BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16349_g1_i3 len=759 path=[822:0-45 868:46-221 1129:222-758]

Length=759
                                                                      Score     E

ref|XP_009597872.1|  PREDICTED: cancer-related nucleoside-triphos...    159   6e-70   
ref|XP_009794034.1|  PREDICTED: cancer-related nucleoside-triphos...    155   5e-69   
ref|XP_002521720.1|  ATP binding protein, putative                      149   1e-63   Ricinus communis
gb|KDP43768.1|  hypothetical protein JCGZ_22395                         150   1e-63   
ref|XP_011096975.1|  PREDICTED: cancer-related nucleoside-triphos...    143   3e-63   
ref|XP_010029581.1|  PREDICTED: cancer-related nucleoside-triphos...    137   3e-61   
ref|XP_004985848.1|  PREDICTED: cancer-related nucleoside-triphos...    149   7e-61   
ref|XP_004985847.1|  PREDICTED: cancer-related nucleoside-triphos...    148   1e-60   
ref|XP_009389170.1|  PREDICTED: cancer-related nucleoside-triphos...    140   1e-59   
ref|XP_003612365.1|  Nucleoside-triphosphatase, putative                145   6e-59   
gb|EYU18763.1|  hypothetical protein MIMGU_mgv1a014330mg                135   8e-59   
gb|AFK47755.1|  unknown                                                 145   1e-58   
ref|NP_001237831.1|  uncharacterized protein LOC100527302               137   2e-58   
ref|XP_008448475.1|  PREDICTED: cancer-related nucleoside-triphos...    138   2e-58   
ref|XP_002465924.1|  hypothetical protein SORBIDRAFT_01g048330          140   1e-57   Sorghum bicolor [broomcorn]
ref|XP_004159739.1|  PREDICTED: cancer-related nucleoside-triphos...    135   2e-57   
ref|XP_007046507.1|  Nucleoside-triphosphatase C1orf57 isoform 1        135   1e-56   
ref|XP_007046508.1|  Nucleoside-triphosphatase C1orf57 isoform 2        135   1e-56   
ref|XP_008361331.1|  PREDICTED: cancer-related nucleoside-triphos...    137   2e-56   
gb|KEH27623.1|  cancer-related nucleoside-triphosphatase-like pro...    145   4e-56   
ref|XP_004146174.1|  PREDICTED: cancer-related nucleoside-triphos...    134   9e-56   
ref|XP_004512269.1|  PREDICTED: cancer-related nucleoside-triphos...    136   1e-55   
ref|XP_002865090.1|  hypothetical protein ARALYDRAFT_332964             131   1e-55   
ref|XP_007138453.1|  hypothetical protein PHAVU_009G210300g             136   4e-55   
ref|XP_010557441.1|  PREDICTED: cancer-related nucleoside-triphos...    127   6e-55   
ref|XP_008448472.1|  PREDICTED: cancer-related nucleoside-triphos...    139   2e-54   
ref|XP_011096976.1|  PREDICTED: cancer-related nucleoside-triphos...    144   5e-54   
gb|KHG07846.1|  Cancer-related nucleoside-triphosphatase                126   6e-53   
ref|XP_009597871.1|  PREDICTED: cancer-related nucleoside-triphos...    130   2e-52   
ref|NP_001032157.1|  uncharacterized protein                            122   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444856.1|  PREDICTED: cancer-related nucleoside-triphos...    133   1e-51   
ref|XP_010466294.1|  PREDICTED: cancer-related nucleoside-triphos...    129   1e-50   
ref|XP_010444855.1|  PREDICTED: cancer-related nucleoside-triphos...    129   2e-50   
gb|KFK28261.1|  hypothetical protein AALP_AA8G493800                    126   6e-50   
ref|XP_010466286.1|  PREDICTED: cancer-related nucleoside-triphos...    126   1e-49   
ref|XP_010444853.1|  PREDICTED: cancer-related nucleoside-triphos...    133   1e-48   
ref|XP_010484703.1|  PREDICTED: cancer-related nucleoside-triphos...    125   2e-48   
ref|XP_010444852.1|  PREDICTED: cancer-related nucleoside-triphos...    129   3e-47   
ref|XP_010484702.1|  PREDICTED: cancer-related nucleoside-triphos...    125   5e-47   
ref|XP_010466277.1|  PREDICTED: cancer-related nucleoside-triphos...    129   6e-47   
ref|XP_010466269.1|  PREDICTED: cancer-related nucleoside-triphos...    125   8e-46   
ref|XP_006572836.1|  PREDICTED: uncharacterized protein LOC100527...    115   3e-45   
gb|KEH27622.1|  cancer-related nucleoside-triphosphatase-like pro...    109   7e-45   
gb|KEH27625.1|  cancer-related nucleoside-triphosphatase-like pro...    109   3e-44   
ref|XP_008241937.1|  PREDICTED: cancer-related nucleoside-triphos...    154   2e-42   
ref|XP_004234510.1|  PREDICTED: cancer-related nucleoside-triphos...    154   3e-42   
ref|XP_006343328.1|  PREDICTED: cancer-related nucleoside-triphos...    153   6e-42   
ref|XP_007202622.1|  hypothetical protein PRUPE_ppa011922mg             152   2e-41   
ref|XP_011096977.1|  PREDICTED: cancer-related nucleoside-triphos...    150   4e-41   
ref|XP_010103255.1|  Cancer-related nucleoside-triphosphatase-lik...    149   8e-41   
ref|XP_008809107.1|  PREDICTED: cancer-related nucleoside-triphos...    149   2e-40   
ref|XP_010266192.1|  PREDICTED: cancer-related nucleoside-triphos...    149   2e-40   
ref|XP_010266191.1|  PREDICTED: cancer-related nucleoside-triphos...    149   4e-40   
ref|XP_002273009.1|  PREDICTED: cancer-related nucleoside-triphos...    147   6e-40   Vitis vinifera
ref|NP_974998.1|  uncharacterized protein                               104   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287726.1|  PREDICTED: cancer-related nucleoside-triphos...    144   1e-38   
emb|CDP01789.1|  unnamed protein product                                142   6e-38   
ref|XP_010918267.1|  PREDICTED: cancer-related nucleoside-triphos...    142   1e-37   
gb|EEC74447.1|  hypothetical protein OsI_09852                          141   1e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_006425281.1|  hypothetical protein CICLE_v10026547mg             141   2e-37   
ref|XP_011022175.1|  PREDICTED: cancer-related nucleoside-triphos...    141   2e-37   
gb|EMT32800.1|  Nucleoside-triphosphatase THEP1                         138   4e-37   
ref|XP_009359592.1|  PREDICTED: cancer-related nucleoside-triphos...    140   5e-37   
ref|XP_009359593.1|  PREDICTED: cancer-related nucleoside-triphos...    140   6e-37   
ref|XP_006467082.1|  PREDICTED: cancer-related nucleoside-triphos...    139   7e-37   
ref|XP_006467081.1|  PREDICTED: cancer-related nucleoside-triphos...    139   8e-37   
tpg|DAA43161.1|  TPA: hypothetical protein ZEAMMB73_715792              135   2e-36   
ref|XP_010229251.1|  PREDICTED: cancer-related nucleoside-triphos...    140   2e-36   
ref|XP_010229252.1|  PREDICTED: cancer-related nucleoside-triphos...    140   4e-36   
tpg|DAA43163.1|  TPA: hypothetical protein ZEAMMB73_715792              137   9e-36   
ref|XP_008650688.1|  PREDICTED: cancer-related nucleoside-triphos...    137   2e-35   
ref|XP_010695204.1|  PREDICTED: cancer-related nucleoside-triphos...    135   4e-35   
ref|XP_010466301.1|  PREDICTED: cancer-related nucleoside-triphos...  90.1    8e-35   
dbj|BAK01424.1|  predicted protein                                      134   1e-34   
ref|XP_010484704.1|  PREDICTED: cancer-related nucleoside-triphos...  89.0    1e-34   
ref|XP_006281185.1|  hypothetical protein CARUB_v10027220mg             133   2e-34   
ref|XP_006382998.1|  hypothetical protein POPTR_0005s10450g             125   1e-33   
ref|NP_001048856.1|  Os03g0130700                                       138   8e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006855733.1|  hypothetical protein AMTR_s00044p00159530          128   1e-32   
gb|EMS63092.1|  Nucleoside-triphosphatase THEP1                         135   6e-32   
ref|NP_974997.1|  uncharacterized protein                               122   4e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41625.1|  unknown                                                 120   2e-30   
ref|XP_008448476.1|  PREDICTED: uncharacterized protein LOC103490...    120   6e-30   
ref|XP_006467083.1|  PREDICTED: cancer-related nucleoside-triphos...    121   7e-30   
ref|XP_006281186.1|  hypothetical protein CARUB_v10027220mg             120   8e-30   
gb|KEH27626.1|  cancer-related nucleoside-triphosphatase-like pro...    111   2e-26   
ref|XP_008809109.1|  PREDICTED: cancer-related nucleoside-triphos...    112   2e-26   
ref|XP_008809108.1|  PREDICTED: cancer-related nucleoside-triphos...    112   3e-26   
tpg|DAA43162.1|  TPA: hypothetical protein ZEAMMB73_715792              106   2e-25   
gb|KEH27624.1|  cancer-related nucleoside-triphosphatase-like pro...    101   6e-23   
gb|ABF93803.1|  expressed protein                                       108   6e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002068320.1|  GK13424                                          68.9    1e-22   Drosophila willistoni
ref|XP_010863431.1|  PREDICTED: cancer-related nucleoside-triphos...  68.2    1e-22   
ref|XP_001956976.1|  GF10190                                          70.5    2e-22   Drosophila ananassae
ref|XP_002739152.2|  PREDICTED: cancer-related nucleoside-triphos...  70.9    4e-22   Saccoglossus kowalevskii
gb|EKC25319.1|  Nucleoside-triphosphatase C1orf57                     68.6    7e-22   
ref|XP_003723869.1|  PREDICTED: cancer-related nucleoside-triphos...  69.7    8e-22   
ref|XP_005291265.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    5e-21   
gb|ACQ58852.1|  Probable UPF0334 kinase-like protein C1orf57          67.4    7e-21   Anoplopoma fimbria
gb|KHN41819.1|  Nucleoside-triphosphatase THEP1                       95.5    8e-21   
ref|NP_001134734.1|  Probable UPF0334 kinase-like protein C1orf57     66.2    1e-20   Salmo salar
ref|NP_001003463.1|  cancer-related nucleoside-triphosphatase         65.1    6e-20   Danio rerio [leopard danio]
ref|XP_002047842.1|  GJ13661                                          65.5    7e-20   Drosophila virilis
ref|XP_002989823.1|  hypothetical protein SELMODRAFT_48869            75.1    1e-19   
emb|CCI55420.1|  PH01B031C15.3                                        93.2    2e-19   
gb|ACH44231.1|  putative RIKEN cDNA 2310079N02 variant 2              68.6    6e-19   Taeniopygia guttata
ref|NP_001153395.1|  nucleoside-triphosphatase C1orf57                68.9    8e-19   Taeniopygia guttata
ref|XP_005518594.1|  PREDICTED: cancer-related nucleoside-triphos...  68.9    8e-19   
ref|XP_005518595.1|  PREDICTED: cancer-related nucleoside-triphos...  68.9    8e-19   
ref|XP_009091097.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    1e-18   
ref|XP_009091096.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    1e-18   
ref|XP_001984585.1|  GH14943                                          67.4    1e-18   Drosophila grimshawi
ref|XP_005487657.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    3e-18   
ref|XP_005487656.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    3e-18   
ref|WP_004082498.1|  MULTISPECIES: ATPase AAA                         64.3    3e-18   
gb|EMP27259.1|  Cancer-related nucleoside-triphosphatase              61.6    6e-18   
ref|XP_007068929.1|  PREDICTED: cancer-related nucleoside-triphos...  61.6    7e-18   
ref|WP_011943465.1|  ATPase AAA                                       61.6    8e-18   
ref|XP_005963769.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    9e-18   
ref|XP_008167956.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    1e-17   
ref|XP_001973572.1|  GG13264                                          71.6    1e-17   Drosophila erecta
ref|XP_002404843.1|  conserved hypothetical protein                   59.3    1e-17   Ixodes scapularis [blacklegged tick]
ref|WP_012310814.1|  MULTISPECIES: ATPase AAA                         61.6    2e-17   
ref|XP_001626430.1|  predicted protein                                67.4    2e-17   Nematostella vectensis
ref|XP_007238516.1|  PREDICTED: cancer-related nucleoside-triphos...  60.1    2e-17   
ref|XP_006274565.1|  PREDICTED: cancer-related nucleoside-triphos...  59.3    3e-17   
ref|XP_005602754.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    3e-17   
ref|XP_006122141.1|  PREDICTED: cancer-related nucleoside-triphos...  59.3    4e-17   
ref|XP_006531346.1|  PREDICTED: cancer-related nucleoside-triphos...  65.9    5e-17   
ref|WP_015919151.1|  ATPase AAA                                       65.5    5e-17   
ref|XP_005177692.1|  PREDICTED: cancer-related nucleoside-triphos...  58.2    7e-17   
ref|WP_029683125.1|  ATPase AAA                                       61.6    7e-17   
ref|XP_009679444.1|  PREDICTED: cancer-related nucleoside-triphos...  57.4    1e-16   
ref|XP_008485077.1|  PREDICTED: cancer-related nucleoside-triphos...  64.3    2e-16   
ref|WP_038033251.1|  MULTISPECIES: ATPase AAA                         61.6    2e-16   
ref|XP_009862484.1|  PREDICTED: cancer-related nucleoside-triphos...  61.6    4e-16   
ref|XP_005169614.1|  PREDICTED: cancer-related nucleoside-triphos...  59.7    5e-16   
ref|XP_002095380.1|  GE22362                                          67.0    6e-16   Drosophila yakuba
gb|AAY54986.1|  IP06602p                                              65.1    1e-15   Drosophila melanogaster
ref|XP_005838624.1|  hypothetical protein GUITHDRAFT_66044            57.0    1e-15   
ref|XP_008201729.1|  PREDICTED: cancer-related nucleoside-triphos...  61.6    1e-15   
ref|XP_004527079.1|  PREDICTED: cancer-related nucleoside-triphos...  60.1    2e-15   
ref|XP_002086292.1|  GE22954                                          65.9    2e-15   Drosophila yakuba
ref|XP_002085737.1|  GD12145                                          64.3    3e-15   Drosophila simulans
ref|WP_035107288.1|  hypothetical protein                             61.2    3e-15   
ref|XP_008320552.1|  PREDICTED: cancer-related nucleoside-triphos...  56.2    3e-15   
ref|WP_004068940.1|  NTPase                                           59.7    5e-15   
ref|XP_006027513.1|  PREDICTED: cancer-related nucleoside-triphos...  56.2    6e-15   
ref|WP_010880824.1|  nucleoside triphosphatase                        59.3    7e-15   
ref|NP_649279.2|  CG10581                                             62.0    9e-15   Drosophila melanogaster
ref|WP_020251725.1|  MULTISPECIES: hypothetical protein               58.2    1e-14   
gb|ETN64133.1|  hypothetical protein AND_004133                       53.9    2e-14   
ref|WP_014867340.1|  Nucleoside-triphosphatase THEP1                  55.5    2e-14   
gb|AGC92685.1|  nucleoside-triphosphatase C1orf57-like protein        59.7    2e-14   
ref|XP_002935867.2|  PREDICTED: cancer-related nucleoside-triphos...  55.8    4e-14   
gb|KFW77852.1|  Cancer-related nucleoside-triphosphatase              60.5    4e-14   
ref|WP_013907683.1|  thymidylate kinase                               55.1    5e-14   
ref|WP_008868763.1|  protein of unknown function DUF265               61.6    5e-14   
ref|XP_002949453.1|  hypothetical protein VOLCADRAFT_80686            53.9    6e-14   
gb|KFV73679.1|  Cancer-related nucleoside-triphosphatase              57.4    7e-14   
gb|KFD66025.1|  hypothetical protein M514_21848                       57.4    7e-14   
ref|WP_009200387.1|  putative GTPase domain, era and thdf protein     59.7    8e-14   
pdb|1YE8|A  Chain A, Crystal Structure Of Thep1 From The Hyperthe...  55.1    1e-13   
ref|XP_009066350.1|  hypothetical protein LOTGIDRAFT_223139           76.6    1e-13   
ref|XP_001353210.2|  GA10412                                          67.0    1e-13   Drosophila pseudoobscura pseudoobscura
ref|XP_003215858.1|  PREDICTED: cancer-related nucleoside-triphos...  75.9    2e-13   
ref|WP_017889637.1|  hypothetical protein                             59.7    2e-13   
ref|WP_011752670.1|  nucleoside triphosphatase                        55.5    4e-13   
gb|KFO53909.1|  Cancer-related nucleoside-triphosphatase              57.8    5e-13   
ref|XP_008641593.1|  PREDICTED: cancer-related nucleoside-triphos...  58.2    6e-13   
ref|WP_008512234.1|  putative nucleotide kinase                       52.0    6e-13   
ref|WP_017872625.1|  hypothetical protein                             55.8    6e-13   
gb|KFB44453.1|  AGAP005921-PA-like protein                            51.2    6e-13   
ref|XP_004336830.1|  Nucleoside-triphosphatase                        51.2    6e-13   
gb|EHJ63733.1|  ATP binding protein                                   59.7    6e-13   
ref|WP_038002232.1|  hypothetical protein                             63.9    9e-13   
ref|WP_018032273.1|  hypothetical protein                             60.5    1e-12   
ref|WP_029521396.1|  nucleoside triphosphatase                        55.1    1e-12   
ref|XP_007427015.1|  PREDICTED: cancer-related nucleoside-triphos...  73.6    1e-12   
ref|WP_015738953.1|  putative NTPase                                  54.3    2e-12   
gb|AIS32628.1|  nucleotide kinase related protein                     53.1    2e-12   
ref|XP_002040752.1|  GM22168                                          57.0    2e-12   Drosophila sechellia
ref|WP_012963463.1|  nucleoside triphosphatase                        54.3    3e-12   
ref|WP_015849726.1|  NTPase                                           60.5    3e-12   
ref|WP_022947809.1|  ATPase AAA                                       54.7    3e-12   
ref|XP_002780600.1|  conserved hypothetical protein                   52.0    3e-12   Perkinsus marinus ATCC 50983
emb|CEA12369.1|  Nucleoside-triphosphatase                            53.1    4e-12   
ref|XP_004077534.1|  PREDICTED: cancer-related nucleoside-triphos...  72.0    5e-12   
ref|WP_013296246.1|  nucleoside triphosphatase                        56.2    5e-12   
dbj|BAJ49181.1|  nucleotide kinase                                    53.5    6e-12   
ref|XP_004659756.1|  PREDICTED: cancer-related nucleoside-triphos...  71.2    7e-12   
ref|WP_037562141.1|  hypothetical protein                             52.8    7e-12   
ref|WP_025781087.1|  hypothetical protein                             53.5    8e-12   
ref|WP_020863369.1|  nucleotide kinase                                52.8    1e-11   
ref|WP_029522413.1|  nucleoside triphosphatase                        55.1    1e-11   
dbj|BAL54341.1|  NTPase                                               51.6    1e-11   
ref|XP_010560953.1|  PREDICTED: cancer-related nucleoside-triphos...  70.5    1e-11   
ref|WP_014127739.1|  nucleoside triphosphatase                        59.7    2e-11   
gb|AIJ04966.1|  putative NTPase                                       55.8    2e-11   
ref|XP_006807736.1|  PREDICTED: cancer-related nucleoside-triphos...  70.1    2e-11   
ref|XP_003441090.1|  PREDICTED: cancer-related nucleoside-triphos...  70.1    2e-11   
ref|XP_002009062.1|  GI11469                                          70.1    2e-11   Drosophila mojavensis
gb|ETE73105.1|  Cancer-related nucleoside-triphosphatase              69.7    3e-11   
ref|XP_005795187.1|  PREDICTED: cancer-related nucleoside-triphos...  69.7    3e-11   
ref|XP_007626140.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    4e-11   
ref|XP_004451086.1|  PREDICTED: cancer-related nucleoside-triphos...  68.2    4e-11   
ref|XP_004559778.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    4e-11   
ref|WP_007223398.1|  ATPase AAA                                       53.5    4e-11   
ref|XP_003978149.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    4e-11   
ref|XP_009905297.1|  PREDICTED: cancer-related nucleoside-triphos...  69.3    4e-11   
ref|WP_013335378.1|  hypothetical protein                             56.6    5e-11   
ref|XP_005146043.1|  PREDICTED: cancer-related nucleoside-triphos...  68.9    5e-11   
sp|Q58954.2|NTPTH_METJA  RecName: Full=Nucleoside-triphosphatase ...  57.8    6e-11   Methanocaldococcus jannaschii
ref|XP_005992674.1|  PREDICTED: cancer-related nucleoside-triphos...  68.9    6e-11   
ref|WP_010871083.1|  NTPase                                           57.8    7e-11   
ref|XP_006870645.1|  PREDICTED: cancer-related nucleoside-triphos...  68.6    7e-11   
ref|XP_008428449.1|  PREDICTED: cancer-related nucleoside-triphos...  68.6    7e-11   
ref|XP_007551546.1|  PREDICTED: cancer-related nucleoside-triphos...  68.6    7e-11   
ref|XP_007551550.1|  PREDICTED: cancer-related nucleoside-triphos...  68.6    8e-11   
ref|WP_018194653.1|  MULTISPECIES: hypothetical protein               55.8    8e-11   
gb|AJB41413.1|  putative NTPase                                       50.4    8e-11   
ref|NP_001279961.1|  nucleoside-triphosphatase, cancer-related        68.6    8e-11   
ref|XP_007551551.1|  PREDICTED: cancer-related nucleoside-triphos...  68.6    8e-11   
ref|WP_004031419.1|  nucleoside-triphosphatase                        48.9    9e-11   
ref|XP_007551547.1|  PREDICTED: cancer-related nucleoside-triphos...  68.6    9e-11   
ref|WP_039014260.1|  hypothetical protein                             55.1    9e-11   
ref|WP_013466898.1|  NTPase                                           53.5    9e-11   
ref|WP_012980325.1|  NTPase                                           55.5    1e-10   
gb|KFM79386.1|  Cancer-related nucleoside-triphosphatase-like pro...  66.6    1e-10   
emb|CDQ66315.1|  unnamed protein product                              65.5    1e-10   
ref|XP_004578589.1|  PREDICTED: cancer-related nucleoside-triphos...  68.2    1e-10   
ref|XP_006638609.1|  PREDICTED: cancer-related nucleoside-triphos...  68.2    1e-10   
ref|XP_004451085.1|  PREDICTED: cancer-related nucleoside-triphos...  68.2    1e-10   
ref|XP_004712266.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    1e-10   
ref|XP_004432432.1|  PREDICTED: cancer-related nucleoside-triphos...  68.2    1e-10   
ref|XP_004456730.1|  PREDICTED: cancer-related nucleoside-triphos...  68.2    1e-10   
ref|XP_002717409.1|  PREDICTED: cancer-related nucleoside-triphos...  68.2    1e-10   Oryctolagus cuniculus [domestic rabbit]
ref|WP_020962919.1|  hypothetical protein                             50.8    1e-10   
ref|XP_004408695.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    1e-10   
ref|XP_004819629.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    1e-10   
ref|XP_005273368.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    1e-10   
ref|XP_004691187.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    1e-10   
dbj|BAC39726.1|  unnamed protein product                              66.6    1e-10   Mus musculus [mouse]
ref|XP_008499334.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    1e-10   
ref|XP_004372866.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    1e-10   
ref|XP_006146035.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    1e-10   
ref|XP_004281627.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    2e-10   
ref|XP_003410945.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    2e-10   
ref|XP_003496852.1|  PREDICTED: cancer-related nucleoside-triphos...  67.8    2e-10   
ref|XP_003893809.2|  PREDICTED: cancer-related nucleoside-triphos...  66.2    2e-10   
ref|NP_001026694.1|  nucleoside-triphosphatase C1orf57 homolog        67.4    2e-10   Gallus gallus [bantam]
ref|XP_003204074.1|  PREDICTED: cancer-related nucleoside-triphos...  67.4    2e-10   
gb|AIY90358.1|  nucleoside triphosphatase                             52.8    2e-10   
ref|XP_006982554.1|  PREDICTED: cancer-related nucleoside-triphos...  67.4    2e-10   
ref|XP_008299637.1|  PREDICTED: cancer-related nucleoside-triphos...  67.4    2e-10   
ref|XP_005064556.1|  PREDICTED: cancer-related nucleoside-triphos...  67.0    2e-10   
gb|ELU01135.1|  hypothetical protein CAPTEDRAFT_94348                 67.0    3e-10   
ref|XP_006531347.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    3e-10   
ref|XP_010736100.1|  PREDICTED: cancer-related nucleoside-triphos...  67.0    3e-10   
ref|XP_006106294.1|  PREDICTED: cancer-related nucleoside-triphos...  67.0    3e-10   
ref|XP_008148085.1|  PREDICTED: cancer-related nucleoside-triphos...  67.0    3e-10   
ref|WP_013100023.1|  NTPase                                           53.5    3e-10   
ref|XP_008844038.1|  PREDICTED: cancer-related nucleoside-triphos...  67.0    3e-10   
ref|XP_848743.2|  PREDICTED: cancer-related nucleoside-triphospha...  68.9    3e-10   Canis lupus familiaris [dogs]
ref|XP_008579073.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    3e-10   
gb|EAW69978.1|  chromosome 1 open reading frame 57, isoform CRA_c     66.2    3e-10   
ref|XP_001760458.1|  predicted protein                                53.5    3e-10   
ref|XP_002809340.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    4e-10   
ref|XP_006903407.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    4e-10   
ref|XP_010787795.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    4e-10   
ref|XP_005891961.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    4e-10   
ref|XP_004028654.1|  PREDICTED: cancer-related nucleoside-triphos...  66.6    4e-10   
ref|NP_001069284.1|  cancer-related nucleoside-triphosphatase hom...  66.2    4e-10   Bos taurus [bovine]
ref|XP_010705306.1|  PREDICTED: cancer-related nucleoside-triphos...  67.0    4e-10   
ref|XP_010836897.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    4e-10   
ref|NP_115700.1|  cancer-related nucleoside-triphosphatase            66.2    4e-10   Homo sapiens [man]
ref|XP_007173826.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    4e-10   
ref|WP_029230042.1|  nucleoside triphosphatase                        48.5    4e-10   
ref|XP_009439948.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    4e-10   
pdb|2I3B|A  Chain A, Solution Structure Of A Human Cancer-Related...  66.2    4e-10   
ref|XP_003267317.1|  PREDICTED: LOW QUALITY PROTEIN: cancer-relat...  66.2    4e-10   
ref|NP_001253961.1|  nucleoside-triphosphatase, cancer-related        66.2    5e-10   
ref|XP_001492414.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    5e-10   
ref|XP_006745157.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    5e-10   
ref|XP_004987884.1|  hypothetical protein PTSG_10957                  66.6    5e-10   
ref|XP_005345949.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    5e-10   
ref|XP_007467054.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    5e-10   
gb|EAW69976.1|  chromosome 1 open reading frame 57, isoform CRA_a     66.6    5e-10   
ref|XP_001369101.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    5e-10   
ref|XP_004021405.1|  PREDICTED: cancer-related nucleoside-triphos...  66.2    6e-10   
dbj|BAB31712.1|  unnamed protein product                              65.9    6e-10   
ref|XP_003797512.1|  PREDICTED: cancer-related nucleoside-triphos...  65.9    6e-10   
ref|XP_006077153.1|  PREDICTED: cancer-related nucleoside-triphos...  65.9    6e-10   
ref|XP_005699036.1|  PREDICTED: cancer-related nucleoside-triphos...  65.9    6e-10   
ref|WP_029552014.1|  nucleoside triphosphatase                        52.0    7e-10   
ref|NP_079912.1|  cancer-related nucleoside-triphosphatase homolog    65.9    7e-10   
ref|WP_013683278.1|  nucleoside triphosphatase                        47.8    7e-10   
ref|WP_012547179.1|  hypothetical protein                             48.1    8e-10   
ref|XP_010980946.1|  PREDICTED: cancer-related nucleoside-triphos...  65.5    9e-10   
ref|WP_015321134.1|  putative nucleotide kinase                       50.4    9e-10   
ref|WP_013537378.1|  Nucleoside-triphosphatase                        47.8    1e-09   
ref|XP_004620377.1|  PREDICTED: cancer-related nucleoside-triphos...  65.5    1e-09   
ref|XP_010950406.1|  PREDICTED: cancer-related nucleoside-triphos...  65.1    1e-09   
ref|WP_012991207.1|  nucleoside triphosphatase                        47.0    2e-09   
ref|XP_010620255.1|  PREDICTED: cancer-related nucleoside-triphos...  64.7    2e-09   
ref|XP_010620254.1|  PREDICTED: cancer-related nucleoside-triphos...  64.7    3e-09   
ref|XP_001692060.1|  hypothetical protein CHLREDRAFT_100906           63.9    3e-09   
ref|WP_013824931.1|  nucleoside-triphosphatase                        45.1    3e-09   
ref|WP_038260760.1|  hypothetical protein [                           55.5    3e-09   
gb|AHF80030.1|  ATP-binding protein                                   50.1    4e-09   
ref|XP_006567814.1|  PREDICTED: cancer-related nucleoside-triphos...  48.1    4e-09   
dbj|BAM70218.1|  conserved hypothetical protein                       44.3    4e-09   
ref|XP_007127654.1|  PREDICTED: cancer-related nucleoside-triphos...  63.2    4e-09   
ref|XP_001121167.2|  PREDICTED: cancer-related nucleoside-triphos...  48.1    4e-09   
ref|WP_021328483.1|  hypothetical protein                             44.7    5e-09   
ref|XP_005405020.1|  PREDICTED: cancer-related nucleoside-triphos...  63.5    5e-09   
ref|WP_013680464.1|  nucleoside triphosphatase                        60.8    5e-09   
ref|WP_013748898.1|  NTPase                                           49.7    6e-09   
ref|XP_010620253.1|  PREDICTED: cancer-related nucleoside-triphos...  65.1    6e-09   
ref|WP_027986767.1|  hypothetical protein                             52.0    7e-09   
ref|WP_011011618.1|  NTPase                                           47.8    7e-09   
ref|XP_002760850.1|  PREDICTED: cancer-related nucleoside-triphos...  63.2    7e-09   
ref|XP_008320553.1|  PREDICTED: cancer-related nucleoside-triphos...  63.2    7e-09   
ref|NP_001128045.1|  cancer-related nucleoside-triphosphatase         62.8    7e-09   
ref|XP_004900545.1|  PREDICTED: cancer-related nucleoside-triphos...  62.8    8e-09   
ref|XP_003473546.2|  PREDICTED: cancer-related nucleoside-triphos...  62.8    8e-09   
ref|XP_004900544.1|  PREDICTED: cancer-related nucleoside-triphos...  62.8    8e-09   
ref|XP_004640914.1|  PREDICTED: cancer-related nucleoside-triphos...  64.3    9e-09   
ref|XP_004900542.1|  PREDICTED: cancer-related nucleoside-triphos...  62.8    9e-09   
ref|XP_007127653.1|  PREDICTED: cancer-related nucleoside-triphos...  62.8    9e-09   
ref|WP_030916654.1|  hypothetical protein                             45.1    9e-09   
ref|XP_004900543.1|  PREDICTED: cancer-related nucleoside-triphos...  62.8    9e-09   
emb|CAG05192.1|  unnamed protein product                              62.4    1e-08   
ref|XP_008122442.1|  PREDICTED: cancer-related nucleoside-triphos...  62.4    1e-08   
ref|WP_012583931.1|  hypothetical protein                             48.5    1e-08   
ref|XP_003696650.1|  PREDICTED: cancer-related nucleoside-triphos...  47.4    1e-08   
ref|XP_005110675.1|  PREDICTED: cancer-related nucleoside-triphos...  62.8    1e-08   
ref|XP_005110674.1|  PREDICTED: cancer-related nucleoside-triphos...  63.2    1e-08   
gb|KGK99755.1|  NTPase                                                46.2    1e-08   
ref|XP_001868934.1|  conserved hypothetical protein                   52.0    1e-08   
ref|WP_012675911.1|  nucleoside triphosphatase                        44.7    1e-08   
ref|XP_003940835.1|  PREDICTED: cancer-related nucleoside-triphos...  62.0    2e-08   
ref|WP_010884886.1|  NTPase                                           50.1    2e-08   
ref|WP_011249512.1|  NTPase                                           47.0    2e-08   
ref|WP_013905427.1|  NTPase                                           50.8    2e-08   
ref|NP_001188028.1|  nucleoside-triphosphatase c1orf57                61.6    2e-08   
ref|XP_008687774.1|  PREDICTED: cancer-related nucleoside-triphos...  61.2    3e-08   
ref|NP_001040309.1|  ATP binding protein                              48.1    3e-08   
ref|XP_009889465.1|  PREDICTED: cancer-related nucleoside-triphos...  62.0    3e-08   
ref|WP_029957378.1|  hypothetical protein                             47.0    3e-08   
gb|EZA61579.1|  Cancer-related nucleoside-triphosphatase-like pro...  50.8    4e-08   
ref|WP_039192819.1|  hypothetical protein                             56.6    4e-08   
ref|WP_010876692.1|  nucleoside triphosphatase                        43.5    4e-08   
ref|WP_010878317.1|  nucleoside triphosphatase                        49.7    5e-08   
gb|KFU94842.1|  Cancer-related nucleoside-triphosphatase              60.1    5e-08   
gb|KFQ12747.1|  Cancer-related nucleoside-triphosphatase              60.1    5e-08   
ref|XP_002984364.1|  hypothetical protein SELMODRAFT_48850            43.9    6e-08   
gb|AIG97692.1|  putative nucleotide kinase                            51.2    6e-08   
ref|WP_009589854.1|  DNA mistmatch repair protein MutT                45.1    6e-08   
ref|XP_009951237.1|  PREDICTED: cancer-related nucleoside-triphos...  60.5    6e-08   
ref|XP_002972788.1|  hypothetical protein SELMODRAFT_59230            43.9    6e-08   
ref|WP_020265535.1|  hypothetical protein                             60.1    6e-08   
ref|WP_014733812.1|  NTPase                                           43.5    7e-08   
ref|WP_012123208.1|  nucleoside triphosphatase                        52.8    7e-08   
gb|KFQ88986.1|  Cancer-related nucleoside-triphosphatase              59.7    8e-08   
ref|WP_013931875.1|  nucleoside triphosphatase                        48.5    8e-08   
gb|KFP99271.1|  Cancer-related nucleoside-triphosphatase              59.3    9e-08   
ref|WP_012185380.1|  nucleoside triphosphatase                        54.7    9e-08   
ref|XP_008579075.1|  PREDICTED: cancer-related nucleoside-triphos...  59.7    1e-07   
gb|KFV13870.1|  Cancer-related nucleoside-triphosphatase              59.7    1e-07   
ref|WP_011009283.1|  nucleoside triphosphatase                        55.1    1e-07   
ref|WP_010865968.1|  nucleoside triphosphatase                        48.1    1e-07   
ref|WP_011019195.1|  nucleoside triphosphatase                        46.6    1e-07   
ref|WP_030971629.1|  hypothetical protein                             43.5    1e-07   
gb|KFW93188.1|  Cancer-related nucleoside-triphosphatase              59.3    1e-07   
ref|XP_009910980.1|  PREDICTED: cancer-related nucleoside-triphos...  59.7    1e-07   
gb|EMC86054.1|  hypothetical protein A306_05450                       59.7    1e-07   
gb|KFP20385.1|  Cancer-related nucleoside-triphosphatase              59.3    1e-07   
ref|WP_014027354.1|  nucleoside triphosphatase                        53.9    1e-07   
gb|KFP43786.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
ref|WP_014122096.1|  NTPase                                           46.6    1e-07   
gb|KFV40414.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
gb|KFV11137.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
ref|XP_009932587.1|  PREDICTED: cancer-related nucleoside-triphos...  59.7    1e-07   
gb|KFZ46588.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
gb|KFM09229.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
gb|KFQ53243.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
ref|WP_015859168.1|  NTPase                                           45.4    1e-07   
gb|KGL98171.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
gb|KFQ62845.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
gb|KFQ29342.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
ref|WP_012020683.1|  nucleoside triphosphatase                        48.9    1e-07   
gb|KFZ58135.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
gb|KFQ91599.1|  Cancer-related nucleoside-triphosphatase              58.9    1e-07   
gb|KFW08700.1|  Cancer-related nucleoside-triphosphatase              58.9    2e-07   
gb|KFP58554.1|  Cancer-related nucleoside-triphosphatase              58.9    2e-07   
ref|WP_036702967.1|  DNA mismatch repair protein MutT                 43.1    2e-07   
ref|XP_009978126.1|  PREDICTED: cancer-related nucleoside-triphos...  59.3    2e-07   
gb|KFO83369.1|  Cancer-related nucleoside-triphosphatase              58.5    2e-07   
ref|WP_007260541.1|  nucleotide kinase related protein                46.2    2e-07   
ref|WP_009071533.1|  Protein of unknown function, DUF265              57.4    2e-07   
gb|KFP26909.1|  Cancer-related nucleoside-triphosphatase              58.5    2e-07   
gb|KFP61359.1|  Cancer-related nucleoside-triphosphatase              58.9    2e-07   
ref|XP_009819705.1|  PREDICTED: cancer-related nucleoside-triphos...  58.9    2e-07   
gb|KFV92277.1|  Cancer-related nucleoside-triphosphatase              58.5    2e-07   
ref|XP_009707112.1|  PREDICTED: cancer-related nucleoside-triphos...  58.9    2e-07   
ref|WP_015736593.1|  DNA mistmatch repair protein MutT                44.7    2e-07   
gb|EFB26417.1|  hypothetical protein PANDA_005337                     58.5    2e-07   
ref|WP_036664226.1|  DNA mismatch repair protein MutT                 44.7    2e-07   
gb|KFV61161.1|  Cancer-related nucleoside-triphosphatase              58.5    2e-07   
ref|XP_009327505.1|  PREDICTED: cancer-related nucleoside-triphos...  58.9    2e-07   
ref|XP_006758706.1|  PREDICTED: cancer-related nucleoside-triphos...  58.9    2e-07   
gb|EOA93299.1|  Putative UPF0334 kinase-like protein C1orf57          58.2    2e-07   
gb|AIU70690.1|  NTPase                                                47.4    2e-07   
ref|WP_014767772.1|  nucleoside triphosphatase                        44.3    3e-07   
ref|XP_005239228.1|  PREDICTED: cancer-related nucleoside-triphos...  59.3    3e-07   
ref|XP_005031012.1|  PREDICTED: cancer-related nucleoside-triphos...  58.5    3e-07   
ref|WP_012608479.1|  nucleoside triphosphatase                        45.1    3e-07   
gb|ELW68147.1|  Cancer-related nucleoside-triphosphatase              60.8    3e-07   
ref|XP_001849039.1|  conserved hypothetical protein                   47.4    3e-07   
gb|KFP88779.1|  Cancer-related nucleoside-triphosphatase              58.2    3e-07   
gb|KFR10443.1|  Cancer-related nucleoside-triphosphatase              57.8    3e-07   
ref|XP_009081120.1|  PREDICTED: cancer-related nucleoside-triphos...  58.2    4e-07   
ref|WP_011822065.1|  nucleoside triphosphatase                        45.4    4e-07   
ref|XP_005423293.1|  PREDICTED: cancer-related nucleoside-triphos...  58.2    4e-07   
gb|KFO05624.1|  Cancer-related nucleoside-triphosphatase              57.8    4e-07   
ref|WP_012712685.1|  ATPase AAA                                       50.1    4e-07   
gb|KFP76731.1|  Cancer-related nucleoside-triphosphatase              57.4    5e-07   
ref|WP_015662194.1|  hypothetical protein                             42.7    5e-07   
gb|KFQ27583.1|  Cancer-related nucleoside-triphosphatase              57.4    5e-07   
ref|XP_010390135.1|  PREDICTED: cancer-related nucleoside-triphos...  58.2    5e-07   
ref|XP_009560450.1|  PREDICTED: cancer-related nucleoside-triphos...  58.5    5e-07   
gb|KFV50149.1|  Cancer-related nucleoside-triphosphatase              57.4    5e-07   
ref|WP_008285816.1|  nucleoside triphosphatase                        57.4    5e-07   
gb|AIF69649.1|  hypothetical protein PAP_06255                        42.0    5e-07   
ref|WP_011276942.1|  nucleoside triphosphatase                        48.9    6e-07   
ref|XP_010080147.1|  PREDICTED: cancer-related nucleoside-triphos...  57.4    6e-07   
ref|XP_007936702.1|  PREDICTED: cancer-related nucleoside-triphos...  57.8    6e-07   
ref|WP_020060344.1|  hypothetical protein                             49.7    6e-07   
ref|XP_009506991.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    6e-07   
gb|ELR59137.1|  hypothetical protein M91_16219                        57.4    6e-07   
ref|XP_005043969.1|  PREDICTED: cancer-related nucleoside-triphos...  58.2    6e-07   
ref|XP_010002854.1|  PREDICTED: cancer-related nucleoside-triphos...  57.8    7e-07   
ref|XP_004776093.1|  PREDICTED: cancer-related nucleoside-triphos...  58.5    7e-07   
ref|XP_010163509.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    7e-07   
ref|WP_010477675.1|  NTPase                                           43.5    8e-07   
ref|WP_013129026.1|  nucleoside triphosphatase                        46.2    8e-07   
ref|XP_009642470.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    9e-07   
ref|WP_019177114.1|  hypothetical protein                             42.4    9e-07   
gb|KFP06495.1|  Cancer-related nucleoside-triphosphatase              56.6    9e-07   
ref|XP_002613578.1|  hypothetical protein BRAFLDRAFT_57781            57.0    9e-07   
ref|XP_002502753.1|  predicted protein                                58.9    9e-07   
ref|XP_010205438.1|  PREDICTED: cancer-related nucleoside-triphos...  56.6    1e-06   
ref|XP_005508762.1|  PREDICTED: cancer-related nucleoside-triphos...  57.4    1e-06   
ref|XP_010016850.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    1e-06   
ref|XP_010122521.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    1e-06   
ref|XP_001770237.1|  predicted protein                                55.8    1e-06   
ref|XP_007988002.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    1e-06   
ref|XP_008938184.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    1e-06   
ref|XP_009580289.1|  PREDICTED: cancer-related nucleoside-triphos...  56.6    1e-06   
ref|WP_022304626.1|  putative uncharacterized protein                 57.0    1e-06   
ref|XP_009484415.1|  PREDICTED: cancer-related nucleoside-triphos...  56.6    1e-06   
ref|XP_006998715.1|  PREDICTED: cancer-related nucleoside-triphos...  55.1    1e-06   
emb|CDW55456.1|  cancer nucleoside triphosphatase                     57.0    1e-06   
ref|WP_010076867.1|  hypothetical protein                             47.4    1e-06   
ref|XP_009280098.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    1e-06   
ref|XP_009469511.1|  PREDICTED: cancer-related nucleoside-triphos...  56.6    1e-06   
ref|XP_006183792.1|  PREDICTED: cancer-related nucleoside-triphos...  56.6    1e-06   
gb|AHL22516.1|  putative nucleotide kinase                            45.1    1e-06   
ref|WP_009992133.1|  MULTISPECIES: ATPase AAA                         48.5    1e-06   
ref|WP_012719298.1|  ATPase AAA                                       48.5    1e-06   
gb|KFO77075.1|  Cancer-related nucleoside-triphosphatase              56.2    1e-06   
ref|WP_024082781.1|  nucleoside triphosphatase                        48.9    1e-06   
gb|EKE02665.1|  hypothetical protein ACD_20C00347G0002                42.0    1e-06   
ref|WP_012953399.1|  ATPase AAA                                       48.5    1e-06   
ref|XP_010131852.1|  PREDICTED: cancer-related nucleoside-triphos...  57.0    2e-06   
ref|XP_010787796.1|  PREDICTED: cancer-related nucleoside-triphos...  56.2    2e-06   
ref|WP_015232807.1|  nucleotide kinase                                52.0    2e-06   
gb|KFQ71396.1|  Cancer-related nucleoside-triphosphatase              55.8    2e-06   
ref|WP_012571893.1|  NTPase                                           41.2    2e-06   
ref|XP_008525724.1|  PREDICTED: cancer-related nucleoside-triphos...  56.2    2e-06   
ref|XP_009038585.1|  hypothetical protein AURANDRAFT_28872            50.1    2e-06   
ref|XP_010280669.1|  PREDICTED: cancer-related nucleoside-triphos...  56.2    2e-06   
ref|XP_007086117.1|  PREDICTED: uncharacterized protein LOC102958747  58.2    2e-06   
ref|XP_007522991.1|  PREDICTED: cancer-related nucleoside-triphos...  57.4    2e-06   
ref|WP_014514418.1|  ATPase AAA                                       48.5    3e-06   
ref|XP_009869028.1|  PREDICTED: cancer-related nucleoside-triphos...  55.5    3e-06   
ref|XP_010304771.1|  PREDICTED: cancer-related nucleoside-triphos...  55.5    3e-06   
ref|WP_013604772.1|  hypothetical protein                             55.5    3e-06   
gb|AFD03350.1|  nucleoside-triphosphatase                             53.5    3e-06   
ref|XP_010186108.1|  PREDICTED: cancer-related nucleoside-triphos...  55.5    3e-06   
ref|WP_030065252.1|  hypothetical protein                             43.1    3e-06   
ref|WP_037731147.1|  hypothetical protein                             43.5    3e-06   
ref|WP_013909012.1|  thymidylate kinase                               57.0    3e-06   
ref|XP_009964604.1|  PREDICTED: cancer-related nucleoside-triphos...  55.5    4e-06   
ref|WP_014736733.1|  nucleotide kinase                                46.6    4e-06   
ref|WP_020198942.1|  hypothetical protein                             51.2    4e-06   
ref|XP_010147381.1|  PREDICTED: cancer-related nucleoside-triphos...  53.5    4e-06   
gb|EST20663.1|  hypothetical protein M878_39220                       43.5    4e-06   
ref|XP_008320551.1|  PREDICTED: cancer-related nucleoside-triphos...  55.8    5e-06   



>ref|XP_009597872.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X2 
[Nicotiana tomentosiformis]
Length=192

 Score =   159 bits (402),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLFIIDEVGKMELYSSSFFPAVLK+L++ +PLLAS+PIPKAGRDIPGVAR++N
Sbjct  101  LQVREDTDLFIIDEVGKMELYSSSFFPAVLKVLQSNIPLLASIPIPKAGRDIPGVARMRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA +FTLN NNRDA++E ++S+L+D +QK
Sbjct  161  HPGARVFTLNANNRDAMREQIYSILADMVQK  191


 Score =   132 bits (333),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAA GKCFLVTG PG+GKTTLI++V E+LR+SNPNLK+QGFYTREIREGT+RVGFEVVTL
Sbjct  1    MAATGKCFLVTGSPGIGKTTLIVRVLETLRNSNPNLKVQGFYTREIREGTERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGRKG+LASNKIS
Sbjct  61   DGRKGILASNKIS  73



>ref|XP_009794034.1| PREDICTED: cancer-related nucleoside-triphosphatase [Nicotiana 
sylvestris]
Length=192

 Score =   155 bits (392),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLFIIDEVGKMELYSSSFFPAVLK+L++ +PLLAS+PIPKAGRDIPGVAR++N
Sbjct  101  LQVREDTDLFIIDEVGKMELYSSSFFPAVLKVLQSNIPLLASIPIPKAGRDIPGVARMRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA +FTL+ NNRDA++E + S L+D LQK
Sbjct  161  HPGARVFTLSANNRDAMREQICSALADMLQK  191


 Score =   133 bits (335),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAA GKCFLVTG PGVGKTTLI++V E+LR+SNPNLK QGFYTREIREGT+RVGFEVVTL
Sbjct  1    MAATGKCFLVTGSPGVGKTTLIVRVLETLRNSNPNLKFQGFYTREIREGTERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGRKGLLASNKIS
Sbjct  61   DGRKGLLASNKIS  73



>ref|XP_002521720.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40707.1| ATP binding protein, putative [Ricinus communis]
Length=192

 Score =   149 bits (376),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQVKEDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +P+LASVPIPK GRDIPGVAR+K
Sbjct  100  ELQVKEDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPVLASVPIPKFGRDIPGVARVK  159

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            NHPGA IFTL+P+NRD +KE ++S L   L +
Sbjct  160  NHPGATIFTLSPSNRDVLKEQIYSQLVGSLGR  191


 Score =   122 bits (305),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAAPGKC LV+GPPGVGKTTLI++VFESL+ S PNLK+QGFYT EIREG++RVGFEVVTL
Sbjct  1    MAAPGKCLLVSGPPGVGKTTLIMRVFESLKISYPNLKIQGFYTSEIREGSERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGRK  LAS  IS
Sbjct  61   DGRKAPLASTTIS  73



>gb|KDP43768.1| hypothetical protein JCGZ_22395 [Jatropha curcas]
Length=193

 Score =   150 bits (379),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKE TDLFIIDEVGKMEL SSSFFPAVLK+LE+ +P+LAS+PIPK+GRDIPGVARL+N
Sbjct  102  LQVKEHTDLFIIDEVGKMELCSSSFFPAVLKVLESNIPVLASIPIPKSGRDIPGVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQKS  495
            HPGA +FTL+P+NRDA+KE +++ L D+L K+
Sbjct  162  HPGATVFTLSPSNRDAVKEQIYTQLVDKLHKN  193


 Score =   120 bits (301),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    MAAPGKCFL-VTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVT  181
            MAAPGKC L VTG PGVGKTTLI++VFESL+  NPNLK+QGFYTREIREG+QRVGFEVVT
Sbjct  1    MAAPGKCLLLVTGSPGVGKTTLIVRVFESLKVLNPNLKIQGFYTREIREGSQRVGFEVVT  60

Query  182  LDGRKGLLASNKIS  223
            LDGRK  LAS  IS
Sbjct  61   LDGRKAPLASTTIS  74



>ref|XP_011096975.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Sesamum indicum]
Length=192

 Score =   143 bits (361),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK DTDLFIIDEVGKMEL+SSSFFPAVL++LE+ +PLLASVPIPK+GRDIPGVARLKN
Sbjct  101  LQVKVDTDLFIIDEVGKMELFSSSFFPAVLRVLESNIPLLASVPIPKSGRDIPGVARLKN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            HPGA +  LN +NRDA+KE ++S L + LQ
Sbjct  161  HPGATMCMLNTSNRDAMKEQIYSNLINLLQ  190


 Score =   126 bits (317),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAAPGKCFLVTGPPGVGKTTLII+V E+L+ SNP+LK+QGFYTRE+REG +RVGFEVVTL
Sbjct  1    MAAPGKCFLVTGPPGVGKTTLIIRVLEALKQSNPSLKIQGFYTRELREGAERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR+G LAS  IS
Sbjct  61   DGRRGPLASTTIS  73



>ref|XP_010029581.1| PREDICTED: cancer-related nucleoside-triphosphatase [Eucalyptus 
grandis]
 gb|KCW56502.1| hypothetical protein EUGRSUZ_I02225 [Eucalyptus grandis]
Length=192

 Score =   137 bits (346),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDTDL+IIDEVGKMELYSS+FFPAVLK+L++  PLLAS+PIPK GRDIPGVARL+N
Sbjct  101  LQVKEDTDLYIIDEVGKMELYSSAFFPAVLKVLQSNSPLLASIPIPKNGRDIPGVARLRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
             PGA +FTL+ +NRDA++E +++ L   L K
Sbjct  161  QPGAEVFTLSASNRDAVREQIYNKLLGLLPK  191


 Score =   125 bits (313),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAAPGKC LVTGPPGVGKTTLI +VFESL++SNP+LK+QGFYTREIREG  RVGFEVVTL
Sbjct  1    MAAPGKCLLVTGPPGVGKTTLITRVFESLKASNPHLKVQGFYTREIREGGDRVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR G LAS+ IS
Sbjct  61   DGRTGPLASSTIS  73



>ref|XP_004985848.1| PREDICTED: cancer-related nucleoside-triphosphatase-like isoform 
X2 [Setaria italica]
Length=197

 Score =   149 bits (375),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDTDLFIIDEVGKMEL+SS+FFPAV++++E+ +P+LA++PIP+ GRDIPGVARL+N
Sbjct  102  LQVKEDTDLFIIDEVGKMELFSSAFFPAVMRVVESNIPVLATIPIPRNGRDIPGVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQKSIRC  504
            HPGAAIFTLN  NRD ++E +++ LS  LQK + C
Sbjct  162  HPGAAIFTLNTGNRDTMRETIYNQLSSLLQKRLSC  196


 Score =   113 bits (282),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG  190
            AP +C  VTGPPGVGKTTL+++VFE+LR+S+PNL ++GFYTRE+RE  +RVGFEVVTLDG
Sbjct  4    APSRCLFVTGPPGVGKTTLVMRVFEALRASHPNLTIRGFYTREVRESGERVGFEVVTLDG  63

Query  191  RKGLLASNKIS  223
            R G LAS+K+S
Sbjct  64   RSGPLASSKVS  74



>ref|XP_004985847.1| PREDICTED: cancer-related nucleoside-triphosphatase-like isoform 
X1 [Setaria italica]
Length=199

 Score =   148 bits (374),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDTDLFIIDEVGKMEL+SS+FFPAV++++E+ +P+LA++PIP+ GRDIPGVARL+N
Sbjct  102  LQVKEDTDLFIIDEVGKMELFSSAFFPAVMRVVESNIPVLATIPIPRNGRDIPGVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQKSI  498
            HPGAAIFTLN  NRD ++E +++ LS  LQKSI
Sbjct  162  HPGAAIFTLNTGNRDTMRETIYNQLSSLLQKSI  194


 Score =   113 bits (282),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG  190
            AP +C  VTGPPGVGKTTL+++VFE+LR+S+PNL ++GFYTRE+RE  +RVGFEVVTLDG
Sbjct  4    APSRCLFVTGPPGVGKTTLVMRVFEALRASHPNLTIRGFYTREVRESGERVGFEVVTLDG  63

Query  191  RKGLLASNKIS  223
            R G LAS+K+S
Sbjct  64   RSGPLASSKVS  74



>ref|XP_009389170.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Musa 
acuminata subsp. malaccensis]
Length=197

 Score =   140 bits (354),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQ+KE  DLFI+DEVGKMELYSSSFFPAVL++L++ +P LA++PIPK GRDIPGVARL+
Sbjct  105  QLQIKEGIDLFIVDEVGKMELYSSSFFPAVLRVLDSNIPFLATIPIPKFGRDIPGVARLR  164

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            NHPGA +FTLNP NRDA+K+ ++S + + LQ
Sbjct  165  NHPGATVFTLNPGNRDAMKDTIYSQIVNLLQ  195


 Score =   116 bits (291),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = +2

Query  8    AAPG--KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVT  181
            AAPG  KC LVTGPPGVGKTTLI++V E+LR+S+P+L +QGFYTRE+REG  RVGFEVVT
Sbjct  5    AAPGSSKCLLVTGPPGVGKTTLIMRVLEALRTSHPHLTVQGFYTREVREGADRVGFEVVT  64

Query  182  LDGRKGLLASNKIS  223
            LDGR+G LAS+KIS
Sbjct  65   LDGRRGPLASSKIS  78



>ref|XP_003612365.1| Nucleoside-triphosphatase, putative [Medicago truncatula]
 gb|AES95323.1| cancer-related nucleoside-triphosphatase-like protein [Medicago 
truncatula]
Length=192

 Score =   145 bits (366),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +P+LAS+P+PK GRDIP VARLKN
Sbjct  101  LQVREDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPILASIPVPKFGRDIPAVARLKN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            H GA +FTL+ +NRDA++E + SLL D L+K
Sbjct  161  HAGATLFTLSVSNRDAVREQMRSLLEDLLKK  191


 Score =   110 bits (274),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M   GKCFLVTGPPGVGK+TLI++VFESL++SNP LK+QGFYTRE+R   +RVGFEVVTL
Sbjct  1    MVGTGKCFLVTGPPGVGKSTLIMRVFESLKASNPTLKVQGFYTREVRVAGERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR   LAS+  S
Sbjct  61   DGRTCPLASSNFS  73



>gb|EYU18763.1| hypothetical protein MIMGU_mgv1a014330mg [Erythranthe guttata]
Length=193

 Score =   135 bits (341),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 82/91 (90%), Gaps = 1/91 (1%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAG-RDIPGVARLK  396
            LQVKED+DLF+IDEVGKMEL+SSSFFPA+L++LE+ +PLLA+VP+PK+G RDIPGVARLK
Sbjct  101  LQVKEDSDLFVIDEVGKMELFSSSFFPAILRVLESNIPLLATVPLPKSGCRDIPGVARLK  160

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            N  GA I+T++ +NRDA+K+ ++S L+D LQ
Sbjct  161  NQTGATIYTVDSSNRDAMKDQIYSNLADLLQ  191


 Score =   119 bits (298),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA+ GKCFLVTG PGVGKTTLII+V E+L+ SNPNLK+QGFYTRE+REG +R+GFEVVTL
Sbjct  1    MASAGKCFLVTGAPGVGKTTLIIRVLEALKLSNPNLKIQGFYTREVREGGERIGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGRK  LAS  IS
Sbjct  61   DGRKAPLASTNIS  73



>gb|AFK47755.1| unknown [Medicago truncatula]
Length=192

 Score =   145 bits (366),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +P+LAS+P+PK GRDIP VARLKN
Sbjct  101  LQVREDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPILASIPVPKFGRDIPAVARLKN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            H GA +FTL+ +NRDA++E + SLL D L+K
Sbjct  161  HAGATLFTLSVSNRDAVREQMRSLLEDLLKK  191


 Score =   108 bits (271),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M   GKCFLVTGPPGVGK+TLI++VFESL++SNP LK+QGFYTRE+R   +RVGF+VVTL
Sbjct  1    MVGTGKCFLVTGPPGVGKSTLIMRVFESLKASNPTLKVQGFYTREVRVAGERVGFDVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR   LAS+  S
Sbjct  61   DGRTCPLASSNFS  73



>ref|NP_001237831.1| uncharacterized protein LOC100527302 [Glycine max]
 gb|ACU16372.1| unknown [Glycine max]
 gb|KHN35957.1| Cancer-related nucleoside-triphosphatase [Glycine soja]
Length=191

 Score =   137 bits (346),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQVKEDTDLFIIDEVGKMEL+SSSFFPAVL++LE+ +P+LAS+P+PK GRDIP VARL+
Sbjct  99   ELQVKEDTDLFIIDEVGKMELFSSSFFPAVLRVLESNIPVLASIPVPKFGRDIPEVARLR  158

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            NH GA  FTL+ +NRDA++E + S L D L K
Sbjct  159  NHAGATCFTLSVSNRDAVREQIRSQLEDMLTK  190


 Score =   115 bits (289),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKCFLVTGPPGVGKTTLI+KVFESL+  NP+LKLQGFYTREIR   QRVGFEVVTL
Sbjct  1    MAGPGKCFLVTGPPGVGKTTLIMKVFESLKV-NPSLKLQGFYTREIRRAGQRVGFEVVTL  59

Query  185  DGRKGLLASNKIS  223
            DGR   LAS  IS
Sbjct  60   DGRTAPLASIDIS  72



>ref|XP_008448475.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Cucumis melo]
Length=195

 Score =   138 bits (348),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV++DTDLFIIDEVGKMEL+SSSFFPAVLK+LE+  PLLAS+PIPK GRDIPGVARL+N
Sbjct  101  LQVEKDTDLFIIDEVGKMELFSSSFFPAVLKVLESNTPLLASIPIPKFGRDIPGVARLRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA I TLNP+NRD  KE +   + + L++
Sbjct  161  HPGANILTLNPSNRDGAKEQIHGQILNMLEQ  191


 Score =   115 bits (287),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M  PG+C LVTGPPGVGKTTLI+KVFE L++S+PNLK++GFYTREIR+G+QRVGFEVVTL
Sbjct  1    MGGPGRCLLVTGPPGVGKTTLIVKVFEMLKASSPNLKIKGFYTREIRQGSQRVGFEVVTL  60

Query  185  DGRKGLLA  208
            DGR   LA
Sbjct  61   DGRTAPLA  68



>ref|XP_002465924.1| hypothetical protein SORBIDRAFT_01g048330 [Sorghum bicolor]
 gb|EER92922.1| hypothetical protein SORBIDRAFT_01g048330 [Sorghum bicolor]
Length=193

 Score =   140 bits (354),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKE+TDLFIIDEVGKMEL+SS+FFPAV++++E+ +P+LA++PIP+ GRDIPGVARL+N
Sbjct  102  LQVKEETDLFIIDEVGKMELFSSAFFPAVMRVIESNIPVLATIPIPRRGRDIPGVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGAA+FTLN  NRD +++ +++ LS  LQK
Sbjct  162  HPGAAVFTLNTANRDTMRDTIYNHLSSLLQK  192


 Score =   110 bits (274),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            AAP +C LVTGPPGVGKTTL+++VFE+LR S+PNL ++GFYTRE+REG +RVGFEVVTLD
Sbjct  3    AAPSRCLLVTGPPGVGKTTLVMRVFETLRGSHPNLTIRGFYTREVREGGERVGFEVVTLD  62

Query  188  GRKGLL  205
            GR G L
Sbjct  63   GRSGPL  68



>ref|XP_004159739.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Cucumis 
sativus]
Length=194

 Score =   135 bits (341),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV++DTDLFIIDEVGKMEL+SSSFFPAVLK+LE+  PLLAS+PIPK GRDIPGVARL+N
Sbjct  101  LQVEKDTDLFIIDEVGKMELFSSSFFPAVLKVLESNTPLLASIPIPKFGRDIPGVARLRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA I TLNP+NRD   E +   + + L++
Sbjct  161  HPGANILTLNPSNRDEANEQIHGEILNMLEQ  191


 Score =   115 bits (287),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M  PG+C LVTGPPGVGKTTLI+KVFE L++S+PNLK++GFYTREIR+G+QRVGFEVVTL
Sbjct  1    MGGPGRCLLVTGPPGVGKTTLIVKVFEMLKASSPNLKIKGFYTREIRQGSQRVGFEVVTL  60

Query  185  DGRKGLLA  208
            DGR   LA
Sbjct  61   DGRTAPLA  68



>ref|XP_007046507.1| Nucleoside-triphosphatase C1orf57 isoform 1 [Theobroma cacao]
 gb|EOX90664.1| Nucleoside-triphosphatase C1orf57 isoform 1 [Theobroma cacao]
Length=203

 Score =   135 bits (340),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            L+++EDTDLFIIDEVGKMELYSS FFPA+LKIL++ +PLLA+VPIP  G+DIP VARLKN
Sbjct  108  LKIREDTDLFIIDEVGKMELYSSYFFPAILKILQSNIPLLATVPIPNFGKDIPAVARLKN  167

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTL+  NRDA+ E ++S L D L K
Sbjct  168  HPGATIFTLDQYNRDAMHEQIYSQLVDILPK  198


 Score =   112 bits (280),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA  GKCFL+TGPPGVGKT LI++++ESL+ SNPNLKLQGFYT+EIR+G +RVGFEV TL
Sbjct  1    MAGVGKCFLLTGPPGVGKTNLIMRIYESLKYSNPNLKLQGFYTQEIRQGGERVGFEVFTL  60

Query  185  DGRKGLLASNKI  220
            DGR+G LA   I
Sbjct  61   DGRRGQLACTVI  72



>ref|XP_007046508.1| Nucleoside-triphosphatase C1orf57 isoform 2 [Theobroma cacao]
 gb|EOX90665.1| Nucleoside-triphosphatase C1orf57 isoform 2 [Theobroma cacao]
Length=196

 Score =   135 bits (340),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            L+++EDTDLFIIDEVGKMELYSS FFPA+LKIL++ +PLLA+VPIP  G+DIP VARLKN
Sbjct  101  LKIREDTDLFIIDEVGKMELYSSYFFPAILKILQSNIPLLATVPIPNFGKDIPAVARLKN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTL+  NRDA+ E ++S L D L K
Sbjct  161  HPGATIFTLDQYNRDAMHEQIYSQLVDILPK  191


 Score =   112 bits (280),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA  GKCFL+TGPPGVGKT LI++++ESL+ SNPNLKLQGFYT+EIR+G +RVGFEV TL
Sbjct  1    MAGVGKCFLLTGPPGVGKTNLIMRIYESLKYSNPNLKLQGFYTQEIRQGGERVGFEVFTL  60

Query  185  DGRKGLLASNKI  220
            DGR+G LA   I
Sbjct  61   DGRRGQLACTVI  72



>ref|XP_008361331.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Malus 
domestica]
Length=192

 Score =   137 bits (346),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQV+EDTDLFI+DEV KMEL+SSSFFP VL+ILE+ VP LA+VPIPK GRDIP VARLK
Sbjct  100  ELQVREDTDLFIVDEVXKMELFSSSFFPCVLRILESNVPFLATVPIPKFGRDIPAVARLK  159

Query  397  NHPGAAIFTLNPNNRDAIKE----HLFSLLSDQ  483
            NHPGA +FTL+  NRDA+KE    HL +LLS Q
Sbjct  160  NHPGATMFTLSKGNRDAVKEEIYSHLVALLSKQ  192


 Score =   109 bits (272),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKC LVTGPPGVGK+TL+++VFE+L++S PNLK+QGFYT E+REG++RVGF+VVTL
Sbjct  1    MAGPGKCLLVTGPPGVGKSTLVMRVFETLKASYPNLKIQGFYTSEVREGSERVGFQVVTL  60

Query  185  DGRKGLL  205
            DGR   L
Sbjct  61   DGRTAPL  67



>gb|KEH27623.1| cancer-related nucleoside-triphosphatase-like protein [Medicago 
truncatula]
Length=190

 Score =   145 bits (366),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +P+LAS+P+PK GRDIP VARLKN
Sbjct  99   LQVREDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPILASIPVPKFGRDIPAVARLKN  158

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            H GA +FTL+ +NRDA++E + SLL D L+K
Sbjct  159  HAGATLFTLSVSNRDAVREQMRSLLEDLLKK  189


 Score =   100 bits (250),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 2/73 (3%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M   GKCFLVTGPPGVGK+TLI++VFESL++SNP LK+QGFYT  +R   +RVGFEVVTL
Sbjct  1    MVGTGKCFLVTGPPGVGKSTLIMRVFESLKASNPTLKVQGFYT--LRVAGERVGFEVVTL  58

Query  185  DGRKGLLASNKIS  223
            DGR   LAS+  S
Sbjct  59   DGRTCPLASSNFS  71



>ref|XP_004146174.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Cucumis 
sativus]
 gb|KGN55609.1| hypothetical protein Csa_3G002300 [Cucumis sativus]
Length=194

 Score =   134 bits (336),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV++DTDLFIIDEVGKMEL+SSSFFPAVLK+LE+  PLLAS+PIPK GRDIPGVARL+N
Sbjct  101  LQVEKDTDLFIIDEVGKMELFSSSFFPAVLKVLESNTPLLASIPIPKFGRDIPGVARLRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA I TLNP+NR    E +   + + L++
Sbjct  161  HPGANILTLNPSNRGEANEQIHGEILNMLEQ  191


 Score =   111 bits (277),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M  PG+C LVTGP GVGKTTLI+KVFE L++S+PNLK++GFYTREIR+G+QRVGFEVVTL
Sbjct  1    MGGPGRCLLVTGPSGVGKTTLIVKVFEMLKASSPNLKIKGFYTREIRQGSQRVGFEVVTL  60

Query  185  DGRKGLLA  208
            DGR   LA
Sbjct  61   DGRTAPLA  68



>ref|XP_004512269.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Cicer arietinum]
 ref|XP_004512270.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Cicer arietinum]
Length=192

 Score =   136 bits (342),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLF+IDEVGKMELYSSSFFPAVLK+L++ +P+LAS+P+PK GRDIP VARL+N
Sbjct  101  LQVREDTDLFVIDEVGKMELYSSSFFPAVLKVLDSNIPILASIPVPKFGRDIPEVARLRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            H GA  FTL+  NRDA++E + S L D L K
Sbjct  161  HAGATCFTLSVGNRDAVREQIRSHLEDLLIK  191


 Score =   108 bits (270),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA  GKCFLVTGPPGVGKTTLI+K+FE++++SN  LK+QGFYTRE+R  ++RVGFEVVTL
Sbjct  1    MAGIGKCFLVTGPPGVGKTTLIMKLFETIKASNSTLKVQGFYTREVRVASERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR   LAS+  S
Sbjct  61   DGRTCPLASSNFS  73



>ref|XP_002865090.1| hypothetical protein ARALYDRAFT_332964 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41349.1| hypothetical protein ARALYDRAFT_332964 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   131 bits (330),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK+DT LFIIDE+GKME++S SFFPAVLK+L + +PLLAS+PIPK GRD+PGVARLKN
Sbjct  101  LQVKDDTHLFIIDELGKMEMFSPSFFPAVLKVLGSNIPLLASIPIPKFGRDLPGVARLKN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
             PG  + TL+ +NRD++KEH+F + S  L K
Sbjct  161  QPGVTVITLSESNRDSMKEHIFDVFSGWLPK  191


 Score =   112 bits (281),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA  GKC LVTGPPGVGKTTLI++VF+ +R  NPNLK+QGFYTRE+RE  QRVGF+VVTL
Sbjct  1    MAGTGKCLLVTGPPGVGKTTLIMRVFDMIRVFNPNLKIQGFYTREMRERGQRVGFQVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR  LLAS+ +S
Sbjct  61   DGRTSLLASSTVS  73



>ref|XP_007138453.1| hypothetical protein PHAVU_009G210300g [Phaseolus vulgaris]
 gb|ESW10447.1| hypothetical protein PHAVU_009G210300g [Phaseolus vulgaris]
Length=191

 Score =   136 bits (343),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDT LFIIDEVGKMEL+SSSFFPAVL++LE+ +P+LAS+P+PK GRDIP VARL+N
Sbjct  100  LQVREDTSLFIIDEVGKMELFSSSFFPAVLRVLESNIPVLASIPVPKFGRDIPEVARLRN  159

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            H GA  FTLN  NRDA++E + SLL D L K
Sbjct  160  HAGATCFTLNVANRDAVREQIRSLLEDLLIK  190


 Score =   106 bits (264),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKCFLVTGPPGVGKTTLI++V ESL S+N ++KLQGFYTRE+R   QRVGFEVVTL
Sbjct  1    MAGPGKCFLVTGPPGVGKTTLIMRVLESL-SANSSIKLQGFYTREVRRAGQRVGFEVVTL  59

Query  185  DGRKGLLASNKIS  223
            D R   LAS   S
Sbjct  60   DARTAPLASLHFS  72



>ref|XP_010557441.1| PREDICTED: cancer-related nucleoside-triphosphatase [Tarenaya 
hassleriana]
Length=192

 Score =   127 bits (318),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK DT LFIIDEVGKME++S SFFPAVLK+LE+ +P LAS+P+PK GR IPGV RL+N
Sbjct  101  LQVKADTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPFLASIPVPKLGRAIPGVERLRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
             PGA++ +L+ +NRD+++E ++ +LS+ L K
Sbjct  161  QPGASLISLSTSNRDSMREQVYGVLSEWLPK  191


 Score =   115 bits (288),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M++ GKC L+TGPPGVGKTTLI ++ E+LR SNPNLK+QGFYT+E+RE  QRVGFEVVTL
Sbjct  1    MSSSGKCLLLTGPPGVGKTTLIKRILETLRLSNPNLKIQGFYTQEVRERGQRVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR+GLLAS+ +S
Sbjct  61   DGRRGLLASSTVS  73



>ref|XP_008448472.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Cucumis melo]
 ref|XP_008448474.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Cucumis melo]
Length=219

 Score =   139 bits (349),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV++DTDLFIIDEVGKMEL+SSSFFPAVLK+LE+  PLLAS+PIPK GRDIPGVARL+N
Sbjct  125  LQVEKDTDLFIIDEVGKMELFSSSFFPAVLKVLESNTPLLASIPIPKFGRDIPGVARLRN  184

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA I TLNP+NRD  KE +   + + L++
Sbjct  185  HPGANILTLNPSNRDGAKEQIHGQILNMLEQ  215


 Score =   101 bits (251),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 61/92 (66%), Gaps = 24/92 (26%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTR----------------  136
            M  PG+C LVTGPPGVGKTTLI+KVFE L++S+PNLK++GFYTR                
Sbjct  1    MGGPGRCLLVTGPPGVGKTTLIVKVFEMLKASSPNLKIKGFYTRKQILPFLFLFLFHRFF  60

Query  137  --------EIREGTQRVGFEVVTLDGRKGLLA  208
                    EIR+G+QRVGFEVVTLDGR   LA
Sbjct  61   YRCSVFTGEIRQGSQRVGFEVVTLDGRTAPLA  92



>ref|XP_011096976.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Sesamum indicum]
Length=191

 Score =   144 bits (362),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK DTDLFIIDEVGKMEL+SSSFFPAVL++LE+ +PLLASVPIPK+GRDIPGVARLKN
Sbjct  100  LQVKVDTDLFIIDEVGKMELFSSSFFPAVLRVLESNIPLLASVPIPKSGRDIPGVARLKN  159

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            HPGA +  LN +NRDA+KE ++S L + LQ
Sbjct  160  HPGATMCMLNTSNRDAMKEQIYSNLINLLQ  189


 Score = 95.5 bits (236),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLASNKIS  223
            GVGKTTLII+V E+L+ SNP+LK+QGFYTRE+REG +RVGFEVVTLDGR+G LAS  IS
Sbjct  14   GVGKTTLIIRVLEALKQSNPSLKIQGFYTRELREGAERVGFEVVTLDGRRGPLASTTIS  72



>gb|KHG07846.1| Cancer-related nucleoside-triphosphatase [Gossypium arboreum]
Length=209

 Score =   126 bits (317),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            L+++EDT LFI+DEVGKMEL SS FFPA+L IL++ +PLLA+VPIPK G+DIP V RLKN
Sbjct  118  LKIREDTGLFIVDEVGKMELLSSYFFPAILNILQSNIPLLATVPIPKFGKDIPAVVRLKN  177

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTL+ +NRDA+K+ ++  L+  L K
Sbjct  178  HPGATIFTLDKSNRDAMKDRIYPQLAGMLLK  208


 Score =   108 bits (271),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA  GKC LVTGPPGVGKTTLI+++ E+L+ SNP++KLQGFY++EIR+G +RVGFEVVTL
Sbjct  18   MAGVGKCILVTGPPGVGKTTLIMRICENLKLSNPSIKLQGFYSQEIRQGGERVGFEVVTL  77

Query  185  DGRKGLLASNKIS  223
            DGR+  LAS+ IS
Sbjct  78   DGRRARLASSTIS  90



>ref|XP_009597871.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Nicotiana tomentosiformis]
Length=205

 Score =   130 bits (328),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAA GKCFLVTG PG+GKTTLI++V E+LR+SNPNLK+QGFYTREIREGT+RVGFEVVTL
Sbjct  1    MAATGKCFLVTGSPGIGKTTLIVRVLETLRNSNPNLKVQGFYTREIREGTERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGRKG+LASNKIS
Sbjct  61   DGRKGILASNKIS  73


 Score =   102 bits (255),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPG  381
            LQV+EDTDLFIIDEVGKMELYSSSFFPAVLK+L++ +PLLAS+PIPKAGRDIPG
Sbjct  101  LQVREDTDLFIIDEVGKMELYSSSFFPAVLKVLQSNIPLLASIPIPKAGRDIPG  154



>ref|NP_001032157.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAT41788.1| At5g66005 [Arabidopsis thaliana]
 gb|AAU29477.1| At5g66005 [Arabidopsis thaliana]
 dbj|BAD95397.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98139.1| uncharacterized protein AT5G66005 [Arabidopsis thaliana]
Length=192

 Score =   122 bits (305),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK+DT+LFIIDEVGKME++S SFFPAVL +L++ VPLLAS+P PK GR +P VARLKN
Sbjct  101  LQVKDDTNLFIIDEVGKMEMFSPSFFPAVLNVLDSNVPLLASIPSPKFGRHLPEVARLKN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
             PG  + +L+  NRD +KEH+F + S  L K
Sbjct  161  QPGVNVISLSATNRDPMKEHIFDVFSGWLPK  191


 Score =   111 bits (277),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA  GKC LVTGPPGVGKTTLI++V + +R SNPNLK+QGFYT+E+RE  QRVGF+VVTL
Sbjct  1    MAGTGKCLLVTGPPGVGKTTLIMRVLDMMRVSNPNLKIQGFYTQEMRERGQRVGFQVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR  LLAS+ +S
Sbjct  61   DGRTSLLASSIVS  73



>ref|XP_010444856.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X4 [Camelina sativa]
Length=210

 Score =   133 bits (334),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+PGVARLKN
Sbjct  117  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLPGVARLKN  176

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  177  QPGVTIINLSESNRDSMKRHIFDVLSGWLH  206


 Score = 98.2 bits (243),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 13/83 (16%)
 Frame = +2

Query  14   PGKCFLVTGPPGVGKTTLIIKVFESLRS-----------SNPNLKLQGFYTREIRE--GT  154
            PGKC LVTGPPGVGKTTLI++V + +R            SNPNLK+QGFYT+E+RE  G 
Sbjct  6    PGKCLLVTGPPGVGKTTLIMRVLDMMRMRMGMGMGMRGLSNPNLKIQGFYTQEMRERRGG  65

Query  155  QRVGFEVVTLDGRKGLLASNKIS  223
            QRVGF+VVTLDGR  LLAS+ +S
Sbjct  66   QRVGFQVVTLDGRTSLLASSTVS  88



>ref|XP_010466294.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X4 [Camelina sativa]
Length=200

 Score =   129 bits (325),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+P VARLKN
Sbjct  107  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLPEVARLKN  166

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  167  QPGVTIINLSESNRDSMKRHIFDVLSGWLH  196


 Score = 98.2 bits (243),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 4/72 (6%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRS---SNPNLKLQGFYTREIRE-GTQRVGFE  172
            MA  GKC LVTGPPGVGKTTLI++V + +     SNPNLK+QGFYT+E+RE G QRVGF+
Sbjct  1    MAGTGKCLLVTGPPGVGKTTLIMRVLDMMMMRGLSNPNLKIQGFYTQEMRERGGQRVGFQ  60

Query  173  VVTLDGRKGLLA  208
            VVTLDGR  LLA
Sbjct  61   VVTLDGRTSLLA  72



>ref|XP_010444855.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X3 [Camelina sativa]
Length=211

 Score =   129 bits (323),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPG-VARLK  396
            LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+PG VARLK
Sbjct  117  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLPGAVARLK  176

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            N PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  177  NQPGVTIINLSESNRDSMKRHIFDVLSGWLH  207


 Score = 98.2 bits (243),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 13/83 (16%)
 Frame = +2

Query  14   PGKCFLVTGPPGVGKTTLIIKVFESLRS-----------SNPNLKLQGFYTREIRE--GT  154
            PGKC LVTGPPGVGKTTLI++V + +R            SNPNLK+QGFYT+E+RE  G 
Sbjct  6    PGKCLLVTGPPGVGKTTLIMRVLDMMRMRMGMGMGMRGLSNPNLKIQGFYTQEMRERRGG  65

Query  155  QRVGFEVVTLDGRKGLLASNKIS  223
            QRVGF+VVTLDGR  LLAS+ +S
Sbjct  66   QRVGFQVVTLDGRTSLLASSTVS  88



>gb|KFK28261.1| hypothetical protein AALP_AA8G493800 [Arabis alpina]
Length=187

 Score =   126 bits (316),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQVKE T LFIIDE+GKME++S SFFPAVLK+LE+ +PLLAS+P P  G+D+P VARLK
Sbjct  95   QLQVKEGTHLFIIDEIGKMEMFSQSFFPAVLKVLESNIPLLASIPSPNFGQDLPAVARLK  154

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            N PG  + TL  +NRD++K+H+F +LS  L K
Sbjct  155  NQPGVTVITLTASNRDSMKQHIFDVLSGWLPK  186


 Score = 99.4 bits (246),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 60/69 (87%), Gaps = 3/69 (4%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
            G+C LVTGPPGVGKTTLI++V + L   +P+ K+QGFYT+E+REG +RVGF+VVTL+GRK
Sbjct  3    GRCLLVTGPPGVGKTTLIMRVLDML---SPSFKIQGFYTQEMREGNERVGFQVVTLNGRK  59

Query  197  GLLASNKIS  223
            GLLAS+ +S
Sbjct  60   GLLASSTVS  68



>ref|XP_010466286.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X3 [Camelina sativa]
Length=201

 Score =   126 bits (316),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIP-GVARLK  396
            LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+P  VARLK
Sbjct  107  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLPEAVARLK  166

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            N PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  167  NQPGVTIINLSESNRDSMKRHIFDVLSGWLH  197


 Score = 98.2 bits (243),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 4/72 (6%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRS---SNPNLKLQGFYTREIRE-GTQRVGFE  172
            MA  GKC LVTGPPGVGKTTLI++V + +     SNPNLK+QGFYT+E+RE G QRVGF+
Sbjct  1    MAGTGKCLLVTGPPGVGKTTLIMRVLDMMMMRGLSNPNLKIQGFYTQEMRERGGQRVGFQ  60

Query  173  VVTLDGRKGLLA  208
            VVTLDGR  LLA
Sbjct  61   VVTLDGRTSLLA  72



>ref|XP_010444853.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Camelina sativa]
Length=226

 Score =   133 bits (335),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+PGVARLKN
Sbjct  133  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLPGVARLKN  192

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  193  QPGVTIINLSESNRDSMKRHIFDVLSGWLH  222


 Score = 87.4 bits (215),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 62/99 (63%), Gaps = 29/99 (29%)
 Frame = +2

Query  14   PGKCFLVTGPP----------------GVGKTTLIIKVFESLRS-----------SNPNL  112
            PGKC LVTGPP                GVGKTTLI++V + +R            SNPNL
Sbjct  6    PGKCLLVTGPPVYKIRYGWISIFFAMKGVGKTTLIMRVLDMMRMRMGMGMGMRGLSNPNL  65

Query  113  KLQGFYTREIRE--GTQRVGFEVVTLDGRKGLLASNKIS  223
            K+QGFYT+E+RE  G QRVGF+VVTLDGR  LLAS+ +S
Sbjct  66   KIQGFYTQEMRERRGGQRVGFQVVTLDGRTSLLASSTVS  104



>ref|XP_010484703.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Camelina sativa]
Length=210

 Score =   125 bits (315),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDT LFIIDEVGKME++S SFFPAVL +LE+ +PLLAS+P PK+G  +PGVARLKN
Sbjct  117  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLTVLESNIPLLASIPSPKSGGHLPGVARLKN  176

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  177  QPGVTIINLSESNRDSMKRHIFDVLSGWLH  206


 Score = 94.7 bits (234),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 9/77 (12%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRS-------SNPNLKLQGFYTREIRE--GTQRVGFE  172
            KC LVTGPPGVGKTTLI++V + +R        SNPNLK+QGFYT+E+RE  G QRVGF+
Sbjct  12   KCLLVTGPPGVGKTTLIMRVLDMMRMRMRMKGLSNPNLKIQGFYTQEMRERRGGQRVGFQ  71

Query  173  VVTLDGRKGLLASNKIS  223
            VVTLDGR  LLAS+ +S
Sbjct  72   VVTLDGRTSLLASSTVS  88



>ref|XP_010444852.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Camelina sativa]
Length=227

 Score =   129 bits (323),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPG-VARLK  396
            LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+PG VARLK
Sbjct  133  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLPGAVARLK  192

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            N PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  193  NQPGVTIINLSESNRDSMKRHIFDVLSGWLH  223


 Score = 87.8 bits (216),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 62/99 (63%), Gaps = 29/99 (29%)
 Frame = +2

Query  14   PGKCFLVTGPP----------------GVGKTTLIIKVFESLRS-----------SNPNL  112
            PGKC LVTGPP                GVGKTTLI++V + +R            SNPNL
Sbjct  6    PGKCLLVTGPPVYKIRYGWISIFFAMKGVGKTTLIMRVLDMMRMRMGMGMGMRGLSNPNL  65

Query  113  KLQGFYTREIRE--GTQRVGFEVVTLDGRKGLLASNKIS  223
            K+QGFYT+E+RE  G QRVGF+VVTLDGR  LLAS+ +S
Sbjct  66   KIQGFYTQEMRERRGGQRVGFQVVTLDGRTSLLASSTVS  104



>ref|XP_010484702.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Camelina sativa]
Length=215

 Score =   125 bits (314),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDT LFIIDEVGKME++S SFFPAVL +LE+ +PLLAS+P PK+G  +PGVARLKN
Sbjct  122  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLTVLESNIPLLASIPSPKSGGHLPGVARLKN  181

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  182  QPGVTIINLSESNRDSMKRHIFDVLSGWLH  211


 Score = 90.5 bits (223),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 14/82 (17%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRS-------SNPNLKLQGFYTR-----EIRE--GTQ  157
            KC LVTGPPGVGKTTLI++V + +R        SNPNLK+QGFYTR     E+RE  G Q
Sbjct  12   KCLLVTGPPGVGKTTLIMRVLDMMRMRMRMKGLSNPNLKIQGFYTRKSRPEEMRERRGGQ  71

Query  158  RVGFEVVTLDGRKGLLASNKIS  223
            RVGF+VVTLDGR  LLAS+ +S
Sbjct  72   RVGFQVVTLDGRTSLLASSTVS  93



>ref|XP_010466277.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Camelina sativa]
Length=220

 Score =   129 bits (325),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+P VARLKN
Sbjct  127  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLPEVARLKN  186

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  187  QPGVTIINLSESNRDSMKRHIFDVLSGWLH  216


 Score = 85.9 bits (211),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 58/92 (63%), Gaps = 24/92 (26%)
 Frame = +2

Query  5    MAAPGKCFLVTGPP--------------------GVGKTTLIIKVFESLRS---SNPNLK  115
            MA  GKC LVTGPP                    GVGKTTLI++V + +     SNPNLK
Sbjct  1    MAGTGKCLLVTGPPVYKIRFGWISIFFFPDFAMKGVGKTTLIMRVLDMMMMRGLSNPNLK  60

Query  116  LQGFYTREIRE-GTQRVGFEVVTLDGRKGLLA  208
            +QGFYT+E+RE G QRVGF+VVTLDGR  LLA
Sbjct  61   IQGFYTQEMRERGGQRVGFQVVTLDGRTSLLA  92



>ref|XP_010466269.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Camelina sativa]
Length=221

 Score =   125 bits (315),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIP-GVARLK  396
            LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+P  VARLK
Sbjct  127  LQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLPEAVARLK  186

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            N PG  I  L+ +NRD++K H+F +LS  L 
Sbjct  187  NQPGVTIINLSESNRDSMKRHIFDVLSGWLH  217


 Score = 85.9 bits (211),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 58/92 (63%), Gaps = 24/92 (26%)
 Frame = +2

Query  5    MAAPGKCFLVTGPP--------------------GVGKTTLIIKVFESLRS---SNPNLK  115
            MA  GKC LVTGPP                    GVGKTTLI++V + +     SNPNLK
Sbjct  1    MAGTGKCLLVTGPPVYKIRFGWISIFFFPDFAMKGVGKTTLIMRVLDMMMMRGLSNPNLK  60

Query  116  LQGFYTREIRE-GTQRVGFEVVTLDGRKGLLA  208
            +QGFYT+E+RE G QRVGF+VVTLDGR  LLA
Sbjct  61   IQGFYTQEMRERGGQRVGFQVVTLDGRTSLLA  92



>ref|XP_006572836.1| PREDICTED: uncharacterized protein LOC100527302 isoform X1 [Glycine 
max]
Length=166

 Score =   115 bits (288),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKCFLVTGPPGVGKTTLI+KVFESL+  NP+LKLQGFYTREIR   QRVGFEVVTL
Sbjct  1    MAGPGKCFLVTGPPGVGKTTLIMKVFESLKV-NPSLKLQGFYTREIRRAGQRVGFEVVTL  59

Query  185  DGRKGLLASNKIS  223
            DGR   LAS  IS
Sbjct  60   DGRTAPLASIDIS  72


 Score = 94.7 bits (234),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIP  378
             LQVKEDTDLFIIDEVGKMEL+SSSFFPAVL++LE+ +P+LAS+P+PK GRDIP
Sbjct  99   ELQVKEDTDLFIIDEVGKMELFSSSFFPAVLRVLESNIPVLASIPVPKFGRDIP  152



>gb|KEH27622.1| cancer-related nucleoside-triphosphatase-like protein [Medicago 
truncatula]
Length=197

 Score =   109 bits (273),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M   GKCFLVTGPPGVGK+TLI++VFESL++SNP LK+QGFYTRE+R   +RVGFEVVTL
Sbjct  1    MVGTGKCFLVTGPPGVGKSTLIMRVFESLKASNPTLKVQGFYTREVRVAGERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR   LAS+  S
Sbjct  61   DGRTCPLASSNFS  73


 Score = 98.6 bits (244),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +P+LAS+P+PK GRDIP    L++
Sbjct  101  LQVREDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPILASIPVPKFGRDIPAGRNLED  160

Query  400  H  402
             
Sbjct  161  Q  161



>gb|KEH27625.1| cancer-related nucleoside-triphosphatase-like protein [Medicago 
truncatula]
Length=173

 Score =   109 bits (272),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M   GKCFLVTGPPGVGK+TLI++VFESL++SNP LK+QGFYTRE+R   +RVGFEVVTL
Sbjct  1    MVGTGKCFLVTGPPGVGKSTLIMRVFESLKASNPTLKVQGFYTREVRVAGERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR   LAS+  S
Sbjct  61   DGRTCPLASSNFS  73


 Score = 97.1 bits (240),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPG  381
             LQV+EDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +P+LAS+P+PK GRDIP 
Sbjct  100  ELQVREDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPILASIPVPKFGRDIPA  154



>ref|XP_008241937.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Prunus 
mume]
Length=191

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +PLLASVPIPK GRDIPGVARLKN
Sbjct  100  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPLLASVPIPKFGRDIPGVARLKN  159

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTL+P+NRDA+KE ++  L D L K
Sbjct  160  HPGATIFTLSPSNRDAVKEEIYLQLVDLLSK  190


 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 11/90 (12%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKC LVTGPPGVGK+TLI++VFE+LR+S PNLK+QGFYT E+R G++RVGF+VVTL
Sbjct  1    MAVPGKCLLVTGPPGVGKSTLIMRVFETLRASYPNLKIQGFYTSEVRRGSERVGFQVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGR   LAS          ISS   +S RW
Sbjct  61   DGRTAPLAST---------ISSP--ESFRW  79



>ref|XP_004234510.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Solanum 
lycopersicum]
 ref|XP_010317680.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Solanum 
lycopersicum]
Length=192

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  214  QNLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARL  393
            Q LQV+EDTDLFIIDE+GKMELYSSSFFPAVLK+L++ +PLLAS+PI K GRDIPGVAR+
Sbjct  99   QELQVREDTDLFIIDEIGKMELYSSSFFPAVLKVLQSNIPLLASIPITKVGRDIPGVARM  158

Query  394  KNHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            KNHPGA +FTL+ NNRDA++E + S L+D LQK
Sbjct  159  KNHPGARVFTLDANNRDAMREQICSTLADVLQK  191


 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 10/90 (11%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAA GKCFLVTGP G+GKTTLI++V E+LR+SNPNLK+QGFYTREIREGT+R+GFEVVTL
Sbjct  1    MAAAGKCFLVTGPAGIGKTTLIVRVLETLRNSNPNLKVQGFYTREIREGTERIGFEVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGR GLLASNKIS            +S+RW
Sbjct  61   DGRTGLLASNKISS----------AQSLRW  80



>ref|XP_006343328.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Solanum 
tuberosum]
Length=192

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLFIIDE+GKMELYSSSFFPAVLK+L++ +PLLAS+PI K GRDIPGVAR+KN
Sbjct  101  LQVREDTDLFIIDEIGKMELYSSSFFPAVLKVLQSNIPLLASIPITKVGRDIPGVARMKN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA +FTL+ NNRDA++E + S+L+D LQK
Sbjct  161  HPGARVFTLDANNRDAMREQICSILADMLQK  191


 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 10/90 (11%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAA GKCFLVTGP G+GKTTLI++V E+LR+SNPNLK+QGFYTREIREGT+R+GFEVVTL
Sbjct  1    MAAAGKCFLVTGPVGIGKTTLIVRVLETLRNSNPNLKVQGFYTREIREGTERIGFEVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGR GLLASNKIS            +S+RW
Sbjct  61   DGRTGLLASNKISS----------AQSLRW  80



>ref|XP_007202622.1| hypothetical protein PRUPE_ppa011922mg [Prunus persica]
 gb|EMJ03821.1| hypothetical protein PRUPE_ppa011922mg [Prunus persica]
Length=191

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKED DLFIIDEVGKMELYSSSFFPAVLK+LE+ +PLLASVPIPK GRDIPGVARLKN
Sbjct  100  LQVKEDIDLFIIDEVGKMELYSSSFFPAVLKVLESNIPLLASVPIPKFGRDIPGVARLKN  159

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTL+P+NRDA+KE ++  L D L K
Sbjct  160  HPGATIFTLSPSNRDAVKEEIYLQLVDLLSK  190


 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 11/90 (12%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKC LVTGPPGVGK+TLI++VFE+L++SNPNLK+QGFYT E+R+G++R+GF+VVTL
Sbjct  1    MAVPGKCLLVTGPPGVGKSTLIMRVFETLKASNPNLKIQGFYTSEVRQGSERIGFQVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGR   LAS          ISS   +S RW
Sbjct  61   DGRTAPLAST---------ISSP--ESFRW  79



>ref|XP_011096977.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X3 [Sesamum indicum]
Length=156

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 107/160 (67%), Gaps = 10/160 (6%)
 Frame = +1

Query  22   MLPCDRASWRRQDYSDYQSIRKSSQF*S*LEASGLLYS*N*GRNTEGRIRGGHTRWP*RA  201
            ML C   S   ++YSD  S        S L+ SG LYS    R ++     G  R+    
Sbjct  1    MLSCHWPSGSGKNYSDNPSAGGPQTIESQLKDSGFLYS----RESQRWPNVG--RYKVDV  54

Query  202  SCFQQ----NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGR  369
            S F+      LQVK DTDLFIIDEVGKMEL+SSSFFPAVL++LE+ +PLLASVPIPK+GR
Sbjct  55   SSFESLALPELQVKVDTDLFIIDEVGKMELFSSSFFPAVLRVLESNIPLLASVPIPKSGR  114

Query  370  DIPGVARLKNHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            DIPGVARLKNHPGA +  LN +NRDA+KE ++S L + LQ
Sbjct  115  DIPGVARLKNHPGATMCMLNTSNRDAMKEQIYSNLINLLQ  154



>ref|XP_010103255.1| Cancer-related nucleoside-triphosphatase-like protein [Morus 
notabilis]
 gb|EXB95126.1| Cancer-related nucleoside-triphosphatase-like protein [Morus 
notabilis]
Length=175

 Score =   149 bits (377),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQV+EDTDLF+IDEVGKMELYSSSFFPAVLK+LE+ +P+LA+VPIPK+GRDIPGVARLK
Sbjct  83   QLQVREDTDLFVIDEVGKMELYSSSFFPAVLKVLESNIPILATVPIPKSGRDIPGVARLK  142

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            NHPGA+I+ L  +NRDAIK+ ++S L D L+K
Sbjct  143  NHPGASIYALTASNRDAIKDQIYSQLVDLLRK  174


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 38/86 (44%), Gaps = 38/86 (44%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
            GKC LVTGPP                             REIR+G++RVGFEVVTLDG K
Sbjct  16   GKCLLVTGPP----------------------------VREIRQGSERVGFEVVTLDGHK  47

Query  197  GLLASNKISR*RKTLISSSLMKSVRW  274
              LA+           SS   + +RW
Sbjct  48   APLATT----------SSPSPECLRW  63



>ref|XP_008809107.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Phoenix dactylifera]
Length=211

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKE TDLFIIDEVGKMEL+SSSFFPAVLKILE+ +P+LAS+PIPK GRDIPGVARL+N
Sbjct  120  LQVKEGTDLFIIDEVGKMELFSSSFFPAVLKILESNIPILASIPIPKFGRDIPGVARLRN  179

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGAA+FTLN  NRDAIKE++++LL   L K
Sbjct  180  HPGAAVFTLNTGNRDAIKENIYNLLVTLLSK  210


 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 72/88 (82%), Gaps = 10/88 (11%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG  190
            AP KCF+VTGPPG+GKTTL+++V ESL++S+P+L ++GFYTRE+RE ++RVGFEVVTLDG
Sbjct  22   APSKCFIVTGPPGIGKTTLVMRVLESLKTSHPHLNIRGFYTREVREASERVGFEVVTLDG  81

Query  191  RKGLLASNKISR*RKTLISSSLMKSVRW  274
            R+G LAS+       T++S+   +S RW
Sbjct  82   RRGTLASS-------TVLSA---ESFRW  99



>ref|XP_010266192.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Nelumbo nucifera]
Length=192

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQ+KEDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +P+LA++PIPK GRDIPGVARL+N
Sbjct  101  LQIKEDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPVLATIPIPKFGRDIPGVARLRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTLNP+NRD +KE +++ L   L K
Sbjct  161  HPGATIFTLNPSNRDTMKEQIYTKLVALLHK  191


 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 10/90 (11%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKCFLVTGPPGVGKTTL+++V E +R++NPNLK+QGFYTRE+R+GT+RVGFEVVTL
Sbjct  1    MATPGKCFLVTGPPGVGKTTLVMRVLERIRTTNPNLKVQGFYTREVRQGTERVGFEVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGRKG LAS           ++S  +S+RW
Sbjct  61   DGRKGPLAST----------TNSSPESLRW  80



>ref|XP_010266191.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Nelumbo nucifera]
Length=234

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQ+KEDTDLFIIDEVGKMELYSSSFFPAVLK+LE+ +P+LA++PIPK GRDIPGVARL+N
Sbjct  143  LQIKEDTDLFIIDEVGKMELYSSSFFPAVLKVLESNIPVLATIPIPKFGRDIPGVARLRN  202

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTLNP+NRD +KE +++ L   L K
Sbjct  203  HPGATIFTLNPSNRDTMKEQIYTKLVALLHK  233


 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 73/132 (55%), Gaps = 52/132 (39%)
 Frame = +2

Query  5    MAAPGKCFLVTGPP------------------------------------------GVGK  58
            MA PGKCFLVTGPP                                          GVGK
Sbjct  1    MATPGKCFLVTGPPVSENEIPTNENTGTRFQCLVNLNRQAVFSYCCCLLPSCSFFQGVGK  60

Query  59   TTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLASNKISR*RKT  238
            TTL+++V E +R++NPNLK+QGFYTRE+R+GT+RVGFEVVTLDGRKG LAS         
Sbjct  61   TTLVMRVLERIRTTNPNLKVQGFYTREVRQGTERVGFEVVTLDGRKGPLAST--------  112

Query  239  LISSSLMKSVRW  274
              ++S  +S+RW
Sbjct  113  --TNSSPESLRW  122



>ref|XP_002273009.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Vitis 
vinifera]
 emb|CBI37644.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDTDLFIIDEVGKMEL+SSSFFPAVL++LE+ +P+LAS+PIPK  RDIPGVARL+N
Sbjct  100  LQVKEDTDLFIIDEVGKMELFSSSFFPAVLRVLESNIPVLASIPIPKFSRDIPGVARLRN  159

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTLN  NRD +KE ++S L D LQK
Sbjct  160  HPGATIFTLNTGNRDFVKEQIYSQLRDLLQK  190


 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 11/90 (12%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKCFLVTGPPGVGKTTLI++V E+L+ SNPNLK+QGFYT E+RE ++RVGF+VVTL
Sbjct  1    MAGPGKCFLVTGPPGVGKTTLIMRVLETLKISNPNLKVQGFYTSEVREASERVGFQVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGRKG LAS+         ISS   +S+RW
Sbjct  61   DGRKGPLASS---------ISSP--ESLRW  79



>ref|NP_974998.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED98138.1| uncharacterized protein AT5G66005 [Arabidopsis thaliana]
Length=164

 Score =   104 bits (260),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA  GKC LVTGPPGVGKTTLI++V + +R SNPNLK+QGFYT ++RE  QRVGF+VVTL
Sbjct  1    MAGTGKCLLVTGPPGVGKTTLIMRVLDMMRVSNPNLKIQGFYT-QMRERGQRVGFQVVTL  59

Query  185  DGRKGLLASNKIS  223
            DGR  LLAS+ +S
Sbjct  60   DGRTSLLASSIVS  72


 Score = 83.2 bits (204),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIP  378
            LQVK+DT+LFIIDEVGKME++S SFFPAVL +L++ VPLLAS+P PK GR +P
Sbjct  100  LQVKDDTNLFIIDEVGKMEMFSPSFFPAVLNVLDSNVPLLASIPSPKFGRHLP  152



>ref|XP_004287726.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Fragaria 
vesca subsp. vesca]
Length=191

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQV+EDTDLF+IDEVGKMEL+SSSFFP+VL++LE+ +P+LASVP+PK GRDIP VARLK
Sbjct  100  ELQVREDTDLFVIDEVGKMELFSSSFFPSVLRVLESNIPVLASVPVPKVGRDIPAVARLK  159

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            NHPGA IFTL+ +NRDA KE ++S L D L+K
Sbjct  160  NHPGATIFTLSQSNRDATKELIYSQLVDLLRK  191


 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 10/90 (11%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA  GKC LVTGPPGVGKTTLI+KVFE+L+SS PNLK+QGFYT E+R+G  RVGF+VVTL
Sbjct  1    MAGAGKCLLVTGPPGVGKTTLIVKVFETLKSSYPNLKIQGFYTSEVRQGGDRVGFQVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGR   LAS+ IS           ++S+RW
Sbjct  61   DGRTAPLASSTISS----------LESLRW  80



>emb|CDP01789.1| unnamed protein product [Coffea canephora]
Length=194

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDT+LFIIDEVGKMEL SS FFPAVL++L++ +PLLAS+PIPK+GRDIPGVARL+N
Sbjct  103  LQVKEDTELFIIDEVGKMELCSSFFFPAVLRVLQSNIPLLASIPIPKSGRDIPGVARLRN  162

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
             PGA +FTL+ NNRDA+KE ++S L+D L K
Sbjct  163  EPGATVFTLSKNNRDAMKEQIYSHLTDLLPK  193


 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            AAP KCFLVTGPPGVGKTTLII+V ESL+++ PNLK+QGFYTREIREG+ RVGFEVVTLD
Sbjct  4    AAPAKCFLVTGPPGVGKTTLIIRVLESLKTAYPNLKVQGFYTREIREGSDRVGFEVVTLD  63

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
            GR G LASNKIS            +S+RW
Sbjct  64   GRTGPLASNKISS----------AESLRW  82



>ref|XP_010918267.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Elaeis 
guineensis]
Length=193

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 82/92 (89%), Gaps = 4/92 (4%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            L++KE TDLFIIDEVGKMEL+SSSFFPAVLK+LE+ +P+LAS+PIPK GRDIPGVARL+N
Sbjct  102  LRIKEGTDLFIIDEVGKMELFSSSFFPAVLKVLESNIPILASIPIPKFGRDIPGVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLF----SLLSDQ  483
            HPGAA+FTLN  NRDAIKE+++    SLLS+ 
Sbjct  162  HPGAAVFTLNKANRDAIKENIYNQLVSLLSNH  193


 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 69/88 (78%), Gaps = 10/88 (11%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG  190
            AP KCFLVTGPPG+GKTTL+++V ESL++S+P+L + GFYTRE+REG++RVGFEVVTLDG
Sbjct  4    APSKCFLVTGPPGIGKTTLVMRVLESLKTSHPHLNIHGFYTREVREGSERVGFEVVTLDG  63

Query  191  RKGLLASNKISR*RKTLISSSLMKSVRW  274
            R+G LAS+ +S            +S RW
Sbjct  64   RRGTLASSTVSS----------AESFRW  81



>gb|EEC74447.1| hypothetical protein OsI_09852 [Oryza sativa Indica Group]
 gb|EEE58273.1| hypothetical protein OsJ_09288 [Oryza sativa Japonica Group]
Length=193

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK+DTDLFIIDEVGKMEL+SS+FFPAV++++E+ +P+LA++P+P+ GRDIPGVARL+N
Sbjct  102  LQVKDDTDLFIIDEVGKMELFSSAFFPAVMRVIESNIPVLATIPVPRLGRDIPGVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA I+TLN  NRDA++E +++ LS  LQK
Sbjct  162  HPGAVIYTLNTGNRDAMREGVYNHLSSLLQK  192


 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            AAP +C LVTGPPGVGKTTL+ +VFE+LR S+P+L ++GFYTRE+RE  +RVGFEVVTLD
Sbjct  3    AAPSRCLLVTGPPGVGKTTLVTRVFETLRESHPHLNIRGFYTREVRESGERVGFEVVTLD  62

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
            GR G LAS+K+S            +SVRW
Sbjct  63   GRTGPLASSKVSS----------RESVRW  81



>ref|XP_006425281.1| hypothetical protein CICLE_v10026547mg [Citrus clementina]
 gb|ESR38521.1| hypothetical protein CICLE_v10026547mg [Citrus clementina]
Length=193

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+ DTDLF+IDEVGKMEL+SSSFFPAVL+ILE+ +P+LAS+P PK+GRDIP VARL+N
Sbjct  102  LQVRADTDLFVIDEVGKMELFSSSFFPAVLRILESNIPVLASIPTPKSGRDIPAVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTL+P NRD++K++++  L+D + K
Sbjct  162  HPGATIFTLSPGNRDSLKDNIYYQLTDAVSK  192


 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            A  GKCFLVTGPPGVGKTTLI++V ESL++SNP+LK+QGFYT EIR+G QRVGFEVVTLD
Sbjct  3    AGAGKCFLVTGPPGVGKTTLIMRVLESLKASNPSLKVQGFYTGEIRQGGQRVGFEVVTLD  62

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
             R+  LAS          I++S  +S RW
Sbjct  63   DRRAPLAS----------INASSPESYRW  81



>ref|XP_011022175.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Populus 
euphratica]
Length=191

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQ++EDTDLFIIDEVGKMEL+SSSFFPAVLK+LE+ +PLLAS+PI K GRDIP VARL+
Sbjct  102  ELQIREDTDLFIIDEVGKMELFSSSFFPAVLKVLESNIPLLASIPILKFGRDIPAVARLR  161

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
            +HPGA IFTL+P+NRDA+KE +++ L D
Sbjct  162  DHPGAKIFTLSPSNRDAVKEQIYTQLVD  189


 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 10/88 (11%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG  190
            APGKCFLVTGPPGVGKTTLI++VFE+L++SNP LK+QGFYTREIREG +RVGFEVVTLDG
Sbjct  5    APGKCFLVTGPPGVGKTTLIMRVFETLKTSNPTLKIQGFYTREIREGIERVGFEVVTLDG  64

Query  191  RKGLLASNKISR*RKTLISSSLMKSVRW  274
            RK  LAS  IS            +S+RW
Sbjct  65   RKAPLASTTIST----------PESIRW  82



>gb|EMT32800.1| Nucleoside-triphosphatase THEP1 [Aegilops tauschii]
Length=128

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDTDLFIIDEVGKMEL+S +FFPAV++++E+ +P+LA++P+P+ GRDIPGVARL+N
Sbjct  37   LQVKEDTDLFIIDEVGKMELFSPAFFPAVMRVMESNIPVLATIPLPRYGRDIPGVARLRN  96

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA +FTLN  NRD ++E +++ LS  +QK
Sbjct  97   HPGADVFTLNTGNRDTMRESIYNQLSRLMQK  127



>ref|XP_009359592.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Pyrus x bretschneideri]
Length=191

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQV+EDTDLFI+DEVGKMEL+SSSFFP VL+ILE+ VP LA+VPIPK GRDIP VARLK
Sbjct  99   ELQVREDTDLFIVDEVGKMELFSSSFFPCVLRILESNVPFLATVPIPKFGRDIPAVARLK  158

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            NHPGA +FTL+ +NRD +KE ++S L   L K
Sbjct  159  NHPGATMFTLSKSNRDVVKEEIYSQLVALLSK  190


 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 11/90 (12%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKC LVTGPPGVGK+TL+++VFE+L++S PNLK+QGFYT E+RE ++RVGF+VVTL
Sbjct  1    MAGPGKCLLVTGPPGVGKSTLVMRVFETLKASYPNLKIQGFYTSEVREASERVGFQVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGR   L+S          ISS   +S+RW
Sbjct  61   DGRTAPLSST---------ISSP--ESLRW  79



>ref|XP_009359593.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Pyrus x bretschneideri]
Length=187

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQV+EDTDLFI+DEVGKMEL+SSSFFP VL+ILE+ VP LA+VPIPK GRDIP VARLK
Sbjct  95   ELQVREDTDLFIVDEVGKMELFSSSFFPCVLRILESNVPFLATVPIPKFGRDIPAVARLK  154

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            NHPGA +FTL+ +NRD +KE ++S L   L K
Sbjct  155  NHPGATMFTLSKSNRDVVKEEIYSQLVALLSK  186


 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 15/90 (17%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKC LVTGPPGVGK+TL+++VFE+L++S PNLK+QG    E+RE ++RVGF+VVTL
Sbjct  1    MAGPGKCLLVTGPPGVGKSTLVMRVFETLKASYPNLKIQG----EVREASERVGFQVVTL  56

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGR   L+S          ISS   +S+RW
Sbjct  57   DGRTAPLSST---------ISSP--ESLRW  75



>ref|XP_006467082.1| PREDICTED: cancer-related nucleoside-triphosphatase-like isoform 
X2 [Citrus sinensis]
 gb|KDO71480.1| hypothetical protein CISIN_1g029421mg [Citrus sinensis]
Length=193

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV  DTDLF+IDEVGKMEL+SSSFFPAVL+ILE+ +P+LAS+P PK+GRDIP VARL+N
Sbjct  102  LQVGADTDLFVIDEVGKMELFSSSFFPAVLRILESNIPVLASIPAPKSGRDIPAVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTL+P NRD++K++++  L+D + K
Sbjct  162  HPGATIFTLSPGNRDSLKDNIYYQLTDAVSK  192


 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            A  GKCFLVTGPPGVGKTTLI++V ESL++SNP+LK+QGFYT EIR+G QRVGFEVVTLD
Sbjct  3    AGAGKCFLVTGPPGVGKTTLIMRVLESLKASNPSLKVQGFYTGEIRQGGQRVGFEVVTLD  62

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
             R+  LAS          I++S  +S RW
Sbjct  63   DRRAPLAS----------INASSPESYRW  81



>ref|XP_006467081.1| PREDICTED: cancer-related nucleoside-triphosphatase-like isoform 
X1 [Citrus sinensis]
Length=196

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV  DTDLF+IDEVGKMEL+SSSFFPAVL+ILE+ +P+LAS+P PK+GRDIP VARL+N
Sbjct  105  LQVGADTDLFVIDEVGKMELFSSSFFPAVLRILESNIPVLASIPAPKSGRDIPAVARLRN  164

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA IFTL+P NRD++K++++  L+D + K
Sbjct  165  HPGATIFTLSPGNRDSLKDNIYYQLTDAVSK  195


 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 68/92 (74%), Gaps = 13/92 (14%)
 Frame = +2

Query  8    AAPGKCFLVTGPP---GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVV  178
            A  GKCFLVTGPP   GVGKTTLI++V ESL++SNP+LK+QGFYT EIR+G QRVGFEVV
Sbjct  3    AGAGKCFLVTGPPVSDGVGKTTLIMRVLESLKASNPSLKVQGFYTGEIRQGGQRVGFEVV  62

Query  179  TLDGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            TLD R+  LAS          I++S  +S RW
Sbjct  63   TLDDRRAPLAS----------INASSPESYRW  84



>tpg|DAA43161.1| TPA: hypothetical protein ZEAMMB73_715792 [Zea mays]
Length=93

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  223  QVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNH  402
            QVKE+TDLFIIDEVGKMEL+SS+FFPAV++++E+ +P+LA++PIP+ GRDIPGVARL+NH
Sbjct  4    QVKEETDLFIIDEVGKMELFSSAFFPAVMRVIESNIPVLATIPIPRQGRDIPGVARLRNH  63

Query  403  PGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            PGAA+FTL+  NRD +++ + S L   LQ+
Sbjct  64   PGAAVFTLDTGNRDTMRDTICSQLRSLLQR  93



>ref|XP_010229251.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Brachypodium distachyon]
Length=269

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQVKEDTDL+I+DEVGKMEL+SS+FFPAV++++E+ +P+LA++PIP+ GRDIPGVARL+
Sbjct  145  ELQVKEDTDLYIVDEVGKMELFSSAFFPAVVRVIESNIPVLATIPIPRYGRDIPGVARLR  204

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQKSIR  501
            NHPGA +FTLN  NRD ++E ++  LS  +QK  R
Sbjct  205  NHPGAVVFTLNTGNRDTMREGIYDQLSRLVQKRSR  239


 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 65/89 (73%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            A+P +C LVTG PGVGKTTL+++V E+LR+S+P L ++GF TRE+RE  +RVGFEVVT D
Sbjct  47   ASPSRCLLVTGAPGVGKTTLVMRVMETLRASHPELTIRGFSTREVRERGERVGFEVVTPD  106

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
            GR G LAS++IS            +SVRW
Sbjct  107  GRSGRLASSRISS----------PESVRW  125



>ref|XP_010229252.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X2 
[Brachypodium distachyon]
Length=267

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQVKEDTDL+I+DEVGKMEL+SS+FFPAV++++E+ +P+LA++PIP+ GRDIPGVARL+
Sbjct  145  ELQVKEDTDLYIVDEVGKMELFSSAFFPAVVRVIESNIPVLATIPIPRYGRDIPGVARLR  204

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            NHPGA +FTLN  NRD ++E ++  LS  +QK
Sbjct  205  NHPGAVVFTLNTGNRDTMREGIYDQLSRLVQK  236


 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 65/89 (73%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            A+P +C LVTG PGVGKTTL+++V E+LR+S+P L ++GF TRE+RE  +RVGFEVVT D
Sbjct  47   ASPSRCLLVTGAPGVGKTTLVMRVMETLRASHPELTIRGFSTREVRERGERVGFEVVTPD  106

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
            GR G LAS++IS            +SVRW
Sbjct  107  GRSGRLASSRISS----------PESVRW  125



>tpg|DAA43163.1| TPA: hypothetical protein ZEAMMB73_715792 [Zea mays]
Length=192

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKE+TDLFIIDEVGKMEL+SS+FFPAV++++E+ +P+LA++PIP+ GRDIPGVARL+N
Sbjct  102  LQVKEETDLFIIDEVGKMELFSSAFFPAVMRVIESNIPVLATIPIPRQGRDIPGVARLRN  161

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGAA+FTL+  NRD +++ + S L   LQ+
Sbjct  162  HPGAAVFTLDTGNRDTMRDTICSQLRSLLQR  192


 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            A P    L+TGPPGVGKTTL+++VFE+LR S+PNL ++GFYTRE+REG +R+GFEVVTLD
Sbjct  3    AVPSGFLLITGPPGVGKTTLVMRVFETLRGSHPNLNIRGFYTREVREGGERIGFEVVTLD  62

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
            GR G L+S K+S            +SVRW
Sbjct  63   GRTGPLSSCKVSS----------PESVRW  81



>ref|XP_008650688.1| PREDICTED: cancer-related nucleoside-triphosphatase [Zea mays]
Length=245

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKE+TDLFIIDEVGKMEL+SS+FFPAV++++E+ +P+LA++PIP+ GRDIPGVARL+N
Sbjct  155  LQVKEETDLFIIDEVGKMELFSSAFFPAVMRVIESNIPVLATIPIPRQGRDIPGVARLRN  214

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGAA+FTL+  NRD +++ + S L   LQ+
Sbjct  215  HPGAAVFTLDTGNRDTMRDTICSQLRSLLQR  245


 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            A P    L+TGPPGVGKTTL+++VFE+LR S+PNL ++GFYTRE+REG +R+GFEVVTLD
Sbjct  56   AVPSGFLLITGPPGVGKTTLVMRVFETLRGSHPNLNIRGFYTREVREGGERIGFEVVTLD  115

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
            GR G L+S K+S            +SVRW
Sbjct  116  GRTGPLSSCKVSS----------PESVRW  134



>ref|XP_010695204.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Beta 
vulgaris subsp. vulgaris]
Length=192

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQ+KEDTDLF+IDEVGKMELYSSSF PAVL++L + +PLLA++PI + GRDIPGVA L+N
Sbjct  101  LQIKEDTDLFVIDEVGKMELYSSSFLPAVLRLLNSNIPLLATIPIARYGRDIPGVATLRN  160

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA I+TLNP+NRD  +E + S + D L K
Sbjct  161  HPGATIYTLNPSNRDEYRERVHSHMIDLLTK  191


 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 10/90 (11%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MAAPGKC LV+G PGVGKTTLII+V E+LR+SNPNLK+QGFYTREIR+G +RVGFEV+T+
Sbjct  1    MAAPGKCVLVSGSPGVGKTTLIIRVLENLRASNPNLKVQGFYTREIRQGNERVGFEVITV  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            + ++  LAS          I++   +S RW
Sbjct  61   NDQRCTLAS----------INNPSPESSRW  80



>ref|XP_010466301.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X5 [Camelina sativa]
Length=183

 Score = 90.1 bits (222),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIP  378
             LQVKEDT LFIIDEVGKME++S SFFPAVLK+LE+ +PLLAS+P PK+GRD+P
Sbjct  126  ELQVKEDTHLFIIDEVGKMEMFSPSFFPAVLKVLESNIPLLASIPSPKSGRDLP  179


 Score = 85.1 bits (209),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 58/92 (63%), Gaps = 24/92 (26%)
 Frame = +2

Query  5    MAAPGKCFLVTGPP--------------------GVGKTTLIIKVFESLRS---SNPNLK  115
            MA  GKC LVTGPP                    GVGKTTLI++V + +     SNPNLK
Sbjct  1    MAGTGKCLLVTGPPVYKIRFGWISIFFFPDFAMKGVGKTTLIMRVLDMMMMRGLSNPNLK  60

Query  116  LQGFYTREIRE-GTQRVGFEVVTLDGRKGLLA  208
            +QGFYT+E+RE G QRVGF+VVTLDGR  LLA
Sbjct  61   IQGFYTQEMRERGGQRVGFQVVTLDGRTSLLA  92



>dbj|BAK01424.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=194

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQVKEDTDLFIIDEVGKMEL+S +FFPAV++++E+ +P+LA++P+P+ GRDIPGVARL+
Sbjct  101  ELQVKEDTDLFIIDEVGKMELFSPAFFPAVMRVMESNIPVLATIPLPRYGRDIPGVARLR  160

Query  397  NHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            NHPGA +FTL+  +RD ++E +++ LS +L +
Sbjct  161  NHPGADVFTLSTGDRDTMRESIYNQLSSRLMQ  192


 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 10/89 (11%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            AA  +C LVTGPPGVGKTTL+++V E+LRSS+P+L ++GFYTRE+RE  +RVGFEVVTLD
Sbjct  3    AASSRCLLVTGPPGVGKTTLVMRVLETLRSSHPHLAVRGFYTREVRENGERVGFEVVTLD  62

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
            GR G LAS++IS            +SVRW
Sbjct  63   GRSGPLASSRISS----------PESVRW  81



>ref|XP_010484704.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X3 [Camelina sativa]
Length=171

 Score = 89.0 bits (219),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 10/77 (13%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRS-------SNPNLKLQGFYT--REIREGTQRVGFE  172
            KC LVTGPPGVGKTTLI++V + +R        SNPNLK+QGFYT  RE R G QRVGF+
Sbjct  12   KCLLVTGPPGVGKTTLIMRVLDMMRMRMRMKGLSNPNLKIQGFYTQMRE-RRGGQRVGFQ  70

Query  173  VVTLDGRKGLLASNKIS  223
            VVTLDGR  LLAS+ +S
Sbjct  71   VVTLDGRTSLLASSTVS  87


 Score = 85.1 bits (209),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPG  381
             LQVKEDT LFIIDEVGKME++S SFFPAVL +LE+ +PLLAS+P PK+G  +PG
Sbjct  115  ELQVKEDTHLFIIDEVGKMEMFSPSFFPAVLTVLESNIPLLASIPSPKSGGHLPG  169



>ref|XP_006281185.1| hypothetical protein CARUB_v10027220mg, partial [Capsella rubella]
 gb|EOA14083.1| hypothetical protein CARUB_v10027220mg, partial [Capsella rubella]
Length=180

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 106/172 (62%), Gaps = 19/172 (11%)
 Frame = +1

Query  1    RNGSSWKMLPCDRASWRRQDYSDYQSIRKSSQF*S*LEASGLLYS*N*GRNTEGRIRGGH  180
            +NGS  +M  C R+SW R+++ D++S R    F    +  G L+S       +G +    
Sbjct  15   KNGSHREMPSCHRSSWCRENHIDHESCRYDEGFQPQTKDPGSLHS-------QGSMTS--  65

Query  181  TRWP*RA------SCFQQ----NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGV  330
            + WP         + F+      LQVK+DT LFIIDEVGKME++S SF PAVLK+LE+ +
Sbjct  66   SSWPSVGKYKVDIASFESIALPELQVKDDTHLFIIDEVGKMEMFSPSFLPAVLKVLESNI  125

Query  331  PLLASVPIPKAGRDIPGVARLKNHPGAAIFTLNPNNRDAIKEHLFSLLSDQL  486
            P LAS+P  K GRD+PGVARLKN PG  +  L+ NNRD++++++F + S  L
Sbjct  126  PFLASIPSSKFGRDLPGVARLKNQPGVTVINLSANNRDSMRKYIFDVFSGWL  177



>ref|XP_006382998.1| hypothetical protein POPTR_0005s10450g [Populus trichocarpa]
 gb|ERP60795.1| hypothetical protein POPTR_0005s10450g [Populus trichocarpa]
Length=134

 Score =   125 bits (314),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 10/88 (11%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG  190
            APGKCFLVTGPPGVGKTTLI++VFE+L++SNP LK+QGFYTREIREG +RVGFEVVTLDG
Sbjct  5    APGKCFLVTGPPGVGKTTLIMRVFETLKTSNPTLKIQGFYTREIREGIERVGFEVVTLDG  64

Query  191  RKGLLASNKISR*RKTLISSSLMKSVRW  274
            RK  LAS  IS            +S+RW
Sbjct  65   RKAPLASTTIST----------PESIRW  82


 Score = 45.4 bits (106),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  391  LKNHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
            L++HPGA IFTL+P+N DA+KE +++ L D
Sbjct  103  LRDHPGAKIFTLSPSNSDAVKEQIYTQLVD  132



>ref|NP_001048856.1| Os03g0130700 [Oryza sativa Japonica Group]
 gb|AAO72591.1| unknown [Oryza sativa Japonica Group]
 dbj|BAF10770.1| Os03g0130700 [Oryza sativa Japonica Group]
Length=1413

 Score =   138 bits (347),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 61/91 (67%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK+DTDLFIIDEVGKMEL+SS+FFPAV++++E+ +P+LA++P+P+ GRDIPGVARL+N
Sbjct  242  LQVKDDTDLFIIDEVGKMELFSSAFFPAVMRVIESNIPVLATIPVPRLGRDIPGVARLRN  301

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA I+TLN  NRDA++E +++ LS  LQK
Sbjct  302  HPGAVIYTLNTGNRDAMREGVYNHLSSLLQK  332


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 10/76 (13%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLASNKISR  226
            GVGKTTL+ +VFE+LR S+P+L ++GFYTRE+RE  +RVGFEVVTLDGR G LAS+K+S 
Sbjct  156  GVGKTTLVTRVFETLRESHPHLNIRGFYTREVRESGERVGFEVVTLDGRTGPLASSKVSS  215

Query  227  *RKTLISSSLMKSVRW  274
                       +SVRW
Sbjct  216  ----------RESVRW  221



>ref|XP_006855733.1| hypothetical protein AMTR_s00044p00159530 [Amborella trichopoda]
 gb|ERN17200.1| hypothetical protein AMTR_s00044p00159530 [Amborella trichopoda]
Length=191

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 85/118 (72%), Gaps = 10/118 (8%)
 Frame = +1

Query  166  IRGGHTRWP*RA------SCFQ----QNLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKI  315
            +  G  RWP         + F+      L+V+E T+LFIIDEVG+MEL+SSSFFPAVL++
Sbjct  72   VSAGTARWPSVGKYKVDVASFEFLALPELEVREGTELFIIDEVGRMELFSSSFFPAVLEV  131

Query  316  LETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            L+T +P+LA++PIPK GRDIP VARL+NHPGA ++TLN +NRD I+E + + L + L 
Sbjct  132  LKTNIPILATIPIPKFGRDIPEVARLRNHPGAEVYTLNSSNRDNIREQISTQLLNMLN  189


 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M  P K  L+TGPPG+GKTTL+++V ESLR+S PNLK+QGFYTREIR+GT+RVGFEVVTL
Sbjct  1    MGTPAKGVLLTGPPGIGKTTLVMRVLESLRASKPNLKVQGFYTREIRQGTERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR+  LAS  +S
Sbjct  61   DGRRESLASTSVS  73



>gb|EMS63092.1| Nucleoside-triphosphatase THEP1 [Triticum urartu]
Length=1188

 Score =   135 bits (340),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVKEDTDLFIIDEVGKMEL+SS+FFPAV++++E  +P+LA++P+P+ GRDIPGVARL+N
Sbjct  44   LQVKEDTDLFIIDEVGKMELFSSAFFPAVMRVMEFNIPVLATIPLPRYGRDIPGVARLRN  103

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            HPGA +FTLN  NRD ++E +++ LS  +QK
Sbjct  104  HPGADVFTLNTGNRDTMRESIYNQLSRLMQK  134



>ref|NP_974997.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED98137.1| uncharacterized protein AT5G66005 [Arabidopsis thaliana]
Length=147

 Score =   122 bits (306),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK+DT+LFIIDEVGKME++S SFFPAVL +L++ VPLLAS+P PK GR +P VARLKN
Sbjct  56   LQVKDDTNLFIIDEVGKMEMFSPSFFPAVLNVLDSNVPLLASIPSPKFGRHLPEVARLKN  115

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
             PG  + +L+  NRD +KEH+F + S  L K
Sbjct  116  QPGVNVISLSATNRDPMKEHIFDVFSGWLPK  146


 Score = 40.4 bits (93),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  140  IREGTQRVGFEVVTLDGRKGLLASNKIS  223
            +RE  QRVGF+VVTLDGR  LLAS+ +S
Sbjct  1    MRERGQRVGFQVVTLDGRTSLLASSIVS  28



>gb|AFK41625.1| unknown [Lotus japonicus]
Length=103

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 72/90 (80%), Gaps = 10/90 (11%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            MA PGKCFLVTGPPGVGK+TLI++VFE+L+SSNPNLK+QGFYTRE+R   +RVGFEVVTL
Sbjct  1    MAGPGKCFLVTGPPGVGKSTLIMRVFEALKSSNPNLKVQGFYTREVRSAGERVGFEVVTL  60

Query  185  DGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            DGR   LAS        T+ISS   +S+RW
Sbjct  61   DGRTCPLAS--------TIISSP--ESMRW  80



>ref|XP_008448476.1| PREDICTED: uncharacterized protein LOC103490648 isoform X3 [Cucumis 
melo]
Length=162

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M  PG+C LVTGPPGVGKTTLI+KVFE L++S+PNLK++GFYTREIR+G+QRVGFEVVTL
Sbjct  1    MGGPGRCLLVTGPPGVGKTTLIVKVFEMLKASSPNLKIKGFYTREIRQGSQRVGFEVVTL  60

Query  185  DGRKGLLASNKISR  226
            DGR   LAS  +SR
Sbjct  61   DGRTAPLASTSVSR  74



>ref|XP_006467083.1| PREDICTED: cancer-related nucleoside-triphosphatase-like isoform 
X3 [Citrus sinensis]
Length=181

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLK  396
             LQV  DTDLF+IDEVGKMEL+SSSFFPAVL+ILE+ +P+LAS+P PK+GRDIP VARL+
Sbjct  104  ELQVGADTDLFVIDEVGKMELFSSSFFPAVLRILESNIPVLASIPAPKSGRDIPAVARLR  163

Query  397  NHPGAAIFTLNPN  435
            NHPGA IFTL+P 
Sbjct  164  NHPGATIFTLSPG  176


 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 68/92 (74%), Gaps = 13/92 (14%)
 Frame = +2

Query  8    AAPGKCFLVTGPP---GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVV  178
            A  GKCFLVTGPP   GVGKTTLI++V ESL++SNP+LK+QGFYT EIR+G QRVGFEVV
Sbjct  3    AGAGKCFLVTGPPVSDGVGKTTLIMRVLESLKASNPSLKVQGFYTGEIRQGGQRVGFEVV  62

Query  179  TLDGRKGLLASNKISR*RKTLISSSLMKSVRW  274
            TLD R+  LAS          I++S  +S RW
Sbjct  63   TLDDRRAPLAS----------INASSPESYRW  84



>ref|XP_006281186.1| hypothetical protein CARUB_v10027220mg, partial [Capsella rubella]
 gb|EOA14084.1| hypothetical protein CARUB_v10027220mg, partial [Capsella rubella]
Length=151

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQVK+DT LFIIDEVGKME++S SF PAVLK+LE+ +P LAS+P  K GRD+PGVARLKN
Sbjct  60   LQVKDDTHLFIIDEVGKMEMFSPSFLPAVLKVLESNIPFLASIPSSKFGRDLPGVARLKN  119

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQL  486
             PG  +  L+ NNRD++++++F + S  L
Sbjct  120  QPGVTVINLSANNRDSMRKYIFDVFSGWL  148



>gb|KEH27626.1| cancer-related nucleoside-triphosphatase-like protein [Medicago 
truncatula]
Length=147

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M   GKCFLVTGPPGVGK+TLI++VFESL++SNP LK+QGFYTRE+R   +RVGFEVVTL
Sbjct  1    MVGTGKCFLVTGPPGVGKSTLIMRVFESLKASNPTLKVQGFYTREVRVAGERVGFEVVTL  60

Query  185  DGRKGLLASNKIS  223
            DGR   LAS+  S
Sbjct  61   DGRTCPLASSNFS  73



>ref|XP_008809109.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X3 [Phoenix dactylifera]
 ref|XP_008809110.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X3 [Phoenix dactylifera]
Length=183

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 72/88 (82%), Gaps = 10/88 (11%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG  190
            AP KCF+VTGPPG+GKTTL+++V ESL++S+P+L ++GFYTRE+RE ++RVGFEVVTLDG
Sbjct  22   APSKCFIVTGPPGIGKTTLVMRVLESLKTSHPHLNIRGFYTREVREASERVGFEVVTLDG  81

Query  191  RKGLLASNKISR*RKTLISSSLMKSVRW  274
            R+G LAS+       T++S+   +S RW
Sbjct  82   RRGTLASS-------TVLSA---ESFRW  99


 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPG  381
             LQVKE TDLFIIDEVGKMEL+SSSFFPAVLKILE+ +P+LAS+PIPK GRDIPG
Sbjct  119  ELQVKEGTDLFIIDEVGKMELFSSSFFPAVLKILESNIPILASIPIPKFGRDIPG  173



>ref|XP_008809108.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Phoenix dactylifera]
Length=204

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 72/88 (82%), Gaps = 10/88 (11%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG  190
            AP KCF+VTGPPG+GKTTL+++V ESL++S+P+L ++GFYTRE+RE ++RVGFEVVTLDG
Sbjct  22   APSKCFIVTGPPGIGKTTLVMRVLESLKTSHPHLNIRGFYTREVREASERVGFEVVTLDG  81

Query  191  RKGLLASNKISR*RKTLISSSLMKSVRW  274
            R+G LAS+       T++S+   +S RW
Sbjct  82   RRGTLASS-------TVLSA---ESFRW  99


 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPG  381
             LQVKE TDLFIIDEVGKMEL+SSSFFPAVLKILE+ +P+LAS+PIPK GRDIPG
Sbjct  119  ELQVKEGTDLFIIDEVGKMELFSSSFFPAVLKILESNIPILASIPIPKFGRDIPG  173



>tpg|DAA43162.1| TPA: hypothetical protein ZEAMMB73_715792 [Zea mays]
Length=86

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            A P    L+TGPPGVGKTTL+++VFE+LR S+PNL ++GFYTRE+REG +R+GFEVVTLD
Sbjct  3    AVPSGFLLITGPPGVGKTTLVMRVFETLRGSHPNLNIRGFYTREVREGGERIGFEVVTLD  62

Query  188  GRKGLLASNKISR  226
            GR G L+S K+SR
Sbjct  63   GRTGPLSSCKVSR  75



>gb|KEH27624.1| cancer-related nucleoside-triphosphatase-like protein [Medicago 
truncatula]
Length=145

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 2/73 (3%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M   GKCFLVTGPPGVGK+TLI++VFESL++SNP LK+QGFYT  +R   +RVGFEVVTL
Sbjct  1    MVGTGKCFLVTGPPGVGKSTLIMRVFESLKASNPTLKVQGFYT--LRVAGERVGFEVVTL  58

Query  185  DGRKGLLASNKIS  223
            DGR   LAS+  S
Sbjct  59   DGRTCPLASSNFS  71



>gb|ABF93803.1| expressed protein [Oryza sativa Japonica Group]
Length=1155

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  271  MELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFTLNPNNRDAI  450
            MEL+SS+FFPAV++++E+ +P+LA++P+P+ GRDIPGVARL+NHPGA I+TLN  NRDA+
Sbjct  1    MELFSSAFFPAVMRVIESNIPVLATIPVPRLGRDIPGVARLRNHPGAVIYTLNTGNRDAM  60

Query  451  KEHLFSLLSDQLQK  492
            +E +++ LS  LQK
Sbjct  61   REGVYNHLSSLLQK  74



>ref|XP_002068320.1| GK13424 [Drosophila willistoni]
 gb|EDW79306.1| GK13424 [Drosophila willistoni]
Length=185

 Score = 68.9 bits (167),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EGTQRVGFEVVT  181
            MA      L+TGPPGVGKTTL+ K+  +L       KLQGFYT E+R E  QR+GF+VVT
Sbjct  1    MANSTGIVLITGPPGVGKTTLVRKICANLSGVR---KLQGFYTEEVRDESHQRIGFDVVT  57

Query  182  LDGRKGLLA  208
            L G++G+LA
Sbjct  58   LAGQRGILA  66


 Score = 65.5 bits (158),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = +1

Query  238  TDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAI  417
            + L++IDEVGKMEL S  F  A+ +++   VPLLA+  IP+ G+ +P V  LK  PGA I
Sbjct  107  SSLWVIDEVGKMELCSFPFEDALEELIYCQVPLLAT--IPQQGQSLPMVKLLKQQPGAVI  164

Query  418  FTLNPNNRDAIKEHLFSLLS  477
            + +  +NRDA+   +   L+
Sbjct  165  YHVTESNRDALCATITEYLT  184



>ref|XP_010863431.1| PREDICTED: cancer-related nucleoside-triphosphatase [Esox lucius]
Length=193

 Score = 68.2 bits (165),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +1

Query  214  QNLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGV-PLLASVPIPKAGRDIPGVAR  390
            +N +      LFIIDEVG+MEL+S SF  AV + L++ V  +L ++P+PK G+ +  V  
Sbjct  99   RNFESAGARKLFIIDEVGRMELFSQSFIRAVRQTLDSSVCCVLGTIPLPK-GKPLVLVEE  157

Query  391  LKNHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQKSI  498
            ++  P   +FT+  +NRD I   + S+L + L++S+
Sbjct  158  IRARPDVTVFTVTKDNRDVILSDILSVLQNCLKQSL  193


 Score = 65.9 bits (159),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGK+TL+ K  + + SS   + ++GFYT+E+REG +RVGF+VVTL G++G
Sbjct  3    KHVFLTGPPGVGKSTLVQKACDVMTSSG--VSVEGFYTQEVREGGRRVGFDVVTLTGQRG  60

Query  200  LLA  208
             L+
Sbjct  61   HLS  63



>ref|XP_001956976.1| GF10190 [Drosophila ananassae]
 gb|EDV39782.1| GF10190 [Drosophila ananassae]
Length=187

 Score = 70.5 bits (171),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = +2

Query  23   CFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EGTQRVGFEVVTLDGRKG  199
              L+TGPPGVGKTTL+ K++  LR    NL  +GFYT E+R E  QR+GF+VVTL G++G
Sbjct  4    IILITGPPGVGKTTLVHKIWSKLREK--NLSSRGFYTEEVRGENGQRIGFDVVTLAGKRG  61

Query  200  LLA  208
            +L+
Sbjct  62   ILS  64


 Score = 62.4 bits (150),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
            + +L IIDEVG+MEL+S  F  AV  +L    PL+  + IP+ G  +P V +LK HPGA 
Sbjct  103  ERELLIIDEVGRMELFSKKFESAVRDLLRQKTPLV--ITIPQKGH-LPLVEQLKKHPGAI  159

Query  415  IFTLNPNNRDAIKEHLFSLLSDQL  486
            +  +  +NR+A+ + +  L+   L
Sbjct  160  LHNVTKSNREALVQEITDLIEKSL  183



>ref|XP_002739152.2| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Saccoglossus 
kowalevskii]
Length=199

 Score = 70.9 bits (172),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGT-QRVGFEVVTLDGRK  196
            K  ++TGPPGVGKTTLI +V E L+S   ++ +QGFYT E+R G  +RVGF+VVTLDG++
Sbjct  18   KHVILTGPPGVGKTTLIQRVTEKLQSY--SVSVQGFYTEEVRGGHGKRVGFDVVTLDGKR  75

Query  197  GLLA  208
            G LA
Sbjct  76   GTLA  79


 Score = 61.6 bits (148),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFT  423
            +++IDE+GKME++S SF   V  IL  G+ +LA++PIPKA R +  V  +++     IFT
Sbjct  120  IYVIDEIGKMEMFSDSFKVQVQSILNQGITVLATIPIPKA-RPLLFVEEIRSRQDVKIFT  178

Query  424  LNPNNRD  444
            +   NRD
Sbjct  179  VTKENRD  185



>gb|EKC25319.1| Nucleoside-triphosphatase C1orf57 [Crassostrea gigas]
Length=202

 Score = 68.6 bits (166),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +1

Query  214  QNLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVAR  390
            +N Q    + +FIIDE+GKMEL+S +F   V  +L+     ++A++P+PK GR IP V  
Sbjct  111  KNAQTDSKSQVFIIDEIGKMELFSQTFVSMVRDVLKNPKSTIIATIPVPK-GRPIPFVEE  169

Query  391  LKNHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
            ++NH    +FT+   NRD + E +   L +
Sbjct  170  IRNHTQVQVFTVTMENRDKLLEDIMGTLHN  199


 Score = 63.2 bits (152),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = +2

Query  32   VTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            +TG PG+GKTTLI K+  +L  S   ++++GFYT E+ E  QR+GF+VVTLDG +G LA
Sbjct  15   LTGRPGIGKTTLIKKIHSAL--SKTGVEVRGFYTEELLESGQRIGFDVVTLDGNRGPLA  71



>ref|XP_003723869.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Strongylocentrotus 
purpuratus]
Length=190

 Score = 69.7 bits (169),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K    L S    + LQGFYT E+REG +R GF+++TLDG++G
Sbjct  8    KHVFLTGPPGVGKTTLVRKTCSELMSKA--IPLQGFYTEELREGGKRTGFDIITLDGQRG  65

Query  200  LLA  208
             LA
Sbjct  66   TLA  68


 Score = 61.6 bits (148),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHP  405
            K+ + +++IDE+GKMEL+S  F  AV K+++     +  ++P+PK GR +  V  +++ P
Sbjct  100  KDSSPIYVIDEIGKMELFSQGFIQAVRKLIDQPNTTIFGTIPVPK-GRPLGLVEEVRSRP  158

Query  406  GAAIFTLNPNNRDAIKEHLFSLLSD  480
               +FT++ +NRD I E +   ++ 
Sbjct  159  DVQVFTISKDNRDGIIEEILKAINQ  183



>ref|XP_005291265.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Chrysemys picta bellii]
Length=190

 Score = 69.3 bits (168),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             K   +TGPPG+GKTTLI K  E L+SS   + + GFYT E+RE  +R+GF+V+TL GR+
Sbjct  2    AKHVFLTGPPGIGKTTLIQKATEVLKSSG--VPIDGFYTEEVRESGRRIGFDVITLSGRR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GTLS  63


 Score = 59.3 bits (142),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 55/92 (60%), Gaps = 4/92 (4%)
 Frame = +1

Query  214  QNLQVKEDT--DLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+ +  DT   +++IDEVGKMEL+S SF  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  97   RNVDLGSDTGKKVYVIDEVGKMELFSRSFIQAVRQTLTASGTTILGTIPIPK-GKPLGLV  155

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
              +++     +F +   NRD I + + + + D
Sbjct  156  EEIRSRKDVKVFNVTKENRDNILQDIVTTVQD  187



>gb|ACQ58852.1| Probable UPF0334 kinase-like protein C1orf57 [Anoplopoma fimbria]
Length=195

 Score = 67.4 bits (163),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 7/77 (9%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   +  +GFYT E+REG +RVGF+VVT+ G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSGAGV--EGFYTEEVREGGRRVGFDVVTVTGERG  60

Query  200  LLASNKISR*RKTLISS  250
                 ++SR R    SS
Sbjct  61   -----RLSRIRDVAASS  72


 Score = 60.8 bits (146),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +F+IDE+GKMEL+S SF  AV + L+ +   +L ++PIPK G+ +  V  +++     +F
Sbjct  111  VFVIDEIGKMELFSQSFVRAVRQTLDSSSCTILGTIPIPK-GKPLGLVEEVRSRRDVKVF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKS  495
            T++  NR+AI + + + L + L+ S
Sbjct  170  TVSKENRNAILQDILATLQNCLKHS  194



>gb|KHN41819.1| Nucleoside-triphosphatase THEP1 [Glycine soja]
Length=130

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 60/91 (66%), Gaps = 16/91 (18%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            LQV+EDTDLFIIDEVGKMEL+SSSFFPAVL++     P                +ARL+N
Sbjct  55   LQVREDTDLFIIDEVGKMELFSSSFFPAVLRVFGVKYP----------------IARLRN  98

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQK  492
            H GA  FTL+ +NRDA++E + S L D L K
Sbjct  99   HAGATCFTLSVSNRDAVREKIRSQLEDLLTK  129



>ref|NP_001134734.1| Probable UPF0334 kinase-like protein C1orf57 [Salmo salar]
 gb|ACI68630.1| Probable UPF0334 kinase-like protein C1orf57 [Salmo salar]
 gb|ADM15933.1| Probable UPF0334 kinase-like protein C1orf57 [Salmo salar]
Length=195

 Score = 66.2 bits (160),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  + + SS   + ++GFYT+E+REG +RVGF+VVT+ G++G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACDVMVSSG--VSVEGFYTQEVREGRRRVGFDVVTVTGQRG  60

Query  200  LLA  208
             L+
Sbjct  61   HLS  63


 Score = 60.5 bits (145),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 2/94 (2%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGV-PLLASVPIPKAGRDIPGVARL  393
            N     +  +FIIDEVGKMEL+S +F  +V + L++ V  +L ++P+P +G+ +  +  +
Sbjct  102  NSSCSSNRQVFIIDEVGKMELFSQAFIWSVRQTLDSPVFSVLGTIPLP-SGKPLGFMEEI  160

Query  394  KNHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQKS  495
            +      +FT+   NRD I   + S L D L++S
Sbjct  161  RTRTDVTVFTVTKENRDVILTEIVSALKDCLKQS  194



>ref|NP_001003463.1| cancer-related nucleoside-triphosphatase [Danio rerio]
 gb|AAH78345.1| Zgc:92420 [Danio rerio]
Length=185

 Score = 65.1 bits (157),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +1

Query  214  QNLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVAR  390
            +N+Q      LF++DEVGKMEL+S  F  AV +ILE +   +L ++P+PK G+ +  V  
Sbjct  94   RNMQEGSGKQLFVMDEVGKMELFSQPFIRAVRQILEKSCCSVLGTIPVPK-GKPLALVEE  152

Query  391  LKNHPGAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
            L++     IFT+   NRD I + + S + + L+
Sbjct  153  LRSRADVKIFTVTKENRDVIFDDIVSAVRECLK  185


 Score = 59.7 bits (143),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TG PGVGKTTL+ KV ++L      L + GFYT E+RE  +RVGF+VVT+ G +G
Sbjct  2    KHVFLTGVPGVGKTTLVKKVCDAL----SGLSVSGFYTEEVREHGRRVGFDVVTVSGDRG  57

Query  200  LLA  208
             L+
Sbjct  58   RLS  60



>ref|XP_002047842.1| GJ13661 [Drosophila virilis]
 gb|EDW70184.1| GJ13661 [Drosophila virilis]
Length=189

 Score = 65.5 bits (158),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +2

Query  23   CFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGL  202
             F++TG PGVGKTTLI K+  +L   +   KL GFYT E+R   QR+GF+VVT++G +G+
Sbjct  8    AFIITGQPGVGKTTLIRKLCTALSVHS---KLAGFYTEEVRANGQRIGFDVVTVNGTRGI  64

Query  203  LA  208
            LA
Sbjct  65   LA  66


 Score = 59.3 bits (142),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFT  423
            L +IDE+GKMEL S+ F  AV ++L+   P+L ++P+ +  + IP V RLK+ P A  F 
Sbjct  106  LLLIDEIGKMELLSNRFEAAVSELLKQKQPILVTIPL-RTRQPIPIVERLKSSPDAVTFH  164

Query  424  LNPNNRDAIKEHLFSLLSDQLQK  492
            +  +NRD + + +   + D L K
Sbjct  165  VTRSNRDGLTQVITEYIVDALFK  187



>ref|XP_002989823.1| hypothetical protein SELMODRAFT_48869, partial [Selaginella moellendorffii]
 ref|XP_002992000.1| hypothetical protein SELMODRAFT_49183, partial [Selaginella moellendorffii]
 gb|EFJ06968.1| hypothetical protein SELMODRAFT_49183, partial [Selaginella moellendorffii]
 gb|EFJ09090.1| hypothetical protein SELMODRAFT_48869, partial [Selaginella moellendorffii]
Length=133

 Score = 75.1 bits (183),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD-GRKGLLAS  211
            G+GKTTLI+KV E LR+++PNLK+QGFYT+E+R+  +RVGFEV+  + GRK +LAS
Sbjct  1    GIGKTTLIVKVVEKLRATHPNLKVQGFYTKEVRKEGERVGFEVIAFNGGRKEMLAS  56


 Score = 49.3 bits (116),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVP  351
            EDT LF+IDEVGKMEL+S  FFPAV  +L+     +L SVP
Sbjct  93   EDTQLFVIDEVGKMELFSPKFFPAVEALLQRRNAVILGSVP  133



>emb|CCI55420.1| PH01B031C15.3 [Phyllostachys edulis]
Length=185

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 5/78 (6%)
 Frame = +1

Query  151  NTEGRIRGGHTRWP*RASCFQQNLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGV  330
            ++E  I  GH      +S   Q   VKEDTDLFIIDEVGKMEL+SS+FFPAV++++E+ +
Sbjct  92   SSELSILKGHI-----SSAKLQKRDVKEDTDLFIIDEVGKMELFSSAFFPAVMRVIESNI  146

Query  331  PLLASVPIPKAGRDIPGV  384
            P+LA++PIP+ GRDIPGV
Sbjct  147  PVLATIPIPRYGRDIPGV  164


 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 44/89 (49%), Gaps = 24/89 (27%)
 Frame = +2

Query  8    AAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            AAP +C LVTGPP     T     F               +  E+RE  +RVGFEVVTLD
Sbjct  3    AAPSRCLLVTGPP---FATGFFTPFSCY-----------LFVGEVRESGERVGFEVVTLD  48

Query  188  GRKGLLASNKISR*RKTLISSSLMKSVRW  274
            GR G LAS+ IS           ++SVRW
Sbjct  49   GRSGPLASSNISS----------LESVRW  67



>gb|ACH44231.1| putative RIKEN cDNA 2310079N02 variant 2 [Taeniopygia guttata]
Length=192

 Score = 68.6 bits (166),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS     + GFYT+E+REG +R GF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSGA--PIDGFYTQEVREGGRRTGFDVVTLSGNRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 53.1 bits (126),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 55/88 (63%), Gaps = 4/88 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV ++L  +G  +L ++PIPK G+ +  V
Sbjct  99   RNVNHGGDTEKRICVIDEIGKMELFSQAFIQAVCQMLAGSGTVVLGTIPIPK-GKPLDLV  157

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
              +++     +F ++  NR++I + + +
Sbjct  158  EEIRSRKDVKVFNVSKENRNSILQDILA  185



>ref|NP_001153395.1| nucleoside-triphosphatase C1orf57 [Taeniopygia guttata]
Length=190

 Score = 68.9 bits (167),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS     + GFYT+E+REG +R GF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSGA--PIDGFYTQEVREGGRRAGFDVVTLSGNRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 52.4 bits (124),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 55/88 (63%), Gaps = 4/88 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV ++L  +G  +L ++PIPK G+ +  V
Sbjct  97   RNVNHGGDTEKRICVIDEIGKMELFSQAFIQAVRQMLAGSGTVVLGTIPIPK-GKPLDLV  155

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
              +++     +F ++  NR++I + + +
Sbjct  156  EEIRSRKDVKVFNVSKENRNSILQDILA  183



>ref|XP_005518594.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Pseudopodoces humilis]
Length=192

 Score = 68.9 bits (167),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS   + + GFYT+E+REG +R GF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSG--VPIDGFYTQEVREGGRRTGFDVVTLSGNRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 52.0 bits (123),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  99   RNVNQDGDTEKRICVIDEIGKMELFSQAFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  157

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
              +++     +F ++  NR++I + + +
Sbjct  158  EEIRSRKDVRVFNVSKENRNSILQDILA  185



>ref|XP_005518595.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X2 
[Pseudopodoces humilis]
Length=190

 Score = 68.9 bits (167),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS   + + GFYT+E+REG +R GF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSG--VPIDGFYTQEVREGGRRTGFDVVTLSGNRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 52.0 bits (123),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  97   RNVNQDGDTEKRICVIDEIGKMELFSQAFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  155

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
              +++     +F ++  NR++I + + +
Sbjct  156  EEIRSRKDVRVFNVSKENRNSILQDILA  183



>ref|XP_009091097.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X2 
[Serinus canaria]
Length=190

 Score = 69.3 bits (168),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS   + + GFYT+E+REG +R GF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSG--VPIDGFYTQEVREGGRRTGFDVVTLSGNRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 51.6 bits (122),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  97   RNVNHGGDTEKRICVIDEIGKMELFSQAFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  155

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
              +++     +F ++  NR++I + + +
Sbjct  156  EEIRSRKDVKVFNVSKENRNSILQDILA  183



>ref|XP_009091096.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Serinus canaria]
Length=192

 Score = 69.3 bits (168),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS   + + GFYT+E+REG +R GF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSG--VPIDGFYTQEVREGGRRTGFDVVTLSGNRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 51.2 bits (121),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  99   RNVNHGGDTEKRICVIDEIGKMELFSQAFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  157

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
              +++     +F ++  NR++I + + +
Sbjct  158  EEIRSRKDVKVFNVSKENRNSILQDILA  185



>ref|XP_001984585.1| GH14943 [Drosophila grimshawi]
 gb|EDV96933.1| GH14943 [Drosophila grimshawi]
Length=214

 Score = 67.4 bits (163),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = +2

Query  23   CFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGL  202
             FL+TG PGVGKTTL+ K+   L   N   KL GFYT E+R   QR+GF+VVT+ G +G+
Sbjct  8    TFLITGQPGVGKTTLVRKIIAKLGGDN---KLAGFYTEEVRTNGQRIGFDVVTVSGTRGI  64

Query  203  LA  208
            LA
Sbjct  65   LA  66


 Score = 53.1 bits (126),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 5/82 (6%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
             L IIDE+GKMEL S  F  A+ +++     +LA++P  +  + +P V RL+N P + I+
Sbjct  105  QLLIIDEIGKMELLSHRFESAINELMRQKQLILATIP-SQTRQPMPIVERLRNAPDSFIY  163

Query  421  TLNPNNRDA----IKEHLFSLL  474
             +   NRDA    I EH+   L
Sbjct  164  QVTKANRDALTDDITEHVRKTL  185



>ref|XP_005487657.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X2 
[Zonotrichia albicollis]
Length=190

 Score = 69.3 bits (168),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS   + + GFYT+E+REG +R GF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSG--VPIDGFYTQEVREGGRRTGFDVVTLSGNRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 50.1 bits (118),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S  F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  97   RNVNHGGDTEKRICVIDEIGKMELFSQPFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  155

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
              +++     +F ++  NR++I + + +
Sbjct  156  EEIRSRKDVKVFNVSKENRNSILQDILA  183



>ref|XP_005487656.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Zonotrichia albicollis]
Length=192

 Score = 69.3 bits (168),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS   + + GFYT+E+REG +R GF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSG--VPIDGFYTQEVREGGRRTGFDVVTLSGNRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 50.1 bits (118),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S  F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  99   RNVNHGGDTEKRICVIDEIGKMELFSQPFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  157

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
              +++     +F ++  NR++I + + +
Sbjct  158  EEIRSRKDVKVFNVSKENRNSILQDILA  185



>ref|WP_004082498.1| MULTISPECIES: ATPase AAA [Thermotoga]
 ref|NP_227852.1| NTPase [Thermotoga maritima MSB8]
 ref|YP_007976384.1| Hypothetical ATP-binding protein, containing DUF265 domain [Thermotoga 
maritima MSB8]
 ref|YP_008990987.1| ATPase AAA [Thermotoga maritima MSB8]
 sp|Q9WXP3.1|NTPTH_THEMA RecName: Full=Nucleoside-triphosphatase THEP1; Short=NTPase THEP1; 
AltName: Full=Nucleoside triphosphate phosphohydrolase 
[Thermotoga maritima MSB8]
 gb|AAD35130.1|AE001691_4 conserved hypothetical protein [Thermotoga maritima MSB8]
 gb|EJX25905.1| putative NTPase [Thermotoga sp. EMP]
 gb|AGL48959.1| Hypothetical ATP-binding protein, containing DUF265 domain [Thermotoga 
maritima MSB8]
 gb|AHD18193.1| ATPase AAA [Thermotoga maritima MSB8]
 gb|KHC92882.1| NTPase [Thermotoga sp. Mc24]
 gb|AIY86464.1| putative NTPase [Thermotoga sp. 2812B]
Length=174

 Score = 64.3 bits (155),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 6/61 (10%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PGVGKTTLI K+   L+++       GFYT E+REG +R+GF+++TLDG +G+L
Sbjct  3    ILITGRPGVGKTTLIKKLSRLLQNAG------GFYTEEMREGEKRIGFKIITLDGEEGIL  56

Query  206  A  208
            A
Sbjct  57   A  57


 Score = 54.7 bits (130),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            ++ DL I+DE+GKMEL S  F   V KI ++   ++A++   K   D P V ++KN    
Sbjct  90   QEKDLIIVDEIGKMELLSRKFREVVEKIFDSEKDVIATI---KKSSD-PFVEKIKNRNDV  145

Query  412  AIFTLNPNNRDAIKEHLFSLLS  477
             IF LN  NR+++   + S+L 
Sbjct  146  VIFELNEKNRNSLLNEILSVLK  167



>gb|EMP27259.1| Cancer-related nucleoside-triphosphatase [Chelonia mydas]
Length=195

 Score = 61.6 bits (148),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            G+GKTTLI K  E+L+SS   + + GFYT E+REG +R+GF+VVTL GR+G L+
Sbjct  17   GIGKTTLIQKATEALKSSG--VPIDGFYTEEVREGGRRIGFDVVTLSGRRGTLS  68


 Score = 56.6 bits (135),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 55/92 (60%), Gaps = 4/92 (4%)
 Frame = +1

Query  214  QNLQVKEDT--DLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+ +  DT   +++IDE+GKMEL+S SF  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  102  RNVDLGSDTGKKVYVIDEIGKMELFSRSFIQAVRQTLTGSGTTILGTIPIPK-GKPLGLV  160

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
              +++     +F +   NRD I + + + + +
Sbjct  161  EEIRSRKDVMMFNVTKENRDNILQDIVTTVQN  192



>ref|XP_007068929.1| PREDICTED: cancer-related nucleoside-triphosphatase [Chelonia 
mydas]
Length=301

 Score = 61.6 bits (148),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  41   PPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            P  +GKTTLI K  E+L+SS   + + GFYT E+REG +R+GF+VVTL GR+G L+
Sbjct  121  PQRIGKTTLIQKATEALKSSG--VPIDGFYTEEVREGGRRIGFDVVTLSGRRGTLS  174


 Score = 56.2 bits (134),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 55/92 (60%), Gaps = 4/92 (4%)
 Frame = +1

Query  214  QNLQVKEDT--DLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+ +  DT   +++IDE+GKMEL+S SF  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  208  RNVDLGSDTGKKVYVIDEIGKMELFSRSFIQAVRQTLTGSGTTILGTIPIPK-GKPLGLV  266

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
              +++     +F +   NRD I + + + + +
Sbjct  267  EEIRSRKDVMMFNVTKENRDNILQDIVTTVQN  298



>ref|WP_011943465.1| ATPase AAA [Thermotoga petrophila]
 ref|YP_001244481.1| putative NTPase [Thermotoga petrophila RKU-1]
 sp|A5IL32.1|NTPTH_THEP1 RecName: Full=Nucleoside-triphosphatase THEP1; Short=NTPase THEP1; 
AltName: Full=Nucleoside triphosphate phosphohydrolase 
[Thermotoga petrophila RKU-1]
 gb|ABQ46905.1| protein of unknown function DUF265 [Thermotoga petrophila RKU-1]
Length=179

 Score = 61.6 bits (148),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PGVGKTTLI K+   L+++       GFYT EIRE  +R+GF++VTLDG +G+L
Sbjct  3    ILITGRPGVGKTTLIKKLSCLLQNAG------GFYTEEIRESGKRIGFKIVTLDGEEGIL  56

Query  206  A  208
            A
Sbjct  57   A  57


 Score = 56.2 bits (134),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
            + +L I+DE+GKMEL SS F   V KI ++   ++A++   K   D P V R+K+  G  
Sbjct  91   EKNLIIVDEIGKMELLSSKFREVVEKIFDSEKDVIATI---KKSSD-PFVERIKSRDGVV  146

Query  415  IFTLNPNNRDA-IKEHLFSL  471
            +F LN  NRD+ +KE L+ L
Sbjct  147  VFELNEKNRDSLLKEILYVL  166



>ref|XP_005963769.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Pantholops 
hodgsonii]
Length=190

 Score = 66.6 bits (161),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPGVGKTTLI K  E L+SS   + + GFYT E+R+G +R+GF+VVTL G +G L+
Sbjct  6    FLTGPPGVGKTTLIQKATEVLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGMRGPLS  63


 Score = 51.2 bits (121),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 49/92 (53%), Gaps = 6/92 (7%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHP  405
            +    + +IDEVGKMEL+S  F  AV + L T G  +L ++P+PK G+ +  V  ++   
Sbjct  104  RSGQSICVIDEVGKMELFSQPFIQAVRQALSTPGTVVLGTIPVPK-GKPLALVEEIRTRK  162

Query  406  GAAIFTLNPNNRDAIKEHLFSLLSDQLQKSIR  501
               +F++   NR+    HL   +   +Q S +
Sbjct  163  DVKVFSVTKENRN----HLLPEIVTHMQSSWK  190



>ref|XP_008167956.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X2 
[Chrysemys picta bellii]
Length=175

 Score = 69.3 bits (168),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             K   +TGPPG+GKTTLI K  E L+SS   + + GFYT E+RE  +R+GF+V+TL GR+
Sbjct  2    AKHVFLTGPPGIGKTTLIQKATEVLKSSG--VPIDGFYTEEVRESGRRIGFDVITLSGRR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GTLS  63


 Score = 48.1 bits (113),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  214  QNLQVKEDT--DLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+ +  DT   +++IDEVGKMEL+S SF  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  97   RNVDLGSDTGKKVYVIDEVGKMELFSRSFIQAVRQTLTASGTTILGTIPIPK-GKPLGLV  155

Query  385  ARLKNHPGAAIF  420
              +++     +F
Sbjct  156  EEIRSRKDVKVF  167



>ref|XP_001973572.1| GG13264 [Drosophila erecta]
 gb|EDV52598.1| GG13264 [Drosophila erecta]
Length=188

 Score = 71.6 bits (174),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EG-TQRVGFEVV  178
            M +  K  L+TGPPGVGKTTL+ K+  +LR  +    LQGFYT E+R EG +QR+GF+VV
Sbjct  1    MKSANKTVLITGPPGVGKTTLVHKICSALR--DKGHILQGFYTEEVRGEGISQRIGFDVV  58

Query  179  TLDGRKGLLA  208
            TL G++G+L+
Sbjct  59   TLSGKRGILS  68


 Score = 45.4 bits (106),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 50/86 (58%), Gaps = 7/86 (8%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +L ++DEVGKMEL S  F  A+  +L+    LL ++P  K+  D+  V +L+   G+ I+
Sbjct  109  ELLVVDEVGKMELLSKRFESAMADLLKEKRALLVTIP-EKSALDL--VEQLRKSAGSNIY  165

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKSI  498
             +  +NR+     L   +++Q+ KS+
Sbjct  166  QVTRSNRNI----LAGEITEQITKSL  187



>ref|XP_002404843.1| conserved hypothetical protein [Ixodes scapularis]
 gb|EEC09998.1| conserved hypothetical protein [Ixodes scapularis]
Length=185

 Score = 59.3 bits (142),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            ++TG PGVGKTTL+ +V ESL  +     + GFYT E+RE  +R+GF+V+T  G++G LA
Sbjct  8    VLTGRPGVGKTTLVKRVVESL--TKHGASVSGFYTEELRENGRRIGFDVITTTGKRGPLA  65


 Score = 57.8 bits (138),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +1

Query  238  TDLFIIDEVGKMELYSSSFFPAVLK-ILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
             D+ I+DEVGKMEL+S  F   V + IL     +L +VP+   GR +P V R++ H  A 
Sbjct  101  CDVVILDEVGKMELFSQRFQQRVQELILSPDRCILVTVPVA-GGRPLPLVERIRGHQSAT  159

Query  415  IFTLNPNNRDAIKEHLFSLLSDQLQK  492
            +  +N +NR+     + SL+ D ++K
Sbjct  160  VIEINHDNRNHRLAEILSLIHDAIRK  185



>ref|WP_012310814.1| MULTISPECIES: ATPase AAA [Thermotoga]
 ref|YP_001738943.1| putative NTPase [Thermotoga sp. RQ2]
 ref|YP_003346177.1| hypothetical protein Tnap_0667 [Thermotoga naphthophila RKU-10]
 sp|B1LAB2.1|NTPTH_THESQ RecName: Full=Nucleoside-triphosphatase THEP1; Short=NTPase THEP1; 
AltName: Full=Nucleoside triphosphate phosphohydrolase 
[Thermotoga sp. RQ2]
 gb|ACB09260.1| protein of unknown function DUF265 [Thermotoga sp. RQ2]
 gb|ADA66763.1| protein of unknown function DUF265 [Thermotoga naphthophila RKU-10]
Length=174

 Score = 61.6 bits (148),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PGVGKTTLI K+   L+++       GFYT E+RE  +R+GF+++TLDG +G+L
Sbjct  3    ILITGRPGVGKTTLIKKLSRLLQNAG------GFYTEEMREDGKRIGFKIITLDGEEGIL  56

Query  206  A  208
            A
Sbjct  57   A  57


 Score = 55.1 bits (131),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            ++ DL IIDE+GKMEL S  F   V KI ++   ++A++   K   D P V ++KN    
Sbjct  90   QEKDLIIIDEIGKMELLSRKFREVVEKIFDSEKDVVATI---KKSSD-PFVEKIKNRNDV  145

Query  412  AIFTLNPNNRDAIKEHLFSLLS  477
             IF LN  NR+++   + S+L 
Sbjct  146  VIFELNEKNRNSLLNEILSVLK  167



>ref|XP_001626430.1| predicted protein [Nematostella vectensis]
 gb|EDO34330.1| predicted protein [Nematostella vectensis]
Length=193

 Score = 67.4 bits (163),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR--EGTQRVGFEVV  178
            MAA  K  L+TGPPG+GKTTL  KV ++L S    +  QGFYT EIR   G  RVGF+VV
Sbjct  1    MAAYKKHVLLTGPPGIGKTTLCSKVKQALASR--GVPTQGFYTEEIRGPGGGARVGFDVV  58

Query  179  TLDGRKGLLASNKIS  223
            TLDG +G LA  K +
Sbjct  59   TLDGGRGPLARVKTT  73


 Score = 48.9 bits (115),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +1

Query  238  TDLFIIDEVGKMELYSSSFFPAVLKILETG-VPLLASVPIPKAGRDIPGVARLKNHPGAA  414
            + + IIDE+GKMEL+S +F  A+  + + G  P+LA+VPI +  + I  V +LK      
Sbjct  106  SGIIIIDEIGKMELFSQTFSRAIQDLFDGGHSPILATVPIARQ-KPIHLVEQLKQRSDVT  164

Query  415  IFTLNPNNRDAIKEHLFSLL  474
            +  ++  NR+ +++ +  L+
Sbjct  165  LLEVSKCNRNTLQDKVVELI  184



>ref|XP_007238516.1| PREDICTED: cancer-related nucleoside-triphosphatase [Astyanax 
mexicanus]
Length=187

 Score = 60.1 bits (144),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TG PGVGKTTL+ +V +SL S++  + + GFYT E+RE  +RVGF+VV+L G +G
Sbjct  3    KHVFLTGSPGVGKTTLVQEVCKSLVSAD--VSVHGFYTEELRERGKRVGFDVVSLTGERG  60

Query  200  LLA  208
             L+
Sbjct  61   PLS  63


 Score = 56.2 bits (134),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHP  405
            K    LFIIDE+GKMEL+S +F  AV + L+ +   +L ++P+PK G+ +  V  ++   
Sbjct  101  KGSRSLFIIDEIGKMELFSQAFIRAVRQALDNSACSILGTIPVPK-GKPLGLVEEIRARK  159

Query  406  GAAIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             A +F +   NRD I   +   + + L+
Sbjct  160  DAKVFIVTRENRDTIISEILVAVKECLK  187



>ref|XP_006274565.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Alligator mississippiensis]
 ref|XP_006274566.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X2 
[Alligator mississippiensis]
Length=190

 Score = 59.3 bits (142),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             K   +TG PGVGKTTLI K  ++L+SS   + + GFYT E+R   +R GF+VVTL G +
Sbjct  2    AKHVFLTGSPGVGKTTLIQKATQALKSSG--IPIDGFYTEEVRVDGRRTGFDVVTLSGGR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GTLS  63


 Score = 56.6 bits (135),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARL  393
            NL       + +IDE+GKMEL+S SF  AV + L  +G  +L ++PIPK G+ +  V  +
Sbjct  100  NLDSGTGKKVCVIDEIGKMELFSQSFIRAVRQTLAGSGTVILGTIPIPK-GKPLGFVEEI  158

Query  394  KNHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
            ++     +F++   NRD++ E + + + +
Sbjct  159  RSRKDVKVFSVTKENRDSLLEDIVTTVQN  187



>ref|XP_005602754.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X4 
[Equus caballus]
Length=156

 Score = 66.2 bits (160),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIQKASELLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGMR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 49.7 bits (117),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S  F  AV + L + G  +L ++PIPK G+ +  V  ++N     +F
Sbjct  75   VCVIDEIGKMELFSQPFIQAVRQTLSSPGTTVLGTIPIPK-GKPLALVEEIRNRNDVKVF  133

Query  421  TLNPNNRDAI  450
            ++   NR+ +
Sbjct  134  SVTKENRNHL  143



>ref|XP_006122141.1| PREDICTED: cancer-related nucleoside-triphosphatase [Pelodiscus 
sinensis]
Length=212

 Score = 59.3 bits (142),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  50   VGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            +GKTTLI K  E+L+SS   + + GFYT+E+RE  +R+GF+VVTL GR+G L+
Sbjct  35   IGKTTLIQKAIEALKSSG--VTIDGFYTQEVRESGRRIGFDVVTLSGRRGALS  85


 Score = 56.2 bits (134),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 55/92 (60%), Gaps = 4/92 (4%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILETG-VPLLASVPIPKAGRDIPGV  384
            +N+ +  DT+  + IIDE+GKMEL+S SF  AV +IL +    +L ++PIPK G+ +  V
Sbjct  119  RNVDLDGDTEKKVCIIDEIGKMELFSQSFIQAVRQILTSSRTTILGTIPIPK-GKPLGLV  177

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
              +++     +F +   NRD I + + + + +
Sbjct  178  EEIRSRKDVKVFNVTRENRDNILQDIVTTVQN  209



>ref|XP_006531346.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Mus musculus]
Length=202

 Score = 65.9 bits (159),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPGVGKTTLI K  E L+SS   L + GFYT+E+R+  +R+GF+VVTL G +G L+
Sbjct  52   FLTGPPGVGKTTLIQKAIEVLQSSG--LPVDGFYTQEVRQEGKRIGFDVVTLSGAQGPLS  109


 Score = 49.3 bits (116),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + IIDE+GKMEL+S  F  AV ++L T G+ ++ ++P+PK G+ +  V  ++      +F
Sbjct  121  VCIIDEIGKMELFSQPFIQAVRQMLSTPGIIVVGTIPVPK-GKPLALVEEIRKRRDVKVF  179

Query  421  TLNPNNRDAI  450
             +  +NR+++
Sbjct  180  NVTRDNRNSL  189



>ref|WP_015919151.1| ATPase AAA [Thermotoga neapolitana]
 ref|YP_002534198.1| putative NTPase [Thermotoga neapolitana DSM 4359]
 gb|ACM22832.1| Hypothetical Protein CTN_0656 [Thermotoga neapolitana DSM 4359]
 gb|KFZ22084.1| NTPase [Thermotoga neapolitana LA10]
Length=174

 Score = 65.5 bits (158),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 6/61 (10%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PGVGKTTLI K+   L+++       GFYT E+RE  +RVGF++VTLDGR+G+L
Sbjct  3    ILITGRPGVGKTTLIKKISSLLQNAG------GFYTEEMREKGKRVGFKIVTLDGREGIL  56

Query  206  A  208
            A
Sbjct  57   A  57


 Score = 49.7 bits (117),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 9/93 (10%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            E+  + IIDE+GKMEL S  F   V K   +   L+A++   K   D P V ++KN    
Sbjct  90   EEKSVVIIDEIGKMELLSERFKRVVEKAFNSEKDLIATI---KKSSD-PFVEKIKNKKDV  145

Query  412  AIFTLNPNNRDAIKEHLFSLLSDQLQKSIRCAG  510
             IF LN  NRD + + +  +L     KS R  G
Sbjct  146  IIFELNERNRDLLLKRILDML-----KSNRGVG  173



>ref|XP_005177692.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Musca 
domestica]
Length=190

 Score = 58.2 bits (139),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            L+  +   L ++DE+GKMEL S  F  +V   LE G  +LA+VP  +  + +P V +LK 
Sbjct  99   LRQSQTLQLLVMDEIGKMELKSKRFESSVYNCLEVGSTILATVPF-EMRQPLPLVEKLKT  157

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLLSDQLQKSI  498
            HP A    +   NR+ +++ +   L D + K +
Sbjct  158  HPKAKTIVVTKENRNNLQKEIIEALLDMIIKKL  190


 Score = 56.6 bits (135),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGT-QRVGFEVVTLDGRK  196
             L+TGPPGVGKTTL+ KV + L  ++  +   GFYT E+R+   QR+GF+V+TL  +K
Sbjct  9    LLLTGPPGVGKTTLVRKVCQELLGTH-RINCNGFYTEEVRDSNRQRIGFDVITLAEQK  65



>ref|WP_029683125.1| ATPase AAA [Thermotoga sp. A7A]
Length=174

 Score = 61.6 bits (148),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PGVGKTTLI K+   L+++       GFYT E+RE  +R+GF+++TLDG +G+L
Sbjct  3    ILITGRPGVGKTTLIKKLSRLLQNAG------GFYTEEMREDGKRIGFKIITLDGEEGIL  56

Query  206  A  208
            A
Sbjct  57   A  57


 Score = 53.1 bits (126),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            ++ +L IIDE+GKMEL S  F   V KI ++   ++A++   K   D P V ++KN    
Sbjct  90   QEKELIIIDEIGKMELLSRKFREVVEKIFDSEKDVVATI---KKSSD-PFVEKIKNRNDV  145

Query  412  AIFTLNPNNRDAIKEHLFSLLS  477
             IF LN  NR+++   + S+L 
Sbjct  146  VIFELNEKNRNSLLNEILSVLK  167



>ref|XP_009679444.1| PREDICTED: cancer-related nucleoside-triphosphatase [Struthio 
camelus australis]
Length=182

 Score = 57.4 bits (137),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
            GVGKTTLI KV ++L+S+   + + GFYT E+REG +R GF+VVTL G++G L
Sbjct  4    GVGKTTLIQKVTQALKSTG--VPIDGFYTEEVREGGRRTGFDVVTLSGKRGPL  54


 Score = 57.0 bits (136),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARL  393
            NL    +  + +IDE+GKMEL+S SF  AV + L  +G  +L ++PIPK G+ +  V  +
Sbjct  92   NLSSDAEKKICVIDEIGKMELFSQSFIQAVRQTLTGSGTVILGTIPIPK-GKPLDLVEEI  150

Query  394  KNHPGAAIFTLNPNNRDAIKEHLFS  468
            ++     +F +N  NR+ + + + +
Sbjct  151  RSRKDVKVFNVNKENRNGVLQDILA  175



>ref|XP_008485077.1| PREDICTED: cancer-related nucleoside-triphosphatase [Diaphorina 
citri]
Length=187

 Score = 64.3 bits (155),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 3/62 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD-GRKGL  202
             L+TG PG GKTTL+ K ++SL SS   +K++GFYT E+R G+QR GF+VV L+ G++G 
Sbjct  11   ILLTGDPGCGKTTLVHKAYQSLLSSG--VKMEGFYTEEVRAGSQRSGFDVVLLNGGQRGP  68

Query  203  LA  208
            LA
Sbjct  69   LA  70


 Score = 49.3 bits (116),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 4/85 (5%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
               + I+DE+GKMEL+S  F  AV K+ ++   +LA+VP     R    V +LK   G  
Sbjct  106  SCQVLILDEIGKMELFSKPFESAVHKVFQSPQVILATVPT----RGSSLVEKLKFQAGPN  161

Query  415  IFTLNPNNRDAIKEHLFSLLSDQLQ  489
            +  ++P NRD + E +   L  Q++
Sbjct  162  LIRVHPGNRDTLVEEIKKKLMLQIK  186



>ref|WP_038033251.1| MULTISPECIES: ATPase AAA [Thermotoga]
 gb|KHC90807.1| NTPase [Thermotoga sp. TBGT1765]
 gb|KHC91653.1| NTPase [Thermotoga sp. TBGT1766]
 gb|KHC96818.1| NTPase [Thermotoga sp. Xyl54]
 gb|AIY88222.1| putative NTPase [Thermotoga sp. Cell2]
Length=174

 Score = 61.6 bits (148),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PGVGKTTLI K+   L+++       GFYT E+RE  +R+GF+++TLDG +G+L
Sbjct  3    ILITGRPGVGKTTLIKKLSRLLQNAG------GFYTEEMREDGKRIGFKIITLDGEEGIL  56

Query  206  A  208
            A
Sbjct  57   A  57


 Score = 51.6 bits (122),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            ++ DL IIDE+GKMEL S  F   V KI ++   ++A++   K   D P V ++KN    
Sbjct  90   QEKDLIIIDEIGKMELLSRKFREVVEKIFDSEKDVVATI---KKSSD-PFVEKIKNRNDV  145

Query  412  AIFTLNPNNRDAIKEHLFSLLS  477
             IF  N  NR+++   + S+L 
Sbjct  146  VIFEPNEKNRNSLLNEILSVLK  167



>ref|XP_009862484.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Ciona 
intestinalis]
Length=193

 Score = 61.6 bits (148),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +2

Query  14   PGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGR  193
            P   FL TGPPGVGKTTL+ ++ +SL S  P   ++GFYT EIR+G +R+GF+VV ++G 
Sbjct  5    PTHVFL-TGPPGVGKTTLVRQLKDSLLSCCP---IRGFYTEEIRQGGRRIGFDVVLVNGN  60

Query  194  KGLLA  208
            +  LA
Sbjct  61   RCPLA  65


 Score = 50.4 bits (119),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = +1

Query  223  QVKEDTDLFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKN  399
            Q  +   +F++DE+GKMEL+SS F   V+K+ E+ G  +L ++P+ K G  I  V  ++ 
Sbjct  104  QTDDVKSIFVLDEIGKMELFSSKFKTEVMKVFESKGTVILGTIPV-KKGSGILFVENIRR  162

Query  400  HPGAAIFTLNPNNRDAIKEHLFSLL  474
                 +F ++  NR+ + E + + L
Sbjct  163  REDVKLFEVSFANRNRLFEDILNSL  187



>ref|XP_005169614.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Danio rerio]
Length=181

 Score = 59.7 bits (143),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TG PGVGKTTL+ KV ++L      L + GFYT E+RE  +RVGF+VVT+ G +G
Sbjct  18   KHVFLTGVPGVGKTTLVKKVCDTL----SGLSVSGFYTEEVREHGRRVGFDVVTVSGDRG  73

Query  200  LLA  208
             L+
Sbjct  74   RLS  76


 Score = 52.0 bits (123),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +1

Query  214  QNLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVAR  390
            +N+Q      LF++DEVGKMEL+S  F  AV +ILE +   +L ++P+PK G+ +  V  
Sbjct  110  RNMQEGSGKQLFVMDEVGKMELFSQPFIRAVRQILEKSCCSVLGTIPVPK-GKPLALVEE  168

Query  391  LKNHPGAAIFTLN  429
            L++     IF + 
Sbjct  169  LRSRADVKIFMVT  181



>ref|XP_002095380.1| GE22362 [Drosophila yakuba]
 gb|EDW95092.1| GE22362 [Drosophila yakuba]
Length=188

 Score = 67.0 bits (162),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EG-TQRVGFEVV  178
            M       ++TGPPGVGKTTL+ K+  +LR  +    LQGFYT E+R EG +QR+GF+VV
Sbjct  1    MKNANTTVIITGPPGVGKTTLVHKICSALR--DKGRILQGFYTEEVRGEGISQRIGFDVV  58

Query  179  TLDGRKGLLA  208
            TL G++G+L+
Sbjct  59   TLSGKRGILS  68


 Score = 44.3 bits (103),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 3/82 (4%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            DL ++DEVGKMEL S  F  A+  +L+    LL ++P  ++  D+  V +L+   G+ I+
Sbjct  109  DLLVVDEVGKMELLSKRFELAMADLLKKKRTLLVTIP-ERSTVDL--VEQLRKSAGSNIY  165

Query  421  TLNPNNRDAIKEHLFSLLSDQL  486
             +  +NR+ +   +   ++  L
Sbjct  166  QVTRSNRNILAGEIIEQITKSL  187



>gb|AAY54986.1| IP06602p [Drosophila melanogaster]
Length=187

 Score = 65.1 bits (157),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +2

Query  23   CFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGL  202
              ++TGPPGVGKTTL+ K+  +L+  +    LQGFYT E+R  +QR+GF+VVTL G++ +
Sbjct  8    TIILTGPPGVGKTTLVHKICSALQ--DRGRILQGFYTEEMRGASQRIGFDVVTLAGKRAI  65

Query  203  LA  208
            L+
Sbjct  66   LS  67


 Score = 45.8 bits (107),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (56%), Gaps = 3/70 (4%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            DL ++DEVGKMEL S  F  A+  +L+    LL ++P       +  V +L+   G+ I+
Sbjct  108  DLLVVDEVGKMELLSKRFESAMADLLKKKRALLVTIPEKST---LALVEQLRKSAGSKIY  164

Query  421  TLNPNNRDAI  450
             +   NR+A+
Sbjct  165  QVTKFNRNAL  174



>ref|XP_005838624.1| hypothetical protein GUITHDRAFT_66044 [Guillardia theta CCMP2712]
 gb|EKX51644.1| hypothetical protein GUITHDRAFT_66044 [Guillardia theta CCMP2712]
Length=153

 Score = 57.0 bits (136),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            +   +TG P  GKTTLI  +         +L++ GFYT E+ EG +RVGF++V  DGR G
Sbjct  15   RILYITGQPSCGKTTLIKNMVRE--DGLKHLRVSGFYTEEVLEGGRRVGFDIVDFDGRSG  72

Query  200  LLASNKISR*RKT  238
            +LA   I    KT
Sbjct  73   VLARKGIKSGPKT  85


 Score = 53.5 bits (127),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +1

Query  217  NLQVKEDTDLFII-DEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGR  369
            +++V+ D DL++I DE+G+MEL+S  F  AV K++E+G P+  S+  P+ GR
Sbjct  102  SIKVRGDVDLYVIADEIGRMELHSRGFKMAVTKLIESGKPVFGSIAAPRYGR  153



>ref|XP_008201729.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Tribolium 
castaneum]
Length=175

 Score = 61.6 bits (148),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K  ++ G PGVGKTTL  K+   L+  +  + + GFYT E+RE   R+GF+VVTLD ++G
Sbjct  2    KNIILQGLPGVGKTTLTKKIANKLK--DLAVDVTGFYTEELRENNYRIGFDVVTLDNKRG  59

Query  200  LLA  208
            +LA
Sbjct  60   ILA  62


 Score = 48.9 bits (115),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + IIDE+GKME++S +F   V +++ +  + ++A+VP+  +   +P V ++KN   + + 
Sbjct  99   IIIIDEIGKMEMFSKTFQANVERVITDKSIRVVATVPLKAS---LPLVQKIKNSNTSRLI  155

Query  421  TLNPNNRDAIKEHLFSLLS  477
            T++  NRD + + +  LL+
Sbjct  156  TVSAGNRDRLLDEIIPLLT  174



>ref|XP_004527079.1| PREDICTED: cancer-related nucleoside-triphosphatase-like, partial 
[Ceratitis capitata]
Length=183

 Score = 60.1 bits (144),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 5/63 (8%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR--EGTQRVGFEVVTLDGRKG  199
             L+TGPPGVGKTTL+ K+ + LR S+   K+ GF T E+R  +   R+GF+VVTL G + 
Sbjct  4    ILLTGPPGVGKTTLVKKICDELRMSH---KVYGFITEEVRSEQAFTRIGFDVVTLSGARC  60

Query  200  LLA  208
            +LA
Sbjct  61   ILA  63


 Score = 49.7 bits (117),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPG  408
            K   DL +IDE+G MEL S  F  A+  ++    P+ A++P   + R    +  +K+ P 
Sbjct  97   KSKKDLLVIDEIGTMELKSKRFEKALNDVIH-KTPIFATIPC-HSHRKNTILEHIKSSPA  154

Query  409  AAIFTLNPNNRDAIKEHLFSLLSDQLQKS  495
              IF +  NNR+ ++  + + + + L+K+
Sbjct  155  TRIFEITKNNRNIVQNDIVNCIKNMLRKN  183



>ref|XP_002086292.1| GE22954 [Drosophila yakuba]
 gb|EDW99693.1| GE22954 [Drosophila yakuba]
Length=188

 Score = 65.9 bits (159),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EG-TQRVGFEVV  178
            M       ++TGPPGVGKTTL+ K+  +LR  +    LQGFYT E+R EG +QR+GF+VV
Sbjct  1    MKNANTTVIITGPPGVGKTTLVHKICLALR--DKGRILQGFYTEEVRGEGISQRIGFDVV  58

Query  179  TLDGRKGLLA  208
            TL G++G+L+
Sbjct  59   TLSGKRGILS  68


 Score = 43.5 bits (101),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 3/82 (4%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            DL ++DEVGKMEL S  F  A+  +L+    LL ++P  ++  D+  V +L+   G+ I+
Sbjct  109  DLLVVDEVGKMELLSKRFELAMADLLKEKRTLLVTIP-ERSTVDL--VEQLRKSAGSNIY  165

Query  421  TLNPNNRDAIKEHLFSLLSDQL  486
             +  +NR+ +   +   ++  L
Sbjct  166  QVTRSNRNILAGEIIEHITKSL  187



>ref|XP_002085737.1| GD12145 [Drosophila simulans]
 gb|EDX11322.1| GD12145 [Drosophila simulans]
Length=188

 Score = 64.3 bits (155),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 49/64 (77%), Gaps = 4/64 (6%)
 Frame = +2

Query  23   CFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EG-TQRVGFEVVTLDGRK  196
              ++TGPPGVGKTTL+ K+  +LR  +    LQGFYT ++R EG +QR+GF+VVTL G++
Sbjct  7    TIILTGPPGVGKTTLVHKICSALR--DKGRILQGFYTEDVRGEGISQRIGFDVVTLAGKR  64

Query  197  GLLA  208
            G+L+
Sbjct  65   GILS  68


 Score = 45.1 bits (105),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            DL ++DEVGKMEL S  F  A+  +L+    LL ++P       +  V +L+   G+ I+
Sbjct  109  DLLVVDEVGKMELLSKRFESALADLLKKKRALLVTIPEKST---LALVEQLRKSAGSKIY  165

Query  421  TLNPNNRD  444
             +  +NR+
Sbjct  166  QVTKSNRN  173



>ref|WP_035107288.1| hypothetical protein [Desulfovirgula thermocuniculi]
Length=181

 Score = 61.2 bits (147),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 47/74 (64%), Gaps = 6/74 (8%)
 Frame = +2

Query  5    MAAPG-KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVT  181
            M+A G K FL+TG PG GKTT+++++   L          GFYT EIR G +RVGFEVVT
Sbjct  1    MSAGGAKNFLLTGLPGAGKTTVVVRLAHLLGPLA-----AGFYTAEIRAGGKRVGFEVVT  55

Query  182  LDGRKGLLASNKIS  223
            L G+K LLA    S
Sbjct  56   LGGKKDLLAHVSFS  69


 Score = 47.8 bits (112),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 41/80 (51%), Gaps = 4/80 (5%)
 Frame = +1

Query  247  FIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFTL  426
             IIDE+GKMEL    F  AVLK LE  VP++A+V      R  P    LK  P A +  +
Sbjct  103  LIIDEIGKMELLVPGFAEAVLKALEAPVPVVATV----LARPHPFADALKRRPDAQVIEV  158

Query  427  NPNNRDAIKEHLFSLLSDQL  486
               NR+ +   L+  L+  L
Sbjct  159  TGENRNDLPRRLYDALAALL  178



>ref|XP_008320552.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X2 
[Cynoglossus semilaevis]
Length=201

 Score = 56.2 bits (134),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +F+IDE+GKMEL+S SF  AV +IL+ +   +L ++PIPK G+ +  V  +++     +F
Sbjct  117  VFVIDEIGKMELFSQSFIRAVRQILDSSSCTVLGTIPIPK-GKPLGLVEEVRSSRDVRVF  175

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
             +   NR+A+ + +   + + L+
Sbjct  176  AVTKENRNALLQDIVGAVQECLK  198


 Score = 52.8 bits (125),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            GVGKTTL+ K  E+L SS   + ++GFYT E+RE  +R GF+VVT+ G +G L+
Sbjct  51   GVGKTTLVQKACEALLSSG--VGVEGFYTEEVRERGRRTGFDVVTMTGERGHLS  102



>ref|WP_004068940.1| NTPase [Thermococcus litoralis]
 ref|YP_008429819.1| NTPase [Thermococcus litoralis DSM 5473]
 gb|EHR78198.1| NTPase [Thermococcus litoralis DSM 5473]
Length=171

 Score = 59.7 bits (143),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD-GRKGL  202
              +TG PGVGKTTL +KV E L++ N  LK+ GF T+E+RE  +RVGF++  LD G +G+
Sbjct  3    IFITGLPGVGKTTLALKVTEELKTYN--LKIGGFITQEVREKGRRVGFKIKALDTGEEGI  60

Query  203  LA  208
            LA
Sbjct  61   LA  62


 Score = 48.9 bits (115),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 9/86 (10%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            ED DL IIDE+G ME  S  F  AV K +++  PLLA+V    A        R K++   
Sbjct  94   EDADLIIIDEIGAMEYKSREFAEAVEKAVKSEKPLLATVHRNYA-------KRFKDY--G  144

Query  412  AIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             ++ L P NR+ I++ +   L   L+
Sbjct  145  KLYVLTPENREYIRQEIIHNLKAILK  170



>ref|XP_006027513.1| PREDICTED: cancer-related nucleoside-triphosphatase [Alligator 
sinensis]
Length=211

 Score = 56.2 bits (134),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARL  393
            NL       + +IDE+GKMEL+S SF  AV + L  +G  +L ++PIPK G+ +  V  +
Sbjct  121  NLDSGTGKKVCVIDEIGKMELFSQSFIRAVRQTLAGSGTVILGTIPIPK-GKPLGLVEEI  179

Query  394  KNHPGAAIFTLNPNNRDAIKEHLFSLLSD  480
            ++     +F++   NRD++ E + + + +
Sbjct  180  RSRKDVKVFSVTKENRDSLLEDIVTTVQN  208


 Score = 51.6 bits (122),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            GVGKTTLI K  ++L+SS   + + GFYT E+R   +R GF+VVTL G +G L+
Sbjct  33   GVGKTTLIQKATQALKSSG--IPIDGFYTEEVRVDGRRTGFDVVTLSGGRGTLS  84



>ref|WP_010880824.1| nucleoside triphosphatase [Aquifex aeolicus]
 ref|NP_213886.1| NTPase [Aquifex aeolicus VF5]
 sp|O67322.1|NTPTH_AQUAE RecName: Full=Nucleoside-triphosphatase THEP1; Short=NTPase THEP1; 
AltName: Full=Nucleoside triphosphate phosphohydrolase 
[Aquifex aeolicus VF5]
 gb|AAC07294.1| hypothetical protein aq_1292 [Aquifex aeolicus VF5]
Length=178

 Score = 59.3 bits (142),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDI-PGVARLKNH  402
            K+   + IIDE+GKMEL+S  F   V +I+ +  V ++A++PI    RD+ P V  ++  
Sbjct  97   KDRRKVIIIDEIGKMELFSKKFRDLVRQIMHDPNVNVVATIPI----RDVHPLVKEIRRL  152

Query  403  PGAAIFTLNPNNRDAIKEHLFSLLS  477
            PGA +  L P NRD I E + SLL 
Sbjct  153  PGAVLIELTPENRDVILEDILSLLE  177


 Score = 48.5 bits (114),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR--EGTQRVGFEVVTLDGRKG  199
             ++TG PGVGKTTL+ K+ E L       +  GF+T E+R  E  +R GF ++T +G+K 
Sbjct  3    IIITGEPGVGKTTLVKKIVERL-----GKRAIGFWTEEVRDPETKKRTGFRIITTEGKKK  57

Query  200  LLASN  214
            + +S 
Sbjct  58   IFSSK  62



>ref|NP_649279.2| CG10581 [Drosophila melanogaster]
 gb|AAY54929.1| IP06402p [Drosophila melanogaster]
 gb|AAF51671.2| CG10581 [Drosophila melanogaster]
Length=189

 Score = 62.0 bits (149),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +2

Query  23   CFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EGT-QRVGFEVVTLDGRK  196
              ++TGPPGVGKTTL+ K+  +L+  +    LQGFYT E+R EGT QR+GF+VVTL G++
Sbjct  8    TIILTGPPGVGKTTLVHKICSALQ--DRGRILQGFYTEEMRGEGTSQRIGFDVVTLAGKR  65

Query  197  GLLA  208
             +L+
Sbjct  66   AILS  69


 Score = 45.8 bits (107),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (56%), Gaps = 3/70 (4%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            DL ++DEVGKMEL S  F  A+  +L+    LL ++P       +  V +L+   G+ I+
Sbjct  110  DLLVVDEVGKMELLSKRFESAMADLLKKKRALLVTIPEKST---LALVEQLRKSAGSKIY  166

Query  421  TLNPNNRDAI  450
             +   NR+A+
Sbjct  167  QVTKFNRNAL  176



>ref|WP_020251725.1| MULTISPECIES: hypothetical protein [unclassified Cloacimonetes]
Length=173

 Score = 58.2 bits (139),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K  L+TG P VGKTTL+ K+ + L     + K+ GFYT E+RE  +R GF +   DG + 
Sbjct  3    KNILITGYPRVGKTTLVNKIIKQL-----SCKIDGFYTHEMRENGRRTGFYITDFDGNQM  57

Query  200  LLASNK  217
            ++AS+K
Sbjct  58   VMASDK  63


 Score = 49.3 bits (116),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 42/85 (49%), Gaps = 4/85 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            ++ DL +IDE+G+ME++S  F   +  + ++  PLLA++       D      LK     
Sbjct  93   KNADLIVIDEIGRMEMFSPKFCYMLRTVFDSEKPLLATIK----KIDCELTKELKQRKDV  148

Query  412  AIFTLNPNNRDAIKEHLFSLLSDQL  486
             IF +  NNRD I   +   + D L
Sbjct  149  IIFEVTANNRDTILSKILEAIEDYL  173



>gb|ETN64133.1| hypothetical protein AND_004133 [Anopheles darlingi]
Length=190

 Score = 53.9 bits (128),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIRE---GTQRVGFEVVTLDGRK  196
             LVTG PG GKTT+I K+ E LR+    L + GFYT E+R    G +R GF+V+T  G++
Sbjct  4    ILVTGMPGTGKTTIIRKLSEELRAR--GLSVAGFYTEEVRNNGTGGERSGFDVITFTGQR  61

Query  197  GLLA  208
              LA
Sbjct  62   APLA  65


 Score = 52.8 bits (125),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 6/88 (7%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSF---FPAVLKILETG-VPLLASVPIPKAGRDIPGV  384
             L  +    + I+DE+GKMEL S  F     A+LK ++TG V  +A+VP+  AG  I  +
Sbjct  97   TLDERHRARVLIVDEIGKMELKSRRFSQQMDAILKEVKTGTVRFIATVPLKAAG--IQLI  154

Query  385  ARLKNHPGAAIFTLNPNNRDAIKEHLFS  468
             +LK   G  +F + P+NR+ I   L S
Sbjct  155  EKLKAVSGCQVFHVKPSNREDIYADLLS  182



>ref|WP_014867340.1| Nucleoside-triphosphatase THEP1 [Methanoculleus bourgensis]
 ref|YP_006545081.1| putative NTPase [Methanoculleus bourgensis MS2]
 emb|CCJ36365.1| putative NTPase [Methanoculleus bourgensis MS2]
Length=178

 Score = 55.5 bits (132),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PG GKTTLI ++ E     +P     GFYT E+REG  RVGF++V+L G + LL
Sbjct  5    LLITGRPGSGKTTLIRRLAERFADCSP----VGFYTVEVREGGVRVGFDLVSLTGERRLL  60

Query  206  A  208
            A
Sbjct  61   A  61


 Score = 50.8 bits (120),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 44/86 (51%), Gaps = 8/86 (9%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
            D  L IIDEVGKME YS  F   V ++L+   P +A++    A R  PG+ R++      
Sbjct  94   DARLVIIDEVGKMECYSGVFRRVVREVLDAATPCVATI----AQRGAPGLDRIRARADVR  149

Query  415  IFTLNPNNRDAIKEHLFSLLSDQLQK  492
            +  +   NRD    HL   L  ++++
Sbjct  150  VVEVTRANRD----HLLPELEAEVRR  171



>gb|AGC92685.1| nucleoside-triphosphatase C1orf57-like protein [Heliconius erato]
Length=187

 Score = 59.7 bits (143),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL  184
            M    K F++TG PG+GKTT+I K+   L SS   +K  GF+T E+R    R GF+V++L
Sbjct  1    MTQNIKYFIITGDPGIGKTTIIQKICSLLNSSG--VKTVGFFTEEVRRNRMREGFDVISL  58

Query  185  DGRKGLLASNK  217
             G +G LA ++
Sbjct  59   TGERGRLARDQ  69


 Score = 46.6 bits (109),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (52%), Gaps = 1/83 (1%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKN  399
            L+  +D  L +IDE+GKMEL+SSSF   + +   T    +    IP    D P +  ++N
Sbjct  98   LKECDDKSLLVIDEIGKMELFSSSFKLRIKEFFSTESKNIVLATIPSRKGD-PIIESIRN  156

Query  400  HPGAAIFTLNPNNRDAIKEHLFS  468
            +    I+ +    R+ I E +F+
Sbjct  157  NNKTKIWMITREKRNIIHEKIFN  179



>ref|XP_002935867.2| PREDICTED: cancer-related nucleoside-triphosphatase [Xenopus 
(Silurana) tropicalis]
Length=210

 Score = 55.8 bits (133),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            G+GKTTLI K  E L+S    +   GFYT E+R G +RVGF+VVTL G++G L+
Sbjct  34   GIGKTTLIQKTVEVLKSHGYCI--HGFYTEEVRAGGRRVGFDVVTLSGKRGSLS  85


 Score = 49.7 bits (117),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 45/85 (53%), Gaps = 2/85 (2%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVP-LLASVPIPKAGRDIPGVARLKNHP  405
            ++   + IIDE+GKMEL+S SF  AV K L+     +  ++P  K G+ +  V  +KN  
Sbjct  124  EKQKSICIIDEIGKMELFSQSFIHAVRKTLDCDTAFIFGTIPATK-GKPLLLVEEIKNRA  182

Query  406  GAAIFTLNPNNRDAIKEHLFSLLSD  480
               IF +   NR  I + + + + +
Sbjct  183  DVRIFNITRENRGVIMQEIVTAIQE  207



>gb|KFW77852.1| Cancer-related nucleoside-triphosphatase, partial [Manacus vitellinus]
Length=158

 Score = 60.5 bits (145),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 5/63 (8%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL---ASNK  217
            GVGKTTLI KV ++L+SS   + + GFYT E+REG +R GF+VVTL G +G L   +SN 
Sbjct  1    GVGKTTLIQKVTQALKSSG--IPIDGFYTEEVREGGRRTGFDVVTLSGNRGPLSRVSSNS  58

Query  218  ISR  226
             SR
Sbjct  59   TSR  61


 Score = 44.7 bits (104),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  85   RNVNHGSDTERRICVIDEIGKMELFSQAFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  143

Query  385  ARLKNHPGAAIFTLN  429
              +++     +F ++
Sbjct  144  EEIRSRKDVKVFNVS  158



>ref|WP_013907683.1| thymidylate kinase [Thermodesulfatator indicus]
 ref|YP_004625905.1| thymidylate kinase [Thermodesulfatator indicus DSM 15286]
 gb|AEH44941.1| thymidylate kinase [Thermodesulfatator indicus DSM 15286]
Length=380

 Score = 55.1 bits (131),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 5/63 (8%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K  L+ G PG GKTTL+    E L +  P  K +GFYTRE+RE  +R+GF++VTL+G++ 
Sbjct  9    KNILLHGLPGSGKTTLV----ERLVNKIPYPK-RGFYTREVREKGRRIGFKIVTLEGKEA  63

Query  200  LLA  208
             LA
Sbjct  64   WLA  66


 Score = 50.1 bits (118),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  223  QVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNH  402
            +VKE+ ++ IIDE+GKMEL+S  F  AVLK+L++  P+LA+V        IP V  L   
Sbjct  95   EVKEN-EMIIIDEIGKMELFSKPFQEAVLKVLDSKAPVLATVGYGL----IPFVEELFKR  149

Query  403  PGAAIFTLNPNNRDAI  450
              A    + P +RD +
Sbjct  150  EDAIFAEVTPESRDYL  165



>ref|WP_008868763.1| protein of unknown function DUF265 [Desulfonatronospira thiodismutans]
 gb|EFI35634.1| protein of unknown function DUF265 [Desulfonatronospira thiodismutans 
ASO3-1]
Length=175

 Score = 61.6 bits (148),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 4/65 (6%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PG GKTTL+  +  SL+  NP     GFYT+EIRE  +R+GFE+V+LDG   +L
Sbjct  6    ILITGSPGTGKTTLVRSLCHSLKDFNP----AGFYTQEIREKGKRLGFELVSLDGPGMIL  61

Query  206  ASNKI  220
            A   +
Sbjct  62   AHTDL  66


 Score = 43.5 bits (101),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 12/88 (14%)
 Frame = +1

Query  238  TDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAI  417
            T L +IDE+GKME +S +F   V   L++ +P+LA+V     G     +  +K  P   +
Sbjct  96   TGLIVIDEIGKMECFSDNFAALVYTALDSPIPVLATVAAKGGGL----ITAVKKRPDVEV  151

Query  418  FTLNPNNRDAIKEHLFSLLSDQLQKSIR  501
              L  +NR+         L+ +L++ IR
Sbjct  152  VELTLHNRNE--------LAPELERRIR  171



>ref|XP_002949453.1| hypothetical protein VOLCADRAFT_80686 [Volvox carteri f. nagariensis]
 gb|EFJ49472.1| hypothetical protein VOLCADRAFT_80686 [Volvox carteri f. nagariensis]
Length=191

 Score = 53.9 bits (128),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            L ++DE+GKMEL+S +FFPAV   L+ T + +L ++P  K  R +  V  +       + 
Sbjct  101  LLLVDEIGKMELFSRAFFPAVRAALDSTFLVVLGTIPSQKGARTLREVEEVSAREDVEVL  160

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKSIR  501
            T+   NRDA+ + +      +LQ+S+R
Sbjct  161  TVTRFNRDALVQEVIV----RLQESMR  183


 Score = 50.8 bits (120),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 6/69 (9%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EGTQRVGFEVVT  181
            M +    FL TG PGVGK+TL  +V          +   GFYT E+R E  +R+GF+VVT
Sbjct  1    MKSKRHVFL-TGDPGVGKSTLCQRVIRQ----TSEMVWAGFYTAELRNEQGERLGFDVVT  55

Query  182  LDGRKGLLA  208
            LDG +G LA
Sbjct  56   LDGSRGPLA  64



>gb|KFV73679.1| Cancer-related nucleoside-triphosphatase, partial [Struthio camelus 
australis]
Length=159

 Score = 57.4 bits (137),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
            GVGKTTLI KV ++L+S+   + + GFYT E+REG +R GF+VVTL G++G L
Sbjct  1    GVGKTTLIQKVTQALKSTG--VPIDGFYTEEVREGGRRTGFDVVTLSGKRGPL  51


 Score = 47.4 bits (111),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARL  393
            NL    +  + +IDE+GKMEL+S SF  AV + L  +G  +L ++PIPK G+ +  V  +
Sbjct  89   NLSSDAEKKICVIDEIGKMELFSQSFIQAVRQTLTGSGTVILGTIPIPK-GKPLDLVEEI  147

Query  394  KNHPGAAIFTLN  429
            ++     +F ++
Sbjct  148  RSRKDVKVFNVS  159



>gb|KFD66025.1| hypothetical protein M514_21848 [Trichuris suis]
 gb|KHJ43219.1| putative nucleoside-triphosphatase THEP1 [Trichuris suis]
Length=202

 Score = 57.4 bits (137),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG-RK  196
            +   +TG PGVGKTTL+ ++ E LR  +  + L+GFYT E+R    R GFE+VT+DG R+
Sbjct  9    RHLFITGLPGVGKTTLVCRLCEILRRES--VPLRGFYTTEVRGTYGRTGFEIVTVDGSRR  66

Query  197  GLLASNK  217
              LA+ K
Sbjct  67   ATLATVK  73


 Score = 47.4 bits (111),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (56%), Gaps = 6/90 (7%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +F+IDE+GKMEL S SF  A L++  +    ++A++P  K  + +   A +++ P A +F
Sbjct  114  VFVIDEIGKMELTSKSFGDAALQVFSQPSTIVIATIP-AKPLKQLEAFAGIRHGPSAKLF  172

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKSIRCAG  510
             +   NRDA        + D ++K+I   G
Sbjct  173  EITKQNRDAT----LQTVHDCVRKAIAALG  198



>ref|WP_009200387.1| putative GTPase domain, era and thdf protein [Anaerobaculum hydrogeniformans]
 gb|EFD25265.1| hypothetical protein HMPREF1705_00163 [Anaerobaculum hydrogeniformans 
ATCC BAA-1850]
Length=181

 Score = 59.7 bits (143),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = +2

Query  14   PGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGR  193
            P K  L+TG PGVGKTTLI ++ + +     NL   GFYT EIRE  +R GFE + L G 
Sbjct  2    PAKNILITGRPGVGKTTLIFRLIKQI-----NLPCVGFYTAEIRESGRRTGFEAIALHGP  56

Query  194  KGLLASNKI  220
            K +++   I
Sbjct  57   KLIMSHVDI  65


 Score = 44.7 bits (104),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +1

Query  250  IIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFTLN  429
            +IDE+GKME +S  F   +L +L+   PL+A++    A R    +  +K      ++T+ 
Sbjct  99   VIDEIGKMECFSPLFKKLILNLLDRNTPLIATI----ALRGDAFIESIKTRHDVRVYTVT  154

Query  430  PNNRDAIKEHLFSLLSD  480
             +NRD +   L+ +L +
Sbjct  155  YDNRDKLAMELYPVLKE  171



>pdb|1YE8|A Chain A, Crystal Structure Of Thep1 From The Hyperthermophile 
Aquifex Aeolicus
Length=178

 Score = 55.1 bits (131),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDI-PGVARLKNH  402
            K+   + IIDE+GK EL+S  F   V +I  +  V ++A++PI    RD+ P V  ++  
Sbjct  97   KDRRKVIIIDEIGKXELFSKKFRDLVRQIXHDPNVNVVATIPI----RDVHPLVKEIRRL  152

Query  403  PGAAIFTLNPNNRDAIKEHLFSLLS  477
            PGA +  L P NRD I E + SLL 
Sbjct  153  PGAVLIELTPENRDVILEDILSLLE  177


 Score = 48.5 bits (114),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR--EGTQRVGFEVVTLDGRKG  199
             ++TG PGVGKTTL+ K+ E L       +  GF+T E+R  E  +R GF ++T +G+K 
Sbjct  3    IIITGEPGVGKTTLVKKIVERL-----GKRAIGFWTEEVRDPETKKRTGFRIITTEGKKK  57

Query  200  LLASN  214
            + +S 
Sbjct  58   IFSSK  62



>ref|XP_009066350.1| hypothetical protein LOTGIDRAFT_223139 [Lottia gigantea]
 gb|ESO82982.1| hypothetical protein LOTGIDRAFT_223139 [Lottia gigantea]
Length=190

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 91/179 (51%), Gaps = 37/179 (21%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             ++TGPPGVGK+TLI K  ++++S    + +QGFYT EIR G +R GF+VVTLDG++G L
Sbjct  6    IILTGPPGVGKSTLIQKACDAIKSKG--ISVQGFYTEEIRSGGRRTGFDVVTLDGKRGPL  63

Query  206  ASNKISR*RKTLISSSLMKSVRWSCTVLHSSLLC*KYWKQGSHSWLLYQFQRLGEIFLEW  385
            A  ++S     L SS                    + +K G +S  L  F+++    L  
Sbjct  64   A--RVSEGGDGLPSSKK------------------RDYKVGQYSVQLQSFEQIALPTLHL  103

Query  386  QD*KTIRVLQFLR*TQITGMQLKNIYFRSCLISCRRALDVLEYDLVRGGTTIIGEEFIC  562
            +D K + V+      +I  M+L    F    I C R+  +L+ D     TT++    IC
Sbjct  104  KDEKCVIVID-----EIGKMEL----FSQTFIQCVRS--ILDNDT----TTVLATIPIC  147


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 52/79 (66%), Gaps = 2/79 (3%)
 Frame = +1

Query  217  NLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARL  393
             L +K++  + +IDE+GKMEL+S +F   V  IL+     +LA++PI K G+ IP V  +
Sbjct  100  TLHLKDEKCVIVIDEIGKMELFSQTFIQCVRSILDNDTTTVLATIPICK-GKPIPFVEEI  158

Query  394  KNHPGAAIFTLNPNNRDAI  450
            ++   + +FT++ +NR++I
Sbjct  159  RHRQDSQVFTISQSNRNSI  177



>ref|XP_001353210.2| GA10412 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL30712.2| GA10412 [Drosophila pseudoobscura pseudoobscura]
Length=301

 Score = 67.0 bits (162),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREG--TQRVGFEVVTLDGRKG  199
             L+TGPPGVGKTTL+ K+   L   +   KLQGFYT E+R     QR+GF+VVTL G +G
Sbjct  10   ILITGPPGVGKTTLVRKICSKLSEQS---KLQGFYTEEVRADGKGQRIGFDVVTLTGERG  66

Query  200  LLASNK  217
            +LA  +
Sbjct  67   ILARER  72


 Score = 36.6 bits (83),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +1

Query  238  TDLFIIDEVGKMELYSSSFFPAVLKILETGVP  333
             +L +IDEVGKMEL S  F  A+ K+L+   P
Sbjct  107  CELLVIDEVGKMELLSKRFETAIAKVLQQQRP  138



>ref|XP_003215858.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Anolis carolinensis]
Length=190

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             K   +TGPPGVGKTTLI K  E L+SS   L + GFYT E+REG +R+GF+VVTL+GR+
Sbjct  2    AKHVFLTGPPGVGKTTLIQKAIEILKSSG--LPIDGFYTEEVREGGRRIGFDVVTLNGRR  59

Query  197  GLLA  208
            G+L+
Sbjct  60   GILS  63


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S SF  AV ++L  +GV +L ++P+PK G+ +  V  +++H    +F
Sbjct  109  VCVIDEIGKMELFSQSFIQAVRQLLSGSGVVMLGTIPVPK-GKPLGLVEEVRSHKEVKVF  167

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
            T+   NRD I E +   + + L+
Sbjct  168  TITKENRDNILEEVVKAVRNCLK  190



>ref|WP_017889637.1| hypothetical protein [Candidatus Caldatribacteirum californiense]
Length=187

 Score = 59.7 bits (143),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
            ++ G PGVGKTTL+ +V E      P L   GFYT EIREG  R GF +VTL G++G+LA
Sbjct  5    VILGRPGVGKTTLVKRVAERF----PGL-FHGFYTEEIREGHMRTGFRIVTLSGKRGVLA  59

Query  209  SN  214
            + 
Sbjct  60   TK  61


 Score = 43.1 bits (100),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 6/68 (9%)
 Frame = +1

Query  250  IIDEVGKMELYSSSFFPAVLKILETGVP-LLASVPIPKAGRDIPGVARLKNHPGAAIFTL  426
            ++DE+GKMEL+S + F  +L IL      LLA+   P    +IP V  L   PG   F L
Sbjct  98   LVDEIGKMELFSQN-FQKLLDILWNEAEFLLATSRFP----EIPEVQELFARPGTLRFFL  152

Query  427  NPNNRDAI  450
             P NR+ +
Sbjct  153  TPKNREEV  160



>ref|WP_011752670.1| nucleoside triphosphatase [Thermofilum pendens]
 ref|YP_920408.1| putative NTPase [Thermofilum pendens Hrk 5]
 sp|A1RYX5.1|NTPTH_THEPD RecName: Full=Nucleoside-triphosphatase THEP1; Short=NTPase THEP1; 
AltName: Full=Nucleoside triphosphate phosphohydrolase 
[Thermofilum pendens Hrk 5]
 gb|ABL78405.1| protein of unknown function DUF265 [Thermofilum pendens Hrk 5]
Length=182

 Score = 55.5 bits (132),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVT-  181
            MAA  K FL+TG PG+GKTT ++K  E L S    +K+ G  T E+REG  RVGF+V   
Sbjct  1    MAA--KNFLLTGRPGIGKTTCVVKTAELLVSR--GVKVGGMVTHEVREGGSRVGFKVRDL  56

Query  182  LDGRKGLLA  208
            L GR+G LA
Sbjct  57   LTGREGFLA  65


 Score = 46.6 bits (109),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  220  LQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASV  348
            L+   +  + +IDE+G MELYS SF PAVLK L++  P+LA++
Sbjct  94   LRAVSEAQVVVIDEIGPMELYSPSFLPAVLKALDSDKPVLATI  136



>gb|KFO53909.1| Cancer-related nucleoside-triphosphatase, partial [Corvus brachyrhynchos]
Length=161

 Score = 57.8 bits (138),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
            GVGKTTLI KV ++L+SS   + + GFYT+E+REG +R GF+VVTL G +G L
Sbjct  1    GVGKTTLIQKVTQALKSSG--VPIDGFYTQEVREGGRRTGFDVVTLSGNRGPL  51


 Score = 43.9 bits (102),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  88   RNVNHGGDTEKRICVIDEIGKMELFSQAFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  146

Query  385  ARLKNHPGAAIFTLN  429
              +++     +F ++
Sbjct  147  EEIRSRKDVKVFNVS  161



>ref|XP_008641593.1| PREDICTED: cancer-related nucleoside-triphosphatase [Corvus brachyrhynchos]
Length=218

 Score = 58.2 bits (139),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  47   GVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
            GVGKTTLI KV ++L+SS   + + GFYT+E+REG +R GF+VVTL G +G L
Sbjct  21   GVGKTTLIQKVTQALKSSG--VPIDGFYTQEVREGGRRTGFDVVTLSGNRGPL  71


 Score = 43.5 bits (101),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = +1

Query  214  QNLQVKEDTD--LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGV  384
            +N+    DT+  + +IDE+GKMEL+S +F  AV + L  +G  +L ++PIPK G+ +  V
Sbjct  108  RNVNHGGDTEKRICVIDEIGKMELFSQAFIQAVRQTLAGSGTVVLGTIPIPK-GKPLDLV  166

Query  385  ARLKNHPGAAIF  420
              +++     +F
Sbjct  167  EEIRSRKDVKVF  178



>ref|WP_008512234.1| putative nucleotide kinase [Methanobacterium sp. Maddingley MBC34]
 gb|EKQ55741.1| putative nucleotide kinase [Methanobacterium sp. Maddingley MBC34]
Length=186

 Score = 52.0 bits (123),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDG-RKGLL  205
            L+TGPPGVGKTTL+ ++   +R       + G Y  EIRE  +R GF ++ +   RKG+L
Sbjct  14   LITGPPGVGKTTLLNEIKNKIRDQ--GYSVGGMYCPEIREEDRRTGFNIIDIASRRKGIL  71

Query  206  ASNK  217
            AS +
Sbjct  72   ASTQ  75


 Score = 49.3 bits (116),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            E +D  +IDE+  MEL SSSF   V +++E+  P++A +       + P + ++K+    
Sbjct  105  ETSDYILIDEIAPMELASSSFSQTVWEVMESQKPVIAVI---HQRSNHPFILKVKSREDV  161

Query  412  AIFTLNPNNRDAIKEHLFSLL  474
             IF LN  N+D + + +  LL
Sbjct  162  QIFNLNQENQDCLLKKILELL  182



>ref|WP_017872625.1| hypothetical protein [Candidatus Caldatribacterium saccharofermentans]
Length=187

 Score = 55.8 bits (133),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             ++ G PGVGKTTL+ +V E      P L  +GFYT EIREG  R GF +VTL G++ +L
Sbjct  4    LVILGRPGVGKTTLVKRVAEHF----PGL-FRGFYTEEIREGRVRTGFWIVTLSGKRSVL  58

Query  206  ASN  214
            A+ 
Sbjct  59   AAK  61


 Score = 45.4 bits (106),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 4/83 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            E     ++DE+GKMEL+S +F   +  + +    LLA+   P    +IP V  L   PG 
Sbjct  92   EQRAALLVDEIGKMELFSRNFRKLLDTLWKEAELLLATSRFP----EIPEVQELFARPGT  147

Query  412  AIFTLNPNNRDAIKEHLFSLLSD  480
              F L P NR+ +   +  L+ +
Sbjct  148  MRFLLTPGNREEVFTRVRELIGE  170



>gb|KFB44453.1| AGAP005921-PA-like protein [Anopheles sinensis]
Length=190

 Score = 51.2 bits (121),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGT--QRVGFEVVTLDGRKG  199
             LVTG PGVGKTT++ ++ + L     N+ + GFYT E+R+    +R GF+VVT  G++ 
Sbjct  4    ILVTGMPGVGKTTILRRIGDEL--GRRNVPVAGFYTEEVRDSASGERTGFDVVTFSGQRA  61

Query  200  LLA  208
             LA
Sbjct  62   PLA  64


 Score = 50.1 bits (118),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 50/91 (55%), Gaps = 10/91 (11%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKILE----TGVPLLASVPIPKAGRDIPGVARLK  396
            + D  + ++DE+GKMEL S +F   +  I+       +  +A++P+   G D+  + RLK
Sbjct  101  QSDGGILLLDEIGKMELKSRAFQERMQAIVSEVTARKLQFVATIPLKATGIDV--IERLK  158

Query  397  NHPGAAIFTLNPNNRDA----IKEHLFSLLS  477
              PG  +F + P+NRD     IK+   S+LS
Sbjct  159  LIPGCLLFHVKPSNRDGMYEQIKDACLSILS  189



>ref|XP_004336830.1| Nucleoside-triphosphatase [Acanthamoeba castellanii str. Neff]
 gb|ELR14817.1| Nucleoside-triphosphatase [Acanthamoeba castellanii str. Neff]
Length=210

 Score = 51.2 bits (121),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 6/74 (8%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNP---NLKLQGFYTREIR-EGTQRVGFEVVTLD  187
            +  L+TG PGVGKTT I +V   LR   P     +L+GF TRE+R  G QR GFE V   
Sbjct  5    RVVLLTGAPGVGKTTAIQRVIALLRQGGPAAGQCELRGFVTREVRGAGGQREGFEAVLCS  64

Query  188  -GRKGLLAS-NKIS  223
             GR  L+A  +K+S
Sbjct  65   TGRAVLMAHESKVS  78


 Score = 50.1 bits (118),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 48/91 (53%), Gaps = 17/91 (19%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKIL----------ETGVP----LLASVPIPKAGRDIPG  381
            ++++DE+GKME YSS+F   V ++L          + G P    ++ ++P+    R I G
Sbjct  118  VYVLDEIGKMECYSSAFKKRVSELLAYHASSGGGEQLGGPRRVHIIGTIPLKSQDRFIEG  177

Query  382  VARLKNHPGAAIFTLNPNNRDAIKEHLFSLL  474
            V   K      + T+   NRDAI + +FSLL
Sbjct  178  V---KARSDVELLTVTQQNRDAIPDQMFSLL  205



>gb|EHJ63733.1| ATP binding protein [Danaus plexippus]
Length=182

 Score = 59.7 bits (143),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
            F++TG PGVGKTTLI K+   L  +   +K +GFYT E+R    R GF++VTL+G +G L
Sbjct  3    FILTGDPGVGKTTLIKKIVSIL--NRKGIKTKGFYTEEVRNNGVREGFDIVTLNGVRGKL  60

Query  206  ASNK  217
            A ++
Sbjct  61   ARDQ  64


 Score = 41.6 bits (96),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/81 (25%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
            + D+ +IDE+GKME +S+SF   +  I  +    +    IP    D P +  ++N   + 
Sbjct  100  ERDVMVIDEIGKMEFFSTSFKFRIKDIFSSECENIVLATIPSRKSD-PIIESIRNDKRSY  158

Query  415  IFTLNPNNRDAIKEHLFSLLS  477
            ++ +   NR+ + + + + +S
Sbjct  159  VWMVTRENRNVLHDEIVNKIS  179



>ref|WP_038002232.1| hypothetical protein [Syntrophorhabdus aromaticivorans]
Length=183

 Score = 63.9 bits (154),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 4/65 (6%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
            FLVTG PG+GKTTLI ++ + L   +P     GFYT+E+RE   RVGFE+V L G KGLL
Sbjct  6    FLVTGAPGIGKTTLIRRISQDLVCYDP----AGFYTQELREDGVRVGFELVGLTGEKGLL  61

Query  206  ASNKI  220
            +   +
Sbjct  62   SHADL  66


 Score = 36.6 bits (83),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 4/67 (6%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFT  423
            L +IDE+G+ME  SS F   V  +L     ++A+V +  A      +  +K  P   +F 
Sbjct  98   LVVIDEIGRMECLSSKFTSLVHDLLAGEKVVVATVALKGA----DFIDEVKRRPDMLLFE  153

Query  424  LNPNNRD  444
            +   NRD
Sbjct  154  ITQGNRD  160



>ref|WP_018032273.1| hypothetical protein [crenarchaeote SCGC AAA261-F05]
Length=183

 Score = 60.5 bits (145),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 3/66 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGR-KGL  202
            + +TG PG GKTTL++ + E L+    N+   GF TREI+EG  R GF+++ +  R KGL
Sbjct  3    WFITGNPGSGKTTLVMLIVEKLKHEGINI--DGFITREIKEGNVRTGFQIIDVKTRNKGL  60

Query  203  LASNKI  220
            LAS K+
Sbjct  61   LASKKL  66


 Score = 40.4 bits (93),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  238  TDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASV  348
            +D+ IIDE+G MEL+SSSF   V KIL++    LA++
Sbjct  98   SDVIIIDEIGTMELFSSSFKSIVNKILKSNKNCLATI  134



>ref|WP_029521396.1| nucleoside triphosphatase [Persephonella sp. IF05-L8]
Length=173

 Score = 55.1 bits (131),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 6/62 (10%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGT-QRVGFEVVTLDGRKGL  202
             L+TG PG+GKTT+I K+   L+      K  GFYT EIR+ T  R GF + TLDG++G+
Sbjct  3    ILITGKPGIGKTTVIKKLTSYLKD-----KAVGFYTEEIRDKTGHRKGFVIKTLDGKEGI  57

Query  203  LA  208
            LA
Sbjct  58   LA  59


 Score = 45.4 bits (106),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPG  408
            ++  + +IDE+GKMEL+SS F   + ++ E     ++A++PI       P +  LK+ P 
Sbjct  92   KENKIILIDEIGKMELFSSKFAQLIKQLFEDKNKTIIATIPIKNVH---PIIKWLKSLPY  148

Query  409  AAIFTLNPNNRDAIKEHLFSLLSDQ  483
            A I  ++  NR+ I E +   ++++
Sbjct  149  AQIIKIDYTNRNYIPEKILESINER  173



>ref|XP_007427015.1| PREDICTED: cancer-related nucleoside-triphosphatase [Python bivittatus]
Length=190

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPG+GKTTLI K  E L+SS   L + GFYT E+REG +R+GF+VVTL+GR+G+L+
Sbjct  6    FLTGPPGIGKTTLIRKAAEILKSSG--LPIDGFYTEEVREGGRRIGFDVVTLNGRRGILS  63


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = +1

Query  250  IIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFTL  426
            IIDE+GKMEL+S +F   V ++L E+G  +L ++P+PK G+ +  V  ++N     +F++
Sbjct  111  IIDEIGKMELFSQTFIQDVQQMLNESGTVILGTIPVPK-GKPLRLVEEIRNRKEVKLFSI  169

Query  427  NPNNRDAIKEHLFSLLSDQLQ  489
               NRD I + + + + + L+
Sbjct  170  TKANRDNILQEVVTAVENCLK  190



>ref|WP_015738953.1| putative NTPase [Ammonifex degensii]
 ref|YP_003238926.1| putative NTPase [Ammonifex degensii KC4]
 gb|ACX52076.1| protein of unknown function DUF265 [Ammonifex degensii KC4]
Length=181

 Score = 54.3 bits (129),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TGPPG+GKTT + K   SL       + +GFYT E REG +RVGF  +TL G+K +L
Sbjct  6    ILLTGPPGIGKTT-VTKRLASLLGE----QARGFYTEERREGGRRVGFVAITLKGKKAIL  60

Query  206  AS  211
            A 
Sbjct  61   AH  62


 Score = 45.8 bits (107),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
             + ++DE+GKMEL    F   + K+L +  P++A+VP     R IP    +K  PG  + 
Sbjct  97   KILLVDEIGKMELLIPRFREVIEKVLSSPWPVVATVP----ARPIPYAEEVKKRPGFTLI  152

Query  421  TLNPNNRD  444
             +N  NRD
Sbjct  153  EVNRANRD  160



>gb|AIS32628.1| nucleotide kinase related protein [Methanobacterium formicicum]
Length=178

 Score = 53.1 bits (126),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            E +D   IDE+  MEL SSSF P V ++LE+  P++A   I +  R  P + ++KN    
Sbjct  95   ETSDYIFIDEIAPMELKSSSFSPVVWEVLESKKPVVAV--IHQRSRH-PFILKVKNREDV  151

Query  412  AIFTLNPNNRDAIKEHLFSLL  474
             IF L   NR+ + E +  LL
Sbjct  152  VIFNLTVENRNQVLEEILELL  172


 Score = 46.6 bits (109),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL-DGRKGL  202
             L+TG PGVGKTTL+ K+   +R+      + G +   I E  +R GF ++ +  GRKG+
Sbjct  3    ILITGSPGVGKTTLLFKIENKVRAQ--RYSIGGMHCPAILENGKRTGFHILDIASGRKGI  60

Query  203  LAS  211
            LAS
Sbjct  61   LAS  63



>ref|XP_002040752.1| GM22168 [Drosophila sechellia]
 gb|EDW44305.1| GM22168 [Drosophila sechellia]
Length=188

 Score = 57.0 bits (136),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 4/70 (6%)
 Frame = +2

Query  5    MAAPGKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR-EGTQ-RVGFEVV  178
            M       ++TG PGVGKTTL++K+  +LR       LQGFYT +++ EG   R+GF+VV
Sbjct  1    MKNESITIILTGRPGVGKTTLVLKICSALREKGRI--LQGFYTEDVQGEGISLRIGFDVV  58

Query  179  TLDGRKGLLA  208
            TL G++G+L+
Sbjct  59   TLAGKRGILS  68


 Score = 42.7 bits (99),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            DL ++DEV KMEL S  F  A+  +L+    LL ++P       +  V +L+   G+ I+
Sbjct  109  DLLVVDEVVKMELLSKRFESAITDLLKKKRALLVTIPEKST---LALVEQLRKSAGSKIY  165

Query  421  TLNPNNRD  444
             +  +NR+
Sbjct  166  QVTKSNRN  173



>ref|WP_012963463.1| nucleoside triphosphatase [Hydrogenobacter thermophilus]
 ref|YP_003432483.1| kinase-like protein [Hydrogenobacter thermophilus TK-6]
 ref|YP_005511512.1| nucleoside-triphosphatase [Hydrogenobacter thermophilus TK-6]
 dbj|BAI69282.1| kinase-like protein [Hydrogenobacter thermophilus TK-6]
 gb|ADO45219.1| Nucleoside-triphosphatase [Hydrogenobacter thermophilus TK-6]
Length=176

 Score = 54.3 bits (129),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 7/65 (11%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIRE--GTQRVGFEVVTLDGRKG  199
             ++TGPPG+GKTTL+IKV + L+      +  GF+T E+R+    +R GF + + DG+  
Sbjct  3    LVITGPPGIGKTTLVIKVIKRLKD-----RAIGFWTEEVRDRIKKERTGFRIKSTDGKSA  57

Query  200  LLASN  214
            + AS 
Sbjct  58   IFASK  62


 Score = 45.1 bits (105),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 7/87 (8%)
 Frame = +1

Query  223  QVKEDTD-LFIIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDI-PGVARL  393
            + +E  D + +IDEVGKMEL+S  F   V ++  +    +L ++PI    RD+ P V  +
Sbjct  90   KARESKDKVVVIDEVGKMELFSKKFADMVQELFSDPKRSMLITLPI----RDVHPLVRWI  145

Query  394  KNHPGAAIFTLNPNNRDAIKEHLFSLL  474
            + HP   +  L  +NRD + + + +LL
Sbjct  146  RRHPQVVLLELTKSNRDGLVDEVANLL  172



>ref|WP_015849726.1| NTPase [Thermococcus sibiricus]
 ref|YP_002994858.1| Translation initiation factor eIF-2B, beta subunit [Thermococcus 
sibiricus MM 739]
 gb|ACS90509.1| Translation initiation factor eIF-2B, beta subunit [Thermococcus 
sibiricus MM 739]
Length=171

 Score = 60.5 bits (145),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD-GRKGL  202
              +TG PGVGKTT+I+KV + L+  N +LK+ GF T+EIRE  +RVGF++  LD G +G+
Sbjct  3    IFITGLPGVGKTTIILKVTKELK--NHDLKVGGFVTQEIREKGKRVGFKIKALDTGEEGI  60

Query  203  LA  208
            LA
Sbjct  61   LA  62


 Score = 38.5 bits (88),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 42/86 (49%), Gaps = 9/86 (10%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            E+ D+ IIDE+G ME  S  F  ++ +++++   LLA+V      R +     L      
Sbjct  94   ENADVIIIDEIGAMEYKSREFAKSIDEVIKSEKVLLATVH----RRYVDKFKTL-----G  144

Query  412  AIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             ++ L P NR+ I++ +   L    +
Sbjct  145  RVYVLTPENREQIRQEIIENLRTHWK  170



>ref|WP_022947809.1| ATPase AAA [Methylohalobius crimeensis]
Length=178

 Score = 54.7 bits (130),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
            D +L++IDE+GKME  S  F   V +IL +G P++++V     G     + ++K  PG  
Sbjct  96   DGELYLIDEIGKMECLSPVFVRRVERILNSGKPVISTVAKKGGGF----IEKIKQRPGRE  151

Query  415  IFTLNPNNRDAIKEHLFSLLSDQ  483
            ++    +NRD + E   + L  Q
Sbjct  152  MWEATHDNRDKLVERALTWLRQQ  174


 Score = 44.7 bits (104),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (55%), Gaps = 4/62 (6%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PG+GKTTLI  +   L        + GFYT+EIR    R GFE++      G++
Sbjct  9    LLLTGTPGIGKTTLIKHIAAQLGGHF----IAGFYTQEIRLKGHRAGFELIGFSRESGVI  64

Query  206  AS  211
            A 
Sbjct  65   AH  66



>ref|XP_002780600.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER12395.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=179

 Score = 52.0 bits (123),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIR--EGTQRVGFEVVTLDG  190
            +L+TG PGVGKTTL +KV   L+ +   +  QGF T+E+R  E   R GF++++LDG
Sbjct  3    YLITGAPGVGKTTLCLKVLGELQKA--GVPCQGFITKEVRNPETHSRDGFDLISLDG  57


 Score = 46.6 bits (109),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query  229  KEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPG  408
            ++D  + I+DE+GKME  S  F P  L+IL    P LA++     G     +A  K   G
Sbjct  98   RKDGCVVILDEIGKMESCSEQFEPKALRILTGRRPCLATIAQKGGGV----IAAAKKLAG  153

Query  409  AAIFTLNPNNRDAIKEHLF  465
              +  + P+NRD +   L+
Sbjct  154  INLIEVTPSNRDKLVSELY  172



>emb|CEA12369.1| Nucleoside-triphosphatase [Methanobacterium formicicum]
Length=178

 Score = 53.1 bits (126),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            E +D   IDE+  MEL SSSF P V ++LE+  P++A   I +  R  P + ++KN    
Sbjct  95   ETSDYMFIDEIAPMELKSSSFSPVVWEVLESKKPVVAV--IHQRSRH-PFILKVKNREDV  151

Query  412  AIFTLNPNNRDAIKEHLFSLL  474
             IF L   NR+ + E +  LL
Sbjct  152  VIFNLTVENRNQVLEEILGLL  172


 Score = 45.4 bits (106),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL-DGRKGL  202
             L+TG PGVGKTT++ K+   +R+      + G +   I E  +R GF ++ +  GRKG+
Sbjct  3    ILITGSPGVGKTTILFKIENKVRAQ--GYSIGGMHCPAILENGKRTGFHILDIASGRKGI  60

Query  203  LAS  211
            LAS
Sbjct  61   LAS  63



>ref|XP_004077534.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Oryzias 
latipes]
Length=193

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + ++GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALSSSG--VGVEGFYTEEVREGGRRVGFDVVTLAGERG  60

Query  200  LLA  208
            LL+
Sbjct  61   LLS  63


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
             T +F+IDE+GKMEL+S SF  AV + L++   +L ++P+PK GR +  V  +++     
Sbjct  106  STKVFVIDEIGKMELFSQSFVRAVSQTLDSPCVILGTIPVPK-GRPLGLVEEVRSRRDVK  164

Query  415  IFTLNPNNRDAIKEHLFSLLSDQLQ  489
            +F ++  NRDA+   + + L + LQ
Sbjct  165  VFHVSKENRDALLPDILAALQECLQ  189



>ref|WP_013296246.1| nucleoside triphosphatase [Methanothermobacter marburgensis]
 ref|YP_003850348.1| nucleotide kinase related protein [Methanothermobacter marburgensis 
str. Marburg]
 gb|ADL59035.1| nucleotide kinase related protein [Methanothermobacter marburgensis 
str. Marburg]
Length=172

 Score = 56.2 bits (134),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL-DGRKGL  202
             L+TG PG GK+TLI ++ + L  S   L   G +T E+REG+ RVGFEVV +  GR+GL
Sbjct  6    ILITGRPGSGKSTLIERIKDYLELSG--LSTGGIFTPEVREGSSRVGFEVVDIKSGRRGL  63

Query  203  LAS  211
            LAS
Sbjct  64   LAS  66


 Score = 42.0 bits (97),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = +1

Query  226  VKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHP  405
            +KED D  +IDE+  MEL S  F  AV + L++ VP++A+V      R +  V  ++   
Sbjct  96   LKED-DCVLIDEIAPMELKSEGFRRAVEEALDSEVPVVAAVH-----RKL--VQSIRKRG  147

Query  406  GAAIFTLNPNNRDAIKEHLFSLLSD  480
               +F + P +RD +   +  LL D
Sbjct  148  DIRVFVVAPESRDHVYRRIIDLLGD  172



>dbj|BAJ49181.1| nucleotide kinase [Candidatus Caldiarchaeum subterraneum]
Length=174

 Score = 53.5 bits (127),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +2

Query  32   VTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVT-LDGRKGLLA  208
            +TG PGVGKTT +++V E LR     +++ GFYTRE+RE   R GFEVV  + G   LLA
Sbjct  1    MTGRPGVGKTTALMRVVELLRKDG--VRVGGFYTRELRETGVRKGFEVVDIISGETALLA  58

Query  209  S  211
            S
Sbjct  59   S  59


 Score = 44.3 bits (103),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 3/86 (3%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            E  D+  +DEVG MEL S+ F   V KIL +G P + +V +       P    ++   G 
Sbjct  91   ETCDVLAVDEVGPMELLSNKFVETVEKILRSGKPSIFTVHVSATH---PVAKSVRKLAGE  147

Query  412  AIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             ++ L+  NRD + + ++ ++   L+
Sbjct  148  NLYLLDTVNRDRVPQVVYEVVKKWLR  173



>ref|XP_004659756.1| PREDICTED: cancer-related nucleoside-triphosphatase [Jaculus 
jaculus]
Length=190

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPGVGKTTLI K  E+L+SS   + + GFYT+E+R+GT+R+GF+VVTL G +G L+
Sbjct  6    FLTGPPGVGKTTLIQKACEALQSSG--VSVDGFYTQEVRQGTRRIGFDVVTLSGTRGPLS  63


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 9/80 (11%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S  F  AV + L   G  +L ++P PK G+ +  V  ++     A+F
Sbjct  109  VCVIDEIGKMELFSQPFIQAVRQALSAPGTTVLGTIPTPK-GKPLALVEEIRGRRDVAVF  167

Query  421  TLNPNNRDAIKEHLFSLLSD  480
            ++   NR+       SLLSD
Sbjct  168  SVTKENRN-------SLLSD  180



>ref|WP_037562141.1| hypothetical protein [Spirochaeta sp. JC202]
 gb|KGM43372.1| hypothetical protein JY97_07700 [Spirochaeta sp. JC202]
Length=176

 Score = 52.8 bits (125),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 7/71 (10%)
 Frame = +2

Query  11   APGKCFLVTGPPGVGKTTLIIKVFESL-RSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
            A  K  L TG PG+GK+T+I K+ + L R  N      GFYT EIR G +R GF + TLD
Sbjct  5    ARHKNILYTGVPGIGKSTIIEKIVQRLDRPKN------GFYTEEIRAGGRREGFGITTLD  58

Query  188  GRKGLLASNKI  220
             + G LA   I
Sbjct  59   RKHGTLAHIDI  69


 Score = 45.1 bits (105),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 43/80 (54%), Gaps = 4/80 (5%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
            D  + IIDE+GKME +S  F   ++ +L++   ++ S+ +    +    +A +K  P   
Sbjct  98   DNSVVIIDEIGKMECFSGLFKQTLINVLDSTNTIVGSISL----KGDAFIANVKKRPDTL  153

Query  415  IFTLNPNNRDAIKEHLFSLL  474
            + ++N  NRD + E L + L
Sbjct  154  LVSVNKGNRDNLVEELLARL  173



>ref|WP_025781087.1| hypothetical protein [Dehalococcoidia bacterium DscP2]
Length=177

 Score = 53.5 bits (127),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 5/68 (7%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            + +L+TG PG GKT+LI +    +R      K  GFYT EIR G  R GF +VTL G   
Sbjct  3    QVYLLTGKPGTGKTSLIKQAVAGMRG-----KAGGFYTEEIRSGGVRQGFRLVTLGGESA  57

Query  200  LLASNKIS  223
            +LA   I 
Sbjct  58   ILAHVNIH  65


 Score = 43.9 bits (102),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPI  354
            E+  L I+DE+GKMEL+S++F  A+L+I+ +G  +L ++ +
Sbjct  93   EECSLVIVDEIGKMELFSANFREAILQIINSGKRVLGTIML  133



>ref|WP_020863369.1| nucleotide kinase [Candidatus Caldiarchaeum subterraneum]
 ref|YP_008796774.1| nucleotide kinase [Candidatus Caldiarchaeum subterraneum]
 dbj|BAJ47274.1| nucleotide kinase [Candidatus Caldiarchaeum subterraneum]
 dbj|BAJ50144.1| nucleotide kinase [Candidatus Caldiarchaeum subterraneum]
Length=174

 Score = 52.8 bits (125),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +2

Query  32   VTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVT-LDGRKGLLA  208
            +TG PGVGKTT ++ V E LR     +++ GFYTRE+RE   R GFEVV  + G   LLA
Sbjct  1    MTGRPGVGKTTALMSVVELLRKDG--VRVGGFYTRELRETGVRKGFEVVDIISGETALLA  58

Query  209  S  211
            S
Sbjct  59   S  59


 Score = 44.3 bits (103),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 3/86 (3%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            E  D+  +DEVG MEL S+ F   V KIL +G P + +V +       P    ++   G 
Sbjct  91   ETCDVLAVDEVGPMELLSNKFVETVEKILRSGKPSIFTVHVSATH---PVAKSVRKLAGE  147

Query  412  AIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             ++ L+  NRD + + ++ ++   L+
Sbjct  148  NLYLLDTVNRDRVPQVVYEVVKKWLR  173



>ref|WP_029522413.1| nucleoside triphosphatase [Persephonella sp. KM09-Lau-8]
Length=173

 Score = 55.1 bits (131),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 6/62 (10%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGT-QRVGFEVVTLDGRKGL  202
             L+TG PG+GKTT+I K+   L+      K  GFYT EIR+ T  R GF + TLDG++G+
Sbjct  3    ILITGKPGIGKTTVIKKLTSYLKD-----KAVGFYTEEIRDKTGHRKGFVIKTLDGKEGI  57

Query  203  LA  208
            LA
Sbjct  58   LA  59


 Score = 42.0 bits (97),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPG  408
            ++  + +IDE+GKMEL+S  F   + ++ E     ++A++PI       P +  +K+ P 
Sbjct  92   KENKIILIDEIGKMELFSPKFAQLIKQLFEDKNKTIIATIPIKNVH---PVIRWIKSLPD  148

Query  409  AAIFTLNPNNRDAIKEHLFSLLSDQ  483
            A I  ++  NR+ I E +   ++++
Sbjct  149  AQIIEIDYTNRNYIPEKILESINER  173



>dbj|BAL54341.1| NTPase [uncultured Aquificae bacterium]
Length=176

 Score = 51.6 bits (122),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIRE--GTQRVGFEVVTLDGRKG  199
             ++TGPPG+GKTTL+IKV + L+      +  GF+T E+R+    +R GF + + DG   
Sbjct  3    LVITGPPGIGKTTLVIKVIKRLKD-----RAIGFWTEEVRDRIKKERTGFRIESTDGTST  57

Query  200  LLASN  214
            + AS 
Sbjct  58   IFASK  62


 Score = 45.4 bits (106),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 7/87 (8%)
 Frame = +1

Query  223  QVKEDTD-LFIIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDI-PGVARL  393
            + +E  D + +IDEVGKMEL+S  F   V ++  +    +L ++PI    RD+ P V  +
Sbjct  90   KARESKDKVVVIDEVGKMELFSKKFADMVQELFSDPKRSMLITLPI----RDVHPLVRWI  145

Query  394  KNHPGAAIFTLNPNNRDAIKEHLFSLL  474
            + HP   +  L  +NRD++ + +  LL
Sbjct  146  RRHPQVVLLELTKSNRDSLVDEVAELL  172



>ref|XP_010560953.1| PREDICTED: cancer-related nucleoside-triphosphatase [Haliaeetus 
leucocephalus]
Length=190

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+SS   + + GFYT E+REG +R GF+VVTL G++G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKSSG--ISIDGFYTEEVREGGRRTGFDVVTLSGKRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            +  + +IDE+GKMEL+S  F  AV + L  +G  +L ++PIPK G+ +  V  +++    
Sbjct  106  EKKICVIDEIGKMELFSQPFIQAVRQTLTGSGTVVLGTIPIPK-GKPLDLVEEIRSRKDV  164

Query  412  AIFTLNPNNRDAIKEHLFS  468
             +F ++  NR++I + + +
Sbjct  165  KVFNVSKENRNSILQDILA  183



>ref|WP_014127739.1| nucleoside triphosphatase [Thermoproteus tenax]
 ref|YP_004893564.1| nucleotide kinase [Thermoproteus tenax Kra 1]
 emb|CCC82486.1| nucleotide kinase [Thermoproteus tenax Kra 1]
Length=166

 Score = 59.7 bits (143),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +2

Query  32   VTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL-DGRKGLLA  208
            VTGPPGVGKTTL +KV E+ R     L ++GF T E+REG QRVGF+++ L DG +  LA
Sbjct  5    VTGPPGVGKTTLALKVAEAARGV--GLDVRGFVTVELREGGQRVGFDILRLADGARAPLA  62


 Score = 36.6 bits (83),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (45%), Gaps = 8/83 (10%)
 Frame = +1

Query  226  VKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHP  405
            ++E  DL I+DEVG ME   + F       +E     LA V +        G AR     
Sbjct  88   LREAGDLLIVDEVGAMEAKCAGFLNEAKSAIERSARALAVVHLRYV-----GAAR---GW  139

Query  406  GAAIFTLNPNNRDAIKEHLFSLL  474
            G  I++L  +NR+ I   +  LL
Sbjct  140  GLKIYSLTKDNREQIFNEVVKLL  162



>gb|AIJ04966.1| putative NTPase [Methanocaldococcus sp. JH146]
Length=170

 Score = 55.8 bits (133),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
              +TG PGVGKTTL +K+ E L+  +   K+ GF T+E+RE  +RVGF+++TLD
Sbjct  3    IFITGMPGVGKTTLTLKIAEKLK--DLGYKVGGFVTKEVREDGRRVGFKIITLD  54


 Score = 40.4 bits (93),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 9/86 (10%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            ED D+ IIDE+G ME  S  F   V +++ +  PLLA++      R+   V + K+    
Sbjct  94   EDADIVIIDELGAMEFKSKKFSEVVDEVINSNKPLLATLH-----RN--WVNKFKDK--G  144

Query  412  AIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             ++TL   NRD + E + + +  +L+
Sbjct  145  ELYTLTIENRDKLFEEILNKILAELK  170



>ref|XP_006807736.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Neolamprologus 
brichardi]
Length=198

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + ++GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGVEGFYTEEVREGGRRVGFDVVTLTGARG  60

Query  200  LLASNKISR  226
             L+  + SR
Sbjct  61   HLSRIRDSR  69


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +F+IDE+GKMEL+S SF  AV + L+ +   +L ++PIPK G+ +  V  ++N     +F
Sbjct  114  VFVIDEIGKMELFSQSFIRAVRQTLDSSSCTILGTIPIPK-GKPLGLVEEVRNRRDVKVF  172

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
            T++  NR+AI + +   L + L+
Sbjct  173  TVSKENRNAILQDILETLQECLK  195



>ref|XP_003441090.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Oreochromis 
niloticus]
Length=199

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + ++GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGVEGFYTEEVREGGRRVGFDVVTLTGARG  60

Query  200  LLASNKISR  226
             L+  + SR
Sbjct  61   HLSRIRDSR  69


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +F+IDE+GKMEL+S SF  AV + L+ +   +L ++PIPK G+ +  V  ++N     +F
Sbjct  115  VFVIDEIGKMELFSQSFIRAVRQTLDSSSCTILGTIPIPK-GKPLGLVEEVRNRRDVKVF  173

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
            T++  NR+AI + +   L + L+
Sbjct  174  TVSKENRNAILQDILETLQECLK  196



>ref|XP_002009062.1| GI11469 [Drosophila mojavensis]
 gb|EDW19538.1| GI11469 [Drosophila mojavensis]
Length=198

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +2

Query  23   CFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGL  202
             F++TGPPGVGKTTL+ K+   L       KL GFYT E+R   QR+GF+VV+L+G +G+
Sbjct  8    AFIITGPPGVGKTTLVRKICSKLSEY---CKLAGFYTEEVRASGQRIGFDVVSLNGTRGI  64

Query  203  LASNK  217
            LA  K
Sbjct  65   LAREK  69


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +1

Query  247  FIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFTL  426
             +IDE+GKMEL S  F  AV K+     P+LA++P     + IP V  ++N P + +F +
Sbjct  116  IVIDEIGKMELLSKRFESAVNKLRNQNQPMLATIP-SHTRQPIPIVEGIRNAPDSIVFHV  174

Query  427  NPNNRDAIKEHLFSLLSDQL  486
              +NRD++   +   +   L
Sbjct  175  TKSNRDSMVNEITEYMVKTL  194



>gb|ETE73105.1| Cancer-related nucleoside-triphosphatase [Ophiophagus hannah]
Length=190

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPG+GKTTLI K  E L+SS   + + GFYT E+RE  +R GF+VVTL+GR+G+L+
Sbjct  6    FLTGPPGIGKTTLIRKAAEILKSSG--IAIDGFYTEEVRESGRRTGFDVVTLNGRRGILS  63


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + IIDEVGKMEL+S +F  AV +IL  +G  +L ++P+PK G+ +  V  ++N     +F
Sbjct  109  VCIIDEVGKMELFSQTFIQAVQQILNGSGTVILGTIPVPK-GKPLRLVEEIRNRKEVKVF  167

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
            ++   NRD I + + + + + L+
Sbjct  168  SITRENRDDILQEVVTAVQNCLK  190



>ref|XP_005795187.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Xiphophorus 
maculatus]
Length=198

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + L+GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGLEGFYTEEVREGGRRVGFDVVTLAGERG  60

Query  200  LLA  208
             L+
Sbjct  61   HLS  63


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +FIIDE+GKMEL+S +F  AV + L+ +   +L ++P+PK G+ +  V  +++     +F
Sbjct  111  VFIIDEIGKMELFSQAFIRAVRQTLDGSSCTILGTIPVPK-GKPLGLVEEVRSRRDVKVF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
            T++  NR+A+ + + S L + L+
Sbjct  170  TVSKENRNALLQDIVSTLQECLK  192



>ref|XP_007626140.1| PREDICTED: cancer-related nucleoside-triphosphatase [Cricetulus 
griseus]
 gb|ERE78335.1| cancer-related nucleoside-triphosphatase-like protein [Cricetulus 
griseus]
Length=190

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
            G+   +TGPPGVGKTTLI K  E L+SS   + + GFYT+E+R+G +R+GF+VVTL G +
Sbjct  2    GRHVFLTGPPGVGKTTLIQKASEVLQSSG--VPIDGFYTQEVRQGGRRIGFDVVTLSGAR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAI  417
             + IIDE+GKMEL+S  F  AV + L T G  +L ++P+PK G+ +  V  ++N P   +
Sbjct  108  SVCIIDEIGKMELFSQPFIQAVRQTLSTPGTVVLGTIPVPK-GKPLALVEEIRNRPDVKV  166

Query  418  FTLNPNNRDAI  450
            F++   NR+++
Sbjct  167  FSVTKENRNSL  177



>ref|XP_004451086.1| PREDICTED: cancer-related nucleoside-triphosphatase-like isoform 
2 [Dasypus novemcinctus]
Length=120

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI KV E L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIRKVSEVLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGTR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63



>ref|XP_004559778.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Maylandia 
zebra]
 ref|XP_005742479.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Pundamilia 
nyererei]
 ref|XP_005927217.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Haplochromis 
burtoni]
Length=198

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   +  +GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGAEGFYTEEVREGGRRVGFDVVTLTGARG  60

Query  200  LLASNKISR  226
             L+  + SR
Sbjct  61   HLSRIRDSR  69


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +F+IDE+GKMEL+S SF  AV + L+ +   +L ++PIPK G+ +  V  ++N     +F
Sbjct  114  VFVIDEIGKMELFSQSFIRAVRQTLDSSSCTILGTIPIPK-GKPLGLVEEVRNRRDVKVF  172

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
            T++  NR+AI + +   L + L+
Sbjct  173  TVSKENRNAILQDILETLQECLK  195



>ref|WP_007223398.1| ATPase AAA [planctomycete KSU-1]
 dbj|GAB64318.1| conserved hypothetical protein [planctomycete KSU-1]
Length=178

 Score = 53.5 bits (127),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K  L+TG PGVGKTT++ K+   L +        GF+T EIR   +R+GF VVTLDG  G
Sbjct  5    KHILLTGKPGVGKTTVMRKIIPLLGADAG-----GFFTEEIRVMGKRMGFRVVTLDGDNG  59

Query  200  LLAS  211
            +LA 
Sbjct  60   ILAH  63


 Score = 42.0 bits (97),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            ++  + +IDE+GKMEL+S  F   V  IL++  PL+ SV +        G+ + K     
Sbjct  95   KNKSILVIDEIGKMELFSMRFRELVRSILDSEKPLI-SVIMEDGNVFTEGIKKRKE---V  150

Query  412  AIFTLNPNNRDAIKEHLFSLLS  477
             + T+N  NRD + E +  ++ 
Sbjct  151  TVVTVNYKNRDYLPEKVLEMVK  172



>ref|XP_003978149.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Takifugu 
rubripes]
Length=195

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+LRSS   ++++GFYT E+REG  RVGF+VVT+ G + 
Sbjct  3    KHVFLTGPPGVGKTTLVHKACEALRSSG--MEVEGFYTEEVREGAGRVGFDVVTVRGERR  60

Query  200  LLA  208
             LA
Sbjct  61   PLA  63


 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +F++DEVGKMEL+S SF   V + L E    +L +VP PK G+ +  VA + N     +F
Sbjct  111  VFVVDEVGKMELFSRSFISCVRRTLDEPSCTILGTVPAPK-GKPLALVAEVWNRTDVKVF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
             ++  NRDA+ + + + L D L+
Sbjct  170  IVSKENRDALLQDILAALRDCLR  192



>ref|XP_009905297.1| PREDICTED: cancer-related nucleoside-triphosphatase [Picoides 
pubescens]
Length=190

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPG+GKTTLI KV ++L+SS   + + GFYT E+REG +R GF+VVTL G++G
Sbjct  3    KHVFLTGPPGIGKTTLIQKVTQALKSSG--VPIDGFYTEEVREGGRRTGFDVVTLSGKRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            +  + +IDE+GKMEL+S +F  AV + L  +G  +L ++PIPK G+ +  V  +++    
Sbjct  106  EKKICVIDEIGKMELFSQAFIQAVRQTLTGSGTVVLGTIPIPK-GKPLDLVEEIRSRKDV  164

Query  412  AIFTLNPNNRDAIKEHLFS  468
             +F ++  NR++I + + +
Sbjct  165  KVFNVSRENRNSILQDILA  183



>ref|WP_013335378.1| hypothetical protein [Vulcanisaeta distributa]
 ref|YP_003900704.1| hypothetical protein Vdis_0241 [Vulcanisaeta distributa DSM 14429]
 gb|ADN49653.1| protein of unknown function DUF265 [Vulcanisaeta distributa DSM 
14429]
Length=180

 Score = 56.6 bits (135),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL-DGRKGLL  205
            L+TGPPGVGKTTLI ++ +  RS    +++ GF T E+REG  RVGF +V + +GR+  L
Sbjct  5    LITGPPGVGKTTLIKRLVDHARSM--GVEVFGFITTEVREGGSRVGFRIVDINNGREAWL  62

Query  206  AS  211
            A 
Sbjct  63   AH  64


 Score = 38.1 bits (87),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 43/86 (50%), Gaps = 7/86 (8%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAIFT  423
            L +IDE+GKMEL    F  A+ +++  GV  L ++ +  A R    VA   +  G  I  
Sbjct  100  LLVIDEIGKMELMHRDFLRALEEVI-NGVHFLGTIYM--AYRTNRPVASFVSKYGFKIVE  156

Query  424  LNPNNRDAIKEHLFSLLSDQLQKSIR  501
            L   NRD I    F+ L  +L K ++
Sbjct  157  LTRTNRDQI----FNELVKELNKEVK  178



>ref|XP_005146043.1| PREDICTED: cancer-related nucleoside-triphosphatase [Melopsittacus 
undulatus]
Length=190

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             K   +TGPPGVGKTTLI KV ++L+S+  ++   GFYT E+REG +R GF+VVTL G++
Sbjct  2    AKHVFLTGPPGVGKTTLIQKVTQALKSAGTSI--DGFYTEEVREGGRRTGFDVVTLSGKR  59

Query  197  GLL  205
            G L
Sbjct  60   GPL  62


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            +  +++IDEVGKMEL+S +F   V + L  +G  +L ++P+PK G+ +  V  ++N    
Sbjct  106  EKKVYVIDEVGKMELFSQAFIQTVRQTLACSGTVVLGTIPVPK-GKPLDLVEEIRNRKDV  164

Query  412  AIFTLNPNNRDAIKEHLFS  468
             +F +   NR++I + + +
Sbjct  165  KVFNVTKENRNSIFQDILA  183



>sp|Q58954.2|NTPTH_METJA RecName: Full=Nucleoside-triphosphatase THEP1; Short=NTPase THEP1; 
AltName: Full=Nucleoside triphosphate phosphohydrolase 
[Methanocaldococcus jannaschii DSM 2661]
Length=170

 Score = 57.8 bits (138),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
             +TG PGVGKTTL +K+ E L+      K+ GF T+EIR+G +RVGF+++TLD
Sbjct  4    FITGMPGVGKTTLALKIAEKLKE--LGYKVGGFITKEIRDGGKRVGFKIITLD  54


 Score = 37.0 bits (84),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 9/79 (11%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            +D D+ IIDE+G ME  S  F   V +++++  PLLA++      R+   V + K+    
Sbjct  94   KDADIIIIDELGAMEFKSRKFSEVVDEVIKSDKPLLATLH-----RN--WVNKFKDK--G  144

Query  412  AIFTLNPNNRDAIKEHLFS  468
             ++TL   NR+ + E + +
Sbjct  145  ELYTLTIENREKLFEEILN  163



>ref|XP_005992674.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Latimeria 
chalumnae]
Length=193

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI K  E+L+SS   + + GFYT E+R+G +R+GF+VVTL G++G
Sbjct  3    KHVFLTGPPGVGKTTLIQKSTEALKSSG--IPIDGFYTEEVRQGGRRIGFDVVTLFGKRG  60

Query  200  LLA  208
             L+
Sbjct  61   TLS  63


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +FIIDE+G+MEL+S SF  AV +IL+ +   +L ++PIPK G+ +  V  +++     +F
Sbjct  112  VFIIDEIGRMELFSHSFIQAVRQILDGSETTVLGTIPIPK-GKPLGLVEEIRSRRDVKVF  170

Query  421  TLNPNNRDAI  450
            ++   NR  I
Sbjct  171  SVTKENRGHI  180



>ref|WP_010871083.1| NTPase [Methanocaldococcus jannaschii]
 ref|NP_248567.1| putative NTPase [Methanocaldococcus jannaschii DSM 2661]
 gb|AAB99578.1| conserved hypothetical protein [Methanocaldococcus jannaschii 
DSM 2661]
Length=188

 Score = 57.8 bits (138),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
             +TG PGVGKTTL +K+ E L+      K+ GF T+EIR+G +RVGF+++TLD
Sbjct  22   FITGMPGVGKTTLALKIAEKLKE--LGYKVGGFITKEIRDGGKRVGFKIITLD  72


 Score = 37.0 bits (84),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 9/79 (11%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            +D D+ IIDE+G ME  S  F   V +++++  PLLA++      R+   V + K+    
Sbjct  112  KDADIIIIDELGAMEFKSRKFSEVVDEVIKSDKPLLATLH-----RNW--VNKFKDK--G  162

Query  412  AIFTLNPNNRDAIKEHLFS  468
             ++TL   NR+ + E + +
Sbjct  163  ELYTLTIENREKLFEEILN  181



>ref|XP_006870645.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Chrysochloris 
asiatica]
Length=189

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPGVGKTTLI K  E+L+SS+  + + GFYT E+R+G +R+GF+VVTL G +G L+
Sbjct  6    FLTGPPGVGKTTLIRKTCEALKSSS--VSVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLS  63


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S +F  AV + L   G  +L ++PIPK G+ +  V  ++N     +F
Sbjct  109  VCVIDEIGKMELFSQTFIQAVRQTLSAPGTLVLGTIPIPK-GKPLALVEEIRNRSDIKVF  167

Query  421  TLNPNNRDAIKEHLF  465
            T+   NR+++ + + 
Sbjct  168  TVTKENRNSLLQEIL  182



>ref|XP_008428449.1| PREDICTED: cancer-related nucleoside-triphosphatase [Poecilia 
reticulata]
Length=198

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + ++GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGVEGFYTEEVREGGRRVGFDVVTLAGERG  60

Query  200  LLA  208
             L+
Sbjct  61   HLS  63


 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +FIIDE+GKMEL+S +F  AV + L+ +   +L ++P+P+ G+ +  V  +++     +F
Sbjct  111  VFIIDEIGKMELFSQAFIRAVRQTLDGSSCTILGTIPVPR-GKPLGLVEEVRSRRDVKVF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKS  495
            TL+  NR+A+ + + S L + L+ S
Sbjct  170  TLSKENRNALLQDILSTLQECLKHS  194



>ref|XP_007551546.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Poecilia formosa]
Length=198

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + ++GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGVEGFYTEEVREGGRRVGFDVVTLAGERG  60

Query  200  LLA  208
             L+
Sbjct  61   HLS  63


 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +FIIDE+GKMEL+S +F  AV + L+ +   +L ++PIPK G+ +  V  +++     +F
Sbjct  111  VFIIDEIGKMELFSQAFIRAVRQTLDGSSCTILGTIPIPK-GKPLGLVEEVRSRRDVKVF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKS  495
            T++  NR+A+ + + S L + L+ S
Sbjct  170  TVSKENRNALLQDILSTLQECLKHS  194



>ref|XP_007551550.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X1 [Poecilia formosa]
Length=198

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + ++GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGVEGFYTEEVREGGRRVGFDVVTLAGERG  60

Query  200  LLA  208
             L+
Sbjct  61   HLS  63


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +FIIDE+GKMEL+S +F  AV + L+ +   +L ++P+PK G+ +  V  +++     +F
Sbjct  111  VFIIDEIGKMELFSQAFIRAVRQTLDGSSCTILGTIPVPK-GKPLGLVEEVRSRRDVKVF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKS  495
            T++  NR+A+ + + S L + L+ S
Sbjct  170  TVSKENRNALLQDILSTLQECLKHS  194



>ref|WP_018194653.1| MULTISPECIES: hypothetical protein [candidate division YNPFFA]
Length=177

 Score = 55.8 bits (133),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 3/67 (4%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGR-KGL  202
            + +TG P  GKTTL++ + E L+    N+   G  T+EIREG +R+GF+++ +  + KG+
Sbjct  3    WFITGEPASGKTTLVMLITERLKKEGINV--DGIITKEIREGDERIGFQIIDIKTKNKGI  60

Query  203  LASNKIS  223
            LAS K+ 
Sbjct  61   LASKKLK  67


 Score = 38.1 bits (87),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLA  342
            + ++ + DE+G MELYS  F   + KIL++  PLLA
Sbjct  97   EAEIIVCDEIGTMELYSEDFRKVIEKILKSDKPLLA  132



>gb|AJB41413.1| putative NTPase [Thermofilum carboxyditrophus 1505]
Length=187

 Score = 50.4 bits (119),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL-DGRK  196
            K FLVTG PG+GKTT +I++ E L S    + + G  T E+RE  +R+GF +  +  GR+
Sbjct  7    KNFLVTGRPGIGKTTCVIRIAEILTSR--GVTVGGMVTYEVREKGERIGFNIRDVYTGRE  64

Query  197  GLLA  208
            G+LA
Sbjct  65   GVLA  68


 Score = 43.9 bits (102),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 10/75 (13%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASV----PIPKAGRDIPGVARLKN  399
            +   + IIDE+G MELYS +F+ AVL  L++  P++A++    P  + G+ I        
Sbjct  101  QQAQVLIIDEIGPMELYSKNFYTAVLSALDSTKPVIATIHEKAPNSQEGKTIL------Q  154

Query  400  HPGAAIFTLNPNNRD  444
                 ++TL   NR+
Sbjct  155  RKDVKLYTLTLANRE  169



>ref|NP_001279961.1| nucleoside-triphosphatase, cancer-related [Callorhinchus milii]
 gb|AFK10975.1| cancer-related nucleoside-triphosphatase-like protein [Callorhinchus 
milii]
Length=193

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            +  ++TGPPGVGKTTLI K  + L+SS   + + GFYT E+R+  +RVGF+VVTL G++G
Sbjct  3    RHVVLTGPPGVGKTTLIHKAMDVLKSSG--ISIDGFYTEEVRQSGRRVGFDVVTLSGKRG  60

Query  200  LLA  208
             L+
Sbjct  61   TLS  63


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +++IDE+GKMEL+S  F  A+ +IL+  G  +L ++P+P+ G+ +  V  ++      +F
Sbjct  112  VYVIDEIGKMELFSQPFIQAIRQILDGAGSTILGTIPVPR-GKPLGLVEEIRTRSDVRMF  170

Query  421  TLNPNNRDAIKEHLFSLLSD  480
             +   NR++I + + S + +
Sbjct  171  NITKENRNSIVQEIISAVQE  190



>ref|XP_007551551.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Poecilia formosa]
Length=197

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + ++GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGVEGFYTEEVREGGRRVGFDVVTLAGERG  60

Query  200  LLA  208
             L+
Sbjct  61   HLS  63


 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +FIIDE+GKMEL+S +F  AV + L+ +   +L ++P+PK G+ +  V  +++     +F
Sbjct  111  VFIIDEIGKMELFSQAFIRAVRQTLDGSSCTILGTIPVPK-GKPLGLVEEVRSRRDVKVF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKSIRC  504
            T++  NR+A+ + + S L + L+ S  C
Sbjct  170  TVSKENRNALLQDILSTLQECLKHSSLC  197



>ref|WP_004031419.1| nucleoside-triphosphatase [Methanobacterium formicicum]
 gb|EKF85190.1| Nucleoside-triphosphatase [Methanobacterium formicicum DSM 3637]
Length=176

 Score = 48.9 bits (115),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGR-KGL  202
             L+TGPPGVGKTTL+       +  +      G Y  EIREG +R GFE++ +  + KGL
Sbjct  3    ILITGPPGVGKTTLL--NKIKKKIKDMGYSTGGMYCPEIREGGRRTGFEIIDIASKQKGL  60

Query  203  LAS  211
            LAS
Sbjct  61   LAS  63


 Score = 45.1 bits (105),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 3/77 (4%)
 Frame = +1

Query  238  TDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAAI  417
            +D   IDE+  MEL SSSF   V +++E+   ++A   I       P + ++KN   A I
Sbjct  97   SDYIFIDEIAPMELTSSSFSQTVWEVMESKKIVIA---IIHQRSKHPFILKVKNREDAMI  153

Query  418  FTLNPNNRDAIKEHLFS  468
            F +N  NRD++ + +  
Sbjct  154  FDINLKNRDSLTDEILQ  170



>ref|XP_007551547.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog isoform 
X2 [Poecilia formosa]
Length=197

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E+L SS   + ++GFYT E+REG +RVGF+VVTL G +G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACEALVSSG--VGVEGFYTEEVREGGRRVGFDVVTLAGERG  60

Query  200  LLA  208
             L+
Sbjct  61   HLS  63


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILE-TGVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +FIIDE+GKMEL+S +F  AV + L+ +   +L ++PIPK G+ +  V  +++     +F
Sbjct  111  VFIIDEIGKMELFSQAFIRAVRQTLDGSSCTILGTIPIPK-GKPLGLVEEVRSRRDVKVF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQKSIRC  504
            T++  NR+A+ + + S L + L+ S  C
Sbjct  170  TVSKENRNALLQDILSTLQECLKHSSLC  197



>ref|WP_039014260.1| hypothetical protein [Cupriavidus sp. IDO]
Length=175

 Score = 55.1 bits (131),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLL  205
             L+TG PG GKTT+I ++  +L    P  +L GF T EIR G +R+GF +   DGR+ ++
Sbjct  2    LLLTGAPGSGKTTIIRRLAAAL----PGWRLAGFCTEEIRMGGERLGFRISDFDGREAVM  57

Query  206  ASNKIS  223
            A    +
Sbjct  58   AHAHFA  63


 Score = 38.9 bits (89),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 22/93 (24%), Positives = 41/93 (44%), Gaps = 10/93 (11%)
 Frame = +1

Query  211  QQNLQVKEDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAG-----RDI  375
            +  L +    D +++DEVGKME   ++F   +  +  +G P++A+V     G     R  
Sbjct  83   ESALVLNPGVDAYLVDEVGKMECLCAAFVTRMGAVFASGKPVVATVAQYGGGFIEEVRAC  142

Query  376  PGVARLKNHPGAAIFTLNPNNRDAIKEHLFSLL  474
             G        G  ++ +   NRD++     + L
Sbjct  143  RGAC-----AGGELWVVTSRNRDSLPGQALAWL  170



>ref|WP_013466898.1| NTPase [Thermococcus barophilus]
 ref|YP_004070823.1| ATP-binding protein [Thermococcus barophilus MP]
 gb|ADT83600.1| hypothetical ATP-binding protein [Thermococcus barophilus MP]
Length=171

 Score = 53.5 bits (127),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = +2

Query  26   FLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD-GRKGL  202
              VTG PGVGKTTL++K+ E LR S    ++ G  T+E+RE  +RVGF++  LD   +G 
Sbjct  3    IFVTGVPGVGKTTLVLKIAEDLRKS--GFRIGGMVTQEVREQGKRVGFKIRALDTNEEGT  60

Query  203  LA  208
            LA
Sbjct  61   LA  62


 Score = 40.4 bits (93),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 37/76 (49%), Gaps = 9/76 (12%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGAA  414
            + D+ IIDE+G ME  S  F   + + L +  PLLA++           V R KN     
Sbjct  95   NADVIIIDEIGAMEFKSKEFAKVIEEALRSEKPLLATL-------HRRWVHRFKNK--GK  145

Query  415  IFTLNPNNRDAIKEHL  462
            ++ L   NR+ I+E +
Sbjct  146  LYVLTEENREKIREEI  161



>ref|WP_012980325.1| NTPase [Methanocaldococcus sp. FS406-22]
 ref|YP_003458151.1| protein of unknown function DUF265 [Methanocaldococcus sp. FS406-22]
 gb|ADC69415.1| protein of unknown function DUF265 [Methanocaldococcus sp. FS406-22]
Length=177

 Score = 55.5 bits (132),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLD  187
             +TG PGVGKTTL +K+ E L+  +   K+ GF T+EIR+  +RVGF+++TLD
Sbjct  4    FITGMPGVGKTTLALKIAEKLK--DFGYKVGGFITKEIRKNGKRVGFKIITLD  54


 Score = 38.5 bits (88),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 9/86 (10%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            +D D+ IIDE+G ME  S +F   V +++    PLLA++      R+   V + KN    
Sbjct  94   KDADIIIIDELGAMEFKSKTFSKVVDEVINNNKPLLATLH-----RN--WVNKFKNK--G  144

Query  412  AIFTLNPNNRDAIKEHLFSLLSDQLQ  489
             I+ L+  NR+ + + +   +   LQ
Sbjct  145  KIYRLSIENRNKLYKEILDEILSYLQ  170



>gb|KFM79386.1| Cancer-related nucleoside-triphosphatase-like protein, partial 
[Stegodyphus mimosarum]
Length=108

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +  L+TGPPGVGKTT+I K  E L+  N N+K  GF+T E++ G +RVGF+VVT +G +
Sbjct  3    NRHILLTGPPGVGKTTVIKKSCELLK--NKNVKYHGFFTEEVKRGRERVGFDVVTTEGNR  60

Query  197  GLLA  208
              LA
Sbjct  61   STLA  64



>emb|CDQ66315.1| unnamed protein product [Oncorhynchus mykiss]
Length=66

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  + + SS   + ++GFYT+E+REG +RVGF+VVT+ G++G
Sbjct  3    KHVFLTGPPGVGKTTLVQKACDVIVSSG--VSVEGFYTQEVREGRRRVGFDVVTVTGQRG  60

Query  200  LLA  208
             L+
Sbjct  61   NLS  63



>ref|XP_004578589.1| PREDICTED: cancer-related nucleoside-triphosphatase [Ochotona 
princeps]
Length=190

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E LRSS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIQKTCEVLRSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGSR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63



>ref|XP_006638609.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Lepisosteus 
oculatus]
Length=192

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTL+ K  E L++S     L GFYT E+REG +R+GF+VVT  G++G
Sbjct  3    KHVFLTGPPGVGKTTLVQKASELLKTSG--FVLDGFYTEEVREGGRRIGFDVVTFSGQRG  60

Query  200  LLA  208
            +L+
Sbjct  61   ILS  63


 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            +F+IDE+GKMEL+S SF  AV + L++    +L ++PIPK G+ +  V  ++N     +F
Sbjct  111  VFVIDEIGKMELFSHSFIQAVRQTLDSPAFVILGTIPIPK-GKPLGLVEEVRNRSDVKLF  169

Query  421  TLNPNNRDAIKEHLFSLLSDQLQ  489
            T+  +NRD I   + + L D L+
Sbjct  170  TVTKDNRDKILPQIVATLQDCLK  192



>ref|XP_004451085.1| PREDICTED: cancer-related nucleoside-triphosphatase-like isoform 
1 [Dasypus novemcinctus]
Length=190

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI KV E L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIRKVSEVLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGTR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S +F  AV + L T G+ +L ++P+PK G+ +  V  ++N     +F
Sbjct  109  VCVIDEIGKMELFSQTFIQAVHQTLSTPGIIILGTIPVPK-GKPLALVEEIRNRNDVKVF  167

Query  421  TLNPNNRDAIKEHL  462
             +   NR+ + + +
Sbjct  168  NVTKENRNNLLQDI  181



>ref|XP_004712266.1| PREDICTED: cancer-related nucleoside-triphosphatase [Echinops 
telfairi]
Length=179

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E+L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIHKASEALKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGTR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63



>ref|XP_004432432.1| PREDICTED: cancer-related nucleoside-triphosphatase [Ceratotherium 
simum simum]
Length=190

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI KV E L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIQKVSEILKSSG--VSVDGFYTEEVRQGGRRIGFDVVTLSGTR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S  F  AV + L T G  +L ++PIPK G+ +  V  ++N     +F
Sbjct  109  VCVIDEIGKMELFSQPFIQAVRQTLSTAGTVVLGTIPIPK-GKPLALVEEIRNRNDVQVF  167

Query  421  TLNPNNRDAI  450
            ++   NR+ +
Sbjct  168  SVTKENRNHL  177



>ref|XP_004456730.1| PREDICTED: cancer-related nucleoside-triphosphatase-like [Dasypus 
novemcinctus]
Length=190

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI KV E L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIRKVSEVLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGTR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S +F  AV + L T G+ +L ++P+PK G+ +  V  ++N     +F
Sbjct  109  VCVIDEIGKMELFSQTFIQAVHQTLSTPGIIILGTIPVPK-GKPLALVEEIRNRNDVKVF  167

Query  421  TLNPNNRDAIKEHL  462
             +   NR+ + + +
Sbjct  168  NVTKENRNNLLQDI  181



>ref|XP_002717409.1| PREDICTED: cancer-related nucleoside-triphosphatase [Oryctolagus 
cuniculus]
Length=190

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E LRSS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIQKTSEVLRSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGSR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S  F  AV + L T G  +L ++P+PK G+ +  V  ++N     +F
Sbjct  109  VCVIDEIGKMELFSQPFIQAVRQTLSTPGTIILGTIPVPK-GKPLALVEEIRNRSDVKVF  167

Query  421  TLNPNNRDAI  450
            ++   NR+ +
Sbjct  168  SVTKENRNHL  177



>ref|WP_020962919.1| hypothetical protein [Thermofilum sp. 1910b]
 ref|YP_008432625.1| hypothetical protein N186_06370 [Thermofilum sp. 1910b]
 gb|AGT35612.1| hypothetical protein N186_06370 [Thermofilum sp. 1910b]
Length=187

 Score = 50.8 bits (120),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTL-DGRK  196
            K FLVTG PG+GKTT +I++ E L S    + + G  T E+RE  +R+GF +  +  GR+
Sbjct  7    KNFLVTGRPGIGKTTCVIRIAEILTSR--GVTVGGMVTYEVREKGERIGFNIRDIYTGRE  64

Query  197  GLLA  208
            G+LA
Sbjct  65   GVLA  68


 Score = 42.7 bits (99),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 10/75 (13%)
 Frame = +1

Query  232  EDTDLFIIDEVGKMELYSSSFFPAVLKILETGVPLLASV----PIPKAGRDIPGVARLKN  399
            +   + IIDE+G MELYS +F+ AVL  L++  P++A++    P  + G+ I        
Sbjct  101  QQAQVIIIDEIGPMELYSKNFYTAVLSALDSTKPVIATIHEKAPNSQEGKTIL------Q  154

Query  400  HPGAAIFTLNPNNRD  444
                 ++TL   NR+
Sbjct  155  RKDVKLYTLTFANRE  169



>ref|XP_004408695.1| PREDICTED: cancer-related nucleoside-triphosphatase [Odobenus 
rosmarus divergens]
Length=190

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPGVGKTTLI K  E L+SS   + + GFYT E+R+G +R+GF+VVTL G +G+L+
Sbjct  6    FLTGPPGVGKTTLIQKASEVLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGMRGVLS  63


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S  F  AV + L T G  +L ++PIPK G+ +  V  ++N     +F
Sbjct  109  VCVIDEIGKMELFSQPFIQAVRQTLCTPGTVVLGTIPIPK-GKPLALVEEIRNRNDIQVF  167

Query  421  TLNPNNRDAI  450
            ++   NR+ +
Sbjct  168  SVTKENRNHL  177



>ref|XP_004819629.1| PREDICTED: cancer-related nucleoside-triphosphatase [Mustela 
putorius furo]
Length=190

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIQKASEVLKSSG--VPVDGFYTEEVRQGGKRIGFDVVTLSGLR  59

Query  197  GLLA  208
            G+L+
Sbjct  60   GVLS  63


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + IIDE+GKMEL+S  F  AV + L T G  +L ++PIPK G+ +  V  ++N     +F
Sbjct  109  VCIIDEIGKMELFSQPFIQAVRQTLATPGTVVLGTIPIPK-GKPLALVEEIRNRNDVQVF  167

Query  421  TLNPNNRDAI  450
            ++   NR+ +
Sbjct  168  SVTKENRNHL  177



>ref|XP_005273368.1| PREDICTED: cancer-related nucleoside-triphosphatase isoform X1 
[Homo sapiens]
 gb|EAW69977.1| chromosome 1 open reading frame 57, isoform CRA_b [Homo sapiens]
Length=120

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIHKASEVLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGTR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63



>ref|XP_004691187.1| PREDICTED: cancer-related nucleoside-triphosphatase [Condylura 
cristata]
Length=190

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E L+SS   L + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIQKASEVLKSSG--LPVDGFYTEEVRQGGRRIGFDVVTLSGMR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 6/83 (7%)
 Frame = +1

Query  250  IIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIFTL  426
            +IDE+GKMEL+S  F  AV + L T G  +L ++PIPK G+ +  V  ++N     +F +
Sbjct  111  VIDEIGKMELFSQPFIQAVRQTLSTPGTVVLGTIPIPK-GKPLDLVEEIRNRNDIKVFNV  169

Query  427  NPNNRDAIKEHLFSLLSDQLQKS  495
               NR+    HL   +   +Q S
Sbjct  170  TKENRN----HLLPDIVTWVQSS  188



>dbj|BAC39726.1| unnamed protein product [Mus musculus]
Length=121

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            +   +TGPPGVGKTTLI K  E L+SS   L + GFYT+E+R+  +R+GF+VVTL G +G
Sbjct  3    RHVFLTGPPGVGKTTLIQKAIEVLQSSG--LPVDGFYTQEVRQEGKRIGFDVVTLSGAQG  60

Query  200  LLA  208
             L+
Sbjct  61   PLS  63



>ref|XP_008499334.1| PREDICTED: cancer-related nucleoside-triphosphatase [Calypte 
anna]
Length=189

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +2

Query  20   KCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKG  199
            K   +TGPPGVGKTTLI KV ++L+ S   + + GFYT E+REG +R GF+VVTL G++G
Sbjct  3    KHVFLTGPPGVGKTTLIQKVTQALKVSG--VPIDGFYTEEVREGGRRTGFDVVTLSGKRG  60

Query  200  LL  205
             L
Sbjct  61   PL  62


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 50/79 (63%), Gaps = 2/79 (3%)
 Frame = +1

Query  235  DTDLFIIDEVGKMELYSSSFFPAVLKIL-ETGVPLLASVPIPKAGRDIPGVARLKNHPGA  411
            + ++ +IDE+GKMEL+S +F  AV + L  +G  +L ++P+PK G+ +  V  +++    
Sbjct  105  EKNICVIDEIGKMELFSQAFVQAVRQTLAASGTVVLGTIPVPK-GKPLDLVEEIRSRKDV  163

Query  412  AIFTLNPNNRDAIKEHLFS  468
             +F ++  NR++I + + +
Sbjct  164  KVFNVSKENRNSILQDILA  182



>ref|XP_004372866.1| PREDICTED: cancer-related nucleoside-triphosphatase [Trichechus 
manatus latirostris]
Length=190

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E+L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIRKASEALKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGTR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S +F  AV   L T G  +L ++P+PK G+ +  V  ++N     +F
Sbjct  109  VCVIDEIGKMELFSQTFIQAVRHTLSTPGTVVLGTIPVPK-GKPLALVEEIRNRSDVKVF  167

Query  421  TLNPNNRDAIKEHLFSLLSD  480
            ++   NR+++ + + + +  
Sbjct  168  SVTKENRNSLLQDIVTCVQS  187



>ref|XP_006146035.1| PREDICTED: cancer-related nucleoside-triphosphatase [Tupaia chinensis]
Length=190

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E+L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIQKASEALKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGPR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63



>ref|XP_004281627.1| PREDICTED: cancer-related nucleoside-triphosphatase homolog [Orcinus 
orca]
Length=190

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPGVGKTTLI KV E L+SS   + + GFYT E+R+G +R+GF+VVTL G +G L+
Sbjct  6    FLTGPPGVGKTTLIQKVSEVLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGARGPLS  63


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAI  417
             + +IDEVGKMEL+S  F  AV ++L T G  +L ++P+PK G+ +  V  ++      +
Sbjct  108  SVCVIDEVGKMELFSQPFIQAVRQVLSTLGTVVLGTIPVPK-GKPLALVEEIRTRNDIKV  166

Query  418  FTLNPNNRDAI  450
            F++   NR+ +
Sbjct  167  FSVTKENRNHL  177



>ref|XP_003410945.1| PREDICTED: cancer-related nucleoside-triphosphatase [Loxodonta 
africana]
Length=190

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E+L+SS   + + GFYT E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIRKASEALKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGAR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +1

Query  244  LFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAIF  420
            + +IDE+GKMEL+S +F  AV + L T G  +L ++P+PK G+ +  V  ++N     +F
Sbjct  109  VCVIDEIGKMELFSQTFIQAVRQTLSTPGTIVLGTIPVPK-GKPLALVEEIRNRSDIKVF  167

Query  421  TLNPNNRDAIKEHLFSLLSD  480
            ++   NR ++ + + + +  
Sbjct  168  SVTKENRSSLLQDIVTCVQS  187



>ref|XP_003496852.1| PREDICTED: cancer-related nucleoside-triphosphatase [Cricetulus 
griseus]
 gb|EGW03340.1| Nucleoside-triphosphatase C1orf57 [Cricetulus griseus]
Length=190

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  17   GKCFLVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRK  196
             +   +TGPPGVGKTTLI K  E L+SS   + + GFYT+E+R+G +R+GF+VVTL G +
Sbjct  2    ARHVFLTGPPGVGKTTLIQKASEVLQSSG--VPIDGFYTQEVRQGGRRIGFDVVTLSGAR  59

Query  197  GLLA  208
            G L+
Sbjct  60   GPLS  63


 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +1

Query  241  DLFIIDEVGKMELYSSSFFPAVLKILET-GVPLLASVPIPKAGRDIPGVARLKNHPGAAI  417
             + IIDE+GKMEL+S  F  AV + L T G  +L ++P+PK G+ +  V  ++N P   +
Sbjct  108  SVCIIDEIGKMELFSQPFIQAVRQTLSTPGTVVLGTIPVPK-GKPLALVEEIRNRPDVKV  166

Query  418  FTLNPNNRDAI  450
            F++   NR+++
Sbjct  167  FSVTKENRNSL  177



>ref|XP_003893809.2| PREDICTED: cancer-related nucleoside-triphosphatase-like [Papio 
anubis]
Length=111

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +2

Query  29   LVTGPPGVGKTTLIIKVFESLRSSNPNLKLQGFYTREIREGTQRVGFEVVTLDGRKGLLA  208
             +TGPPGVGKTTLI K  E L+SS   + + GFYT E+R+G +R+GF+VVTL G +G L+
Sbjct  6    FLTGPPGVGKTTLIQKASEVLKSSG--VPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLS  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1333973365272