BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16361_g3_i1 len=160 path=[2534:0-159]

Length=160
                                                                      Score     E

ref|XP_007015082.1|  Myosin-related isoform 1                           118   6e-29   
ref|XP_009794389.1|  PREDICTED: 40S ribosomal protein S2-3              109   1e-28   
emb|CDY48767.1|  BnaC04g02200D                                          117   1e-28   
ref|XP_006369861.1|  hypothetical protein POPTR_0001s342602g            110   1e-28   
gb|ACR37380.1|  unknown                                                 107   5e-28   Zea mays [maize]
emb|CDP18531.1|  unnamed protein product                                110   7e-28   
ref|XP_011033322.1|  PREDICTED: 40S ribosomal protein S2-3              108   8e-28   
ref|XP_011069984.1|  PREDICTED: 40S ribosomal protein S2-4-like         110   9e-28   
ref|XP_002963234.1|  hypothetical protein SELMODRAFT_67484              110   9e-28   
gb|EYU20868.1|  hypothetical protein MIMGU_mgv1a011569mg                110   1e-27   
gb|KHG06565.1|  40S ribosomal S2-2 -like protein                        110   1e-27   
ref|XP_010554839.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    110   1e-27   
ref|XP_009386449.1|  PREDICTED: 40S ribosomal protein S2-2-like         110   1e-27   
ref|XP_008784865.1|  PREDICTED: 40S ribosomal protein S2-3-like         110   1e-27   
gb|KHG13084.1|  40S ribosomal S2-2 -like protein                        110   1e-27   
ref|XP_010906118.1|  PREDICTED: 40S ribosomal protein S2-2-like         110   1e-27   
gb|ABB03723.1|  putative ribosomal protein                              108   1e-27   Sorghum bicolor [broomcorn]
ref|XP_002974537.1|  hypothetical protein SELMODRAFT_149893             110   1e-27   
ref|XP_008460763.1|  PREDICTED: 40S ribosomal protein S2-4-like         110   1e-27   
ref|XP_009777712.1|  PREDICTED: 40S ribosomal protein S2-3-like         110   1e-27   
ref|XP_010666758.1|  PREDICTED: 40S ribosomal protein S2-2              110   1e-27   
ref|XP_009407563.1|  PREDICTED: 40S ribosomal protein S2-2-like         110   1e-27   
gb|KHG28265.1|  40S ribosomal S2-2 -like protein                        109   1e-27   
gb|KDP22105.1|  hypothetical protein JCGZ_25936                         109   1e-27   
ref|XP_009403825.1|  PREDICTED: 40S ribosomal protein S2-4-like         110   1e-27   
ref|XP_009389539.1|  PREDICTED: 40S ribosomal protein S2-4-like         110   1e-27   
ref|XP_002283793.1|  PREDICTED: 40S ribosomal protein S2-3              110   1e-27   Vitis vinifera
ref|XP_004162177.1|  PREDICTED: 40S ribosomal protein S2-4-like         109   1e-27   
ref|XP_009630221.1|  PREDICTED: 40S ribosomal protein S2-3-like         110   1e-27   
ref|XP_010057233.1|  PREDICTED: 40S ribosomal protein S2-4              109   1e-27   
ref|XP_007015080.1|  Ribosomal protein S5 family protein                109   1e-27   
ref|XP_007015077.1|  Ribosomal protein S5 family protein isoform 1      109   1e-27   
ref|XP_010257189.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   1e-27   
ref|XP_008801692.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   1e-27   
gb|AFW90641.1|  40S ribosomal protein S2                                109   2e-27   
ref|XP_010937193.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
ref|XP_002513481.1|  40S ribosomal protein S2, putative                 109   2e-27   Ricinus communis
ref|XP_010241237.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
ref|XP_004168599.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
ref|XP_008443195.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
ref|XP_011079131.1|  PREDICTED: 40S ribosomal protein S2-4-like         109   2e-27   
ref|XP_002513493.1|  40S ribosomal protein S2, putative                 109   2e-27   Ricinus communis
emb|CDY06903.1|  BnaA04g24120D                                          109   2e-27   
ref|XP_004237924.1|  PREDICTED: 40S ribosomal protein S2-4-like         109   2e-27   
ref|XP_010923421.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
ref|XP_009602513.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
ref|XP_006356337.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
ref|XP_004136761.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
gb|EYU35640.1|  hypothetical protein MIMGU_mgv1a011526mg                109   2e-27   
ref|XP_006838579.1|  hypothetical protein AMTR_s00002p00212950          109   2e-27   
ref|XP_009602518.1|  PREDICTED: 40S ribosomal protein S2-3-like i...    109   2e-27   
ref|XP_004237705.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
gb|EYU20867.1|  hypothetical protein MIMGU_mgv1a011569mg                109   2e-27   
ref|XP_009785188.1|  PREDICTED: 40S ribosomal protein S2-3-like         109   2e-27   
ref|XP_006664900.1|  PREDICTED: 40S ribosomal protein S2-4-like         109   2e-27   
ref|XP_010094236.1|  40S ribosomal protein S2-4                         109   2e-27   
ref|XP_008231963.1|  PREDICTED: 40S ribosomal protein S2-4-like         108   4e-27   
emb|CDY22542.1|  BnaC03g23520D                                          108   4e-27   
ref|XP_006302652.1|  hypothetical protein CARUB_v10020756mg             108   4e-27   
ref|XP_006303259.1|  hypothetical protein CARUB_v10009962mg             108   4e-27   
emb|CDY45881.1|  BnaC01g28170D                                          108   4e-27   
emb|CDX79908.1|  BnaA05g02480D                                          108   4e-27   
ref|XP_002881803.1|  40S ribosomal protein S2                           108   4e-27   
ref|NP_001059158.1|  Os07g0207400                                       106   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009102893.1|  PREDICTED: 40S ribosomal protein S2-2              108   4e-27   
ref|XP_009142017.1|  PREDICTED: 40S ribosomal protein S2-2-like i...    108   5e-27   
gb|KFK40885.1|  hypothetical protein AALP_AA2G055200                    108   5e-27   
ref|XP_010057240.1|  PREDICTED: 40S ribosomal protein S2-4-like         108   5e-27   
ref|XP_007211807.1|  hypothetical protein PRUPE_ppa009890mg             108   5e-27   
ref|XP_002886684.1|  hypothetical protein ARALYDRAFT_475376             108   5e-27   
emb|CDY35397.1|  BnaA03g19630D                                          108   5e-27   
ref|XP_009133513.1|  PREDICTED: 40S ribosomal protein S2-2-like         108   5e-27   
ref|XP_006392282.1|  hypothetical protein EUTSA_v10023633mg             108   5e-27   
ref|XP_010536089.1|  PREDICTED: 40S ribosomal protein S2-3-like         108   5e-27   
ref|XP_002322713.1|  40S ribosomal protein S2                           108   5e-27   Populus trichocarpa [western balsam poplar]
ref|XP_002308954.1|  40S ribosomal protein S2                           108   5e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010508673.1|  PREDICTED: 40S ribosomal protein S2-3              108   5e-27   
ref|XP_010555023.1|  PREDICTED: 40S ribosomal protein S2-4-like         108   5e-27   
ref|XP_011020354.1|  PREDICTED: 40S ribosomal protein S2-3-like         108   6e-27   
ref|XP_010519760.1|  PREDICTED: 40S ribosomal protein S2-3-like         108   6e-27   
ref|XP_006411454.1|  hypothetical protein EUTSA_v10017049mg             108   6e-27   
gb|KFK37024.1|  hypothetical protein AALP_AA4G202400                    108   6e-27   
ref|XP_006294755.1|  hypothetical protein CARUB_v10023800mg             108   6e-27   
ref|XP_010505968.1|  PREDICTED: 40S ribosomal protein S2-3-like         108   6e-27   
ref|XP_010517670.1|  PREDICTED: 40S ribosomal protein S2-3-like         108   6e-27   
gb|EMT24273.1|  40S ribosomal protein S2-3                              107   6e-27   
gb|AAF82250.1|AC008051_1  Identical to gene XW6 from Arabidopsis ...    107   7e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82895.1|  BnaC01g13450D                                          105   7e-27   
ref|XP_006417498.1|  hypothetical protein EUTSA_v10008441mg             108   7e-27   
ref|XP_006402872.1|  hypothetical protein EUTSA_v10006149mg             107   8e-27   
gb|KEH40624.1|  40S ribosomal protein S2-4                              107   8e-27   
ref|XP_007160431.1|  hypothetical protein PHAVU_002G321400g             107   8e-27   
gb|KEH21389.1|  40S ribosomal protein S2-4                              107   8e-27   
ref|XP_006421416.1|  hypothetical protein CICLE_v10005613mg             107   9e-27   
ref|XP_009142781.1|  PREDICTED: 40S ribosomal protein S2-3-like         107   9e-27   
gb|KFK34998.1|  hypothetical protein AALP_AA5G220900                    107   9e-27   
ref|XP_003525227.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   9e-27   
ref|XP_008231962.1|  PREDICTED: 40S ribosomal protein S2-like           108   9e-27   
ref|NP_564737.1|  40S ribosomal protein S2-2                            107   9e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001784315.1|  predicted protein                                  107   9e-27   
ref|XP_001780194.1|  predicted protein                                  107   1e-26   
ref|XP_006650764.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
ref|XP_001753770.1|  predicted protein                                  107   1e-26   
gb|KDO53682.1|  hypothetical protein CISIN_1g024105mg                   107   1e-26   
gb|AAM53281.1|  ribosomal protein S2, putative                          107   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291534.1|  hypothetical protein CARUB_v10017690mg             108   1e-26   
ref|XP_007153237.1|  hypothetical protein PHAVU_003G018300g             107   1e-26   
dbj|BAA88264.1|  RF12                                                   107   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150344.1|  LOC100283974                                       107   1e-26   Zea mays [maize]
gb|AEM36341.1|  At1g58380                                               107   1e-26   
gb|AAM67061.1|  ribosomal protein S2, putative                          107   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981345.1|  PREDICTED: 40S ribosomal protein S2-3-like         107   1e-26   
gb|AFK38691.1|  unknown                                                 107   1e-26   
ref|XP_003538262.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
ref|NP_176134.1|  40S ribosomal protein S2-1                            107   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011048036.1|  PREDICTED: 40S ribosomal protein S2-3              107   1e-26   
ref|XP_002459531.1|  hypothetical protein SORBIDRAFT_02g006200          107   1e-26   Sorghum bicolor [broomcorn]
ref|XP_002298397.2|  hypothetical protein POPTR_0001s26400g             108   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_004498248.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
gb|EEE60147.1|  hypothetical protein OsJ_13042                          107   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001784592.1|  predicted protein                                  107   1e-26   
ref|XP_003630949.1|  40S ribosomal protein S2                           107   1e-26   
ref|XP_008644418.1|  PREDICTED: 40S ribosomal protein S2-3-like         107   1e-26   
pdb|3J60|C  Chain C, Localization Of The Small Subunit Ribosomal ...    107   1e-26   
ref|XP_006574815.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
ref|XP_004302961.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
ref|XP_002466244.1|  hypothetical protein SORBIDRAFT_01g004250          107   1e-26   Sorghum bicolor [broomcorn]
ref|XP_004503350.1|  PREDICTED: 40S ribosomal protein S2-3-like         107   1e-26   
ref|NP_001169209.1|  uncharacterized protein LOC100383062               107   1e-26   Zea mays [maize]
ref|XP_002466245.1|  hypothetical protein SORBIDRAFT_01g004260          107   1e-26   Sorghum bicolor [broomcorn]
ref|XP_010427628.1|  PREDICTED: 40S ribosomal protein S2-4              107   1e-26   
ref|XP_003538244.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
ref|XP_010504675.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
ref|XP_009369694.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
ref|NP_181715.1|  40S ribosomal protein S2-3                            107   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955795.1|  PREDICTED: 40S ribosomal protein S2-3-like         107   1e-26   
ref|NP_001051645.1|  Os03g0807800                                       107   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAM62944.1|  40S ribosomal protein S2                                107   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009366094.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
ref|XP_003564096.1|  PREDICTED: 40S ribosomal protein S2-3-like         107   1e-26   
ref|XP_008361610.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   1e-26   
emb|CAC27136.1|  40S ribosomal protein S2                               106   1e-26   Picea abies
ref|NP_191308.1|  40S ribosomal protein S2-4                            107   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878157.1|  40S ribosomal protein S2                           107   1e-26   
gb|ACN37050.1|  unknown                                                 105   2e-26   Zea mays [maize]
dbj|BAK05186.1|  predicted protein                                      106   2e-26   
gb|ABK21813.1|  unknown                                                 106   2e-26   Picea sitchensis
gb|ABK25823.1|  unknown                                                 107   2e-26   Picea sitchensis
gb|ABK23357.1|  unknown                                                 105   2e-26   Picea sitchensis
ref|XP_010412819.1|  PREDICTED: 40S ribosomal protein S2-4-like         107   2e-26   
gb|EMT00343.1|  40S ribosomal protein S2-3                              105   2e-26   
ref|XP_003557397.1|  PREDICTED: 40S ribosomal protein S2-4-like         106   2e-26   
ref|XP_004149390.1|  PREDICTED: 40S ribosomal protein S2-4-like         106   3e-26   
ref|XP_008385732.1|  PREDICTED: 40S ribosomal protein S2-4-like         106   3e-26   
dbj|BAC83243.1|  putative 40S ribosomal protein S2                      105   4e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CDM84780.1|  unnamed protein product                                105   6e-26   
dbj|BAJ89869.1|  predicted protein                                      105   7e-26   
gb|KDP22104.1|  hypothetical protein JCGZ_25935                         105   9e-26   
gb|EMS57527.1|  40S ribosomal protein S2-3                              104   1e-25   
ref|XP_006423667.1|  hypothetical protein CICLE_v10030004mg             104   1e-25   
gb|EPS60317.1|  hypothetical protein M569_14488                         104   1e-25   
ref|XP_006428531.1|  hypothetical protein CICLE_v10013826mg             102   2e-25   
ref|XP_006423697.1|  hypothetical protein CICLE_v10029866mg             102   5e-25   
gb|AER35085.1|  ribosomal protein S2                                    101   2e-24   
gb|KFD72672.1|  hypothetical protein M514_01798                         103   4e-24   
gb|KHJ46412.1|  ribosomal protein S5                                    103   4e-24   
ref|XP_003532519.2|  PREDICTED: 40S ribosomal protein S2-4-like       97.4    5e-24   
dbj|GAM19630.1|  hypothetical protein SAMD00019534_028050               100   5e-24   
gb|AER57857.1|  ribosomal protein S2                                    100   5e-24   
ref|XP_011062974.1|  PREDICTED: golgin subfamily A member 4-like        104   6e-24   
ref|XP_005651594.1|  ribosomal protein S2 component of cytosolic ...  99.0    2e-23   
gb|ACJ72053.1|  ribosomal protein S2                                  95.5    2e-23   Carybdea marsupialis
emb|CAH04313.1|  S2e ribosomal protein                                96.3    2e-23   Julodis onopordi
gb|KHN16531.1|  40S ribosomal protein S2-4                            97.8    2e-23   
ref|XP_006431702.1|  hypothetical protein CICLE_v10003471mg           98.6    2e-23   
ref|XP_975415.1|  PREDICTED: 40S ribosomal protein S2                 98.2    4e-23   Tribolium castaneum [rust-red flour beetle]
dbj|BAJ99169.1|  predicted protein                                    97.8    5e-23   
ref|XP_805776.1|  40S ribosomal protein S2                            97.4    5e-23   Trypanosoma cruzi strain CL Brener
gb|EKF27923.1|  40S ribosomal protein S2, putative                    97.4    5e-23   
gb|EKG02878.1|  40S ribosomal protein S2, putative                    97.4    5e-23   
gb|EKF28161.1|  40S ribosomal protein S2, putative                    97.4    6e-23   
emb|CCD78318.1|  putative ribosomal protein S2                        96.3    8e-23   
ref|XP_003287730.1|  40S ribosomal protein S2                         97.1    8e-23   
gb|EYC14876.1|  hypothetical protein Y032_0039g58                     98.2    9e-23   
dbj|BAJ23427.1|  ribosomal protein S2                                 95.5    1e-22   
gb|EPY33351.1|  small subunit ribosomal protein S2e                   95.1    1e-22   
ref|NP_001090003.1|  uncharacterized protein LOC735074                96.7    1e-22   Xenopus laevis [clawed frog]
gb|KDD75615.1|  hypothetical protein H632_c591p1                      96.7    1e-22   
ref|XP_009311555.1|  putative 40S ribosomal protein S2                96.7    1e-22   
gb|ENN71910.1|  hypothetical protein YQE_11447                        96.7    1e-22   
gb|EFN77396.1|  40S ribosomal protein S2                              96.7    1e-22   
gb|EFN77365.1|  40S ribosomal protein S2                              96.7    1e-22   
emb|CCD78317.1|  putative ribosomal protein S2                        96.3    1e-22   
gb|EPY27760.1|  small subunit ribosomal protein S2e                   95.1    1e-22   
dbj|GAA32896.1|  small subunit ribosomal protein S2e                  96.3    1e-22   
gb|ESL05428.1|  40S ribosomal protein S2                              94.7    1e-22   
gb|EPY27140.1|  small subunit ribosomal protein S2e                   95.1    1e-22   
ref|XP_009172796.1|  hypothetical protein T265_08661                  96.3    1e-22   
gb|AAM94271.1|  ribosomal protein S2                                  95.9    1e-22   
emb|CAH04121.1|  ribsomal protein S2e                                 96.3    2e-22   Papilio dardanus [flying handkerchief]
gb|EGI60244.1|  40S ribosomal protein S2                              96.7    2e-22   
gb|EHJ64657.1|  ribsomal protein S2e                                  96.3    2e-22   
gb|AEL28817.1|  ribosomal protein S2                                  96.3    2e-22   
gb|ADT80636.1|  ribosomal protein S2                                  95.9    2e-22   
gb|EPY41039.1|  small subunit ribosomal protein S2e                   94.4    2e-22   
gb|EFN68919.1|  40S ribosomal protein S2                              96.3    2e-22   
ref|XP_827939.1|  40S ribosomal protein S2                            96.3    2e-22   Trypanosoma brucei brucei TREU927
ref|XP_011067446.1|  PREDICTED: 40S ribosomal protein S2              96.3    2e-22   
gb|AAN77880.1|  ribosomal protein S2                                  95.1    2e-22   Branchiostoma lanceolatum [common lancelet]
gb|EFZ18642.1|  hypothetical protein SINV_11094                       96.3    2e-22   
gb|EFX68264.1|  hypothetical protein DAPPUDRAFT_330280                94.4    2e-22   
gb|EZA50396.1|  40S ribosomal protein S2                              96.3    2e-22   
ref|XP_011062740.1|  PREDICTED: 40S ribosomal protein S2-like         96.3    2e-22   
gb|AAN86048.1|  ribosomal protein S2                                  95.9    2e-22   Spodoptera frugiperda
gb|KDR22716.1|  40S ribosomal protein S2                              96.3    2e-22   
ref|NP_001037564.1|  ribosomal protein S2                             95.9    2e-22   Bombyx mori [silk moth]
gb|EFZ20665.1|  hypothetical protein SINV_10999                       96.3    2e-22   
ref|XP_001604681.1|  PREDICTED: 40S ribosomal protein S2              96.3    2e-22   Nasonia vitripennis
gb|ABB29623.1|  ribosomal protein 2 small subunit                     92.8    2e-22   Priapulus caudatus
ref|XP_008557531.1|  PREDICTED: 40S ribosomal protein S2              95.9    2e-22   
emb|CDS24186.1|  40S ribosomal protein S2                             95.1    2e-22   
emb|CDJ02437.1|  40S ribosomal protein S2                             95.1    2e-22   
ref|XP_628967.1|  ribosomal protein S2                                95.5    2e-22   Dictyostelium discoideum AX4
gb|AAX62450.1|  ribosomal protein S2                                  95.9    2e-22   Lysiphlebus testaceipes
gb|EUB56429.1|  40S ribosomal protein S2                              95.5    3e-22   
emb|CCC94467.1|  putative 40S ribosomal protein S2                    95.5    3e-22   
gb|EFA82938.1|  ribosomal protein S2                                  95.5    3e-22   Heterostelium album PN500
ref|XP_002954017.1|  component of cytosolic 80S ribosome and 40S ...  95.5    3e-22   
emb|CCC52362.1|  putative 40S ribosomal protein S2                    95.9    3e-22   
gb|KFD57288.1|  hypothetical protein M513_01799                       95.9    3e-22   
emb|CDW51820.1|  Ribosomal S5 and Ribosomal S5 C domain containin...  95.9    3e-22   
gb|KHN82601.1|  40S ribosomal protein S2                              93.6    3e-22   
gb|EPY24367.1|  small subunit ribosomal protein S2e                   95.5    3e-22   
ref|XP_008473023.1|  PREDICTED: 40S ribosomal protein S2              95.5    3e-22   
ref|XP_003723777.1|  PREDICTED: 40S ribosomal protein S2-like         93.6    3e-22   
gb|ACJ72068.1|  ribosomal protein S2                                  92.0    3e-22   Placozoa sp. H2
gb|EPY38096.1|  small subunit ribosomal protein S2e                   94.7    3e-22   
gb|EFN60457.1|  40S ribosomal protein S2                              95.5    3e-22   
ref|XP_001567410.1|  40S ribosomal protein S2                         95.5    3e-22   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_001689670.1|  ribosomal protein S2, component of cytosolic...  95.5    3e-22   Chlamydomonas reinhardtii
ref|XP_005925565.1|  PREDICTED: uncharacterized protein LOC102310332  95.9    3e-22   
ref|XP_003877885.1|  40S ribosomal protein S2                         95.1    4e-22   
ref|XP_003392409.1|  40S ribosomal protein S2                         95.1    4e-22   
gb|AEE62425.1|  unknown                                               95.5    4e-22   
gb|ERG80278.1|  40s ribosomal protein s2                              95.9    4e-22   
emb|CAX76168.1|  small subunit ribosomal protein S2e                  95.1    4e-22   
ref|XP_001682583.1|  40S ribosomal protein S2                         95.1    4e-22   Leishmania major strain Friedlin
gb|AAP06172.1|  SJCHGC06175 protein                                   95.1    4e-22   Schistosoma japonicum
ref|XP_010701735.1|  40S ribosomal protein S2                         95.1    4e-22   
ref|XP_001467728.1|  40S ribosomal protein S2                         95.1    4e-22   Leishmania infantum JPCM5
emb|CAX70956.1|  small subunit ribosomal protein S2e                  95.1    4e-22   
emb|CAX76170.1|  small subunit ribosomal protein S2e                  95.1    4e-22   
ref|XP_010697998.1|  40S ribosomal protein S2                         95.1    4e-22   
gb|ACJ72060.1|  ribosomal protein S2                                  91.3    4e-22   Trichoplax adhaerens
gb|EPY22056.1|  small subunit ribosomal protein S2e                   95.1    4e-22   
gb|ACY95370.1|  ribosomal protein S2                                  95.1    4e-22   Manduca sexta [Carolina sphinx]
sp|O43992.1|RS2_LEIAM  RecName: Full=40S ribosomal protein S2         95.1    4e-22   Leishmania amazonensis
gb|KGB32964.1|  40S ribosomal protein S2                              95.1    4e-22   
ref|XP_001685358.1|  40S ribosomal protein S2                         95.1    4e-22   Leishmania major strain Friedlin
ref|XP_002595695.1|  hypothetical protein BRAFLDRAFT_275374           95.1    5e-22   Branchiostoma floridae
ref|XP_002430250.1|  40S ribosomal protein S2, putative               95.1    5e-22   Pediculus humanus corporis [human body lice]
ref|XP_001745849.1|  hypothetical protein                             98.6    5e-22   Monosiga brevicollis MX1
gb|EPY42585.1|  small subunit ribosomal protein S2e                   94.7    5e-22   
dbj|BAN21161.1|  ribosomal protein S2                                 95.1    5e-22   
ref|XP_003874184.1|  40S ribosomal protein S2                         95.1    5e-22   
gb|EYC14874.1|  hypothetical protein Y032_0039g58                     95.9    5e-22   
ref|XP_002066418.1|  GK18106                                          94.7    5e-22   Drosophila willistoni
emb|CDS29117.1|  40S ribosomal protein S2                             94.7    6e-22   
ref|XP_002133477.1|  GA22914                                          94.7    6e-22   Drosophila pseudoobscura pseudoobscura
ref|XP_001988687.1|  GH10440                                          94.7    6e-22   Drosophila grimshawi
gb|AAV84248.1|  ribosomal protein 2B                                  94.4    6e-22   Culicoides sonorensis
ref|XP_001356343.1|  GA19229                                          94.7    6e-22   Drosophila pseudoobscura pseudoobscura
ref|XP_002003073.1|  GI24366                                          94.7    6e-22   Drosophila mojavensis
ref|XP_003138383.1|  40S ribosomal protein S2                         94.7    6e-22   
gb|EPY42115.1|  small subunit ribosomal protein S2e                   94.7    6e-22   
ref|XP_001640452.1|  predicted protein                                94.7    6e-22   Nematostella vectensis
ref|NP_476874.1|  ribosomal protein S2, isoform A                     94.7    6e-22   Drosophila melanogaster
ref|XP_002052442.1|  GJ21626                                          94.7    6e-22   Drosophila virilis
ref|XP_001961962.1|  GF15233                                          94.7    6e-22   Drosophila ananassae
emb|CDQ00905.1|  Protein Bm2853, isoform c                            94.7    6e-22   
ref|XP_001899324.1|  40S ribosomal protein S2                         94.7    6e-22   
ref|XP_001969358.1|  GG24001                                          94.7    6e-22   
gb|EFO25684.2|  40S ribosomal protein S2                              94.7    6e-22   
ref|XP_001564133.1|  40S ribosomal protein S2                         94.7    6e-22   
ref|XP_002036389.1|  GM12203                                          94.7    6e-22   
gb|EYC14875.1|  hypothetical protein Y032_0039g58                     95.9    6e-22   
ref|XP_002088984.1|  sop                                              94.7    6e-22   
emb|CCW62713.1|  unnamed protein product                              94.4    7e-22   
gb|KHN88277.1|  40S ribosomal protein S2                              94.7    7e-22   
emb|CAH04312.1|  S2e ribosomal protein                                94.4    7e-22   
emb|CCW60846.1|  unnamed protein product                              94.4    7e-22   
ref|XP_003705065.1|  PREDICTED: 40S ribosomal protein S2-like         94.7    7e-22   
gb|EJD76115.1|  40S ribosomal protein S2, variant                     94.4    8e-22   
ref|XP_004527395.1|  PREDICTED: 40S ribosomal protein S2-like         94.4    8e-22   
ref|XP_006607406.1|  PREDICTED: 40S ribosomal protein S2-like         94.7    8e-22   
gb|AFM87828.1|  ribosomal protein S2-like isoform 3                   94.4    8e-22   
ref|XP_003492927.1|  PREDICTED: 40S ribosomal protein S2-like         94.4    8e-22   
gb|AFM86774.1|  ribosomal protein S2-like isoform 3                   94.4    8e-22   
ref|XP_392843.1|  PREDICTED: 40S ribosomal protein S2 isoform 2       94.4    8e-22   
gb|AFM90461.1|  ribosomal protein S2-like isoform 3                   94.4    8e-22   
gb|EFX67704.1|  hypothetical protein DAPPUDRAFT_93655                 94.4    9e-22   
gb|EPY36340.1|  small subunit ribosomal protein S2e                   94.7    9e-22   
gb|AFM88578.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
gb|AFM89047.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
gb|AFM87959.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
gb|AFM87374.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
ref|XP_003401741.1|  PREDICTED: 40S ribosomal protein S2-like iso...  94.4    9e-22   
ref|XP_005108650.1|  PREDICTED: 40S ribosomal protein S2-like         94.4    9e-22   
gb|AFM87968.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
gb|AFM86733.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
gb|EFX77948.1|  hypothetical protein DAPPUDRAFT_92887                 94.4    9e-22   
gb|AFM87326.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
gb|AFM86742.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
ref|XP_001654298.1|  40S ribosomal protein S2                         94.4    9e-22   
ref|XP_003707103.1|  PREDICTED: 40S ribosomal protein S2-like         94.4    9e-22   
gb|AFM86943.1|  ribosomal protein S2-like isoform 3                   94.4    9e-22   
gb|ABR23354.1|  40S ribosomal protein S2/30S                          94.0    1e-21   
gb|AFM89453.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM88214.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM86800.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM85730.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
ref|XP_004333044.1|  ribosomal protein S5, putative                   94.0    1e-21   
gb|AFM89602.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM88619.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM87793.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
ref|NP_001279599.1|  ribosomal protein S2                             94.4    1e-21   
gb|AAV90723.1|  ribosomal protein S2                                  94.4    1e-21   
gb|AFM89133.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM87283.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM88441.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM85842.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|AFM88092.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
ref|XP_002400781.1|  40S ribosomal protein, putative                  94.0    1e-21   
tpg|DAA34096.1|  TPA: 40S ribosomal protein S2                        93.2    1e-21   
gb|AFM88334.1|  ribosomal protein S2-like isoform 3                   94.0    1e-21   
gb|AFM87127.1|  ribosomal protein S2-like isoform 3                   94.0    1e-21   
gb|AFM86556.1|  ribosomal protein S2-like isoform 3                   94.0    1e-21   
gb|AFM86911.1|  ribosomal protein S2-like isoform 3                   94.0    1e-21   
gb|AFM86323.1|  ribosomal protein S2-like isoform 3                   94.0    1e-21   
gb|AFM88251.1|  ribosomal protein S2-like isoform 3                   94.0    1e-21   
gb|AFM85782.1|  ribosomal protein S2-like isoform 3                   94.0    1e-21   
gb|AFM87782.1|  ribosomal protein S2-like isoform 3                   94.0    1e-21   
ref|XP_002014372.1|  GL18987                                          94.7    1e-21   
gb|EGW09504.1|  40S ribosomal protein S2                              92.0    1e-21   
ref|NP_001155755.1|  40S ribosomal protein S2-like                    94.0    1e-21   
gb|ACL38000.1|  40S ribosomal protein S2                              93.6    1e-21   
ref|XP_004211930.1|  PREDICTED: 40S ribosomal protein S2-like         93.2    1e-21   
gb|AFK10711.1|  ribosomal protein S2-like isoform 3                   94.4    1e-21   
gb|ABB29595.1|  ribosomal protein 2 small subunit                     90.9    1e-21   
ref|XP_781777.1|  PREDICTED: 40S ribosomal protein S2-like            94.0    1e-21   
emb|CAA48872.1|  ribosoaml protein S2                                 93.6    1e-21   
ref|XP_001859017.1|  40S ribosomal protein S2                         93.6    2e-21   
ref|XP_003741005.1|  PREDICTED: 40S ribosomal protein S2-like         93.6    2e-21   
gb|ABS18356.1|  40S ribosomal protein S2                              92.8    2e-21   
tpg|DAA22434.1|  TPA: ribosomal protein S2-like                       91.7    2e-21   
gb|ERE68729.1|  40S ribosomal protein S2                              92.0    2e-21   
ref|XP_005712601.1|  unnamed protein product                          93.2    2e-21   
gb|EGV92790.1|  40S ribosomal protein S2                              92.0    2e-21   
ref|XP_005183227.1|  PREDICTED: 40S ribosomal protein S2-like         93.2    2e-21   
gb|ABF68840.1|  ribosomal protein S2                                  90.9    2e-21   
ref|XP_005535075.1|  40S ribosomal protein S2                         93.2    2e-21   
gb|EPQ10923.1|  40S ribosomal protein S2                              92.0    2e-21   
gb|AFM85577.1|  ribosomal protein S2-like isoform 3                   93.2    3e-21   
gb|ABB29699.1|  ribosomal protein 2 small subunit                     90.1    3e-21   
gb|ACD65135.1|  putative 40S ribosomal protein RPS2                   92.8    3e-21   
ref|XP_002110080.1|  expressed hypothetical protein                   92.8    3e-21   
ref|XP_009987204.1|  PREDICTED: 40S ribosomal protein S2              92.0    3e-21   
gb|KFV02792.1|  40S ribosomal protein S2                              92.0    3e-21   
ref|XP_009327653.1|  PREDICTED: 40S ribosomal protein S2              92.0    3e-21   
ref|XP_007176572.1|  PREDICTED: 40S ribosomal protein S2-like         91.7    3e-21   
gb|EPY88939.1|  40S ribosomal protein S2-like isoform 2               92.0    3e-21   
gb|ACD65094.1|  putative 40S ribosomal protein RPS2                   92.4    3e-21   
gb|ABW23136.1|  ribosomal protein rps2                                92.0    3e-21   
gb|KFB37115.1|  ribosomal protein S2                                  92.8    3e-21   
ref|XP_310307.5|  AGAP003768-PA                                       92.8    3e-21   
ref|XP_005871509.1|  PREDICTED: 40S ribosomal protein S2-like         91.3    3e-21   
ref|XP_005354603.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    3e-21   
gb|AAA40074.1|  LLRep3 protein                                        92.0    3e-21   
sp|P46791.1|RS2_CRIGR  RecName: Full=40S ribosomal protein S2         91.7    3e-21   
ref|XP_007061939.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    3e-21   
ref|XP_004596677.1|  PREDICTED: 40S ribosomal protein S2              92.0    3e-21   
gb|EDL18850.1|  mCG18582                                              91.3    3e-21   
gb|AAV69396.1|  40S ribosomal protein S2                              92.8    3e-21   
ref|XP_003915306.2|  PREDICTED: 40S ribosomal protein S2              92.0    3e-21   
gb|ETN60246.1|  40S ribosomal protein S2                              92.8    4e-21   
ref|XP_004692229.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|XP_010213567.1|  PREDICTED: 40S ribosomal protein S2              92.4    4e-21   
gb|EAW98133.1|  hCG2016250, isoform CRA_h                             91.3    4e-21   
ref|XP_006544068.1|  PREDICTED: 40S ribosomal protein S2-like iso...  91.3    4e-21   
ref|XP_006270566.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|XP_006817676.1|  PREDICTED: 40S ribosomal protein S2-like iso...  92.4    4e-21   
ref|XP_005846112.1|  hypothetical protein CHLNCDRAFT_59721            92.4    4e-21   
ref|XP_010383997.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|WP_034359011.1|  hypothetical protein                             91.7    4e-21   
gb|AAQ62744.1|  S2 ribosomal protein                                  91.3    4e-21   
gb|AAQ62756.1|  S2 ribosomal protein                                  91.3    4e-21   
ref|XP_009466239.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|XP_002826021.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
gb|AAQ62750.1|  S2 ribosomal protein                                  91.3    4e-21   
gb|KFM65957.1|  40S ribosomal protein S2                              89.4    4e-21   
ref|XP_007098733.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|XP_009580884.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|XP_005023413.1|  PREDICTED: 40S ribosomal protein S2              92.4    4e-21   
ref|XP_005593624.1|  PREDICTED: 40S ribosomal protein S2-like         91.3    4e-21   
ref|XP_005087680.1|  PREDICTED: 40S ribosomal protein S2-like         92.4    4e-21   
dbj|BAC16801.1|  ribosomal protein S2                                 92.0    4e-21   
pdb|4W23|C  Chain C, Structure Of The 80s Mammalian Ribosome Boun...  91.7    4e-21   
ref|XP_009489293.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
gb|KFV76354.1|  40S ribosomal protein S2                              92.0    4e-21   
ref|XP_010729038.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
gb|ABB29724.1|  ribosomal protein 2 small subunit                     89.7    4e-21   
ref|XP_008631816.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|XP_009664328.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|XP_009193990.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
gb|AAZ38987.1|  40S ribosomal protein S2                              92.0    4e-21   
gb|EOA98500.1|  40S ribosomal protein S2                              91.7    4e-21   
gb|KFO58945.1|  40S ribosomal protein S2                              92.0    4e-21   
ref|XP_010155005.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
ref|XP_009706180.1|  PREDICTED: 40S ribosomal protein S2              92.0    4e-21   
gb|KHJ76676.1|  ribosomal protein S5                                  90.9    5e-21   
ref|XP_009930666.1|  PREDICTED: 40S ribosomal protein S2              92.0    5e-21   
ref|XP_010206787.1|  PREDICTED: 40S ribosomal protein S2              92.0    5e-21   
ref|XP_010718115.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  91.7    5e-21   
ref|XP_009284879.1|  PREDICTED: 40S ribosomal protein S2              92.0    5e-21   
gb|AAQ62749.1|  S2 ribosomal protein                                  90.9    5e-21   
gb|KFM12468.1|  40S ribosomal protein S2                              92.0    5e-21   
ref|XP_008488499.1|  PREDICTED: 40S ribosomal protein S2              92.0    5e-21   
gb|KFO95538.1|  40S ribosomal protein S2                              92.0    5e-21   
gb|EGW04281.1|  40S ribosomal protein S2                              90.9    5e-21   
ref|XP_010182866.1|  PREDICTED: 40S ribosomal protein S2 isoform X1   92.0    5e-21   
gb|ACJ22897.1|  ribosomal protein S2                                  91.3    5e-21   
ref|XP_006024070.1|  PREDICTED: 40S ribosomal protein S2              92.0    5e-21   
ref|XP_010182867.1|  PREDICTED: 40S ribosomal protein S2 isoform X2   92.0    5e-21   
gb|AFM85669.1|  ribosomal protein S2-like isoform 3                   92.4    5e-21   
gb|AFM85532.1|  ribosomal protein S2-like isoform 3                   92.4    5e-21   
ref|XP_004902577.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  92.4    5e-21   
gb|EAW98135.1|  hCG2016250, isoform CRA_j                             92.0    5e-21   
gb|KFW84514.1|  40S ribosomal protein S2                              92.0    5e-21   
ref|XP_010872719.1|  PREDICTED: 40S ribosomal protein S2              92.4    5e-21   
gb|ADX97205.1|  40S ribosomal protein s2                              91.7    5e-21   
gb|ELU04719.1|  hypothetical protein CAPTEDRAFT_173667                92.4    5e-21   
gb|AFM87162.1|  ribosomal protein S2-like isoform 3                   92.0    5e-21   
gb|EDL86044.1|  rCG37521                                              92.0    5e-21   
dbj|BAE39968.1|  unnamed protein product                              92.4    5e-21   
gb|AAP20146.1|  40S ribosomal protein S2                              91.3    5e-21   
gb|AAC04624.1|  ribosomal protein S2                                  92.0    5e-21   
ref|XP_007058631.1|  PREDICTED: 40S ribosomal protein S2              92.4    6e-21   
gb|EDM03873.1|  rCG34378, isoform CRA_j                               91.7    6e-21   
ref|XP_007441890.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  92.0    6e-21   
ref|XP_005289011.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
gb|EDM03871.1|  rCG34378, isoform CRA_h                               92.0    6e-21   
ref|XP_006637290.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    6e-21   
gb|AAC04625.1|  ribosomal protein S2                                  91.7    6e-21   
ref|XP_003252683.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    6e-21   
ref|XP_005861469.1|  PREDICTED: 40S ribosomal protein S2-like         91.7    6e-21   
gb|AAC04621.1|  ribosomal protein S2                                  92.0    6e-21   
gb|EDM03872.1|  rCG34378, isoform CRA_i                               92.0    6e-21   
ref|XP_001095547.2|  PREDICTED: 40S ribosomal protein S2-like iso...  92.0    6e-21   
gb|AFM88091.1|  ribosomal protein S2-like isoform 3                   92.0    6e-21   
gb|AEX09205.1|  putative 40S ribosomal protein                        90.9    6e-21   
ref|XP_008328146.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
ref|XP_003452876.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    6e-21   
gb|EDM03868.1|  rCG34378, isoform CRA_e                               91.3    6e-21   
gb|ACQ58082.1|  40S ribosomal protein S2                              92.0    6e-21   
ref|XP_009507663.1|  PREDICTED: 40S ribosomal protein S2              91.7    6e-21   
ref|NP_001080882.1|  ribosomal protein S2                             92.0    6e-21   
ref|XP_005523144.1|  PREDICTED: 40S ribosomal protein S2 isoform X1   92.0    6e-21   
ref|NP_001264093.1|  40S ribosomal protein S2                         92.0    6e-21   
ref|XP_003229995.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
ref|NP_001007869.1|  ribosomal protein S2                             92.0    6e-21   
ref|XP_004175007.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  92.0    6e-21   
ref|XP_009560492.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
gb|ABZ04253.1|  ribosomal protein rps2                                92.0    6e-21   
ref|XP_006129346.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
ref|XP_004558416.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    6e-21   
ref|XP_003362261.1|  PREDICTED: 40S ribosomal protein S2              91.3    6e-21   
ref|XP_004020761.1|  PREDICTED: 40S ribosomal protein S2 isoform 2    92.0    6e-21   
gb|EAW98129.1|  hCG2016250, isoform CRA_d                             91.7    6e-21   
ref|XP_003762058.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
ref|XP_003964600.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    6e-21   
gb|AEG78365.1|  40S ribosomal protein S2                              92.0    6e-21   
gb|EAW98128.1|  hCG2016250, isoform CRA_c                             92.0    6e-21   
emb|CAG11454.1|  unnamed protein product                              92.0    6e-21   
ref|XP_006544137.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    6e-21   
ref|XP_002799759.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    6e-21   
ref|NP_998444.1|  40S ribosomal protein S2                            92.0    6e-21   
ref|XP_005512150.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  92.0    6e-21   
gb|AAH71673.1|  Ribosomal protein S2                                  92.0    6e-21   
ref|XP_004634361.1|  PREDICTED: 40S ribosomal protein S2-like         92.0    6e-21   
ref|XP_007640311.1|  PREDICTED: 40S ribosomal protein S2 isoform X1   92.0    6e-21   
ref|XP_007100143.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
ref|XP_009895522.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
ref|XP_007198464.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...  92.0    6e-21   
ref|XP_850151.1|  PREDICTED: 40S ribosomal protein S2-like isoform 2  92.0    6e-21   
ref|XP_007937713.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
ref|XP_006873927.1|  PREDICTED: 40S ribosomal protein S2              92.0    6e-21   
ref|XP_004063396.1|  PREDICTED: 40S ribosomal protein S2-like iso...  92.0    6e-21   
ref|XP_008144615.1|  PREDICTED: 40S ribosomal protein S2              92.0    7e-21   
dbj|BAE38847.1|  unnamed protein product                              92.0    7e-21   
ref|XP_004823925.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  92.0    7e-21   



>ref|XP_007015082.1| Myosin-related isoform 1 [Theobroma cacao]
 gb|EOY32701.1| Myosin-related isoform 1 [Theobroma cacao]
Length=961

 Score =   118 bits (295),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  841  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  893



>ref|XP_009794389.1| PREDICTED: 40S ribosomal protein S2-3, partial [Nicotiana sylvestris]
Length=150

 Score =   109 bits (273),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  82   WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  134



>emb|CDY48767.1| BnaC04g02200D [Brassica napus]
Length=1275

 Score =   117 bits (294),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  215



>ref|XP_006369861.1| hypothetical protein POPTR_0001s342602g, partial [Populus trichocarpa]
 gb|ERP66430.1| hypothetical protein POPTR_0001s342602g, partial [Populus trichocarpa]
Length=173

 Score =   110 bits (275),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  105  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  157



>gb|ACR37380.1| unknown [Zea mays]
Length=138

 Score =   107 bits (268),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  64   WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  116



>emb|CDP18531.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   110 bits (275),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  136  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  188



>ref|XP_011033322.1| PREDICTED: 40S ribosomal protein S2-3 [Populus euphratica]
Length=182

 Score =   108 bits (270),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  64   WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  116



>ref|XP_011069984.1| PREDICTED: 40S ribosomal protein S2-4-like [Sesamum indicum]
Length=249

 Score =   110 bits (274),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  130  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  182



>ref|XP_002963234.1| hypothetical protein SELMODRAFT_67484, partial [Selaginella moellendorffii]
 gb|EFJ35105.1| hypothetical protein SELMODRAFT_67484, partial [Selaginella moellendorffii]
Length=263

 Score =   110 bits (274),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  211



>gb|EYU20868.1| hypothetical protein MIMGU_mgv1a011569mg [Erythranthe guttata]
Length=252

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  158  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  210



>gb|KHG06565.1| 40S ribosomal S2-2 -like protein [Gossypium arboreum]
Length=268

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  148  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  200



>ref|XP_010554839.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S2-4-like 
[Tarenaya hassleriana]
Length=271

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  151  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  203



>ref|XP_009386449.1| PREDICTED: 40S ribosomal protein S2-2-like [Musa acuminata subsp. 
malaccensis]
Length=273

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  154  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  206



>ref|XP_008784865.1| PREDICTED: 40S ribosomal protein S2-3-like [Phoenix dactylifera]
Length=273

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  205



>gb|KHG13084.1| 40S ribosomal S2-2 -like protein [Gossypium arboreum]
Length=269

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  149  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  201



>ref|XP_010906118.1| PREDICTED: 40S ribosomal protein S2-2-like [Elaeis guineensis]
Length=274

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  154  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  206



>gb|ABB03723.1| putative ribosomal protein [Sorghum bicolor]
Length=210

 Score =   108 bits (270),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  89   WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  141



>ref|XP_002974537.1| hypothetical protein SELMODRAFT_149893 [Selaginella moellendorffii]
 gb|EFJ24057.1| hypothetical protein SELMODRAFT_149893 [Selaginella moellendorffii]
Length=279

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  211



>ref|XP_008460763.1| PREDICTED: 40S ribosomal protein S2-4-like [Cucumis melo]
Length=271

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  150  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  202



>ref|XP_009777712.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana sylvestris]
Length=275

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  150  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  202



>ref|XP_010666758.1| PREDICTED: 40S ribosomal protein S2-2 [Beta vulgaris subsp. vulgaris]
Length=276

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  207



>ref|XP_009407563.1| PREDICTED: 40S ribosomal protein S2-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407569.1| PREDICTED: 40S ribosomal protein S2-2-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  158  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  210



>gb|KHG28265.1| 40S ribosomal S2-2 -like protein [Gossypium arboreum]
Length=269

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  149  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  201



>gb|KDP22105.1| hypothetical protein JCGZ_25936 [Jatropha curcas]
Length=270

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  151  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  203



>ref|XP_009403825.1| PREDICTED: 40S ribosomal protein S2-4-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  207



>ref|XP_009389539.1| PREDICTED: 40S ribosomal protein S2-4-like [Musa acuminata subsp. 
malaccensis]
Length=277

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  157  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  209



>ref|XP_002283793.1| PREDICTED: 40S ribosomal protein S2-3 [Vitis vinifera]
 emb|CAN79008.1| hypothetical protein VITISV_042472 [Vitis vinifera]
Length=273

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  205



>ref|XP_004162177.1| PREDICTED: 40S ribosomal protein S2-4-like [Cucumis sativus]
 gb|KGN53852.1| hypothetical protein Csa_4G166960 [Cucumis sativus]
Length=271

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  150  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  202



>ref|XP_009630221.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana tomentosiformis]
Length=275

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  150  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  202



>ref|XP_010057233.1| PREDICTED: 40S ribosomal protein S2-4 [Eucalyptus grandis]
 gb|KCW90197.1| hypothetical protein EUGRSUZ_A02370 [Eucalyptus grandis]
Length=271

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  150  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  202



>ref|XP_007015080.1| Ribosomal protein S5 family protein [Theobroma cacao]
 gb|EOY32699.1| Ribosomal protein S5 family protein [Theobroma cacao]
Length=269

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  149  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  201



>ref|XP_007015077.1| Ribosomal protein S5 family protein isoform 1 [Theobroma cacao]
 ref|XP_007015078.1| Ribosomal protein S5 family protein isoform 1 [Theobroma cacao]
 gb|EOY32696.1| Ribosomal protein S5 family protein isoform 1 [Theobroma cacao]
 gb|EOY32697.1| Ribosomal protein S5 family protein isoform 1 [Theobroma cacao]
Length=268

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  148  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  200



>ref|XP_010257189.1| PREDICTED: 40S ribosomal protein S2-3-like [Nelumbo nucifera]
Length=275

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  207



>ref|XP_008801692.1| PREDICTED: 40S ribosomal protein S2-3-like [Phoenix dactylifera]
Length=275

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  154  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  206



>gb|AFW90641.1| 40S ribosomal protein S2 [Solanum tuberosum]
Length=255

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  207



>ref|XP_010937193.1| PREDICTED: 40S ribosomal protein S2-3-like [Elaeis guineensis]
Length=273

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  205



>ref|XP_002513481.1| 40S ribosomal protein S2, putative [Ricinus communis]
 gb|EEF48884.1| 40S ribosomal protein S2, putative [Ricinus communis]
Length=273

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  151  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  203



>ref|XP_010241237.1| PREDICTED: 40S ribosomal protein S2-3-like [Nelumbo nucifera]
Length=276

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  156  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  208



>ref|XP_004168599.1| PREDICTED: 40S ribosomal protein S2-3-like [Cucumis sativus]
 gb|KGN59397.1| hypothetical protein Csa_3G816100 [Cucumis sativus]
Length=269

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  148  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  200



>ref|XP_008443195.1| PREDICTED: 40S ribosomal protein S2-3-like [Cucumis melo]
 gb|ADN33986.1| 40S ribosomal protein s2 [Cucumis melo subsp. melo]
Length=269

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  148  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  200



>ref|XP_011079131.1| PREDICTED: 40S ribosomal protein S2-4-like [Sesamum indicum]
Length=272

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  205



>ref|XP_002513493.1| 40S ribosomal protein S2, putative [Ricinus communis]
 gb|EEF48896.1| 40S ribosomal protein S2, putative [Ricinus communis]
Length=270

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  151  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  203



>emb|CDY06903.1| BnaA04g24120D [Brassica napus]
Length=256

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  134  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  186



>ref|XP_004237924.1| PREDICTED: 40S ribosomal protein S2-4-like [Solanum lycopersicum]
Length=280

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  207



>ref|XP_010923421.1| PREDICTED: 40S ribosomal protein S2-3-like [Elaeis guineensis]
Length=275

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  207



>ref|XP_009602513.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana tomentosiformis]
 ref|XP_009602517.1| PREDICTED: 40S ribosomal protein S2-3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=280

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  154  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  206



>ref|XP_006356337.1| PREDICTED: 40S ribosomal protein S2-3-like [Solanum tuberosum]
Length=280

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  207



>ref|XP_004136761.1| PREDICTED: 40S ribosomal protein S2-3-like [Cucumis sativus]
Length=294

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  173  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  225



>gb|EYU35640.1| hypothetical protein MIMGU_mgv1a011526mg [Erythranthe guttata]
Length=279

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  212



>ref|XP_006838579.1| hypothetical protein AMTR_s00002p00212950 [Amborella trichopoda]
 gb|ERN01148.1| hypothetical protein AMTR_s00002p00212950 [Amborella trichopoda]
Length=278

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  157  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  209



>ref|XP_009602518.1| PREDICTED: 40S ribosomal protein S2-3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=280

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  154  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  206



>ref|XP_004237705.1| PREDICTED: 40S ribosomal protein S2-3-like [Solanum lycopersicum]
Length=280

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  207



>gb|EYU20867.1| hypothetical protein MIMGU_mgv1a011569mg [Erythranthe guttata]
Length=277

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  158  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  210



>ref|XP_009785188.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana sylvestris]
 ref|XP_009797071.1| PREDICTED: 40S ribosomal protein S2-3-like [Nicotiana sylvestris]
Length=280

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  154  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  206



>ref|XP_006664900.1| PREDICTED: 40S ribosomal protein S2-4-like [Oryza brachyantha]
Length=280

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  211



>ref|XP_010094236.1| 40S ribosomal protein S2-4 [Morus notabilis]
 gb|EXB55434.1| 40S ribosomal protein S2-4 [Morus notabilis]
Length=274

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  205



>ref|XP_008231963.1| PREDICTED: 40S ribosomal protein S2-4-like [Prunus mume]
Length=263

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  143  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  195



>emb|CDY22542.1| BnaC03g23520D [Brassica napus]
Length=282

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  212



>ref|XP_006302652.1| hypothetical protein CARUB_v10020756mg [Capsella rubella]
 gb|EOA35550.1| hypothetical protein CARUB_v10020756mg [Capsella rubella]
Length=281

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  212



>ref|XP_006303259.1| hypothetical protein CARUB_v10009962mg [Capsella rubella]
 gb|EOA36157.1| hypothetical protein CARUB_v10009962mg [Capsella rubella]
Length=280

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  211



>emb|CDY45881.1| BnaC01g28170D [Brassica napus]
Length=276

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  207



>emb|CDX79908.1| BnaA05g02480D [Brassica napus]
Length=285

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  215



>ref|XP_002881803.1| 40S ribosomal protein S2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58062.1| 40S ribosomal protein S2 [Arabidopsis lyrata subsp. lyrata]
Length=282

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  213



>ref|NP_001059158.1| Os07g0207400 [Oryza sativa Japonica Group]
 dbj|BAF21072.1| Os07g0207400, partial [Oryza sativa Japonica Group]
Length=165

 Score =   106 bits (264),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAA VPKKVLQFAGIEDV
Sbjct  45   WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAAHVPKKVLQFAGIEDV  97



>ref|XP_009102893.1| PREDICTED: 40S ribosomal protein S2-2 [Brassica rapa]
 emb|CDY44553.1| BnaA01g21860D [Brassica napus]
Length=280

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  211



>ref|XP_009142017.1| PREDICTED: 40S ribosomal protein S2-2-like isoform X1 [Brassica 
rapa]
 ref|XP_009142018.1| PREDICTED: 40S ribosomal protein S2-2-like isoform X2 [Brassica 
rapa]
 emb|CDY14790.1| BnaC04g47870D [Brassica napus]
Length=285

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  215



>gb|KFK40885.1| hypothetical protein AALP_AA2G055200 [Arabis alpina]
Length=282

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  213



>ref|XP_010057240.1| PREDICTED: 40S ribosomal protein S2-4-like [Eucalyptus grandis]
 gb|KCW90198.1| hypothetical protein EUGRSUZ_A02371 [Eucalyptus grandis]
Length=272

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  151  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  203



>ref|XP_007211807.1| hypothetical protein PRUPE_ppa009890mg [Prunus persica]
 ref|XP_007213828.1| hypothetical protein PRUPE_ppa009892mg [Prunus persica]
 gb|EMJ13006.1| hypothetical protein PRUPE_ppa009890mg [Prunus persica]
 gb|EMJ15027.1| hypothetical protein PRUPE_ppa009892mg [Prunus persica]
Length=273

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  205



>ref|XP_002886684.1| hypothetical protein ARALYDRAFT_475376 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62943.1| hypothetical protein ARALYDRAFT_475376 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  213



>emb|CDY35397.1| BnaA03g19630D [Brassica napus]
Length=303

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  181  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  233



>ref|XP_009133513.1| PREDICTED: 40S ribosomal protein S2-2-like [Brassica rapa]
Length=282

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  212



>ref|XP_006392282.1| hypothetical protein EUTSA_v10023633mg [Eutrema salsugineum]
 gb|ESQ29568.1| hypothetical protein EUTSA_v10023633mg [Eutrema salsugineum]
Length=280

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  211



>ref|XP_010536089.1| PREDICTED: 40S ribosomal protein S2-3-like [Tarenaya hassleriana]
Length=275

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  205



>ref|XP_002322713.1| 40S ribosomal protein S2 [Populus trichocarpa]
 gb|EEF04474.1| 40S ribosomal protein S2 [Populus trichocarpa]
Length=276

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  158  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  210



>ref|XP_002308954.1| 40S ribosomal protein S2 [Populus trichocarpa]
 gb|ABK94437.1| unknown [Populus trichocarpa]
 gb|EEE92477.1| 40S ribosomal protein S2 [Populus trichocarpa]
Length=270

 Score =   108 bits (269),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  152  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  204



>ref|XP_010508673.1| PREDICTED: 40S ribosomal protein S2-3 [Camelina sativa]
Length=286

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  165  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  217



>ref|XP_010555023.1| PREDICTED: 40S ribosomal protein S2-4-like [Tarenaya hassleriana]
Length=275

 Score =   108 bits (269),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  205



>ref|XP_011020354.1| PREDICTED: 40S ribosomal protein S2-3-like [Populus euphratica]
Length=270

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  152  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  204



>ref|XP_010519760.1| PREDICTED: 40S ribosomal protein S2-3-like [Tarenaya hassleriana]
Length=275

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  153  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  205



>ref|XP_006411454.1| hypothetical protein EUTSA_v10017049mg [Eutrema salsugineum]
 gb|ESQ52907.1| hypothetical protein EUTSA_v10017049mg [Eutrema salsugineum]
Length=281

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  212



>gb|KFK37024.1| hypothetical protein AALP_AA4G202400 [Arabis alpina]
Length=281

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  213



>ref|XP_006294755.1| hypothetical protein CARUB_v10023800mg [Capsella rubella]
 gb|EOA27653.1| hypothetical protein CARUB_v10023800mg [Capsella rubella]
Length=283

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  215



>ref|XP_010505968.1| PREDICTED: 40S ribosomal protein S2-3-like [Camelina sativa]
Length=288

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  167  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  219



>ref|XP_010517670.1| PREDICTED: 40S ribosomal protein S2-3-like [Camelina sativa]
Length=288

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  167  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  219



>gb|EMT24273.1| 40S ribosomal protein S2-3 [Aegilops tauschii]
Length=213

 Score =   107 bits (266),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  92   WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  144



>gb|AAF82250.1|AC008051_1 Identical to gene XW6 from Arabidopsis thaliana gb|AB008016 and 
contains a Ribosomal protein S5 PF|00333 domain. ESTs gb|T22200, 
gb|N38541, gb|T45263 come from this gene. This gene 
is cut off, partial [Arabidopsis thaliana]
Length=231

 Score =   107 bits (266),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  215



>emb|CDX82895.1| BnaC01g13450D [Brassica napus]
Length=162

 Score =   105 bits (262),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPK VLQF GI+DV
Sbjct  52   WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKMVLQFNGIDDV  104



>ref|XP_006417498.1| hypothetical protein EUTSA_v10008441mg [Eutrema salsugineum]
 gb|ESQ35851.1| hypothetical protein EUTSA_v10008441mg [Eutrema salsugineum]
Length=277

 Score =   108 bits (269),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  156  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  208



>ref|XP_006402872.1| hypothetical protein EUTSA_v10006149mg [Eutrema salsugineum]
 gb|ESQ44325.1| hypothetical protein EUTSA_v10006149mg [Eutrema salsugineum]
Length=279

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  211



>gb|KEH40624.1| 40S ribosomal protein S2-4 [Medicago truncatula]
Length=277

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  157  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  209



>ref|XP_007160431.1| hypothetical protein PHAVU_002G321400g [Phaseolus vulgaris]
 gb|ESW32425.1| hypothetical protein PHAVU_002G321400g [Phaseolus vulgaris]
Length=272

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  152  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  204



>gb|KEH21389.1| 40S ribosomal protein S2-4 [Medicago truncatula]
Length=270

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  150  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  202



>ref|XP_006421416.1| hypothetical protein CICLE_v10005613mg [Citrus clementina]
 gb|ESR34656.1| hypothetical protein CICLE_v10005613mg [Citrus clementina]
Length=272

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  151  WGNKIGRPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  203



>ref|XP_009142781.1| PREDICTED: 40S ribosomal protein S2-3-like [Brassica rapa]
Length=285

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPC+VTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCRVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  215



>gb|KFK34998.1| hypothetical protein AALP_AA5G220900 [Arabis alpina]
Length=275

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>ref|XP_003525227.1| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
 gb|KHN21611.1| 40S ribosomal protein S2-4 [Glycine soja]
Length=272

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  152  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  204



>ref|XP_008231962.1| PREDICTED: 40S ribosomal protein S2-like [Prunus mume]
Length=327

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  207  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  259



>ref|NP_564737.1| 40S ribosomal protein S2-2 [Arabidopsis thaliana]
 ref|NP_564740.1| 40S ribosomal protein S2-2 [Arabidopsis thaliana]
 ref|NP_683443.1| 40S ribosomal protein S2-2 [Arabidopsis thaliana]
 sp|Q93VB8.1|RS22_ARATH RecName: Full=40S ribosomal protein S2-2 [Arabidopsis thaliana]
 gb|AAK62780.1|AC027036_1 ribosomal protein S2, putative [Arabidopsis thaliana]
 gb|AAK62784.1|AC027036_5 ribosomal protein S2, putative [Arabidopsis thaliana]
 gb|AAL57668.1| At1g59359/T4M14_3 [Arabidopsis thaliana]
 dbj|BAB82426.1| ribosomal protein S2 [Arabidopsis thaliana]
 dbj|BAB84012.1| ribosomal protein S2 [Arabidopsis thaliana]
 dbj|BAB84016.1| ribosomal protein S2 [Arabidopsis thaliana]
 gb|AAM91489.1| At1g59359/T4M14_3 [Arabidopsis thaliana]
 dbj|BAD94842.1| ribosomal protein S2 [Arabidopsis thaliana]
 gb|ABF82630.1| At1g59359 [Arabidopsis thaliana]
 dbj|BAG68918.1| 40S ribosomal protein S2 [Arabidopsis thaliana]
 gb|AEE33559.1| 40S ribosomal protein S2-2 [Arabidopsis thaliana]
 gb|AEE33567.1| 40S ribosomal protein S2-2 [Arabidopsis thaliana]
 gb|AEE33576.1| 40S ribosomal protein S2-2 [Arabidopsis thaliana]
Length=284

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  215



>ref|XP_001784315.1| predicted protein [Physcomitrella patens]
 gb|EDQ50877.1| predicted protein [Physcomitrella patens]
Length=280

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVR+VPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRLVPAPRGSGIVAARVPKKVLQFAGIEDV  211



>ref|XP_001780194.1| predicted protein [Physcomitrella patens]
 gb|EDQ54953.1| predicted protein [Physcomitrella patens]
Length=280

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVR+VPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRLVPAPRGSGIVAARVPKKVLQFAGIEDV  211



>ref|XP_006650764.1| PREDICTED: 40S ribosomal protein S2-4-like [Oryza brachyantha]
Length=274

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  205



>ref|XP_001753770.1| predicted protein [Physcomitrella patens]
 gb|EDQ81522.1| predicted protein [Physcomitrella patens]
Length=280

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVR+VPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRLVPAPRGSGIVAARVPKKVLQFAGIEDV  211



>gb|KDO53682.1| hypothetical protein CISIN_1g024105mg [Citrus sinensis]
Length=272

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  151  WGNKIGRPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  203



>gb|AAM53281.1| ribosomal protein S2, putative [Arabidopsis thaliana]
Length=284

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  215



>ref|XP_006291534.1| hypothetical protein CARUB_v10017690mg, partial [Capsella rubella]
 gb|EOA24432.1| hypothetical protein CARUB_v10017690mg, partial [Capsella rubella]
Length=309

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  187  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  239



>ref|XP_007153237.1| hypothetical protein PHAVU_003G018300g [Phaseolus vulgaris]
 gb|ESW25231.1| hypothetical protein PHAVU_003G018300g [Phaseolus vulgaris]
Length=271

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  151  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  203



>dbj|BAA88264.1| RF12 [Arabidopsis thaliana]
Length=282

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  213



>ref|NP_001150344.1| LOC100283974 [Zea mays]
 gb|ACG38751.1| 40S ribosomal protein S2 [Zea mays]
 tpg|DAA59985.1| TPA: 40S ribosomal protein S2 [Zea mays]
Length=279

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  158  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  210



>gb|AEM36341.1| At1g58380 [Arabidopsis thaliana]
Length=284

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  215



>gb|AAM67061.1| ribosomal protein S2, putative [Arabidopsis thaliana]
Length=284

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  215



>ref|XP_004981345.1| PREDICTED: 40S ribosomal protein S2-3-like [Setaria italica]
Length=273

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  205



>gb|AFK38691.1| unknown [Medicago truncatula]
Length=279

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  211



>ref|XP_003538262.1| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
Length=275

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>ref|NP_176134.1| 40S ribosomal protein S2-1 [Arabidopsis thaliana]
 sp|Q8L8Y0.2|RS21_ARATH RecName: Full=40S ribosomal protein S2-1 [Arabidopsis thaliana]
 gb|AAG50639.1|AC082643_3 ribosomal protein S2, putative [Arabidopsis thaliana]
 gb|AAK62403.1|AF386958_1 ribosomal protein S2, putative [Arabidopsis thaliana]
 dbj|BAA88263.1| XW6 [Arabidopsis thaliana]
 dbj|BAB83870.1| ribosomal protein S2 [Arabidopsis thaliana]
 gb|AAL66943.1| ribosomal protein S2, putative [Arabidopsis thaliana]
 gb|AEE33543.1| 40S ribosomal protein S2-1 [Arabidopsis thaliana]
 gb|AEM36354.1| At1g59359 [Arabidopsis thaliana]
Length=284

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  163  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  215



>ref|XP_011048036.1| PREDICTED: 40S ribosomal protein S2-3 [Populus euphratica]
Length=256

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  152  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  204



>ref|XP_002459531.1| hypothetical protein SORBIDRAFT_02g006200 [Sorghum bicolor]
 gb|EER96052.1| hypothetical protein SORBIDRAFT_02g006200 [Sorghum bicolor]
Length=279

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  158  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  210



>ref|XP_002298397.2| hypothetical protein POPTR_0001s26400g [Populus trichocarpa]
 gb|EEE83202.2| hypothetical protein POPTR_0001s26400g [Populus trichocarpa]
Length=339

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  219  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  271



>ref|XP_004498248.1| PREDICTED: 40S ribosomal protein S2-4-like [Cicer arietinum]
Length=275

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>gb|EEE60147.1| hypothetical protein OsJ_13042 [Oryza sativa Japonica Group]
Length=284

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  163  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  215



>ref|XP_001784592.1| predicted protein [Physcomitrella patens]
 gb|EDQ50611.1| predicted protein [Physcomitrella patens]
Length=280

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVR+VPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRLVPAPRGSGIVAARVPKKVLQFAGIEDV  211



>ref|XP_003630949.1| 40S ribosomal protein S2 [Medicago truncatula]
 gb|AET05425.1| 40S ribosomal protein S2-4 [Medicago truncatula]
Length=279

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  211



>ref|XP_008644418.1| PREDICTED: 40S ribosomal protein S2-3-like [Zea mays]
 gb|AFW67266.1| hypothetical protein ZEAMMB73_246206 [Zea mays]
Length=274

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  205



>pdb|3J60|C Chain C, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=263

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  205



>ref|XP_006574815.1| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
Length=275

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>ref|XP_004302961.1| PREDICTED: 40S ribosomal protein S2-4-like [Fragaria vesca subsp. 
vesca]
Length=276

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  156  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  208



>ref|XP_002466244.1| hypothetical protein SORBIDRAFT_01g004250 [Sorghum bicolor]
 gb|EER93242.1| hypothetical protein SORBIDRAFT_01g004250 [Sorghum bicolor]
Length=274

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  205



>ref|XP_004503350.1| PREDICTED: 40S ribosomal protein S2-3-like [Cicer arietinum]
Length=276

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  156  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  208



>ref|NP_001169209.1| uncharacterized protein LOC100383062 [Zea mays]
 ref|XP_008644414.1| PREDICTED: uncharacterized protein LOC100383062 isoform X1 [Zea 
mays]
 gb|ACN31951.1| unknown [Zea mays]
 tpg|DAA52072.1| TPA: hypothetical protein ZEAMMB73_242652 [Zea mays]
 tpg|DAA52073.1| TPA: hypothetical protein ZEAMMB73_242652 [Zea mays]
Length=274

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  205



>ref|XP_002466245.1| hypothetical protein SORBIDRAFT_01g004260 [Sorghum bicolor]
 gb|EER93243.1| hypothetical protein SORBIDRAFT_01g004260 [Sorghum bicolor]
Length=274

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  205



>ref|XP_010427628.1| PREDICTED: 40S ribosomal protein S2-4 [Camelina sativa]
Length=282

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  213



>ref|XP_003538244.1| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
Length=275

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>ref|XP_010504675.1| PREDICTED: 40S ribosomal protein S2-4-like [Camelina sativa]
 ref|XP_010504677.1| PREDICTED: 40S ribosomal protein S2-4-like [Camelina sativa]
Length=282

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  213



>ref|XP_009369694.1| PREDICTED: 40S ribosomal protein S2-4-like [Pyrus x bretschneideri]
 ref|XP_009374934.1| PREDICTED: 40S ribosomal protein S2-4-like [Pyrus x bretschneideri]
Length=275

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>ref|NP_181715.1| 40S ribosomal protein S2-3 [Arabidopsis thaliana]
 sp|P49688.2|RS23_ARATH RecName: Full=40S ribosomal protein S2-3 [Arabidopsis thaliana]
 gb|AAC02764.1| 40S ribosomal protein S2 [Arabidopsis thaliana]
 gb|AAK82512.1| At2g41840/T11A7.6 [Arabidopsis thaliana]
 gb|AAM91391.1| At2g41840/T11A7.6 [Arabidopsis thaliana]
 gb|AEC10039.1| 40S ribosomal protein S2-3 [Arabidopsis thaliana]
Length=285

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  164  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  216



>ref|XP_004955795.1| PREDICTED: 40S ribosomal protein S2-3-like [Setaria italica]
Length=279

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  158  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  210



>ref|NP_001051645.1| Os03g0807800 [Oryza sativa Japonica Group]
 gb|AAP21434.1| putative 40S ribosomal protein S2 [Oryza sativa Japonica Group]
 gb|ABF99457.1| 40S ribosomal protein S2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13559.1| Os03g0807800 [Oryza sativa Japonica Group]
 gb|EAY92273.1| hypothetical protein OsI_13996 [Oryza sativa Indica Group]
 dbj|BAG89307.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  153  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  205



>gb|AAM62944.1| 40S ribosomal protein S2 [Arabidopsis thaliana]
Length=285

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  164  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  216



>ref|XP_009366094.1| PREDICTED: 40S ribosomal protein S2-4-like [Pyrus x bretschneideri]
Length=275

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>ref|XP_003564096.1| PREDICTED: 40S ribosomal protein S2-3-like [Brachypodium distachyon]
Length=278

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  157  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  209



>ref|XP_008361610.1| PREDICTED: 40S ribosomal protein S2-4-like [Malus domestica]
 ref|XP_008368125.1| PREDICTED: 40S ribosomal protein S2-4-like [Malus domestica]
Length=275

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>emb|CAC27136.1| 40S ribosomal protein S2 [Picea abies]
Length=232

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVP KVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  111  WGNKIGKPHTVPVKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  163



>ref|NP_191308.1| 40S ribosomal protein S2-4 [Arabidopsis thaliana]
 sp|Q9SCM3.1|RS24_ARATH RecName: Full=40S ribosomal protein S2-4 [Arabidopsis thaliana]
 emb|CAB66106.1| 40S ribosomal protein S2 homolog [Arabidopsis thaliana]
 gb|AAM60846.1| 40S ribosomal protein S2 homolog [Arabidopsis thaliana]
 gb|AAP12849.1| At3g57490 [Arabidopsis thaliana]
 dbj|BAF00015.1| 40S ribosomal protein S2 homolog [Arabidopsis thaliana]
 gb|AEE79662.1| 40S ribosomal protein S2-4 [Arabidopsis thaliana]
Length=276

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>ref|XP_002878157.1| 40S ribosomal protein S2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54416.1| 40S ribosomal protein S2 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  151  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  203



>gb|ACN37050.1| unknown [Zea mays]
Length=185

 Score =   105 bits (261),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKC SVTVRMVPAPRG+GIVAARVPKKVLQFAGIEDV
Sbjct  64   WGNKIGQPHTVPCKVTGKCRSVTVRMVPAPRGSGIVAARVPKKVLQFAGIEDV  116



>dbj|BAK05186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  109  WGNKIGLPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  161



>gb|ABK21813.1| unknown [Picea sitchensis]
 gb|ACN40117.1| unknown [Picea sitchensis]
Length=270

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVP KVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  149  WGNKIGKPHTVPVKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  201



>gb|ABK25823.1| unknown [Picea sitchensis]
Length=280

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVP KVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  159  WGNKIGKPHTVPVKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  211



>gb|ABK23357.1| unknown [Picea sitchensis]
Length=232

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVP KVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  111  WGNKIGKPHTVPVKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  163



>ref|XP_010412819.1| PREDICTED: 40S ribosomal protein S2-4-like [Camelina sativa]
Length=288

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  167  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  219



>gb|EMT00343.1| 40S ribosomal protein S2-3 [Aegilops tauschii]
Length=213

 Score =   105 bits (262),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  92   WGNKIGLPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  144



>ref|XP_003557397.1| PREDICTED: 40S ribosomal protein S2-4-like [Brachypodium distachyon]
Length=281

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  160  WGNKIGQPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  212



>ref|XP_004149390.1| PREDICTED: 40S ribosomal protein S2-4-like [Cucumis sativus]
Length=271

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAA VPKKVLQFAGIEDV
Sbjct  150  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAAGVPKKVLQFAGIEDV  202



>ref|XP_008385732.1| PREDICTED: 40S ribosomal protein S2-4-like [Malus domestica]
Length=275

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCG VTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  155  WGNKIGKPHTVPCKVTGKCGXVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  207



>dbj|BAC83243.1| putative 40S ribosomal protein S2 [Oryza sativa Japonica Group]
Length=276

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRG+GIVAA VPKKVLQFAGIEDV
Sbjct  156  WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAAHVPKKVLQFAGIEDV  208



>emb|CDM84780.1| unnamed protein product [Triticum aestivum]
Length=278

 Score =   105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  157  WGNKIGLPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  209



>dbj|BAJ89869.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=278

 Score =   105 bits (262),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  157  WGNKIGLPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  209



>gb|KDP22104.1| hypothetical protein JCGZ_25935 [Jatropha curcas]
Length=270

 Score =   105 bits (261),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCK TGKCGSVTVRM PAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  151  WGNKIGKPHTVPCKETGKCGSVTVRMGPAPRGAGIVAARVPKKVLQFAGIEDV  203



>gb|EMS57527.1| 40S ribosomal protein S2-3 [Triticum urartu]
Length=274

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVPCKVTGKCGSVTVRMVPAPRG+GIVAARVPKKVLQFAGI+DV
Sbjct  153  WGNKIGLPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDV  205



>ref|XP_006423667.1| hypothetical protein CICLE_v10030004mg [Citrus clementina]
 gb|ESR36907.1| hypothetical protein CICLE_v10030004mg [Citrus clementina]
Length=268

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PH VPCKVTGKCGS TVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  147  WGNKIGRPHIVPCKVTGKCGSATVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  199



>gb|EPS60317.1| hypothetical protein M569_14488, partial [Genlisea aurea]
Length=256

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCK TGKCGSV VRMVPAPRGAGIVAARVPKKVLQFAGIEDV
Sbjct  137  WGNKIGKPHTVPCKGTGKCGSVIVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  189



>ref|XP_006428531.1| hypothetical protein CICLE_v10013826mg, partial [Citrus clementina]
 gb|ESR41771.1| hypothetical protein CICLE_v10013826mg, partial [Citrus clementina]
Length=166

 Score =   102 bits (253),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVTGKCGS TVRMVPAPRGA IVAARVPKKVLQF GI+DV
Sbjct  45   WGNKIGRPHTVPCKVTGKCGSATVRMVPAPRGAEIVAARVPKKVLQFVGIDDV  97



>ref|XP_006423697.1| hypothetical protein CICLE_v10029866mg, partial [Citrus clementina]
 gb|ESR36937.1| hypothetical protein CICLE_v10029866mg, partial [Citrus clementina]
Length=226

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PH V CKVTGKCGS TVRMVPAPRGAGIVAARVPKKVLQFAGI+DV
Sbjct  105  WGNKIGRPHIVSCKVTGKCGSATVRMVPAPRGAGIVAARVPKKVLQFAGIDDV  157



>gb|AER35085.1| ribosomal protein S2 [Dictyostelium lacteum]
Length=275

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVP KVTGKCGSV+VR+VPAPRG GIVAARVPKK+LQFAGIEDV
Sbjct  166  WGNKIGAPHTVPTKVTGKCGSVSVRLVPAPRGTGIVAARVPKKILQFAGIEDV  218



>gb|KFD72672.1| hypothetical protein M514_01798 [Trichuris suis]
Length=749

 Score =   103 bits (258),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  169  WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLQMAGIED  220



>gb|KHJ46412.1| ribosomal protein S5 [Trichuris suis]
Length=856

 Score =   103 bits (258),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  281  WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLQMAGIED  332



>ref|XP_003532519.2| PREDICTED: 40S ribosomal protein S2-4-like [Glycine max]
Length=139

 Score = 97.4 bits (241),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPH VP KVTGKCGSVTVRMVPAPRG+GIVA RVPKKVLQFAGI+ V
Sbjct  19   WGNKIGKPHNVPFKVTGKCGSVTVRMVPAPRGSGIVAIRVPKKVLQFAGIDGV  71



>dbj|GAM19630.1| hypothetical protein SAMD00019534_028050 [Acytostelium subglobosum 
LB1]
Length=281

 Score =   100 bits (249),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVP KVTGKCGSV +RMVPAPRG GIVAARVPKK+LQFAG+EDV
Sbjct  171  WGNKIGAPHTVPTKVTGKCGSVALRMVPAPRGTGIVAARVPKKLLQFAGVEDV  223



>gb|AER57857.1| ribosomal protein S2 [Acytostelium subglobosum]
Length=280

 Score =   100 bits (249),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVP KVTGKCGSV +RMVPAPRG GIVAARVPKK+LQFAG+EDV
Sbjct  171  WGNKIGAPHTVPTKVTGKCGSVALRMVPAPRGTGIVAARVPKKLLQFAGVEDV  223



>ref|XP_011062974.1| PREDICTED: golgin subfamily A member 4-like [Acromyrmex echinatior]
Length=2548

 Score =   104 bits (259),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  727  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  778



>ref|XP_005651594.1| ribosomal protein S2 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE27050.1| ribosomal protein S2 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=266

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVP KVTGKCGSV+VR++PAPRGAGIVAAR PKKVLQ AGIED
Sbjct  146  WGNKIGKPHTVPTKVTGKCGSVSVRLIPAPRGAGIVAARTPKKVLQMAGIED  197



>gb|ACJ72053.1| ribosomal protein S2 [Carybdea marsupialis]
Length=116

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIVAA VPKK+LQ AG++D
Sbjct  58   WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVAAGVPKKLLQMAGVDD  109



>emb|CAH04313.1| S2e ribosomal protein [Julodis onopordi]
Length=138

 Score = 96.3 bits (238),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  18   WGNKIGKPHTVPCKVTGKCGSVAVRLIPAPRGTGIVSAPVPKKLLQMAGIED  69



>gb|KHN16531.1| 40S ribosomal protein S2-4 [Glycine soja]
Length=223

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPH VP KVTGKCGSVTVRMVPAPRG+GIVA RVPKKVLQFAGI+ V
Sbjct  103  WGNKIGKPHNVPFKVTGKCGSVTVRMVPAPRGSGIVAIRVPKKVLQFAGIDGV  155



>ref|XP_006431702.1| hypothetical protein CICLE_v10003471mg [Citrus clementina]
 gb|ESR44942.1| hypothetical protein CICLE_v10003471mg [Citrus clementina]
Length=274

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHTVPCKVT KCGS  VRMVPA RGAGI+AARVPKKVLQFAGI+DV
Sbjct  153  WGNKIGRPHTVPCKVTDKCGSAIVRMVPASRGAGIMAARVPKKVLQFAGIDDV  205



>ref|XP_975415.1| PREDICTED: 40S ribosomal protein S2 [Tribolium castaneum]
 gb|EFA01765.1| hypothetical protein TcasGA2_TC007364 [Tribolium castaneum]
Length=278

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  158  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGIED  209



>dbj|BAJ99169.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGN IG PHTVP KVTGKCGSVTVR+VPAPRGAGIV+AR PKK+LQ+AGI+DV
Sbjct  169  WGNMIGNPHTVPMKVTGKCGSVTVRLVPAPRGAGIVSARTPKKILQYAGIDDV  221



>ref|XP_805776.1| 40S ribosomal protein S2 [Trypanosoma cruzi strain CL Brener]
 ref|XP_811926.1| 40S ribosomal protein S2 [Trypanosoma cruzi strain CL Brener]
 ref|XP_814348.1| 40S ribosomal protein S2 [Trypanosoma cruzi strain CL Brener]
 ref|XP_814355.1| 40S ribosomal protein S2 [Trypanosoma cruzi strain CL Brener]
 gb|EAN83925.1| 40S ribosomal protein S2, putative [Trypanosoma cruzi]
 gb|EAN90075.1| 40S ribosomal protein S2, putative [Trypanosoma cruzi]
 gb|EAN92497.1| 40S ribosomal protein S2, putative [Trypanosoma cruzi]
 gb|EAN92504.1| 40S ribosomal protein S2, putative [Trypanosoma cruzi]
Length=263

 Score = 97.4 bits (241),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV+VR++PAPRGAGIVAA VPKK+L+FAG+EDV
Sbjct  151  WGNKIGEPHTIPMKVTGKCGSVSVRLIPAPRGAGIVAAPVPKKILEFAGVEDV  203



>gb|EKF27923.1| 40S ribosomal protein S2, putative, partial [Trypanosoma cruzi 
marinkellei]
Length=262

 Score = 97.4 bits (241),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV+VR++PAPRGAGIVAA VPKK+L+FAG+EDV
Sbjct  151  WGNKIGEPHTIPMKVTGKCGSVSVRLIPAPRGAGIVAAPVPKKILEFAGVEDV  203



>gb|EKG02878.1| 40S ribosomal protein S2, putative [Trypanosoma cruzi]
Length=263

 Score = 97.4 bits (241),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV+VR++PAPRGAGIVAA VPKK+L+FAG+EDV
Sbjct  151  WGNKIGEPHTIPMKVTGKCGSVSVRLIPAPRGAGIVAAPVPKKILEFAGVEDV  203



>gb|EKF28161.1| 40S ribosomal protein S2, putative [Trypanosoma cruzi marinkellei]
Length=263

 Score = 97.4 bits (241),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV+VR++PAPRGAGIVAA VPKK+L+FAG+EDV
Sbjct  151  WGNKIGEPHTIPMKVTGKCGSVSVRLIPAPRGAGIVAAPVPKKILEFAGVEDV  203



>emb|CCD78318.1| putative ribosomal protein S2 [Schistosoma mansoni]
Length=230

 Score = 96.3 bits (238),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGN+IGKPHTVPCKVTGKCGSV+VR++PAPRG GIV A VPKK+LQ AGIEDV
Sbjct  151  WGNQIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVGAPVPKKLLQMAGIEDV  203



>ref|XP_003287730.1| 40S ribosomal protein S2 [Dictyostelium purpureum]
 gb|EGC35727.1| 40S ribosomal protein S2 [Dictyostelium purpureum]
Length=260

 Score = 97.1 bits (240),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHTVP KVTGKCGSV VR+VPAPRG GIVAARVPKK+LQ+AG++DV
Sbjct  152  WGNKIGAPHTVPTKVTGKCGSVAVRLVPAPRGTGIVAARVPKKLLQYAGVDDV  204



>gb|EYC14876.1| hypothetical protein Y032_0039g58 [Ancylostoma ceylanicum]
Length=427

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIG PHTVPCKVTGKC SV VR+VPAPRG GIV+A VPKK+LQ AGI+D
Sbjct  321  WGNKIGLPHTVPCKVTGKCASVMVRLVPAPRGTGIVSAPVPKKLLQMAGIQD  372



>dbj|BAJ23427.1| ribosomal protein S2 [Ostrinia nubilalis]
Length=187

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AG++D
Sbjct  117  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQD  168



>gb|EPY33351.1| small subunit ribosomal protein S2e [Strigomonas culicis]
Length=177

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHT+P KVTGKCGSV+VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  65   WGNKIGDPHTIPMKVTGKCGSVSVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  117



>ref|NP_001090003.1| uncharacterized protein LOC735074 [Xenopus laevis]
 gb|AAH92154.1| MGC115171 protein [Xenopus laevis]
Length=261

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGN IGKPHTVPCKVTGKCGSVTVR++PAPRG GIV A VPKK+LQ AGIEDV
Sbjct  151  WGNLIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVGAPVPKKLLQMAGIEDV  203



>gb|KDD75615.1| hypothetical protein H632_c591p1 [Helicosporidium sp. ATCC 50920]
Length=269

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGK HTVPCKVTG CGSV++R+VPAPRGAGIVAAR PKKVLQ AGIED
Sbjct  157  WGNKIGKVHTVPCKVTGSCGSVSIRLVPAPRGAGIVAARTPKKVLQMAGIED  208



>ref|XP_009311555.1| putative 40S ribosomal protein S2 [Trypanosoma grayi]
 gb|KEG10211.1| putative 40S ribosomal protein S2 [Trypanosoma grayi]
Length=263

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR++PAPRGAGIVAA VPKK+L+FAG+EDV
Sbjct  151  WGNKIGEPHTIPMKVTGKCGSVAVRLIPAPRGAGIVAAPVPKKILEFAGVEDV  203



>gb|ENN71910.1| hypothetical protein YQE_11447, partial [Dendroctonus ponderosae]
 gb|ERL94479.1| hypothetical protein D910_11756 [Dendroctonus ponderosae]
Length=282

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIG+PHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  162  WGNKIGQPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGIED  213



>gb|EFN77396.1| 40S ribosomal protein S2 [Harpegnathos saltator]
Length=278

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  212



>gb|EFN77365.1| 40S ribosomal protein S2 [Harpegnathos saltator]
Length=276

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  210



>emb|CCD78317.1| putative ribosomal protein S2 [Schistosoma mansoni]
Length=261

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGN+IGKPHTVPCKVTGKCGSV+VR++PAPRG GIV A VPKK+LQ AGIEDV
Sbjct  151  WGNQIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVGAPVPKKLLQMAGIEDV  203



>gb|EPY27760.1| small subunit ribosomal protein S2e [Strigomonas culicis]
Length=198

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHT+P KVTGKCGSV+VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  86   WGNKIGDPHTIPMKVTGKCGSVSVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  138



>dbj|GAA32896.1| small subunit ribosomal protein S2e [Clonorchis sinensis]
Length=256

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGN IGKPHTVPCKVTGKCGSVTVR++PAPRG G+V A VPKK+LQ AGIEDV
Sbjct  146  WGNLIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGVVGAPVPKKLLQMAGIEDV  198



>gb|ESL05428.1| 40S ribosomal protein S2 [Trypanosoma rangeli SC58]
 gb|ESL05732.1| 40S ribosomal protein S2 [Trypanosoma rangeli SC58]
Length=176

 Score = 94.7 bits (234),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  64   WGNKIGEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  116



>gb|EPY27140.1| small subunit ribosomal protein S2e [Strigomonas culicis]
Length=198

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHT+P KVTGKCGSV+VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  86   WGNKIGDPHTIPMKVTGKCGSVSVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  138



>ref|XP_009172796.1| hypothetical protein T265_08661 [Opisthorchis viverrini]
 gb|KER23441.1| hypothetical protein T265_08661 [Opisthorchis viverrini]
Length=256

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGN IGKPHTVPCKVTGKCGSVTVR++PAPRG G+V A VPKK+LQ AGIEDV
Sbjct  146  WGNLIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGVVGAPVPKKLLQMAGIEDV  198



>gb|AAM94271.1| ribosomal protein S2 [Azumapecten farreri]
Length=249

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+L  AGIED
Sbjct  167  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLNMAGIED  218



>emb|CAH04121.1| ribsomal protein S2e [Papilio dardanus]
 dbj|BAM17745.1| ribosomal protein S2 [Papilio xuthus]
 dbj|BAM19210.1| ribosomal protein S2 [Papilio polytes]
Length=261

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AG++D
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQD  211



>gb|EGI60244.1| 40S ribosomal protein S2 [Acromyrmex echinatior]
Length=288

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  171  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  222



>gb|EHJ64657.1| ribsomal protein S2e [Danaus plexippus]
Length=261

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AG++D
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQD  211



>gb|AEL28817.1| ribosomal protein S2 [Heliconius melpomene cythera]
Length=261

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AG++D
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQD  211



>gb|ADT80636.1| ribosomal protein S2 [Euphydryas aurinia]
Length=261

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AG++D
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQD  211



>gb|EPY41039.1| small subunit ribosomal protein S2e [Angomonas deanei]
 gb|EPY41765.1| small subunit ribosomal protein S2e [Angomonas deanei]
Length=173

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGS++VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  65   WGNKIGEPHTIPMKVTGKCGSISVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  117



>gb|EFN68919.1| 40S ribosomal protein S2 [Camponotus floridanus]
Length=297

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  180  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  231



>ref|XP_827939.1| 40S ribosomal protein S2 [Trypanosoma brucei brucei TREU927]
 ref|XP_827949.1| 40S ribosomal protein S2 [Trypanosoma brucei brucei TREU927]
 pdb|3ZEY|P Chain P, High-resolution Cryo-electron Microscopy Structure Of 
The Trypanosoma Brucei Ribosome
 gb|EAN78827.1| 40S ribosomal protein S2, putative [Trypanosoma brucei brucei 
TREU927]
 gb|EAN78837.1| 40S ribosomal protein S2, putative [Trypanosoma brucei brucei 
TREU927]
 emb|CBH16672.1| 40S ribosomal protein S2, putative [Trypanosoma brucei gambiense 
DAL972]
 emb|CBH16684.1| 40S ribosomal protein S2, putative [Trypanosoma brucei gambiense 
DAL972]
Length=266

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR++PAPRGAGIVAA VPKK+L+FAG+EDV
Sbjct  154  WGNKIGEPHTIPIKVTGKCGSVAVRLIPAPRGAGIVAAPVPKKILEFAGVEDV  206



>ref|XP_011067446.1| PREDICTED: 40S ribosomal protein S2 [Acromyrmex echinatior]
 gb|EGI57196.1| 40S ribosomal protein S2 [Acromyrmex echinatior]
Length=279

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  162  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  213



>gb|AAN77880.1| ribosomal protein S2 [Branchiostoma lanceolatum]
Length=201

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGI+D
Sbjct  105  WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLQMAGIDD  156



>gb|EFZ18642.1| hypothetical protein SINV_11094 [Solenopsis invicta]
Length=288

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  171  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  222



>gb|EFX68264.1| hypothetical protein DAPPUDRAFT_330280 [Daphnia pulex]
Length=165

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++P PRG GIV+A VPKK+LQ AGIED
Sbjct  45   WGNKIGKPHTVPCKVTGKCGSVLVRLIPGPRGTGIVSAPVPKKLLQMAGIED  96



>gb|EZA50396.1| 40S ribosomal protein S2 [Cerapachys biroi]
Length=278

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  161  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  212



>ref|XP_011062740.1| PREDICTED: 40S ribosomal protein S2-like [Acromyrmex echinatior]
Length=276

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  210



>gb|AAN86048.1| ribosomal protein S2 [Spodoptera frugiperda]
Length=261

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AG++D
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQD  211



>gb|KDR22716.1| 40S ribosomal protein S2 [Zootermopsis nevadensis]
Length=273

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  157  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  208



>ref|NP_001037564.1| ribosomal protein S2 [Bombyx mori]
 gb|AAV34857.1| ribosomal protein S2 [Bombyx mori]
Length=261

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSVTVR++PAPRG GIV+A VPKK+LQ AG++D
Sbjct  160  WGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQD  211



>gb|EFZ20665.1| hypothetical protein SINV_10999 [Solenopsis invicta]
Length=279

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  162  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  213



>ref|XP_001604681.1| PREDICTED: 40S ribosomal protein S2 [Nasonia vitripennis]
Length=278

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  159  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  210



>gb|ABB29623.1| ribosomal protein 2 small subunit [Priapulus caudatus]
Length=117

 Score = 92.8 bits (229),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+L  AGIED
Sbjct  54   WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLHMAGIED  105



>ref|XP_008557531.1| PREDICTED: 40S ribosomal protein S2 [Microplitis demolitor]
Length=281

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  162  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  213



>emb|CDS24186.1| 40S ribosomal protein S2 [Echinococcus granulosus]
Length=224

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+L  AGIEDV
Sbjct  152  WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLSMAGIEDV  204



>emb|CDJ02437.1| 40S ribosomal protein S2 [Echinococcus multilocularis]
 emb|CDS39719.1| 40S ribosomal protein S2 [Echinococcus multilocularis]
Length=224

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+L  AGIEDV
Sbjct  152  WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLSMAGIEDV  204



>ref|XP_628967.1| ribosomal protein S2 [Dictyostelium discoideum AX4]
 sp|P27685.1|RS2_DICDI RecName: Full=40S ribosomal protein S2; AltName: Full=Protein 
LLRep3; AltName: Full=Ribosomal protein S4 [Dictyostelium discoideum]
 emb|CAA39744.1| DdLLRep3 [Dictyostelium discoideum]
 gb|EAL60548.1| ribosomal protein S2 [Dictyostelium discoideum AX4]
Length=265

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNK+G PHTVP KVTGKCGSV VR+VPAPRG GIVAARVPKK+LQ+AG++DV
Sbjct  157  WGNKLGAPHTVPTKVTGKCGSVAVRLVPAPRGTGIVAARVPKKLLQYAGVDDV  209



>gb|AAX62450.1| ribosomal protein S2 [Lysiphlebus testaceipes]
Length=285

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  165  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  216



>gb|EUB56429.1| 40S ribosomal protein S2 [Echinococcus granulosus]
Length=263

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+L  AGIEDV
Sbjct  152  WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLSMAGIEDV  204



>emb|CCC94467.1| putative 40S ribosomal protein S2 [Trypanosoma congolense IL3000]
 emb|CCC94476.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=265

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHT+P KVTGKCGSV VR++PAPRGAGIVAA VPKK+L+FAG+EDV
Sbjct  153  WGNKIGDPHTIPVKVTGKCGSVAVRLIPAPRGAGIVAAPVPKKILEFAGVEDV  205



>gb|EFA82938.1| ribosomal protein S2 [Polysphondylium pallidum PN500]
Length=268

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WG+K+G PHTVP KVTGKCGSV +R+VPAPRG GIVAARVPKK+LQ+AGIEDV
Sbjct  158  WGSKLGAPHTVPTKVTGKCGSVALRLVPAPRGTGIVAARVPKKLLQYAGIEDV  210



>ref|XP_002954017.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45046.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=268

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGK HTVP KVTGKCGSVT+R+ PAPRGAGIVAAR PKKVLQ AGIED
Sbjct  150  WGNKIGKVHTVPTKVTGKCGSVTIRLTPAPRGAGIVAARTPKKVLQMAGIED  201



>emb|CCC52362.1| putative 40S ribosomal protein S2 [Trypanosoma vivax Y486]
Length=324

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHT+P KVTGKCGSV+VR++PAPRGAGIVAA VPKK+L+FAG+EDV
Sbjct  213  WGNKIGDPHTIPMKVTGKCGSVSVRLIPAPRGAGIVAAPVPKKILEFAGVEDV  265



>gb|KFD57288.1| hypothetical protein M513_01799 [Trichuris suis]
Length=286

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  169  WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLQMAGIED  220



>emb|CDW51820.1| Ribosomal S5 and Ribosomal S5 C domain containing protein [Trichuris 
trichiura]
Length=286

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  169  WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLQMAGIED  220



>gb|KHN82601.1| 40S ribosomal protein S2 [Toxocara canis]
Length=156

 Score = 93.6 bits (231),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIG+PHTVPCKVTGKCGSV +R++PAPRG GIV+A VPKK+LQ AG+ED
Sbjct  49   WGNKIGQPHTVPCKVTGKCGSVLMRLIPAPRGTGIVSAPVPKKLLQMAGVED  100



>gb|EPY24367.1| small subunit ribosomal protein S2e [Strigomonas culicis]
Length=269

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG PHT+P KVTGKCGSV+VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  157  WGNKIGDPHTIPMKVTGKCGSVSVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  209



>ref|XP_008473023.1| PREDICTED: 40S ribosomal protein S2 [Diaphorina citri]
 gb|ABG81992.1| putative ribosomal protein S2 [Diaphorina citri]
Length=273

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV A VPKK+LQ AGIED
Sbjct  157  WGNKIGKPHTVPCKVTGKCGSVQVRLIPAPRGTGIVGAPVPKKLLQMAGIED  208



>ref|XP_003723777.1| PREDICTED: 40S ribosomal protein S2-like [Strongylocentrotus 
purpuratus]
Length=159

 Score = 93.6 bits (231),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+L  AGIED
Sbjct  62   WGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLHMAGIED  113



>gb|ACJ72068.1| ribosomal protein S2 [Placozoa sp. H2]
Length=100

 Score = 92.0 bits (227),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIG PHTVPCKVTGKCGSV++R++PAPRG GIV+A VPKK+LQ AG+ED
Sbjct  33   WGNKIGLPHTVPCKVTGKCGSVSMRLIPAPRGTGIVSAPVPKKLLQMAGVED  84



>gb|EPY38096.1| small subunit ribosomal protein S2e [Angomonas deanei]
Length=227

 Score = 94.7 bits (234),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGS++VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  119  WGNKIGEPHTIPMKVTGKCGSISVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  171



>gb|EFN60457.1| 40S ribosomal protein S2 [Camponotus floridanus]
Length=278

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHT+PCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ AGIED
Sbjct  161  WGNKIGKPHTIPCKVTGKCGSVQVRLIPAPRGTGIVSAPVPKKLLQMAGIED  212



>ref|XP_001567410.1| 40S ribosomal protein S2 [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM42847.1| 40S ribosomal protein S2 [Leishmania braziliensis MHOM/BR/75/M2904]
Length=267

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  158  WGNKIGEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  210



>ref|XP_001689670.1| ribosomal protein S2, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP09408.1| ribosomal protein S2 [Chlamydomonas reinhardtii]
Length=274

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGK HTVP KVTGKCGSVT+R+ PAPRGAGIVAAR PKKVLQ AGIED
Sbjct  156  WGNKIGKVHTVPTKVTGKCGSVTIRLTPAPRGAGIVAARTPKKVLQMAGIED  207



>ref|XP_005925565.1| PREDICTED: uncharacterized protein LOC102310332 [Haplochromis 
burtoni]
Length=346

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIGKPHTVPCKVTG+CGSV VR++PAPRG GIV+A VPKK+L  AGI+D
Sbjct  223  WGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDD  274



>ref|XP_003877885.1| 40S ribosomal protein S2 [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ29429.1| 40S ribosomal protein S2 [Leishmania mexicana MHOM/GT/2001/U1103]
Length=264

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  155  WGNKIGEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  207



>ref|XP_003392409.1| 40S ribosomal protein S2 [Leishmania infantum JPCM5]
 emb|CBZ08570.1| 40S ribosomal protein S2 [Leishmania infantum JPCM5]
Length=265

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  156  WGNKIGEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  208



>gb|AEE62425.1| unknown [Dendroctonus ponderosae]
Length=283

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIG+PHTVPCKVTGKCGSVTVR++PAPRG GIV+A  PKK+LQ AGIED
Sbjct  162  WGNKIGQPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPFPKKLLQMAGIED  213



>gb|ERG80278.1| 40s ribosomal protein s2 [Ascaris suum]
Length=324

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIED  157
            WGNKIG+PHTVPCKVTGKCGSV VR++PAPRG GIV+A VPKK+LQ +G+ED
Sbjct  214  WGNKIGQPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLQMSGVED  265



>emb|CAX76168.1| small subunit ribosomal protein S2e [Schistosoma japonicum]
 emb|CAX70954.1| small subunit ribosomal protein S2e [Schistosoma japonicum]
Length=260

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGN IGKPHTVPCKVTGKCGSV+VR++PAPRG GIV A VPKK+LQ AGIEDV
Sbjct  150  WGNLIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVGAPVPKKLLQMAGIEDV  202



>ref|XP_001682583.1| 40S ribosomal protein S2 [Leishmania major strain Friedlin]
 emb|CAJ07091.1| 40S ribosomal protein S2 [Leishmania major strain Friedlin]
Length=265

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  156  WGNKIGEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  208



>gb|AAP06172.1| SJCHGC06175 protein [Schistosoma japonicum]
 emb|CAX76169.1| small subunit ribosomal protein S2e [Schistosoma japonicum]
 emb|CAX76171.1| small subunit ribosomal protein S2e [Schistosoma japonicum]
 emb|CAX70953.1| small subunit ribosomal protein S2e [Schistosoma japonicum]
 emb|CAX70955.1| small subunit ribosomal protein S2e [Schistosoma japonicum]
Length=260

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGN IGKPHTVPCKVTGKCGSV+VR++PAPRG GIV A VPKK+LQ AGIEDV
Sbjct  150  WGNLIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVGAPVPKKLLQMAGIEDV  202



>ref|XP_010701735.1| 40S ribosomal protein S2 [Leishmania panamensis]
 gb|AIO00935.1| 40S ribosomal protein S2 [Leishmania panamensis]
Length=267

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  158  WGNKIGEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  210



>ref|XP_001467728.1| 40S ribosomal protein S2 [Leishmania infantum JPCM5]
 ref|XP_003863464.1| 40S ribosomal protein S2 [Leishmania donovani]
 emb|CAM70793.1| 40S ribosomal protein S2 [Leishmania infantum JPCM5]
 emb|CBZ36778.1| 40S ribosomal protein S2 [Leishmania donovani]
Length=264

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIEDV  160
            WGNKIG+PHT+P KVTGKCGSV VR+VPAPRG GIVAA VPKK+L+FAG+EDV
Sbjct  155  WGNKIGEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAAPVPKKILEFAGVEDV  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519368764968