDTNSSSSYVALQP---VNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
            E Q    S++   LQP   V S   G    + GE      + L  PN ++P W+L
Sbjct  185  EGQLIQCSNNSSVLQPQYCVTSSRDGLVERVGGENGGT--SSLIEPNSLLPAWML  237



>dbj|BAJ22385.1| APETALA1 [Vigna unguiculata]
Length=236

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 160/228 (70%), Gaps = 21/228 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER +Y E      D ESQ NW++EY +LKA+I+ L+++ RHYMGEDL S+S +E
Sbjct  65   KILERYERYAYAERQLVANDSESQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LE Q+D+++K IR+++NQLM ESISELQ              KKIKE+EK  A+   
Sbjct  125  LQSLEQQLDTALKQIRTRRNQLMYESISELQKKEKVIQEQNNMLAKKIKEKEKVAAQHA-  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETY--EIAGEGREIEDAQLPP  809
              Q E  +   ++S++  QP+   N+G  Y  E    GR   D  L P
Sbjct  184  --QWEHPNHGVNASFLLPQPL--LNMGGNYREEAPEVGRNELDLTLEP  227



>ref|XP_007032866.1| Agamous-like MADS-box protein AGL8 isoform 1 [Theobroma cacao]
 gb|EOY03792.1| Agamous-like MADS-box protein AGL8 isoform 1 [Theobroma cacao]
Length=248

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 165/244 (68%), Gaps = 21/244 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQL++IENKI+RQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF++++DS ME
Sbjct  5    RVQLRQIENKISRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSNKGKLFEFSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYE+ S  E    PT  ESQ NWSLE  KL + IE L+++ RH++GE+LD LS R+
Sbjct  65   RILDRYEQQSNAERQLVPTGSESQGNWSLECPKLMSTIEALQRNLRHFLGEELDPLSLRD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ LE QID+S+K IR++KNQLM ESISELQ              KK+KE EK   E   
Sbjct  125  LQLLEQQIDTSLKRIRTRKNQLMHESISELQKRERALQNQNNMLAKKLKENEKTQTEHAQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVN----SFNLGETYE-IAGEGREIEDAQLPPPNIVMPQWL  836
             EQQ    + +SSS++   P      S  +G +++ I G  +E E    P  N V+P W+
Sbjct  185  CEQQNL--SQNSSSFIQPPPATIEFPSLTIGGSFQAIEGANKEAETQPQPSTNTVIPPWM  242

Query  837  LPHL  848
            L H+
Sbjct  243  LSHV  246



>gb|AGW23346.1| MADS box protein MADS44 [Gossypium hirsutum]
Length=213

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 154/212 (73%), Gaps = 18/212 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V+LKRIENKINRQVTFSKRRSGL KKA+E+SVLCDA+V +IVFS K KL++Y++DS ME
Sbjct  5    RVELKRIENKINRQVTFSKRRSGLFKKAHELSVLCDAEVALIVFSHKWKLYEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER  Y E     T+ ESQ  WS+EY +LKA++E L+K+ RHYMGEDLD LS +E
Sbjct  65   KILERYERHYYAERHLVATEPESQGEWSVEYYRLKAKVELLQKNHRHYMGEDLDPLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D+++KHIR++KNQL+ ESISELQ+K              IKEREK +A Q  
Sbjct  125  LQNLEQQLDTAVKHIRARKNQLLNESISELQRKEKAIKEQNAMLANQIKEREKTVARQS-  183

Query  672  LEQQEKQDTN-SSSSYVALQPVNSFNLGETYE  764
              Q   QD   ++SS+V   P  S N+G  Y+
Sbjct  184  --QWGLQDNGLNTSSFVLPHPHPSLNIGGIYQ  213



>gb|AFA42327.1| AP1-like transcription factor [Fragaria x ananassa]
Length=245

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 148/209 (71%), Gaps = 14/209 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKANEISVLCDA V +IVFS KGKL +YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKANEISVLCDAQVALIVFSNKGKLSEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E      D + Q NW  E+A+LK ++E L+++ RHYMGEDLDSLS +E
Sbjct  65   NILERYERYSYAERQLVEPDFDPQGNWPFEHARLKVKVELLQRNLRHYMGEDLDSLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            +Q+LE QID+++K IRS+KNQLM ESISELQ              KKIKE EK +AE   
Sbjct  125  IQSLEQQIDTALKQIRSRKNQLMHESISELQRKEKAIKVQNNLLSKKIKEHEKNVAEAQE  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGET  758
            +   E+Q  N   + +A  P+   N+G T
Sbjct  185  VHDWEQQQQNHGLNLLAQGPIPCLNMGGT  213



>gb|AFU81352.1| FRUITFULLa, partial [Medicago papillosa]
Length=227

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 164/231 (71%), Gaps = 19/231 (8%)
 Frame = +3

Query  189  RIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILAR  368
            RIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME+IL R
Sbjct  1    RIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCMEKILER  60

Query  369  YERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLE  548
            YER SY E      DQ    NW +E+AKLK R+E ++K++R++MGE+LDSLS +ELQ+LE
Sbjct  61   YERYSYTERQHVANDQPQNENWIIEHAKLKTRLEVIQKNQRNFMGEELDSLSMKELQHLE  120

Query  549  HQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPNLEQQE  686
            HQ+D+++K IRS+KNQLM ESISEL K              KIKE+EK MA+   L+QQ 
Sbjct  121  HQLDTALKQIRSRKNQLMYESISELSKKDKALQEKNKLLTIKIKEKEKAMAQ---LDQQ-  176

Query  687  KQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             +D N  S+ +A Q + + N+G + E   +G   E++Q    N  +P W+L
Sbjct  177  NEDMNIVSTVLAPQSLETLNIGSSPEDRDDGGNNEESQ-THGNTHLPPWML  226



>emb|CDP00463.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 158/212 (75%), Gaps = 17/212 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y+SDS ME
Sbjct  5    KVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSSDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E      D ES+ +W+LEY KLKA+IE L+++ RHYMGEDLD++S ++
Sbjct  65   NILERYERYSYAERRLVANDLESEGDWTLEYTKLKAKIELLQRNHRHYMGEDLDAMSSKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+D+++K IR++KNQLM ESISELQ              KKIKE+EK MA+Q  
Sbjct  125  LQNLEHQLDTALKQIRTRKNQLMYESISELQRKEKAIQQQNSMLAKKIKEKEKLMAQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQPVNS-FNLGETYE  764
             + +++    SS+ Y+  +P+    N+   YE
Sbjct  183  AQWEQQNQGPSSTPYLIPEPLPPCINVSGNYE  214



>emb|CBY05406.1| FRUITFULL-like protein [Lepidium campestre]
Length=242

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 166/238 (70%), Gaps = 22/238 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDVSXSENWILEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK+  +Q  
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKTDQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQ-PVNSFNLGETYEIAGEGREIEDA-QLPPPNIVMPQWLL  839
             E Q  Q +NSS+S +  Q  V S   G    I   G+E   A  L  PN ++P W+L
Sbjct  183  -EGQFIQCSNSSNSLLLPQYCVTSSRDGLMERI---GQENGGAPSLTEPNSLLPAWML  236



>gb|AHW58038.1| AP1 [Coffea arabica]
Length=242

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 158/212 (75%), Gaps = 17/212 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y+SDS ME
Sbjct  5    KVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSSDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E      D ES+ +W+LEY KLKA+IE L+++ RHYMGEDLD++S ++
Sbjct  65   NILERYERYSYAERRLVANDLESEGDWTLEYTKLKAKIELLQRNHRHYMGEDLDAMSSKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+D+++K IR++KNQLM ESISELQ              KKIKE+EK MA+Q  
Sbjct  125  LQNLEHQLDTALKQIRTRKNQLMYESISELQRKEKAIQQQNSMLAKKIKEKEKLMAQQ--  182

Query  672  LEQQEKQDTNSSSSYVALQPVNS-FNLGETYE  764
             + +++    SS+ Y+  +P+    N+   YE
Sbjct  183  AQWEQQNQGPSSTPYLIPEPLPPCINVSGNYE  214



>ref|XP_006437876.1| hypothetical protein CICLE_v10032490mg [Citrus clementina]
 gb|ESR51116.1| hypothetical protein CICLE_v10032490mg [Citrus clementina]
Length=243

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 151/211 (72%), Gaps = 14/211 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+G LKKA+EISVLCDA+V VI+FS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGFLKKAHEISVLCDAEVAVIIFSHKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER +Y E      D ESQ NW LE   LKA+I+ L+K++RHY+GEDL+SLS ++
Sbjct  65   KILERYERYAYAERQLIAPDPESQRNWPLECNNLKAKIDLLQKNQRHYLGEDLESLSLKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            +Q LE Q+D+++KHIRS+KNQLM ESISELQKK              IKEREK  A+Q  
Sbjct  125  IQQLEQQLDTALKHIRSRKNQLMQESISELQKKEKSIEEQNNLLVKQIKEREKAAAQQAQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
               Q +    ++ S++  QP     LG  Y+
Sbjct  185  WGNQIQNQVPNTLSFLLPQPPPCLRLGGAYQ  215



>ref|XP_004144163.1| PREDICTED: floral homeotic protein APETALA 1-like [Cucumis sativus]
 ref|XP_004165502.1| PREDICTED: floral homeotic protein APETALA 1-like [Cucumis sativus]
Length=223

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 154/211 (73%), Gaps = 18/211 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKR++GLLKKA+EISVLCDA+V +IVFS KGKLF+Y+SDS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRKAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSSDSSME  64

Query  354  RILARYERCSYVESLPNPTDQE--SQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER S+V    N   +   S  NW+LEY +LK+++E L+++  HYMGEDLDSLS 
Sbjct  65   KILERYERYSFVGRQQNAASESEFSYENWTLEYYRLKSKVELLQRNNSHYMGEDLDSLSV  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKE--MA  659
            +ELQNLE QID+++KH+R++KNQLM ESI++LQKK              IKE+EK   +A
Sbjct  125  KELQNLEQQIDTALKHVRTRKNQLMFESITDLQKKVRNIEENNVQLAKQIKEKEKSVALA  184

Query  660  EQPNLEQQEKQDTNSSSSYVALQPVNSFNLG  752
            +Q   E Q++Q  N+ S      P  S N+G
Sbjct  185  QQAEWEHQQQQGYNALSFLFPPPPHPSLNIG  215



>gb|AIC75372.1| MADS-box transcription factor APETALA1-like protein [Camellia 
sinensis]
Length=242

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 165/231 (71%), Gaps = 23/231 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            +IL RYER SYVE  L N    ++  NWSLE  +L+A+IE L+++ RHY+GEDLDSLS +
Sbjct  65   KILERYERYSYVERQLINAP--QTPGNWSLECTRLRAKIELLQRNHRHYVGEDLDSLSLK  122

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE----------------MAE  662
            ELQNLEHQ+D+++KHIR++KNQLM ESISELQKK K  +++                +AE
Sbjct  123  ELQNLEHQLDTALKHIRTRKNQLMHESISELQKKEKAIQEQNNMLVKKIKEKEKEKTIAE  182

Query  663  QPNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEI-AGEGREIE-DAQLPP  809
            Q   EQQ      +SSS++  Q +   N+G TY+    EGR  E D  L P
Sbjct  183  QSQWEQQ--YHCPNSSSFLLPQQLPCLNIGGTYQGEEQEGRRNELDLTLEP  231



>dbj|BAL70391.1| apetala1/squamosa protein [Alstroemeria ligtu subsp. ligtu]
Length=252

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 171/248 (69%), Gaps = 21/248 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKL++Y++D+ ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSTDASME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER S  E   +  D ESQ NW  E++KLK++ E L+K++RH MGE LD+LS +E
Sbjct  65   MILERYERYSQAERAVSEADPESQGNWIHEHSKLKSKDEALQKNQRHLMGEQLDNLSHKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIK--------------EREKEMA----  659
            LQ+LE Q++ ++KHIRSKKNQL+ +S+SELQ+K K              E+EKE A    
Sbjct  125  LQHLEQQLEGALKHIRSKKNQLLSDSVSELQRKEKFLQEQNRLLENKLIEKEKEKAKALM  184

Query  660  EQPNLEQQEKQDTNSSS-SYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQ  830
            +  + EQQ +  T+SSS +++  + + S N+G     AG   E    Q  P   +  +P 
Sbjct  185  QHAHWEQQGQAQTSSSSPTFLMTEQLPSLNMGTYQGGAGNAEEGVAGQTLPRAGSNTLPP  244

Query  831  WLLPHLTG  854
            W+L H++G
Sbjct  245  WMLRHVSG  252



>gb|AAX69065.1| MADS box protein M2 [Pisum sativum]
Length=236

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 165/234 (71%), Gaps = 21/234 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRCGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E    P DQ    NW +E+AKLKAR+E ++K++R++MGE+LD LS +E
Sbjct  65   RILERYERYSYAERQHVPNDQPQNENWIIEHAKLKARLEVIQKNQRNFMGEELDGLSMKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQNLEHQ+DS++K IRS+KNQ++ ESISELQ              KKIKE+EK +A   N
Sbjct  125  LQNLEHQLDSALKQIRSRKNQVVYESISELQKKDKALQEKNNLLTKKIKEKEKALA---N  181

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAG--EGREIEDAQLPPPNIVMP  827
             E     D +  S+ V  QP+ + N+G + +  G  EG + +   L PP ++ P
Sbjct  182  FELH-NDDMDLDSALVP-QPLETPNIGCSPQDRGDNEGSQTQSNALLPPWMLRP  233



>ref|XP_004508656.1| PREDICTED: agamous-like MADS-box protein AGL8-like [Cicer arietinum]
Length=235

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 137/167 (82%), Gaps = 4/167 (2%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y+SD  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      DQ    NW LE+AKLKAR+E L++++R++MGEDLD LS +E
Sbjct  65   RILERYERYSYTERQLVNNDQAPNENWVLEHAKLKARMEVLQRNQRNFMGEDLDGLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL  674
            LQNLE Q+DS++KHIRSKKNQ+M ESISELQKK    +K + E  NL
Sbjct  125  LQNLEQQLDSALKHIRSKKNQVMYESISELQKK----DKALQEHNNL  167



>gb|ACT67688.1| APETALA1-like protein [Prunus serrulata var. lannesiana]
Length=238

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 141/167 (84%), Gaps = 4/167 (2%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA VG++VFS KGKLF+YA+DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAQVGLVVFSNKGKLFEYATDSCMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D ESQCNW+ EY++LKA++E L++++RHY+GEDLDSL+ +E
Sbjct  65   QILDRYERYSYAERQLVEPDFESQCNWTFEYSRLKAKVELLQRNQRHYLGEDLDSLTLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL  674
            +Q+LEHQ+++++K IR +KNQLM ESISELQKK    E+ M EQ NL
Sbjct  125  IQSLEHQLETALKQIRLRKNQLMHESISELQKK----ERAMQEQNNL  167



>gb|AGW23367.1| MADS box protein MADS65 [Gossypium hirsutum]
Length=209

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 152/207 (73%), Gaps = 16/207 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +V+LKRIENKINRQVTFSKRRSGL KKA+E+SVLCDA+V +IVFS K KL++Y++DS ME
Sbjct  5    RVELKRIENKINRQVTFSKRRSGLFKKAHELSVLCDAEVALIVFSHKWKLYEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER  Y E     T+ ESQ  WS+EY +LKA++E L+K+ RHYMGEDLD LS +E
Sbjct  65   KILERYERHYYAERHLVATEPESQGEWSVEYNRLKAKVELLQKNHRHYMGEDLDPLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQNLE Q+D+++KHIR++KNQL+ ESISELQ+K              IKEREK  A Q  
Sbjct  125  LQNLEQQLDTALKHIRARKNQLLNESISELQRKEKAIKEQNAMLANQIKEREKTGARQSQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLG  752
              QQ+  +  ++SS+V   P  S N+G
Sbjct  185  WGQQD--NGLNTSSFVLPHPHPSLNIG  209



>ref|XP_003531957.1| PREDICTED: floral homeotic protein APETALA 1-like [Glycine max]
 gb|KHN37140.1| Floral homeotic protein APETALA 1 [Glycine soja]
Length=236

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 160/228 (70%), Gaps = 21/228 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER +Y E      D E+Q NW++EY +LKA+I+ L+++ RHYMGEDL S+S +E
Sbjct  65   KILERYERYAYAERQLVANDSETQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LE Q+D+++K IR+++NQLM ESISEL+              KKIKE+EK  A Q  
Sbjct  125  LQSLEQQLDTALKQIRTRRNQLMYESISELEKKEKVIQEQNNMLAKKIKEKEKVAASQA-  183

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETY--EIAGEGREIEDAQLPP  809
              Q E  +   ++S++  QP+   N+G  Y  E    GR   D  L P
Sbjct  184  --QWEHPNHGVNASFLLPQPL--LNMGGNYHDEAPEVGRHELDLTLEP  227



>gb|AGX01545.1| FRUITFULL-like protein, partial [Argemone mexicana]
Length=243

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 147/185 (79%), Gaps = 16/185 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSSMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     TD + Q NW LEY+KLKA+IE L+K++RH+MGEDL S+S +E
Sbjct  65   RILERYERYSYTERELVATDLD-QGNWPLEYSKLKAKIEILQKNQRHFMGEDLQSMSLKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMA-EQP  668
            LQNLE Q+D+++K IRS+KNQLM ESISELQKK              +KE+ KE++ +QP
Sbjct  124  LQNLEQQLDTALKQIRSRKNQLMYESISELQKKEKALQEQNKQLEKQLKEKVKEVSQQQP  183

Query  669  NLEQQ  683
            +  QQ
Sbjct  184  HWNQQ  188



>ref|XP_006281003.1| hypothetical protein CARUB_v10027017mg [Capsella rubella]
 gb|EOA13901.1| hypothetical protein CARUB_v10027017mg [Capsella rubella]
Length=242

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 163/239 (68%), Gaps = 25/239 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      +     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGREVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQ              KKIKEREK+      
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKT-----  179

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP---PNIVMPQWLL  839
             +QQE Q    S+S   L P   + L  + +   E  E E+   P    PN ++P W+L
Sbjct  180  -DQQEGQLNQCSNSCSVLLP--QYCLSSSRDDFVERVEGENGSAPSLTEPNSLLPAWML  235



>gb|AGT21646.1| MPF3 [Physalis pubescens]
Length=244

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 162/218 (74%), Gaps = 19/218 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KV+L++IENKINRQVTFSKRR GL+KKA+EISVLCDA+V +I+FS KGK+F+Y+SDS ME
Sbjct  5    KVELRKIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVALIIFSQKGKIFEYSSDSCME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER SY E   L N ++   Q NWSLEY KLKARI+ L+++ +HYMGEDLDS++ 
Sbjct  65   QILERYERYSYAERRLLANTSESPVQENWSLEYTKLKARIDLLQRNHKHYMGEDLDSMAL  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQ  665
            ++LQNLE Q+D+ +K IRS+KNQLM ESISELQ              KKIKE++K + +Q
Sbjct  125  KDLQNLEQQLDTGLKLIRSRKNQLMHESISELQKKERAIQEENNMLAKKIKEKDKIVGQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEI-AGE  776
                QQ+ Q   +S+S++ +QP    N+G  Y++ AG+
Sbjct  185  GEWHQQQNQ-VPASTSFL-IQPHPCLNIGGNYQVEAGD  220



>ref|XP_009111965.1| PREDICTED: agamous-like MADS-box protein AGL8 isoform X2 [Brassica 
rapa]
 emb|CDY16832.1| BnaA09g05500D [Brassica napus]
Length=241

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 160/235 (68%), Gaps = 15/235 (6%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V ++VFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALVVFSSKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE----------MAEQPNLEQQ  683
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQKK K  +              ++ N  QQ
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNTLLKKIKEKEKEKNTGQQ  184

Query  684  EKQDTNSSSSYVALQP---VNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
            E Q    S++   LQP   V +   G    + GE      + L  PN ++P W+L
Sbjct  185  EGQLIQCSNNSSVLQPQYCVTASRDGLVERVVGENGGA--SSLIEPNSLLPAWML  237



>gb|AFU81355.1| FRUITFULLa, partial [Medicago polyceratia]
Length=227

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 164/231 (71%), Gaps = 19/231 (8%)
 Frame = +3

Query  189  RIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILAR  368
            RIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME+IL R
Sbjct  1    RIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCMEKILER  60

Query  369  YERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLE  548
            YER SY E      DQ    NW +E+AKLK R+E ++K++R++MGE+LDSLS +ELQ+LE
Sbjct  61   YERYSYTERQHVANDQPQNENWIIEHAKLKTRLEVIQKNQRNFMGEELDSLSMKELQHLE  120

Query  549  HQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPNLEQQE  686
            HQ+D+++K IRS+KNQLM ESISEL K              KIKE+EK MA+   L+QQ 
Sbjct  121  HQLDTALKQIRSRKNQLMYESISELSKKDKALQEKNKLLTIKIKEKEKAMAQ---LDQQ-  176

Query  687  KQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             +D N  S+ +A Q + + N+G + E   +G   E++Q    N  +P W+L
Sbjct  177  NEDMNIVSTVLAPQSLETLNIGSSPEDRDDGGNNEESQTRGNN-HLPPWML  226



>gb|AGR88913.1| APETALA1-like MADS-box AP1-2 [Populus simonii x Populus nigra]
Length=249

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 156/216 (72%), Gaps = 19/216 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKANEISVLCDA+V +IVFS KGKLF+Y++D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKANEISVLCDAEVALIVFSHKGKLFEYSTDDSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD +SQ NW+LEY +LKA++E L+++ R+Y+GEDLDS+S +E
Sbjct  65   KILERYERYSYAERQLVATDLDSQGNWTLEYNRLKAKVELLQRNHRNYLGEDLDSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREK--EMAEQ  665
            LQNLE QID+++KHIR++KN LM +SISELQ+K              IKE+EK  +   Q
Sbjct  125  LQNLEQQIDTALKHIRARKNHLMSQSISELQRKEREIQVQNNMLVKQIKEKEKKDKALAQ  184

Query  666  PNLEQQEKQDTNSSS---SYVALQPVNSFNLGETYE  764
            P     +    N+SS   S  A  P+   N+G +++
Sbjct  185  PAFWDLQNHGPNASSLLLSQPAGLPLPCLNIGGSHQ  220



>ref|XP_002316076.1| AP1-like family protein [Populus trichocarpa]
 gb|AAT39556.1| APETALA1-like MADS-box PTAP1-2 [Populus trichocarpa]
 gb|EEF02247.1| AP1-like family protein [Populus trichocarpa]
Length=248

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 156/216 (72%), Gaps = 19/216 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKANEISVLCDA+V +IVFS KGKLF+Y++D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKANEISVLCDAEVALIVFSHKGKLFEYSTDDSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD +SQ NW+LEY +LKA++E L+++ R+Y+GEDLDS+S +E
Sbjct  65   KILERYERYSYAERQLVATDLDSQGNWTLEYNRLKAKVELLQRNHRNYLGEDLDSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREK--EMAEQ  665
            LQNLE QID+++KHIR++KN LM +SISELQ+K              IKE+EK  +   Q
Sbjct  125  LQNLEQQIDTALKHIRARKNHLMSQSISELQRKEKAIQVQNNMLVKQIKEKEKNDKALAQ  184

Query  666  PNLEQQEKQDTNSSS---SYVALQPVNSFNLGETYE  764
            P     +    N+SS   S  A  P+   N+G +++
Sbjct  185  PAFWDLQDHGPNASSFLLSQPAGLPLPCLNIGGSHQ  220



>gb|AAP83389.1| FRUITFULL-like MADS-box [Pachysandra terminalis]
Length=234

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 165/238 (69%), Gaps = 21/238 (9%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQL+R+ENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFSTKGKL QY+S+S ME 
Sbjct  1    VQLRRMENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSTKGKLSQYSSNSSMET  60

Query  357  ILARYERCSYVESLPNPTDQ-ESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            IL RYER SY E      D  +SQ +W LEY KLK++IE L++++RH+MGE+LDSLS +E
Sbjct  61   ILDRYERYSYAERKLMAGDHLDSQGSWPLEYTKLKSKIEVLQRNQRHFMGEELDSLSLKE  120

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQ--------------PN  671
            LQ +EHQ+D+S+KHIRS+KNQLM +SI +LQKK    EK + EQ              P 
Sbjct  121  LQYMEHQLDTSLKHIRSRKNQLMNDSIYDLQKK----EKALQEQNSTLIKKLKEKEKAPA  176

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGR-EIEDAQLPP-PNIVMPQWLL  839
             +   +Q   +  S++  QP+ S N+G  Y +A   R E E AQ     N +MP W+L
Sbjct  177  HQACWEQQGQNLPSFLLSQPLPSLNIGXNYXLARXSRDEEEGAQSHARTNPIMPPWML  234



>gb|AGX01548.1| FRUITFULL-like protein, partial [Meconopsis cambrica]
Length=248

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 170/249 (68%), Gaps = 32/249 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY +     T+ + Q NWSLEY+KLK++IE L+K++RH+MGEDL ++S +E
Sbjct  65   RILERYERYSYADRELVTTEID-QGNWSLEYSKLKSKIEILQKNQRHFMGEDLQTMSLKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN-----LEQQEKQ--  692
            LQNLE Q+D ++K IRS+KNQLM ESISELQKK    EK + EQ N     L+++EK+  
Sbjct  124  LQNLEQQLDVALKQIRSRKNQLMYESISELQKK----EKALQEQNNKLGKQLKEKEKEVA  179

Query  693  --------------DTNSSSSYVALQPVNSFNLGE-TYEIAGEGREIEDA-----QLPPP  812
                             SS S++  Q + S N+G  +Y++ G     E+           
Sbjct  180  AQQQQASQWDQQVSQGQSSPSFLLSQSLPSLNIGSGSYQVRGGNNGNEEGIRTQTTRTNT  239

Query  813  NIVMPQWLL  839
              +MP W+L
Sbjct  240  ATLMPPWML  248



>gb|AGW23345.1| MADS box protein MADS43 [Gossypium hirsutum]
Length=231

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 166/235 (71%), Gaps = 22/235 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA V ++VFS+KGKLF+YA++S ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAQVALMVFSSKGKLFEYATESCME  64

Query  354  RILARYERCSYVESLPNPTDQESQ-CNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            RIL RYER S+ E +   TD+  Q  NW+ E+AKLKAR+E L+++ RHY GED+ +LS R
Sbjct  65   RILERYERYSFTE-IQCATDEIQQNGNWTWEHAKLKARMETLQRNLRHYEGEDIQNLSLR  123

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE---------MAEQPNLEQQ  683
            ELQNLE Q+DS++K IRSKKNQLM+ESISE QKK KE +++           E+ N+EQ 
Sbjct  124  ELQNLEQQLDSALKRIRSKKNQLMVESISEFQKKDKELQEQNNILAKKLKEKEKTNVEQA  183

Query  684  EKQ-DTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPH  845
              Q + N   S   L P+N         I+  GRE ED +     +++P W++ H
Sbjct  184  HWQLNNNCQDSSSMLLPLN---------ISSNGREKEDNETTNSGVLLP-WMIRH  228



>emb|CBY05413.1| FRUITFULL-like protein [Aethionema carneum]
Length=228

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 163/237 (69%), Gaps = 27/237 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLD+LS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDTLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+D++IK+IRS+KNQ M ESIS LQ              KKIKEREK+M E   
Sbjct  125  LQSLEHQLDAAIKNIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKMGE---  181

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLP  842
             E+ + Q +NSSS+      +NS   G  + + G+           P +  P  LLP
Sbjct  182  -EEAQVQVSNSSSNLQHQYLLNSSRDG--FIVGGDNG-------GAPLLTEPNSLLP  228



>gb|AAT46099.1| FRUITFULL-like protein [Akebia trifoliata]
Length=242

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 165/240 (69%), Gaps = 18/240 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA EISVLCD +V  IVFS KG+L++++++SRME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAYEISVLCDVEVACIVFSDKGRLYEFSTESRME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYERCS         D +SQ +  LE  +LKAR++ L+K++R +MGEDLDS+S +E
Sbjct  65   RILERYERCSLAAEEIATIDPQSQGSLPLESRRLKARLDVLQKTQRRFMGEDLDSMSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            +QNLE Q+D+S+K IR +KNQLM ESI ELQ              KKIKE+EK + +Q N
Sbjct  125  IQNLEQQLDASLKQIRLRKNQLMYESICELQKKETALQEQNNQLGKKIKEKEKTLTQQVN  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL-PPPNIVMPQWLLPHL  848
             EQ  +    +S +++  Q + S N+G  Y+ A  G E E  Q    P+ V+P W+L H+
Sbjct  185  WEQPNQ--GQNSPAFLQSQTLVSLNIGGPYQ-ARSGEEEERVQSHTQPSTVLPPWMLGHV  241



>gb|ADU15471.1| FUL-like protein [Actinidia chinensis]
Length=247

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 163/240 (68%), Gaps = 20/240 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENK++RQVTFSKRRSGLLKKA+EISVLCDADV +IVFST GKLF+Y++DS ME
Sbjct  5    RVQLKRIENKVSRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTNGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL +Y+R SYVE      D ESQ NWSLE+ KL AR+E L+++ RHY+GEDLD L+ RE
Sbjct  65   RILEKYDRYSYVERQLGAPDTESQPNWSLEHPKLSARVEVLQRNIRHYVGEDLDPLNLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ++E QID++++ IR++KNQLM ESISELQ              KK+KE EK + E   
Sbjct  125  LQHVEQQIDTALRRIRTRKNQLMHESISELQKKQKTLQEQTNILAKKVKENEKTLTEHFQ  184

Query  672  LEQQ---EKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL-PPPNIVMPQWLL  839
             EQ+   +   T           + S  +G  +++   G E + AQ+ P  + +M  W+L
Sbjct  185  REQESLGQNSPTFMLPQPPRPPQLPSLTIGGPFQV--RGAEEDGAQIQPTSSTLMLPWML  242



>gb|AFD36437.1| MADS1 [x Doritaenopsis hybrid cultivar]
Length=245

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 156/241 (65%), Gaps = 14/241 (6%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKIN+QVTFSKRRSGLLKKA+EISVLCDADV +I+FS KGKL +Y++DS ME
Sbjct  5    RVQLKRIENKINQQVTFSKRRSGLLKKAHEISVLCDADVALIIFSNKGKLCEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYE  SY E      +   Q +W LEY K+KA++E L+KS+RH MGE LD LS +E
Sbjct  65   KILERYEHYSYTERALYSNEDNPQADWRLEYNKMKAKVESLQKSQRHLMGEQLDYLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQ+LE Q++SS+KHIRS+K QLM++SISELQKK               K + K + +   
Sbjct  125  LQHLEQQLESSLKHIRSRKTQLMVDSISELQKKEKLLLEQNKTLQDMAKAKAKALVQNAA  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHLT  851
             EQQ K   +S   +  +          T++    G E    QL   N ++P W+L H+ 
Sbjct  185  WEQQNKSQYSSEPPHAVISDSVPTPTSRTFQTRANGEESPQPQLRLGNTLLPPWMLSHVN  244

Query  852  G  854
            G
Sbjct  245  G  245



>gb|AFI08227.1| MADS-box protein [Pisum sativum]
Length=236

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 160/233 (69%), Gaps = 19/233 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y+SD  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSSDPCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      DQ    NW LE+AKLKAR+E L+K++R+YMGE+LD LS +E
Sbjct  65   RILERYERYSYTERQLVANDQSPNENWVLEHAKLKARVEVLQKNQRNYMGEELDGLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-----------EQ  680
            LQ+LE Q+DS++KHIRS+KNQ+M ESISELQKK    +K + E  NL             
Sbjct  125  LQSLEQQLDSALKHIRSRKNQVMYESISELQKK----DKALQEHNNLLAKKIKEKEKELA  180

Query  681  QEKQDTNSSSSYVALQPVNSFNLGET--YEIAGE--GREIEDAQLPPPNIVMP  827
            QE+   +   + +  QP+ S   G +   E   E  G E   + + PP ++ P
Sbjct  181  QEEVQNSMEVALIETQPLESMIAGGSSLQENCNEETGAETRGSAVLPPWMIRP  233



>gb|AIP93871.1| anthocyanin MADS transcription factor [Solanum melongena]
Length=246

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 167/243 (69%), Gaps = 21/243 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYAS-DSRM  350
            +V+LKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDADV +IVFSTKGKLF+YAS DS M
Sbjct  5    RVELKRIENKISRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTKGKLFEYASTDSSM  64

Query  351  ERILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            E IL RYER SY E   N  D + + NWS+E  KL +RIE L+K+  HYMG+DLD LS R
Sbjct  65   ESILERYERYSYAERNMNANDSDPKENWSVECPKLMSRIELLQKNITHYMGQDLDPLSLR  124

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN-----LEQQEKQD  695
            ELQ+LE +ID+S+K IRSKKNQLM ESISELQKK    EK + EQ N     L++ EK  
Sbjct  125  ELQSLEQEIDTSLKRIRSKKNQLMHESISELQKK----EKALQEQNNLITKKLKENEKTR  180

Query  696  TNSS---SSYVALQPVNSF---NLGETYEIAGEGRE--IEDAQLPPPN---IVMPQWLLP  842
             NSS   S+   + P +S    NL       G  R+   +  Q P  N    +MP+W+L 
Sbjct  181  PNSSGQNSATFDVPPSHSHQLPNLTIGVPFVGMNRDGSGQAHQYPGSNNNSSLMPRWMLG  240

Query  843  HLT  851
            H++
Sbjct  241  HVS  243



>dbj|BAG71406.1| transcription factor PnAP1 [Ipomoea nil]
Length=255

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 160/227 (70%), Gaps = 24/227 (11%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KV+LKRIENKINRQVTFSKRR GL+KKA+EISVLCDA+VG+IVFS KGKLF+Y++DS ME
Sbjct  5    KVELKRIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVGLIVFSHKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      + ES  NW+LEYAKLKA++E L+++ +HYMGEDLD+LS ++
Sbjct  65   KILERYERYSYAERRLLANNSESSENWTLEYAKLKAKVELLKRNHKHYMGEDLDTLSLKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREK------E  653
            LQNLE Q+DSS+K IRS++NQL+ ES+SELQ              KKIKE+EK       
Sbjct  125  LQNLEQQLDSSLKLIRSRRNQLLYESLSELQKKERAIREENNMLAKKIKEKEKSAAAAAA  184

Query  654  MAEQPNLEQQEKQDTNSSSSYVALQP-VNSFNLGETY---EIAGEGR  782
               Q   EQQ  Q    SSS++  QP +   N+G +Y   E A E R
Sbjct  185  AQPQAPWEQQNHQVPPGSSSFLFQQPSLPGLNIGGSYQGGEAADEAR  231



>gb|ABS83558.1| APETALA1-like protein [Alpinia oblongifolia]
Length=247

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 171/245 (70%), Gaps = 20/245 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V VI+FS+KGKL++Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVAVIIFSSKGKLYEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYE+  Y E     ++ + Q NW  EY KLKA++E L KS+RH MGE LD+LS +E
Sbjct  65   KILERYEQYCYAEKALISSELDCQENWHHEYGKLKAKMEALSKSQRHLMGEQLDTLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ---KKIKEREKEMAEQ-------PNLEQQ  683
            LQ LE+Q+D+S+KHIRS+KNQ++L+SISELQ   K ++E+ K + +Q         L QQ
Sbjct  125  LQQLENQLDNSLKHIRSRKNQVLLDSISELQVKEKALQEQNKSLEKQILEKQKAKALTQQ  184

Query  684  ---EKQDTNSSSSYVALQPVN-SFNLGETYE----IAGEGREIEDAQLPPPNIVMPQWLL  839
               E+  T+SSS    L   N + N+G  Y+    I GE   +E  Q    N ++P W+L
Sbjct  185  AHWEQAQTSSSSPPFILADANPTLNIG-CYQGRATIEGEVEAVE-GQARINNSMLPPWML  242

Query  840  PHLTG  854
             HL G
Sbjct  243  SHLNG  247



>gb|ACL68407.1| MAP1 [Mangifera indica]
Length=247

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 138/171 (81%), Gaps = 4/171 (2%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDADV  IVFS +GKLF+YA+D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDADVAPIVFSHRGKLFEYATDLSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E        ES  NWSLE+ KLK++IE L++S+RHY+GEDLDSLS R+
Sbjct  65   RILERYERYSYAERQLVDPGPESTGNWSLEFHKLKSKIELLQRSQRHYLGEDLDSLSMRD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNLEQQE  686
            +QNLE Q+D+++KHIRS+KNQLM ESISELQKK    EK + EQ N+  +E
Sbjct  125  IQNLEQQLDTALKHIRSRKNQLMYESISELQKK----EKAIQEQNNMLAKE  171



>gb|AAP83384.1| euAP1 APETALA1-like MADS-box [Phytolacca americana]
Length=239

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 162/218 (74%), Gaps = 18/218 (8%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQL+R+ENKINRQVTFSKRRSGL+KKA+EISVLCDA++ +I+FS +GKLF+Y++DS ME+
Sbjct  1    VQLRRMENKINRQVTFSKRRSGLVKKAHEISVLCDAELALIIFSPRGKLFEYSTDSSMEK  60

Query  357  ILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFREL  536
            IL RYER  Y E      D  ++ NW+ ++AKLKA++E L+++ RHY+G+DLDSL+ ++L
Sbjct  61   ILERYERYFYAERQLASNDPNTEVNWTFDFAKLKAKLELLQRNHRHYLGQDLDSLNIKDL  120

Query  537  QNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPNL  674
            Q+LE Q+D+++KHIR++KNQLM ESISEL               KKIKEREK MAE   +
Sbjct  121  QSLEQQLDNALKHIRTRKNQLMHESISELHKKEKAMQEQNNMLVKKIKEREKAMAEAQGM  180

Query  675  EQQEKQD-TNSSSSYVALQPVNSFNL-GETY--EIAGE  776
            + Q +Q+    +S+++   P+ S+N  G+ Y  +IAGE
Sbjct  181  QWQRQQNEPPEASNFLLPPPLTSWNTAGDAYHGQIAGE  218



>ref|XP_004297215.1| PREDICTED: floral homeotic protein APETALA 1-like [Fragaria vesca 
subsp. vesca]
 gb|AFA42326.1| AP1-like transcription factor [Fragaria x ananassa]
Length=245

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 150/209 (72%), Gaps = 14/209 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISV+CDA V +IVFS KGKLF+YA+DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVMCDAQVALIVFSNKGKLFEYATDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E      D +SQ NW  E+A+LK ++E L+++ RHY+GEDLDSLS +E
Sbjct  65   DILERYERYSYAERQLVEPDFDSQGNWPFEHARLKVKVELLQRNLRHYLGEDLDSLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            +Q+LE Q+++++K IRS+KNQLM ESISELQ              KKIKE EK +AE   
Sbjct  125  IQSLEQQLETALKQIRSRKNQLMHESISELQRKEKAIKEQNNLLSKKIKEHEKNVAEAQE  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGET  758
            +   E+Q  N   + +A  P+   N+G T
Sbjct  185  VHDWEQQQQNHGLNLLAQGPIPCLNMGGT  213



>ref|XP_007037635.1| K-box region and MADS-box transcription factor family protein 
isoform 2, partial [Theobroma cacao]
 ref|XP_007037636.1| K-box region and MADS-box transcription factor family protein 
isoform 2, partial [Theobroma cacao]
 gb|EOY22136.1| K-box region and MADS-box transcription factor family protein 
isoform 2, partial [Theobroma cacao]
 gb|EOY22137.1| K-box region and MADS-box transcription factor family protein 
isoform 2, partial [Theobroma cacao]
Length=219

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS ME
Sbjct  55   RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME  114

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E      + +   +W+LE+AKLKAR+E L++++RH+MGEDLD+LS RE
Sbjct  115  RILERYERYSYAERQLAGNEVDQNGSWTLEHAKLKARMEVLQRNQRHFMGEDLDNLSLRE  174

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK  632
            LQNLE Q+DS++KH+RS+KNQLM ESISELQKK
Sbjct  175  LQNLEQQLDSALKHVRSRKNQLMFESISELQKK  207



>ref|XP_011011648.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Populus euphratica]
Length=248

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 161/233 (69%), Gaps = 20/233 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKANEISVLCDA+V +IVFS KGKLF+Y++D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKANEISVLCDAEVALIVFSHKGKLFEYSTDDCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD +SQ NW+LEY +LKA++E L+++ R+Y+GEDLDS+S +E
Sbjct  65   KILERYERYSYAERQLVTTDLDSQGNWTLEYNRLKAKVELLQRNHRNYLGEDLDSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREK--EMAEQ  665
            LQNLE QID+++KHIR++KN LM +SISELQ+K              IKE+EK  +   Q
Sbjct  125  LQNLEQQIDTALKHIRARKNHLMSQSISELQRKERAIQVQNNMLVKQIKEKEKKDKALAQ  184

Query  666  PNLEQQEKQDTNSSS---SYVALQPVNSFNLGETY-EIAGEGREIEDAQLPPP  812
            P     +    N+SS   S  A  P+   N+G ++ E A E R  E      P
Sbjct  185  PAFWDLQNHGPNASSFLLSQPAGLPLPCLNIGGSHQEEAPEARRNELGHTLEP  237



>emb|CAD12068.2| putative MADS600 protein [Asarum caudigerum]
Length=301

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 162/241 (67%), Gaps = 18/241 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDADV +IVFS KGKL++YA++S ME
Sbjct  61   RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDADVALIVFSAKGKLYEYATNSSME  120

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER S+ E      D ES+  W LEY KLKAR++ L+KS +H MGEDLDSLS +E
Sbjct  121  TILERYERYSFAER-ELVADPESEGGWCLEYGKLKARVDALQKSHKHIMGEDLDSLSIKE  179

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQ+LE Q+D ++KHIRS+KNQ+ML++ISELQ+K              ++E+E  M  Q  
Sbjct  180  LQHLEQQLDVALKHIRSRKNQVMLDTISELQRKEKMLLEQNKALQKTMREKENAMVRQAQ  239

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP--PNIVMPQWLLPH  845
             E Q+ Q   S  S++  +P+ + ++G  Y         +    P    N  +P W+L H
Sbjct  240  WE-QDNQPQASRPSFMLSRPLPTLHIGSNYHQTRNTETEKQGDRPHSRSNSGIPAWMLSH  298

Query  846  L  848
            +
Sbjct  299  M  299



>gb|AAG27459.1|AF305696_1 MADS-box protein EAP2S [Eucalyptus globulus]
Length=205

 Score =   225 bits (573),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 140/167 (84%), Gaps = 4/167 (2%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDADV +IVFSTKGKLF+YA+D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRCGLLKKAHEISVLCDADVALIVFSTKGKLFEYATDCCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY ES     + E+  NW+LE+AKLKAR+E L+K++++ MGE+LDSLS +E
Sbjct  65   RILERYERYSYAESQVLTNNAETNGNWTLEHAKLKARMEILQKNQKNLMGEELDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL  674
            LQNLEHQ+D+++K+IRS+K QLM ESISELQ+K    +K + EQ N+
Sbjct  125  LQNLEHQLDTALKNIRSRKIQLMCESISELQRK----DKALQEQNNM  167



>ref|XP_011008142.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Populus euphratica]
Length=255

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 165/249 (66%), Gaps = 26/249 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDADV +IVFST+GKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDADVALIVFSTRGKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYERCSY+E    P   E Q +WSLE+ KL AR+E L+++ R+Y G++LD LS +E
Sbjct  65   SILERYERCSYLEQQLVPNGSEHQESWSLEHPKLMARVEILQRNLRNYAGQELDPLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQ LE QID+++K IRS+KNQL+ ES++EL+KK              +KE EK + EQ  
Sbjct  125  LQYLEQQIDTALKRIRSRKNQLIHESLNELRKKEKELQEQNNILEEQVKENEKSLIEQAQ  184

Query  672  LEQQEKQDTNSSSSYVAL--------QPVNSFNLGETYEIAG--EGREIEDAQLPPPNIV  821
             EQ+      SS    A+         P      G++++I G   G E  + Q PP    
Sbjct  185  WEQRNLGQNTSSFMPPAVQPPLQPPMPPHPPLTTGDSFQIIGFPNGNENVEVQAPPS--T  242

Query  822  MPQWLLPHL  848
            MP W+L H+
Sbjct  243  MPSWMLRHV  251



>gb|AAZ76263.1| AP1-related protein [Phalaenopsis amabilis]
Length=245

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 156/241 (65%), Gaps = 14/241 (6%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKIN+QVTFSKRRSGLLKKA+EISVLCDADV +I+FS KGKL +Y++DS ME
Sbjct  5    RVQLKRIENKINQQVTFSKRRSGLLKKAHEISVLCDADVALIIFSNKGKLCEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYE  SY E      +   Q +W LEY K+KA++E L+KS+RH MGE LD LS +E
Sbjct  65   KILERYEHYSYTERALYSNEDNPQADWRLEYNKMKAKVESLQKSQRHLMGEQLDYLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            LQ+LE Q++SS+KHIRS+K QLM++SISELQKK               K + K + +   
Sbjct  125  LQHLEQQLESSLKHIRSRKTQLMVDSISELQKKEKLLLEQNKTLQDMAKAKAKALVQNAA  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLLPHLT  851
             EQQ K   +S   +  +          T++    G E    QL   N ++P W+L H+ 
Sbjct  185  WEQQNKSQYSSEPPHAVISDSVPTPTSRTFQTRANGEESPQPQLRLGNSLLPPWMLSHVN  244

Query  852  G  854
            G
Sbjct  245  G  245



>dbj|BAK20016.1| PgMADS protein1 [Panax ginseng]
Length=247

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/243 (53%), Positives = 166/243 (68%), Gaps = 20/243 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDA V +IVFST GKL +Y++DS ME
Sbjct  5    RVQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCDAQVALIVFSTMGKLCEYSTDSSME  64

Query  354  RILARYERCSYVES-LPNPTDQ-ESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
             IL +Y+  SY E  L   TD  E Q +WSLE+ KLKA+IE L+++ RHY GEDLD L+ 
Sbjct  65   TILEKYDGYSYAEKQLSTATDDTEPQNSWSLEFPKLKAKIEILQRNLRHYAGEDLDPLTL  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREK-EMAE  662
            RELQ+LE Q+D+++K IR++KN LM ESIS LQK+              +KE EK  MAE
Sbjct  125  RELQSLEQQLDTALKRIRTRKNHLMQESISNLQKREKALQGQNNELAKMLKENEKTTMAE  184

Query  663  QPNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPP-PNIVMPQWLL  839
            +  LE Q +  T  SS+++      S  +G T+++ G  RE +  Q PP  +  MP W+L
Sbjct  185  REQLEYQNRGQT--SSTFMPPPSFTSLTMGRTFQVVGVIREEDGYQAPPCSSSNMPPWML  242

Query  840  PHL  848
             H+
Sbjct  243  RHV  245



>gb|AAK21258.1|AF335245_1 MADS-box transcription factor FBP29 [Petunia x hybrida]
Length=245

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 164/248 (66%), Gaps = 34/248 (14%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            ++QLKRIENKI+RQVTFSKRRSGLLKKA+EISVLCDADV +IVFSTKGKLF+Y+++S ME
Sbjct  5    RIQLKRIENKISRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTKGKLFEYSTESSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E   N  D + + NW+LEY KL +RIE ++++ RHYMG+DLD LS RE
Sbjct  65   SILERYERYSYAERKLNANDSDPKENWTLEYPKLMSRIELIQRNIRHYMGQDLDPLSLRE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-------------  674
            LQ+LE QID+++K IRS+KNQLM ESISEL KK    E+ + EQ NL             
Sbjct  125  LQSLEQQIDTALKRIRSRKNQLMHESISELHKK----ERALQEQNNLMTKKLKENEKTQS  180

Query  675  EQQEKQDTNSSSSYVALQP------VNSFNLGETYE----IAGEGREIEDAQLPPPNIVM  824
             Q +   + + ++++  QP      V +  +G  +         G +  ++Q+PP     
Sbjct  181  GQTQPISSQNDATFMVPQPPSLSHHVANLTIGGAFGAKTVTNTNGVQASNSQMPP-----  235

Query  825  PQWLLPHL  848
              W++ H+
Sbjct  236  --WMIRHV  241



>emb|CAD47851.1| MADS-box protein FUL-c [Brassica oleracea var. botrytis]
Length=243

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 159/235 (68%), Gaps = 15/235 (6%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V ++VFS+K KLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALVVFSSKDKLFEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE----------MAEQPNLEQQ  683
            LQ+LEHQ+D++IK IRS+KNQ M ESIS LQKK K  +              ++ N  QQ
Sbjct  125  LQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNTLLKKIKEKEKEKNTGQQ  184

Query  684  EKQDTNSSSSYVALQP---VNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
            E Q    S++   LQP   V S   G    + GE      + L  PN ++P W+L
Sbjct  185  EGQLIQCSNNSSVLQPQYCVTSSRDGLVERVGGENGGA--SSLIGPNSLLPAWML  237



>gb|AIU94288.1| APETALA1-like protein [Prunus pseudocerasus]
Length=238

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 140/167 (84%), Gaps = 4/167 (2%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA V ++VFS KGKLF+YA+DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAQVALVVFSNKGKLFEYATDSCMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D ESQCNW+ EY++LKA++E L++++RHY+GEDLDSL+ +E
Sbjct  65   QILDRYERYSYAERQLVEPDFESQCNWTFEYSRLKAKVELLQRNQRHYLGEDLDSLTLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL  674
            +Q+LEHQ+++++K IR +KNQLM ESISELQKK    E+ M EQ NL
Sbjct  125  IQSLEHQLETALKQIRLRKNQLMRESISELQKK----ERAMQEQNNL  167



>gb|ACS74807.2| APETALA1-like protein 2 [Rosa hybrid cultivar]
Length=247

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 151/211 (72%), Gaps = 16/211 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA V +IVFS KGKLF+YA+DSRME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAQVALIVFSNKGKLFEYATDSRME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E      D ESQ NW+ E+A+LK ++E L+++ RHY+GEDLDSLS +E
Sbjct  65   NILERYERYSYAERQLVEPDLESQGNWTFEHARLKVKVELLQRNLRHYLGEDLDSLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            +Q+LE Q+D+S+K IRS+KNQLM ES+SELQ              KK KE+EK +AE   
Sbjct  125  IQSLEQQLDNSLKQIRSRKNQLMHESMSELQRKEKAVQEQNNLLSKKTKEKEKNVAEAQE  184

Query  672  LEQQE--KQDTNSSSSYVALQPVNSFNLGET  758
            +   E  +Q  N   +  A  P+   N+G T
Sbjct  185  VHDWEQQQQQQNHGLNLAAQAPLPCLNMGGT  215



>ref|NP_001275828.1| APETALA1 [Citrus sinensis]
 gb|AAR01227.1| APETALA1 [Citrus sinensis]
 gb|AAR01228.1| APETALA1 [Citrus sinensis]
Length=243

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 149/211 (71%), Gaps = 14/211 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+G LKKA+EISVLCDA+V VI+FS KGKLF+Y++ S ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRAGFLKKAHEISVLCDAEVAVIIFSHKGKLFEYSTGSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER +Y E      D ESQ NW LE   LKA+I+ L+K +RHY+GEDL+SLS ++
Sbjct  65   KILERYERYAYAERQLIAPDPESQRNWPLECNNLKAKIDLLQKDQRHYLGEDLESLSLKD  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKEMAEQPN  671
            +Q LE Q+D+++KHIRS+KNQLM ESISELQKK              IKEREK  A+Q  
Sbjct  125  IQQLEQQLDTALKHIRSRKNQLMQESISELQKKEKSIEEQNNLLVKQIKEREKAAAQQAQ  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
               Q +    ++ S++  QP     LG  Y+
Sbjct  185  WGNQIQNQVPNTLSFLLPQPPPCLRLGGAYQ  215



>gb|AFU81354.1| FRUITFULLa, partial [Medicago monspeliaca]
Length=227

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 163/231 (71%), Gaps = 19/231 (8%)
 Frame = +3

Query  189  RIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILAR  368
            RIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME+IL R
Sbjct  1    RIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCMEKILER  60

Query  369  YERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLE  548
            YER SY E      DQ    NW +E+AKLK R+E ++K++R++MGE+LD LS +ELQ+LE
Sbjct  61   YERYSYAERQHVANDQPQNENWIIEHAKLKTRLEVIQKNQRNFMGEELDVLSMKELQHLE  120

Query  549  HQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPNLEQQE  686
            HQ+DS++K IRS+KNQL+ ESISEL K              KIKE+EK +A+   LEQQ 
Sbjct  121  HQLDSALKQIRSRKNQLLYESISELSKKDKALQEKNKLLTTKIKEKEKALAQ---LEQQ-  176

Query  687  KQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             +DTN +S+ +  Q + + N+G + E   +G   E++     N  +P W++
Sbjct  177  NEDTNLASTVLVPQSLETLNIGGSPEDKDDGGNNEESH-TQGNTNLPSWMI  226



>gb|AFX74875.1| MADS domain transcription factor APL2 [Camellia japonica]
Length=242

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 165/231 (71%), Gaps = 23/231 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVE-SLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFR  530
            +IL RYER SYVE  L N    ++  NWSLE  +L+A+IE L+++ RHY+GEDLDSLS +
Sbjct  65   KILERYERYSYVERQLINAP--QTPGNWSLECTRLRAKIELLQRNHRHYVGEDLDSLSLK  122

Query  531  ELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKE----------------MAE  662
            ELQNLE+Q+D+++KHIR++KNQLM ESISELQKK K  +++                +AE
Sbjct  123  ELQNLENQLDTALKHIRTRKNQLMHESISELQKKEKAIQEQNNMLVKKIKEKEKEKTIAE  182

Query  663  QPNLEQQEKQDTNSSSSYVALQPVNSFNLGETYEI-AGEGREIE-DAQLPP  809
            Q   EQQ      +SSS++  Q +   N+G TY+    EGR  E D  L P
Sbjct  183  QSQWEQQ--YHCPNSSSFLLPQQLPCLNIGGTYQGEEQEGRRNELDLTLEP  231



>gb|AJC01936.1| MADS-box protein [Ficus carica]
Length=249

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 160/221 (72%), Gaps = 28/221 (13%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V VIVFS KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSHKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQES-----QCNWSLEYAKLKARIEFLEKSKRHYMGEDLDS  518
            +IL RYER SY E      D ES     Q NW++EY++L A+IE L++++R ++GEDLDS
Sbjct  65   KILERYERYSYAERQLITMDSESHFQIMQGNWTVEYSRLTAKIELLQRNRRQFLGEDLDS  124

Query  519  LSFRELQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL--------  674
            LS +++QNLEHQ+D+++K+IRS+KNQLM E+ISELQKK    EK M EQ +L        
Sbjct  125  LSQKDIQNLEHQLDTALKNIRSRKNQLMNETISELQKK----EKAMREQNSLLEKKIKEK  180

Query  675  ---------EQQEKQDTN--SSSSYVALQPVNSFNLGETYE  764
                      Q E Q  +  S+SS++  QP+   N+G TYE
Sbjct  181  EKSMAVEHQMQWEAQQNHGASTSSFLLPQPLPCLNIGGTYE  221



>gb|AAD01422.1| NAP1-2 [Nicotiana tabacum]
Length=242

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 155/213 (73%), Gaps = 19/213 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQL+RIENKINRQVTFSKRR GL+KKA+EISVLCDA+V +IVFS KGK+F+Y+SDS ME
Sbjct  5    KVQLRRIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVALIVFSHKGKIFEYSSDSCME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER SY E   L + ++   Q NWSLEYAKLKA+I+ L+++ +HYMGEDLDSL+ 
Sbjct  65   QILERYERYSYTERRLLASNSESSVQENWSLEYAKLKAKIDLLQRNHKHYMGEDLDSLNL  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQ  665
            ++LQNLE Q+D+S+K IRS+KNQLM ESIS LQ              KKIKE++  + +Q
Sbjct  125  KDLQNLEQQLDTSLKLIRSRKNQLMHESISMLQKKEKAIQEENNMLSKKIKEKDNTVGQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
                QQ +  T++S     LQP    N+G  Y+
Sbjct  185  VEWHQQNQVPTSTS---FLLQPHPCLNIGGNYQ  214



>gb|AAF13261.1|AF198175_1 MADS box protein DOMADS2 [Dendrobium grex Madame Thong-In]
Length=247

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 161/247 (65%), Gaps = 25/247 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSTDSSME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      +   Q +W LEY KLKAR+E L+KS+RH MGE LDSLS +E
Sbjct  65   KILERYERYSYAERALFSNEANPQADWRLEYNKLKARVESLQKSQRHLMGEQLDSLSIKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQK--KI--------------KEREKEMAEQ  665
            LQ LE Q++SS+K IRS+K QL+L SISELQK  KI              KE+ K + + 
Sbjct  125  LQRLEQQLESSLKFIRSRKTQLILHSISELQKMEKILLEQNKTLEKEIIAKEKAKALVQH  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNL----GETYEIAGEGREIEDAQLPPPNIVMPQW  833
               E+Q     N S    AL PV S ++      T++      E    QL   N ++P W
Sbjct  185  APWEKQ-----NQSQYSSALPPVISDSVPTPTSRTFQARANEEESPQPQLRVSNTLLPPW  239

Query  834  LLPHLTG  854
            +L H+ G
Sbjct  240  MLSHMNG  246



>ref|XP_008243811.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Prunus mume]
Length=238

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 140/167 (84%), Gaps = 4/167 (2%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA V ++VFS KGKLF+YA+DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAQVALVVFSNKGKLFEYATDSCMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E      D ESQCNW+ EY++LKA++E L++++RHY+GEDLDSL+ +E
Sbjct  65   QILDRYERYSYAERQLVEPDFESQCNWTFEYSRLKAKVELLQRNQRHYLGEDLDSLTLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL  674
            +Q+LEHQ+++++K IR +KNQLM ESISELQ+K    E+ M EQ NL
Sbjct  125  IQSLEHQLETALKQIRLRKNQLMHESISELQRK----ERAMQEQNNL  167



>gb|AFU81353.1| FRUITFULLa, partial [Medicago noeana]
Length=215

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 158/218 (72%), Gaps = 18/218 (8%)
 Frame = +3

Query  189  RIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILAR  368
            RIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME+IL R
Sbjct  1    RIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCMEKILER  60

Query  369  YERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLE  548
            YER SY E      DQ    NW +E+AKLK R+E ++K++R++MGE+LDSLS +ELQ+LE
Sbjct  61   YERYSYTERQHVANDQPQNENWIIEHAKLKTRLEVIQKNQRNFMGEELDSLSMKELQHLE  120

Query  549  HQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPNLEQQE  686
            HQ+D+++K IRS+KNQLM ESISEL K              KIKE+EK MA+   L+QQ 
Sbjct  121  HQLDTALKQIRSRKNQLMYESISELSKKDKALQEKNKLLTIKIKEKEKAMAQ---LDQQ-  176

Query  687  KQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQ  800
             +D N  S+ +A Q + + N+G + E   +G   E++Q
Sbjct  177  NEDMNIVSTVLAPQSLETLNIGSSPEDRDDGGNNEESQ  214



>emb|CDY02185.1| BnaA03g39820D [Brassica napus]
Length=241

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 159/237 (67%), Gaps = 21/237 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +++FS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALVIFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+ ++IK IRS+KNQ M ESIS LQ              KKIKEREK      N
Sbjct  125  LQSLEHQLHAAIKSIRSRKNQAMFESISALQKKDKALQDHNNALLKKIKEREK------N  178

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLG-ETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
              QQE Q    S++   LQP        + +     G +   + L  PN ++P W+L
Sbjct  179  TVQQEGQLIQCSNNSSILQPQYCLTSSRDGFVGRVGGDDGGASSLAEPNSLLPAWML  235



>gb|AFU81349.1| FRUITFULLa, partial [Medicago littoralis]
Length=227

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 164/231 (71%), Gaps = 19/231 (8%)
 Frame = +3

Query  189  RIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILAR  368
            RIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFS KGKL++Y+SD  ME+IL R
Sbjct  1    RIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSSDPCMEKILER  60

Query  369  YERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLE  548
            YER SY E      DQ    NW +E+A+LK R+E ++K++R++MGE+LDSLS +ELQ+LE
Sbjct  61   YERYSYAERQHVVNDQPQNENWIIEHARLKTRLEVIQKNQRNFMGEELDSLSMKELQHLE  120

Query  549  HQIDSSIKHIRSKKNQLMLESISELQK--------------KIKEREKEMAEQPNLEQQE  686
            HQ+DS++K IRS+KNQLM ESISEL K              KIKE+EK +A+   LEQQ 
Sbjct  121  HQLDSALKQIRSRKNQLMYESISELSKKDKALQEKNKLLTTKIKEKEKALAQ---LEQQ-  176

Query  687  KQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             +D N +S+ +  Q + + N+G + E   +G   E++Q    +  +P W+L
Sbjct  177  NEDMNLASTVLVPQSLETLNIGSSPEDRDDGGNNEESQ-THGSTHLPPWML  226



>gb|AAD39035.1|AF068724_1 MADS-box protein MADS5 [Nicotiana tabacum]
 gb|AFY06684.1| apetala 1 protein [Nicotiana tabacum]
Length=242

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 155/213 (73%), Gaps = 19/213 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQL+RIENKINRQVTFSKRR GL KKA+EISVLCDA+V +IVFS KGK+F+Y+SDS ME
Sbjct  5    KVQLRRIENKINRQVTFSKRRGGLAKKAHEISVLCDAEVALIVFSHKGKIFEYSSDSCME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER SY E   L + ++   Q NWSLEYAKLKA+I+ L+++ +HYMGEDLDSL+ 
Sbjct  65   QILERYERYSYAERRLLSSNSESSVQENWSLEYAKLKAKIDLLQRNHKHYMGEDLDSLNL  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQ  665
            ++LQNLE Q+D+S+K IRS+KNQLM ESIS LQ              KKIKE++K + +Q
Sbjct  125  KDLQNLEQQLDTSLKLIRSRKNQLMHESISMLQKKEKAIQEENNMLSKKIKEKDKTVGKQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
                QQ  Q  NS+S    LQP    N+G  Y+
Sbjct  185  AEWHQQN-QVPNSAS--FLLQPHPCLNIGGNYQ  214



>ref|XP_009778843.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Nicotiana sylvestris]
Length=242

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 154/213 (72%), Gaps = 19/213 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KVQL+RIENKINRQVTFSKRR GL+KKA EISVLCDA+V +IVFS KGK+F+Y+SDS ME
Sbjct  5    KVQLRRIENKINRQVTFSKRRGGLVKKALEISVLCDAEVALIVFSHKGKIFEYSSDSCME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER SY E   L + ++   Q NWSLEYAKLKA+I+ L+++ +HYMGEDLDSLS 
Sbjct  65   QILERYERYSYTERRLLASNSESSVQENWSLEYAKLKAKIDLLQRNHKHYMGEDLDSLSL  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQ  665
            ++LQNLE Q+D+S+K IRS+KNQLM ESIS LQ              KKIKE++  + +Q
Sbjct  125  KDLQNLEQQLDTSLKLIRSRKNQLMHESISMLQKKEKAIQEENNMLSKKIKEKDNTVGQQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNLGETYE  764
                QQ +  T++S     LQP    N+G  Y+
Sbjct  185  VEWHQQNQVPTSTS---FLLQPHPCLNIGGNYQ  214



>sp|Q41274.1|AGL8_SINAL RecName: Full=Agamous-like MADS-box protein AGL8 homolog; Short=MADS 
B [Sinapis alba]
 gb|AAB41525.1| transcription factor SaMADS B [Sinapis alba]
Length=241

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 162/239 (68%), Gaps = 25/239 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +++FS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALVIFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RY+R  Y +      D     NW LE+AKLKAR+E LEK+KR++MGEDLDSLS +E
Sbjct  65   KILERYDRYLYSDKQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+ ++IK IRS+KNQ M ESIS LQ              KKIKEREK    Q  
Sbjct  125  LQSLEHQLHAAIKSIRSRKNQAMFESISALQKKDKVLQDHNNALLKKIKEREKNTVHQ--  182

Query  672  LEQQEKQDTNSSSSYVALQP---VNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             E Q  Q +N+SS    LQP   + S   G    + GE      + L  PN ++P W+L
Sbjct  183  -EVQLIQCSNNSS---ILQPQYCLTSSRDGFVGRVEGENEGA--SSLAEPNSLLPAWML  235



>gb|AGX01557.1| FRUITFULL-like protein, partial [Eranthis hyemalis]
Length=232

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 160/234 (68%), Gaps = 17/234 (7%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS  +
Sbjct  4    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGTD  63

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
             IL RYER SY E     TD +SQ +WSLEY KLK++IE L+K++RH+MGEDL  +S +E
Sbjct  64   NILERYERYSYAERELTRTDSDSQGDWSLEYTKLKSKIEILQKNQRHFMGEDLGYMSIKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN------------LE  677
            LQ++E Q+DS++K IR++K+Q+M ESIS+LQK    REK + EQ N              
Sbjct  124  LQSIEQQLDSALKQIRARKSQVMYESISDLQK----REKVLQEQNNQLGKKLKEKEKEES  179

Query  678  QQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             ++ Q  N +        ++   +G  Y+  G G E    Q P P  +MP W+L
Sbjct  180  TRQTQWNNQNPPPPLPNNLHFIGIGGNYQARGTGDEGPRPQ-PRPITLMPPWML  232



>gb|AGX01550.1| FRUITFULL-like protein, partial [Papaver bracteatum]
Length=244

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 138/166 (83%), Gaps = 5/166 (3%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMD  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RYER SY E     T +  Q NWSLEY+KLK++IE L+K++RH+MGEDL S+S +E
Sbjct  65   RILERYERYSYAER-ELVTTEIDQGNWSLEYSKLKSKIEILQKNQRHFMGEDLQSMSLKE  123

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN  671
            LQNLE Q+D ++K IRS+KNQLM ESISELQKK    EK + EQ N
Sbjct  124  LQNLEQQLDVALKQIRSRKNQLMYESISELQKK----EKALQEQNN  165



>gb|AGX01539.1| FRUITFULL-like protein, partial [Dactylicapnos scandens]
Length=239

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 160/243 (66%), Gaps = 26/243 (11%)
 Frame = +3

Query  177  VQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMER  356
            VQL+RIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +IVFSTKGKLF+Y++DS M+R
Sbjct  1    VQLRRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSGMDR  60

Query  357  ILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFREL  536
            IL RYER SY E     +D + Q NWSLEY KLKA+IE L+K++RH+ GEDL+++S +EL
Sbjct  61   ILERYERYSYAERELVTSDLDPQGNWSLEYTKLKAKIEILQKNQRHFXGEDLETMSLKEL  120

Query  537  QNLEHQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPN---------------  671
            Q LE Q+++++K IRS+KNQLM ESISELQ+K    EK + EQ N               
Sbjct  121  QTLEQQLBTALKQIRSRKNQLMYESISELQRK----EKALQEQNNQLGKKXXEKEKEAAQ  176

Query  672  ---LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQL----PPPNIVMPQ  830
                E   +    +S S++  Q + S N+G  Y          + +        N +MP 
Sbjct  177  KVQWENXNQNQGQNSPSFLLSQSLPSLNIGGNYPTRNNTGGGGEEEGNRTQTRTNSLMPP  236

Query  831  WLL  839
            W+L
Sbjct  237  WML  239



>ref|XP_008445435.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like 
[Cucumis melo]
Length=223

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 152/211 (72%), Gaps = 18/211 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKR++GLLKKA+EISVLCDA+V +IVFS KGKLF+Y+SDS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRKAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSSDSSME  64

Query  354  RILARYERCSYVESLPNPTDQE--SQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
            +IL RYER S+V    N   +   S  NW+LEY +LK+++E L+++  HY+GEDLDSLS 
Sbjct  65   KILERYERYSFVGRQQNAASESHFSHENWTLEYYRLKSKVELLQRNNSHYVGEDLDSLSV  124

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKE--MA  659
            +ELQNLE QID+++KH+RS+KNQLM ESI++LQKK              IKE+EK   +A
Sbjct  125  KELQNLEQQIDTALKHVRSRKNQLMFESITDLQKKVRTIEENNAQLAKEIKEKEKSVALA  184

Query  660  EQPNLEQQEKQDTNSSSSYVALQPVNSFNLG  752
            +Q   E Q+    ++ S      P  S N+G
Sbjct  185  QQAEWEHQQHHGYSALSFLFPPPPHPSLNIG  215



>emb|CDY58690.1| BnaC07g49790D [Brassica napus]
Length=241

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 159/237 (67%), Gaps = 21/237 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRRSGLLKKA+EISVLCDA+V +++FS+KGKLF+Y++DS ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALVIFSSKGKLFEYSTDSCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            RIL RY+R  Y +      +     NW LE+AKLKARIE LEK+KR++MGEDLDSLS +E
Sbjct  65   RILERYDRYLYSDKQLVGREISQSENWVLEHAKLKARIEVLEKNKRNFMGEDLDSLSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQ--------------KKIKEREKEMAEQPN  671
            LQ+LEHQ+ ++IK IRS+KNQ M ESIS LQ              KKIKEREK   +Q  
Sbjct  125  LQSLEHQLHAAIKSIRSRKNQAMFESISALQKKDKALQDHNNALLKKIKEREKNTVQQGG  184

Query  672  LEQQEKQDTNSSSSYVALQPVNSFNLGETYEIAGEGREIEDA-QLPPPNIVMPQWLL  839
               Q  Q +NSSS    LQP           +   G E   A  L  PN ++P W+L
Sbjct  185  ---QLIQCSNSSS---ILQPQYCLTSSRDGFVGRVGEENGVASSLAEPNSLLPAWML  235



>gb|AFU81368.1| FRUITFULLb, partial [Medicago ruthenica]
Length=228

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 155/228 (68%), Gaps = 16/228 (7%)
 Frame = +3

Query  189  RIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRMERILAR  368
            RIENKINRQVTFSKRRSGLLKKA EISVLCDA+V +I+FSTKGKLF+Y+SD  MERIL R
Sbjct  1    RIENKINRQVTFSKRRSGLLKKAQEISVLCDAEVALIIFSTKGKLFEYSSDPCMERILER  60

Query  369  YERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRELQNLE  548
            YERCSY+E     +DQ    NW LE+AKLKAR+E LE+++R++MGEDLD LS +ELQ+LE
Sbjct  61   YERCSYMERQLVTSDQSPNENWVLEHAKLKARMEVLERNQRNFMGEDLDGLSLKELQSLE  120

Query  549  HQIDSSIKHIRSKKNQLMLESISELQKKIKEREKEMAEQPNL-----------EQQEKQD  695
             Q+DSS+K IRS+KNQ+M ESISELQKK    +K + E  NL             QE+  
Sbjct  121  QQLDSSLKQIRSRKNQVMYESISELQKK----DKALQEHNNLLAKKIKEKEKELAQEEVQ  176

Query  696  TNSSSSYVALQPVNSFNLGETYEIAGEGREIEDAQLPPPNIVMPQWLL  839
             +   + +  QP+ S N   +  +     E E A       ++P W++
Sbjct  177  NSVEVTPIETQPLESMNATGSGSLQANCNE-ETAAQTRGGAILPSWMI  223



>dbj|BAK20019.1| PgMADS protein4 [Panax ginseng]
Length=243

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 156/229 (68%), Gaps = 18/229 (8%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            KV+LKRIENKINRQVTFSKRR GL+KKA+EISVLCDA+V +IVFS KGKLF+Y++DS ME
Sbjct  5    KVELKRIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVALIVFSAKGKLFEYSTDSSME  64

Query  354  RILARYERCSYVES--LPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSF  527
             IL RYER SY E   +PN  D  S  NW+ EY KLKARIE L+++ +HYMGEDLDSL+ 
Sbjct  65   NILERYERYSYAERQLVPN-YDTASPGNWTFEYTKLKARIELLQRNHQHYMGEDLDSLTL  123

Query  528  RELQNLEHQIDSSIKHIRSKKNQLMLESISELQKK---IKEREKEM-----------AEQ  665
            +E+QNLE Q+D+++KHIRS+KNQLM ESISELQKK   I+E+   +           A+Q
Sbjct  124  KEIQNLEQQLDTALKHIRSRKNQLMHESISELQKKEKAIQEQNSMLTKKIKEKEKTKAQQ  183

Query  666  PNLEQQEKQDTNSSSSYVALQPVNSFNL-GETYEIAGEGREIEDAQLPP  809
               E Q        S  +  Q +   N+ G TY+  G  R   D  L P
Sbjct  184  AQWEHQNPAGPYMPSFLLPDQTLPCLNIGGTTYQGEGIRRNELDLTLEP  232



>gb|AAY82244.1| SAP1 [Salix discolor]
Length=250

 Score =   224 bits (571),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 155/217 (71%), Gaps = 20/217 (9%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSTDDCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD +S  NW+LEY +LKA++E L+++ R+Y+GEDLDS+S +E
Sbjct  65   KILERYERYSYEERQLAATDFDSPGNWTLEYNRLKAKVELLQRNHRNYLGEDLDSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREK--EMAEQ  665
            LQNLE QID+++KHIR++KN LM +SISELQ+K              IKE+EK  +   Q
Sbjct  125  LQNLEQQIDTALKHIRARKNHLMSQSISELQRKEKAIQVQNNMLVKQIKEKEKKDKAVAQ  184

Query  666  PNLEQQEKQDTNSSSSYVALQPVN----SFNLGETYE  764
            P L   ++     +SS++  QP        N+G  Y+
Sbjct  185  PALWDDQQNQGPHASSFLLSQPAGLPLPCLNIGGCYQ  221



>gb|AAY82245.1| SAP1 [Salix discolor]
Length=250

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 157/218 (72%), Gaps = 21/218 (10%)
 Frame = +3

Query  174  KVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDADVGVIVFSTKGKLFQYASDSRME  353
            +VQLKRIENKINRQVTFSKRR+GLLKKA+EISVLCDA+V +IVFS KGKLF+Y++D  ME
Sbjct  5    RVQLKRIENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSTDDCME  64

Query  354  RILARYERCSYVESLPNPTDQESQCNWSLEYAKLKARIEFLEKSKRHYMGEDLDSLSFRE  533
            +IL RYER SY E     TD +SQ NW+LEY +LKA++E L+++ R+Y+GEDLDS+S +E
Sbjct  65   KILERYERYSYEERQLATTDFDSQGNWTLEYNRLKAKVELLQRNHRNYLGEDLDSMSLKE  124

Query  534  LQNLEHQIDSSIKHIRSKKNQLMLESISELQKK--------------IKEREKE----MA  659
            LQNLE QID+++KHIR++KN LM +SISELQ+K              IKE+EK+      
Sbjct  125  LQNLEQQIDTALKHIRARKNHLMSQSISELQRKEKAIQVQNNMLVKQIKEKEKKDKAVAQ  184

Query  660  EQPNLEQQEKQDTNSSS---SYVALQPVNSFNLGETYE  764
              P  + Q+ Q  ++SS   S  A  P+   N+G  Y+
Sbjct  185  PAPIWDDQQNQGPHASSFLLSQPAGLPLPCLNIGGCYQ  222



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3001124733500