BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16339_g2_i1 len=1024 path=[299:0-1023]

Length=1024
                                                                      Score     E

ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        282   7e-89   
gb|ADV41672.1|  cysteine protease                                       282   8e-89   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        280   3e-88   
gb|AAW78661.2|  senescence-specific cysteine protease                   280   4e-88   Nicotiana tabacum [American tobacco]
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    278   4e-87   
ref|XP_008780365.1|  PREDICTED: vignain-like                            270   3e-86   
ref|XP_006362420.1|  PREDICTED: vignain-like                            274   1e-85   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    269   1e-83   
gb|AGT97048.1|  senescence-specific cysteine protease                   267   4e-83   
ref|XP_007025397.1|  Senescence-associated gene 12, putative            266   7e-83   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          265   4e-82   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    265   5e-82   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    264   9e-82   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             262   3e-81   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         261   4e-81   
ref|XP_007025398.1|  Senescence-associated gene 12                      261   8e-81   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    261   9e-81   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             260   1e-80   
emb|CDP18637.1|  unnamed protein product                                258   1e-80   
ref|XP_008780330.1|  PREDICTED: vignain-like                            254   3e-80   
ref|XP_006469011.1|  PREDICTED: vignain-like                            260   3e-80   
ref|XP_009786836.1|  PREDICTED: vignain-like                            254   4e-80   
dbj|BAD29955.1|  cysteine protease                                      260   6e-80   Daucus carota [carrots]
emb|CDP18641.1|  unnamed protein product                                259   7e-80   
gb|ADV74756.1|  cysteine protease                                       259   7e-80   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             258   2e-79   
ref|XP_006467666.1|  PREDICTED: vignain-like                            258   2e-79   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        257   3e-79   
gb|KDP38777.1|  hypothetical protein JCGZ_05113                         253   3e-79   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             257   3e-79   
ref|XP_006469012.1|  PREDICTED: vignain-like                            257   3e-79   
ref|XP_002523447.1|  cysteine protease, putative                        257   3e-79   Ricinus communis
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   256   3e-79   
emb|CAN64655.1|  hypothetical protein VITISV_005140                     257   3e-79   Vitis vinifera
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        257   4e-79   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             257   4e-79   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    257   5e-79   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             256   5e-79   
ref|XP_002865220.1|  senescence-associated gene 12                      257   5e-79   
gb|AAT34987.1|  putative cysteine protease                              256   6e-79   Gossypium hirsutum [American cotton]
ref|XP_006469128.1|  PREDICTED: vignain-like                            256   7e-79   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        256   8e-79   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    256   8e-79   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             256   8e-79   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             255   9e-79   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        256   1e-78   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    256   1e-78   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    256   1e-78   
ref|XP_007216164.1|  hypothetical protein PRUPE_ppa015341mg             250   2e-78   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             255   2e-78   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        255   2e-78   
ref|XP_008228922.1|  PREDICTED: vignain-like                            254   2e-78   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                254   2e-78   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             256   2e-78   Populus trichocarpa [western balsam poplar]
gb|AAK27968.1|AF242372_1  cysteine protease                             255   2e-78   Ipomoea batatas [batate]
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    255   3e-78   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             254   3e-78   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        255   3e-78   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    255   3e-78   
ref|XP_008362418.1|  PREDICTED: vignain-like                            249   3e-78   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             254   3e-78   
ref|XP_002523448.1|  cysteine protease, putative                        254   4e-78   Ricinus communis
ref|XP_008780633.1|  PREDICTED: vignain-like                            249   4e-78   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    254   4e-78   Vitis vinifera
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    254   4e-78   
ref|NP_568651.1|  cysteine protease SAG12                               254   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        254   5e-78   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        254   6e-78   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        254   6e-78   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        254   6e-78   
gb|AAL14199.1|  cysteine proteinase precursor                           254   6e-78   Ipomoea batatas [batate]
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        254   6e-78   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             254   7e-78   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    254   7e-78   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        255   9e-78   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    253   1e-77   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    253   1e-77   Vitis vinifera
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    253   1e-77   Vitis vinifera
ref|XP_008340724.1|  PREDICTED: vignain-like                            253   1e-77   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        253   1e-77   
dbj|BAF46311.1|  cysteine proteinase precursor                          253   1e-77   Ipomoea nil [qian niu]
ref|XP_006360707.1|  PREDICTED: vignain-like                            253   2e-77   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        253   2e-77   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    253   2e-77   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        253   2e-77   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        252   2e-77   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        253   2e-77   
ref|XP_004290089.1|  PREDICTED: vignain-like                            252   2e-77   
ref|XP_007048796.1|  Senescence-associated gene 12                      252   2e-77   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        252   3e-77   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    252   3e-77   
gb|KDP38773.1|  hypothetical protein JCGZ_05109                         248   3e-77   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        252   3e-77   
gb|AAC49135.1|  SAG12 protein                                           252   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        251   4e-77   
ref|XP_004294729.1|  PREDICTED: vignain-like                            252   4e-77   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    252   4e-77   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         251   4e-77   
ref|XP_009359967.1|  PREDICTED: vignain-like                            251   4e-77   
ref|XP_009361500.1|  PREDICTED: vignain-like                            251   5e-77   
ref|XP_004297571.1|  PREDICTED: vignain-like                            251   5e-77   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        251   5e-77   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    251   5e-77   Vitis vinifera
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                251   5e-77   
ref|XP_004308524.1|  PREDICTED: vignain-like                            251   6e-77   
ref|XP_006362426.1|  PREDICTED: vignain-like                            251   6e-77   
emb|CDP18645.1|  unnamed protein product                                251   6e-77   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            251   7e-77   
ref|XP_004306597.1|  PREDICTED: vignain-like                            251   8e-77   
ref|XP_004303175.1|  PREDICTED: vignain-like                            251   8e-77   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    251   9e-77   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    250   9e-77   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        250   9e-77   
ref|XP_007048792.1|  Senescence-associated gene 12                      251   9e-77   
emb|CAN70559.1|  hypothetical protein VITISV_032465                     251   1e-76   Vitis vinifera
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             251   1e-76   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          251   1e-76   
ref|XP_004306836.1|  PREDICTED: vignain-like                            251   1e-76   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    250   2e-76   
ref|XP_006360708.1|  PREDICTED: vignain-like                            250   2e-76   
ref|XP_007048674.1|  Senescence-associated gene 12                      250   2e-76   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             250   2e-76   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                249   3e-76   
gb|AAA50755.1|  cysteine proteinase                                     249   3e-76   Alnus glutinosa
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    249   3e-76   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        249   3e-76   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          249   3e-76   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             249   3e-76   
ref|XP_004297572.1|  PREDICTED: vignain-like                            249   4e-76   
gb|KDP38776.1|  hypothetical protein JCGZ_05112                         245   4e-76   
ref|XP_011014387.1|  PREDICTED: senescence-specific cysteine prot...    244   4e-76   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        249   4e-76   
gb|KHN05669.1|  Vignain                                                 248   4e-76   
ref|XP_011005484.1|  PREDICTED: senescence-specific cysteine prot...    244   4e-76   
gb|AHA62780.1|  RCR3-like cysteine protease                             249   4e-76   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    249   5e-76   
ref|XP_004306813.1|  PREDICTED: vignain-like                            249   5e-76   
ref|XP_006652104.1|  PREDICTED: vignain-like                            249   5e-76   
ref|XP_002522559.1|  cysteine protease, putative                        249   5e-76   Ricinus communis
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        249   6e-76   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            249   6e-76   
dbj|BAD29959.1|  cysteine protease                                      249   6e-76   Daucus carota [carrots]
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             248   6e-76   
emb|CDP18644.1|  unnamed protein product                                248   6e-76   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                249   7e-76   
gb|KFK23231.1|  hypothetical protein AALP_AAs59427U000100               245   7e-76   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    248   7e-76   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             249   8e-76   
ref|XP_007050065.1|  Senescence-associated gene 12                      248   8e-76   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             248   9e-76   Populus trichocarpa [western balsam poplar]
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        248   9e-76   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        248   9e-76   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        248   1e-75   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     247   1e-75   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          248   1e-75   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        248   1e-75   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                247   1e-75   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        248   1e-75   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            248   2e-75   
gb|AHA62781.1|  RCR3-like cysteine protease                             248   2e-75   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    247   2e-75   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    247   2e-75   
ref|XP_004306851.1|  PREDICTED: vignain-like                            247   2e-75   
ref|XP_004506025.1|  PREDICTED: vignain-like                            247   2e-75   
gb|AHA62779.1|  RCR3-like cysteine protease                             248   2e-75   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    247   2e-75   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        247   2e-75   
gb|KHN38752.1|  Vignain                                                 246   3e-75   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         247   3e-75   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             247   3e-75   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             246   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    247   4e-75   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             246   4e-75   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             246   4e-75   
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             246   4e-75   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             246   4e-75   Populus trichocarpa [western balsam poplar]
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             246   5e-75   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    246   5e-75   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        246   5e-75   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         246   5e-75   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        246   5e-75   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        246   5e-75   
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             246   6e-75   
gb|AHA62783.1|  RCR3-like cysteine protease                             246   7e-75   
dbj|BAF56428.1|  cysteine proteinase                                    246   7e-75   Lotus japonicus
ref|XP_004975184.1|  PREDICTED: vignain-like                            246   8e-75   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        246   8e-75   
gb|AAR92154.1|  putative cysteine protease 1                            246   9e-75   Iris x hollandica [Dutch iris]
ref|XP_010906195.1|  PREDICTED: senescence-specific cysteine prot...    242   9e-75   
gb|AAP32194.1|  cysteine protease 1                                     244   9e-75   Trifolium repens [creeping white clover]
ref|XP_008780645.1|  PREDICTED: vignain-like                            244   9e-75   
ref|XP_003538185.1|  PREDICTED: vignain-like                            246   1e-74   
gb|AHA62782.1|  RCR3-like cysteine protease                             245   1e-74   
ref|XP_007048673.1|  Senescence-associated gene 12, putative            244   2e-74   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    246   2e-74   
gb|AEK97329.1|  chromoplast senescence-associated protein 12            242   2e-74   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         245   2e-74   Brassica napus [oilseed rape]
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         245   2e-74   
ref|XP_009349242.1|  PREDICTED: vignain-like                            249   2e-74   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    244   2e-74   
emb|CDX87758.1|  BnaC02g31910D                                          245   2e-74   
ref|XP_008650514.1|  PREDICTED: vignain-like                            241   2e-74   
ref|XP_002531152.1|  cysteine protease, putative                        244   2e-74   Ricinus communis
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                        244   2e-74   
gb|KHN05804.1|  Vignain                                                 243   2e-74   
ref|XP_003609015.1|  Cysteine proteinase                                244   3e-74   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    244   3e-74   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        244   3e-74   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        244   3e-74   
gb|AAP32197.1|  cysteine protease 10                                    241   6e-74   Trifolium repens [creeping white clover]
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    244   6e-74   
gb|ACU23531.1|  unknown                                                 244   6e-74   Glycine max [soybeans]
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        243   7e-74   
ref|XP_002531151.1|  cysteine protease, putative                        243   7e-74   Ricinus communis
ref|XP_006362428.1|  PREDICTED: vignain-like                            243   7e-74   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    243   8e-74   
ref|NP_001237379.1|  cysteine proteinase precursor                      244   9e-74   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like              243   1e-73   
ref|XP_004501841.1|  PREDICTED: vignain-like                            244   1e-73   
ref|XP_006388352.1|  hypothetical protein POPTR_0213s00210g             238   1e-73   
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                     241   2e-73   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                        242   2e-73   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    242   2e-73   
gb|AFW86314.1|  hypothetical protein ZEAMMB73_546353                    238   2e-73   
gb|AFW86315.1|  hypothetical protein ZEAMMB73_539008                    241   2e-73   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             242   2e-73   Populus trichocarpa [western balsam poplar]
dbj|BAF56430.1|  cysteine proteinase                                    242   3e-73   Lotus japonicus
ref|XP_009365508.1|  PREDICTED: vignain-like                            248   3e-73   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        242   3e-73   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        242   3e-73   
gb|AGT16936.1|  vignain-like protein                                    242   3e-73   
gb|KHN13721.1|  Vignain                                                 241   3e-73   
emb|CBI30671.3|  unnamed protein product                                241   3e-73   
gb|EMT12294.1|  Vignain                                                 241   3e-73   
gb|KHN08187.1|  Thiol protease SEN102                                   241   4e-73   
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...    242   4e-73   Vigna mungo [urad dal]
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        241   5e-73   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    241   5e-73   Vitis vinifera
gb|KDP30997.1|  hypothetical protein JCGZ_11373                         242   5e-73   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                        241   5e-73   
ref|XP_002525124.1|  cysteine protease, putative                        241   5e-73   Ricinus communis
ref|XP_003557016.1|  PREDICTED: vignain-like                            241   6e-73   
prf||1910332A  Cys endopeptidase                                        242   6e-73
gb|AAP32195.1|  cysteine protease 5                                     241   6e-73   Trifolium repens [creeping white clover]
ref|XP_003607574.1|  Cysteine protease                                  241   6e-73   
gb|AAP32198.1|  cysteine protease 12                                    241   6e-73   Trifolium repens [creeping white clover]
ref|XP_004505498.1|  PREDICTED: vignain-like                            241   7e-73   
ref|XP_006592465.1|  PREDICTED: vignain-like                            241   7e-73   
gb|EAY93078.1|  hypothetical protein OsI_14879                          241   7e-73   Oryza sativa Indica Group [Indian rice]
emb|CAH66275.1|  OSIGBa0147O06.5                                        241   7e-73   Oryza sativa [red rice]
gb|KHN07963.1|  Vignain                                                 239   7e-73   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             241   7e-73   
gb|EMT29821.1|  Thiol protease SEN102                                   241   7e-73   
gb|EMT29822.1|  Vignain                                                 241   8e-73   
ref|XP_003612210.1|  Cysteine proteinase                                241   8e-73   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                        241   9e-73   
ref|XP_003605890.1|  Cysteine proteinase                                240   1e-72   
gb|EMT20795.1|  Vignain                                                 240   1e-72   
ref|XP_009797968.1|  PREDICTED: vignain-like                            240   1e-72   
gb|AAP32196.1|  cysteine protease 8                                     240   1e-72   Trifolium repens [creeping white clover]
emb|CAH66233.1|  H0825G02.10                                            240   1e-72   Oryza sativa [red rice]
emb|CAD40112.2|  OSJNBa0035O13.5                                        240   1e-72   Oryza sativa Japonica Group [Japonica rice]
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                     240   1e-72   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                    243   1e-72   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    240   1e-72   Oryza sativa Indica Group [Indian rice]
ref|NP_001052246.2|  Os04g0208200                                       236   1e-72   Oryza sativa Japonica Group [Japonica rice]
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    240   1e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like              240   1e-72   
ref|XP_003599736.1|  Cysteine proteinase                                240   1e-72   
gb|EMT20796.1|  Vignain                                                 241   2e-72   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        241   2e-72   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like              240   2e-72   
gb|EMT33085.1|  Vignain                                                 240   2e-72   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                240   2e-72   
dbj|BAB13759.1|  cysteine proteinase                                    240   2e-72   Astragalus sinicus
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like              239   2e-72   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             239   2e-72   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         239   2e-72   
ref|XP_003539770.1|  PREDICTED: vignain-like                            239   2e-72   
gb|AAA92063.1|  cysteinyl endopeptidase                                 240   2e-72   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    239   2e-72   
ref|XP_003607571.1|  Cysteine proteinase EP-B                           239   3e-72   
ref|XP_002446128.1|  hypothetical protein SORBIDRAFT_06g002110          234   3e-72   
ref|XP_003607548.1|  Cysteine protease                                  239   3e-72   
gb|EMT08019.1|  Vignain                                                 238   3e-72   
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g             240   3e-72   
ref|XP_004505502.1|  PREDICTED: vignain-like                            239   3e-72   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             239   3e-72   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        239   3e-72   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    250   4e-72   
emb|CAA40073.1|  endopeptidase (EP-C1)                                  239   4e-72   
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...    239   4e-72   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        239   4e-72   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             239   4e-72   
gb|KHN05670.1|  Vignain                                                 237   4e-72   
ref|XP_010102922.1|  hypothetical protein L484_018940                   239   4e-72   
gb|KHN33962.1|  Vignain                                                 238   5e-72   
gb|KHG06908.1|  Vignain                                                 239   5e-72   
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                  238   6e-72   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        238   6e-72   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             238   7e-72   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        238   7e-72   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...    238   7e-72   
gb|EMT08022.1|  Vignain                                                 238   8e-72   
emb|CAL64936.1|  putative cysteine protease 8                           238   8e-72   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             238   8e-72   
gb|EAY93080.1|  hypothetical protein OsI_14881                          237   9e-72   
ref|XP_002525123.1|  cysteine protease, putative                        238   9e-72   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...    238   9e-72   
ref|XP_004515849.1|  PREDICTED: vignain-like                            238   1e-71   
ref|NP_001237199.1|  cysteine proteinase precursor                      238   1e-71   
gb|EMT29823.1|  Vignain                                                 238   1e-71   
emb|CAD40110.2|  OSJNBa0035O13.9                                        237   1e-71   
ref|XP_003556992.1|  PREDICTED: vignain-like                            238   1e-71   
ref|XP_007050023.1|  Cysteine proteinases superfamily protein, pu...    238   1e-71   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like              238   1e-71   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     236   1e-71   
ref|XP_003527349.1|  PREDICTED: vignain-like                            238   1e-71   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             238   1e-71   
gb|KHN23485.1|  Vignain                                                 233   1e-71   
ref|XP_007025415.1|  Senescence-associated gene 12, putative            238   1e-71   
ref|XP_006592467.1|  PREDICTED: vignain-like                            238   1e-71   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    238   1e-71   
ref|XP_003607647.1|  Cysteine proteinase                                237   2e-71   
gb|AAX13273.1|  putative cysteine protease                              238   2e-71   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        237   2e-71   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                        237   2e-71   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like              237   2e-71   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like              237   2e-71   
emb|CBI21977.3|  unnamed protein product                                236   2e-71   
dbj|BAF56427.1|  cysteine proteinase                                    237   2e-71   
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                        239   2e-71   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     237   2e-71   
ref|XP_006384061.1|  hypothetical protein POPTR_0004s05530g             232   2e-71   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             237   2e-71   
ref|XP_004505522.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    237   2e-71   
gb|AFV30165.1|  cysteine proteinase                                     237   3e-71   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             236   3e-71   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830          236   3e-71   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    247   3e-71   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        236   3e-71   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...    236   3e-71   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410          236   3e-71   
gb|ABF70145.1|  cysteine protease, putative                             237   4e-71   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...    236   4e-71   
ref|XP_007037812.1|  Cysteine proteinases superfamily protein iso...    237   5e-71   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    236   5e-71   
gb|EYU28078.1|  hypothetical protein MIMGU_mgv1a009081mg                236   5e-71   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    236   5e-71   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 234   6e-71   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             236   7e-71   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1                 235   7e-71   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        236   7e-71   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          235   8e-71   
gb|AFK44139.1|  unknown                                                 235   1e-70   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     234   1e-70   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    235   1e-70   
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                        235   1e-70   
ref|XP_003526232.1|  PREDICTED: vignain-like                            235   2e-70   
gb|KEH31736.1|  KDEL-tailed cysteine endopeptidase CEP1                 235   2e-70   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             234   2e-70   
ref|XP_004505500.1|  PREDICTED: vignain-like                            234   2e-70   
emb|CAN62838.1|  hypothetical protein VITISV_003391                     233   2e-70   
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    238   2e-70   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        234   2e-70   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...    234   3e-70   
ref|XP_010695980.1|  PREDICTED: vignain-like                            234   4e-70   
gb|EMT09279.1|  Thiol protease SEN102                                   232   4e-70   
ref|XP_008229136.1|  PREDICTED: zingipain-2                             234   4e-70   
emb|CDP05747.1|  unnamed protein product                                233   5e-70   
gb|KHN32068.1|  Vignain                                                 232   5e-70   
ref|XP_008392874.1|  PREDICTED: vignain-like                            234   5e-70   
ref|XP_008239373.1|  PREDICTED: vignain-like                            234   5e-70   
gb|KHN13720.1|  Vignain                                                 232   6e-70   
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g             232   6e-70   
gb|KHG13330.1|  Vignain                                                 234   6e-70   
ref|XP_003607546.1|  Cysteine proteinase                                233   6e-70   
ref|XP_003638507.1|  Cysteine proteinase                                234   6e-70   
ref|XP_003527388.1|  PREDICTED: vignain-like                            233   6e-70   
gb|EAY97106.1|  hypothetical protein OsI_19029                          233   6e-70   
pdb|1S4V|A  Chain A, The 2.0 A Crystal Structure Of The Kdel-Tail...    229   8e-70   
ref|XP_009333898.1|  PREDICTED: vignain                                 233   8e-70   
ref|XP_006652103.1|  PREDICTED: cysteine protease 1-like                233   1e-69   
ref|XP_003539989.1|  PREDICTED: vignain-like                            233   1e-69   
ref|XP_003539970.1|  PREDICTED: vignain-like                            233   1e-69   
gb|ABA97421.1|  Vignain precursor, putative                             233   1e-69   
emb|CDY58055.1|  BnaA06g40240D                                          232   1e-69   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        233   1e-69   
ref|XP_011005600.1|  PREDICTED: vignain                                 233   1e-69   
ref|XP_002515048.1|  cysteine protease, putative                        233   1e-69   
ref|XP_007209277.1|  hypothetical protein PRUPE_ppa007566mg             233   1e-69   
ref|XP_008805113.1|  PREDICTED: vignain-like                            233   2e-69   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850          231   2e-69   
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             232   2e-69   
ref|XP_004489011.1|  PREDICTED: vignain-like                            232   2e-69   
ref|XP_002321654.1|  Cys endopeptidase family protein                   233   2e-69   
gb|KHN33968.1|  Vignain                                                 228   2e-69   
ref|XP_004299172.1|  PREDICTED: vignain-like                            233   2e-69   
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                        232   2e-69   
ref|NP_001176897.1|  Os12g0273900                                       226   3e-69   
gb|EEC84514.1|  hypothetical protein OsI_31214                          232   3e-69   
ref|XP_011040442.1|  PREDICTED: vignain-like                            232   3e-69   
gb|EAY80530.1|  hypothetical protein OsI_35710                          233   3e-69   
dbj|BAF56429.1|  cysteine proteinase                                    231   3e-69   
gb|KHN07749.1|  Vignain                                                 230   3e-69   
ref|XP_009359516.1|  PREDICTED: vignain-like                            232   3e-69   
ref|XP_004515851.1|  PREDICTED: vignain-like                            232   4e-69   
gb|EMT15489.1|  Thiol protease SEN102                                   231   4e-69   
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...    231   4e-69   
ref|XP_011072006.1|  PREDICTED: vignain-like                            232   4e-69   
ref|XP_006388351.1|  hypothetical protein POPTR_0213s00200g             226   6e-69   
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                     233   6e-69   
emb|CDP06286.1|  unnamed protein product                                229   7e-69   
ref|XP_008374352.1|  PREDICTED: vignain                                 231   8e-69   
ref|XP_011005599.1|  PREDICTED: vignain-like                            231   1e-68   
ref|NP_001067630.1|  Os11g0255300                                       231   1e-68   
gb|AAM73806.1|AF448505_1  cysteine proteinase                           230   1e-68   
ref|XP_002466439.1|  hypothetical protein SORBIDRAFT_01g007820          230   1e-68   
gb|KDP26711.1|  hypothetical protein JCGZ_17869                         227   1e-68   
gb|EMT01703.1|  Vignain                                                 228   1e-68   
ref|XP_010545991.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    230   2e-68   
ref|XP_010682353.1|  PREDICTED: vignain-like                            230   2e-68   
ref|XP_002511277.1|  cysteine protease, putative                        230   2e-68   
ref|XP_006439985.1|  hypothetical protein CICLE_v10020781mg             230   2e-68   
ref|XP_006476933.1|  PREDICTED: vignain-like                            230   2e-68   
gb|ACJ85307.1|  unknown                                                 230   2e-68   
gb|AFK46775.1|  unknown                                                 230   2e-68   
ref|XP_007155505.1|  hypothetical protein PHAVU_003G207200g             232   2e-68   
ref|XP_011013690.1|  PREDICTED: vignain-like                            230   2e-68   
ref|XP_010536661.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    229   3e-68   
ref|XP_006663343.1|  PREDICTED: vignain-like                            228   3e-68   
ref|XP_003526229.1|  PREDICTED: vignain-like                            227   3e-68   
ref|XP_006376886.1|  hypothetical protein POPTR_0012s09270g             229   3e-68   
ref|XP_008228971.1|  PREDICTED: zingipain-2-like                        229   3e-68   
gb|AFW67599.1|  hypothetical protein ZEAMMB73_513726                    224   5e-68   
ref|XP_003527350.1|  PREDICTED: vignain-like                            228   5e-68   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    228   6e-68   
ref|XP_011100224.1|  PREDICTED: zingipain-2                             228   6e-68   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     227   7e-68   
ref|XP_007226517.1|  hypothetical protein PRUPE_ppa025615mg             228   9e-68   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        228   9e-68   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like              227   9e-68   
gb|KHN32069.1|  Vignain                                                 227   1e-67   
tpg|DAA42119.1|  TPA: hypothetical protein ZEAMMB73_388689              224   1e-67   
ref|XP_010519533.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    228   1e-67   
ref|XP_003577598.1|  PREDICTED: vignain                                 228   1e-67   
ref|XP_010245279.1|  PREDICTED: vignain-like                            228   1e-67   
gb|EEE59942.1|  hypothetical protein OsJ_12596                          223   2e-67   
ref|XP_003558756.1|  PREDICTED: senescence-specific cysteine prot...    227   2e-67   
ref|XP_008221945.1|  PREDICTED: vignain-like                            227   2e-67   
ref|XP_006849385.1|  hypothetical protein AMTR_s01332p00008900          227   2e-67   
emb|CDP18638.1|  unnamed protein product                                226   2e-67   
ref|XP_002285397.3|  PREDICTED: vignain-like                            227   3e-67   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             226   3e-67   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              226   3e-67   
gb|KHN10462.1|  Vignain                                                 227   3e-67   
gb|KHN28095.1|  Thiol protease                                          226   3e-67   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                        226   3e-67   
ref|XP_008799976.1|  PREDICTED: vignain-like                            222   4e-67   
ref|XP_010932269.1|  PREDICTED: LOW QUALITY PROTEIN: vignain-like       226   4e-67   
emb|CDP18639.1|  unnamed protein product                                226   4e-67   
ref|XP_003549830.2|  PREDICTED: vignain-like                            227   4e-67   
gb|AFW67600.1|  cysteine protease 1                                     226   4e-67   
gb|KHN27797.1|  Thiol protease SEN102                                   226   5e-67   
gb|EYU22236.1|  hypothetical protein MIMGU_mgv1a008784mg                226   5e-67   
ref|XP_006592475.1|  PREDICTED: vignain-like                            225   5e-67   
ref|XP_010929952.1|  PREDICTED: vignain isoform X1                      226   5e-67   
emb|CBI21941.3|  unnamed protein product                                226   5e-67   
ref|XP_002275891.1|  PREDICTED: zingipain-2                             226   5e-67   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                     226   5e-67   
gb|KDP31767.1|  hypothetical protein JCGZ_12228                         225   5e-67   
ref|XP_006291370.1|  hypothetical protein CARUB_v10017509mg             226   6e-67   
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                        225   6e-67   
emb|CAB09697.1|  cysteine endopeptidase EP-A                            226   6e-67   
ref|XP_002321655.1|  hypothetical protein POPTR_0015s09900g             226   6e-67   
emb|CBI14901.3|  unnamed protein product                                223   7e-67   
gb|AEP83812.2|  cysteine endopeptidase EP8                              226   8e-67   
ref|XP_002525147.1|  cysteine protease, putative                        225   8e-67   
dbj|BAC75924.1|  cysteine protease-2                                    226   9e-67   
ref|XP_010248729.1|  PREDICTED: vignain-like                            225   1e-66   
dbj|BAG16376.1|  cysteine protease                                      224   1e-66   
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                  227   1e-66   
ref|XP_008381611.1|  PREDICTED: ervatamin-B                             225   2e-66   
ref|XP_008797119.1|  PREDICTED: vignain-like                            222   2e-66   
ref|XP_009357242.1|  PREDICTED: ervatamin-B                             224   2e-66   
gb|AAD10337.1|  cysteine proteinase precursor                           225   2e-66   
emb|CAB09699.1|  cysteine endopeptidase EP-A                            225   2e-66   
tpg|DAA42116.1|  TPA: hypothetical protein ZEAMMB73_388689              225   2e-66   
gb|AAW78660.1|  cysteine protease                                       224   3e-66   
ref|XP_009392372.1|  PREDICTED: ervatamin-B-like                        221   4e-66   
ref|XP_009387347.1|  PREDICTED: vignain-like                            224   4e-66   
ref|XP_009774957.1|  PREDICTED: vignain-like                            224   4e-66   
gb|KFK34125.1|  hypothetical protein AALP_AA5G104600                    223   5e-66   
ref|XP_004981743.1|  PREDICTED: cysteine proteinase EP-B 1-like         223   5e-66   
gb|ACY38051.3|  cysteine proteinase C1A                                 224   5e-66   
ref|XP_009617207.1|  PREDICTED: vignain-like                            224   5e-66   
ref|XP_009779832.1|  PREDICTED: vignain-like                            223   5e-66   
ref|XP_006852216.1|  hypothetical protein AMTR_s00049p00133800          223   6e-66   
ref|XP_004979206.1|  PREDICTED: vignain-like                            223   6e-66   
ref|XP_010545992.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    223   6e-66   



>ref|XP_009759551.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=349

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EGL Q+KTGKL+ LSEQELVDCDV GED GC GGL++ AF FI+ NKGLTTE NY
Sbjct  160   AVAATEGLHQLKTGKLIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEANY  219

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DGVCN KK+A++AAKI+GYE VPA+ EKALLQAVA+QPVSVAI+G++FDFQFY  
Sbjct  220   PYKGEDGVCNKKKSALSAAKIAGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSS  279

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C  +LNHAVTA+GYG   DG+KYW+IKNSWG+ WG+SGYMRI RD  +KEGLCG
Sbjct  280   GVFSGSCSTWLNHAVTAVGYGATSDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCG  339

Query  482   LARDATYPV  456
             LA DA+YP 
Sbjct  340   LAMDASYPT  348



>gb|ADV41672.1| cysteine protease [Nicotiana tabacum]
Length=349

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EGL Q+KTGKL+ LSEQELVDCDV GED GC GGL++ AF FI+ NKGLTTE NY
Sbjct  160   AVAATEGLHQLKTGKLIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEANY  219

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DGVCN KK+A++AAKI+GYE VPA+ EKALLQAVA+QPVSVAI+G++FDFQFY  
Sbjct  220   PYKGEDGVCNKKKSALSAAKIAGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSS  279

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C  +LNHAVTA+GYG   DG+KYW+IKNSWG+ WG+SGYMRI RD  +KEGLCG
Sbjct  280   GVFSGSCSTWLNHAVTAVGYGATTDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCG  339

Query  482   LARDATYPV  456
             LA DA+YP 
Sbjct  340   LAMDASYPT  348



>ref|XP_009608954.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=349

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EGL Q+KTG+L+ LSEQELVDCDV GED GC GGL++ AF FI+ NKGLTTE NY
Sbjct  160   AVAAMEGLHQLKTGELIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEVNY  219

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DGVCN KK+A++AAKI+GYE VPA+ EKALLQAVA+QPVSVAI+G++FDFQFY  
Sbjct  220   PYKGEDGVCNKKKSALSAAKITGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSS  279

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C  +LNHAVTA+GYG   DG+KYW+IKNSWG+ WG+SGYMRI RD  +KEGLCG
Sbjct  280   GVFSGSCSTWLNHAVTAVGYGATTDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCG  339

Query  482   LARDATYPV  456
             LA DA+YP 
Sbjct  340   LAMDASYPT  348



>gb|AAW78661.2| senescence-specific cysteine protease [Nicotiana tabacum]
Length=349

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EGL Q+KTG+L+ LSEQELVDCDV GED GC GGL++ AF FI+ NKGLTTE NY
Sbjct  160   AVAAMEGLHQLKTGELIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEVNY  219

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DGVCN KK+A++AAKI+GYE VPA+ EKALLQAVA+QPVSVAI+G++FDFQFY  
Sbjct  220   PYKGEDGVCNKKKSALSAAKITGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSS  279

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C  +LNHAVTA+GYG   DG+KYW+IKNSWG+ WG+SGYMRI RD  +KEGLCG
Sbjct  280   GVFSGSCSTWLNHAVTAVGYGATTDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCG  339

Query  482   LARDATYPV  456
             LA DA+YP 
Sbjct  340   LAMDASYPT  348



>ref|XP_004233054.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=351

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EGL Q+KTGKL+ LSEQELVDCDV GED+GC GGL++ AF FII NKGLTTE NY
Sbjct  162   AVAAMEGLHQLKTGKLIPLSEQELVDCDVEGEDLGCTGGLLDTAFQFIIKNKGLTTEANY  221

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DGVCN KK+A++ AKI+GYE VPA++EKALLQAVA+QPVSVAI+G++FDFQFY  
Sbjct  222   PYQAADGVCNKKKSALSVAKITGYEDVPANNEKALLQAVANQPVSVAIDGSSFDFQFYSS  281

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C  +LNHAVTA+GYG A DG+KYW+IKNSWG+ WGE+GY  + RD   K+GLCG
Sbjct  282   GVFSGSCSTWLNHAVTAVGYGAASDGTKYWIIKNSWGSKWGENGYAHMKRDIDDKKGLCG  341

Query  482   LARDATYPV  456
             LA  A+YP 
Sbjct  342   LAMKASYPT  350



>ref|XP_008780365.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  1010  VEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYPYSA  831
             +EG+T++KTGKL+SLSEQELVDCDV+ +D GC+GGLM+NAF FII+N GLTTETNYPY  
Sbjct  1     MEGITKLKTGKLISLSEQELVDCDVASDDQGCDGGLMDNAFKFIINNHGLTTETNYPYKG  60

Query  830   QDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEGVFD  651
              DG CN+KK+A  AA I GYE VPA+ E ALL+AVA+QPVSVAI  + +DFQFY  GVF+
Sbjct  61    IDGTCNSKKSASHAASIKGYEDVPANSEAALLKAVANQPVSVAIEASGYDFQFYSSGVFN  120

Query  650   GDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGLARD  471
             G C+ YL+H VTA+GYGTA DG+KYWL+KNSWG+SWGE GY+R+ RD A KEGLCG+A +
Sbjct  121   GSCKTYLDHGVTAVGYGTAKDGTKYWLVKNSWGSSWGEKGYIRMERDVAAKEGLCGIAME  180

Query  470   ATYPV  456
             A+YP 
Sbjct  181   ASYPT  185



>ref|XP_006362420.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=347

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL+ LSEQELVDCDV GED+GC GGL++ AF FII NKGLTTE NY
Sbjct  158   AVAAMEGVHQVTTGKLIPLSEQELVDCDVEGEDVGCTGGLLDTAFQFIIKNKGLTTEANY  217

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DGVCN KK+AV+ AKI+GYE VPA++EKALLQAVA+QPVSVAI+G++FDFQFY  
Sbjct  218   PYEAADGVCNKKKSAVSVAKITGYEDVPANNEKALLQAVANQPVSVAIDGSSFDFQFYSS  277

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C  +LNHAVTA+GYG A DG+KYW+IKNSWG+ WGE+GY  + RD   K+GLCG
Sbjct  278   GVFSGSCSTWLNHAVTAVGYGAASDGAKYWIIKNSWGSKWGENGYAHMKRDIDDKKGLCG  337

Query  482   LARDATYPV  456
             LA  A+YP 
Sbjct  338   LAMKASYPT  346



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++KTGKL+SLSEQELVDCDV+GED GCEGGLM++AF FII N GLTTETNY
Sbjct  153   AVAAMEGITKLKTGKLISLSEQELVDCDVAGEDQGCEGGLMDDAFEFIIRNGGLTTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KK+   AA I GYE VPA+ E ALL AV++QPVSVAI  + + FQFY  
Sbjct  213   PYKGIDGTCNTKKSFSHAASIKGYEDVPANSEAALLNAVSNQPVSVAIEASGYSFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYGTA DG+KYWL+KNSWG+SWGESGY+R+ RD A KEGLCG
Sbjct  273   GVFTGSCGTDLDHGVTAVGYGTARDGTKYWLVKNSWGSSWGESGYVRMERDVAAKEGLCG  332

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  333   IAMKASYPT  341



>gb|AGT97048.1| senescence-specific cysteine protease [Capsicum annuum]
Length=347

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+E L Q+KTGKL  LSEQELVDCDV GED+GC GGL++ AF FI+ NKGLTTE NY
Sbjct  158   AVAAMESLHQLKTGKLNPLSEQELVDCDVEGEDVGCSGGLLDTAFKFIMKNKGLTTEANY  217

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DGVCN KK+AV+AAKI+GYE VPA++EKALLQAVA+QPVSVAI+G++FDFQ Y  
Sbjct  218   PYEGADGVCNKKKSAVSAAKITGYEDVPANNEKALLQAVANQPVSVAIDGSSFDFQSYSS  277

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C  +LNHAVTA+GYG   DG+KYW+IKNSWG+ WGE+GY+ + RD   +EGLCG
Sbjct  278   GVFSGSCSTWLNHAVTAVGYGATSDGTKYWIIKNSWGSKWGENGYIHMKRDIDDREGLCG  337

Query  482   LARDATYPV  456
             LA +A+YP 
Sbjct  338   LAMEASYPT  346



>ref|XP_007025397.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOY28019.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=322

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EGLTQ+K GKL+SLSEQ+LVDCD+ GED GCEGGLM+NAF FI  N+GLTTE NY
Sbjct  134   AVAAIEGLTQLKKGKLISLSEQQLVDCDIKGEDEGCEGGLMDNAFQFIKTNRGLTTEANY  193

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   +G C  K A  AA  I+GYE VPA++EKALLQAVA+QPVSVAI G+ + FQFY+ 
Sbjct  194   PYRGSEGECKNKHATPAAT-IAGYEDVPANNEKALLQAVANQPVSVAIEGSGWAFQFYES  252

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTAIGYGT+ DG+KYW++KNSWG  WGE G+MR+ RD   K+GLCG
Sbjct  253   GVFSGECGTYLDHAVTAIGYGTSSDGTKYWMVKNSWGTDWGEKGFMRLKRDVTAKQGLCG  312

Query  482   LARDATYPV  456
             +A  A+YP+
Sbjct  313   VAMKASYPI  321



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAAVEG+TQIKTGKLVSLSEQE+VDCD  GED GC GG M++AF FII+N GLTTE  Y
Sbjct  158   AVAAVEGITQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGFMDDAFEFIINNHGLTTEAKY  217

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN KKA+  AAKI+GYE VP ++EKAL++AVA+QPVSVAI+ + ++FQFY  
Sbjct  218   PYKAVDGTCNTKKASSGAAKITGYEDVPTNNEKALVKAVANQPVSVAIDASGYEFQFYSG  277

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF+GDC   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD A KEGLCG
Sbjct  278   GVFNGDCGTELDHGVTAVGYGVSSDGTKYWLVKNSWGEEWGEKGYIRMQRDVASKEGLCG  337

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  338   IAMEASYPT  346



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++K GKL+SLSEQELVDCD +G D GCEGG M+NAF FI HN GLTTE NY
Sbjct  156   AVAAMEGITKLKAGKLISLSEQELVDCDTAGGDYGCEGGFMDNAFQFIQHNGGLTTEANY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C+ +K+A++AAKISGYE VPA++E ALL+AV++QPVSVAI+   FDFQFY  
Sbjct  216   PYKQTDGTCDKRKSALSAAKISGYEDVPANNEVALLKAVSNQPVSVAIDAGGFDFQFYSS  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G+C   L+H VTA+GYGT+ DG+KYWL+KNSWG +WGE GY+R+ RD A KEGLCG
Sbjct  276   GIFTGECGTNLDHGVTAVGYGTSSDGTKYWLVKNSWGTTWGEKGYIRMKRDVASKEGLCG  335

Query  482   LARDATYPV  456
             +A  A+YP+
Sbjct  336   IAMQASYPI  344



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++KTGKL+SLSEQELVDCDV+ +D GC+GGLM+NAF FII+N+GLTTETNY
Sbjct  153   AVAAMEGITKLKTGKLMSLSEQELVDCDVASDDQGCDGGLMDNAFKFIINNRGLTTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK+A   A I GYE VPA+ E ALL+AVA+QPVSVAI  ++  FQFY  
Sbjct  213   PYKGIDGTCNSKKSASHVASIKGYEDVPANSEAALLKAVANQPVSVAIEASSGSFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   L+H VT +GYGT  DG+KYWL+KNSWG+SWGE GY+R+ RD A KEGLCG
Sbjct  273   GIFTGSCGTDLDHGVTTVGYGTTKDGTKYWLVKNSWGSSWGEKGYIRMERDVAAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++KTGKL+SLSEQ+LVDCDV G D GC GGLM+NAF FI+ N GLT+E  Y
Sbjct  150   AVAAIEGIIKLKTGKLISLSEQQLVDCDVKGVDQGCGGGLMDNAFQFILRNGGLTSEATY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C +KK A   AKI+GYE VP ++E ALLQAVA QPVSVA+ G  +DFQFY+ 
Sbjct  210   PYQGVDGTCKSKKTASIEAKITGYEDVPVNNENALLQAVAKQPVSVAVEGGGYDFQFYKS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC  YL+HAVTAIGYGT  DG+ YWL+KNSWG SWGESGYMR+ R    +EGLCG
Sbjct  270   GVFKGDCGTYLDHAVTAIGYGTNSDGTNYWLVKNSWGTSWGESGYMRMQRGIGAREGLCG  329

Query  482   LARDATYPV  456
             +A DA+YP 
Sbjct  330   VAMDASYPT  338



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++KTG L+SLSEQELVDCDV+GED GC+GG M+ AF +I+ N GLT+E NY
Sbjct  122   AVAAMEGITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGGLTSEANY  181

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DG+C+ KK A + AKI+GYE VP++ EKALLQAVA+QPVSVAI+ + +DF+FY  
Sbjct  182   PYQGEDGICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASGYDFRFYSS  241

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   LNHAVT IGYG++ DG+KYWL+KNSWG  WGE+GYMR+ R+ +  EGLCG
Sbjct  242   GVFKGDCPTDLNHAVTVIGYGSSSDGTKYWLLKNSWGTGWGENGYMRMQREISANEGLCG  301

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  302   IAMKASYPT  310



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   261 bits (667),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+KTGKL+SLSEQELVDCD++GED GC GG M+NAF FII NKGLTTE+NY
Sbjct  149   AVAAMEGINQLKTGKLISLSEQELVDCDINGEDQGCNGGFMDNAFEFIISNKGLTTESNY  208

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KKAA  AA+I+ +E VP++ E ALL+AVA+QPVSVAI+    DFQ Y+ 
Sbjct  209   PYEGVDGSCNKKKAANHAAQITSFEDVPSNSEAALLKAVANQPVSVAIDAGGSDFQHYKS  268

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G+C  +L+H VTA+GYGTA DG+KYWL+KNSWG SWGE GY+R+ RD   +EGLCG
Sbjct  269   GIFTGECSTFLDHGVTAVGYGTADDGTKYWLVKNSWGTSWGEDGYIRMQRDIDAEEGLCG  328

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  329   IAMEASYPT  337



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++KTGKL+SL+EQ+LVDCDV G D GC GGLM+NAF FI+ N GLT+E  Y
Sbjct  150   AVAAIEGIIKLKTGKLISLTEQQLVDCDVEGLDQGCGGGLMDNAFQFILRNGGLTSEATY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C +KK A   AKI+GYE VP ++E ALLQAVA QPVSVA+ G  +DFQFY+ 
Sbjct  210   PYQGVDGTCKSKKTASIEAKITGYEDVPVNNENALLQAVAKQPVSVAVEGGGYDFQFYKS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC  YL+HAVTAIGYGT  DG+ YWL+KNSWG SWGESGYMR+ R    +EGLCG
Sbjct  270   GVFKGDCGTYLDHAVTAIGYGTNSDGTNYWLVKNSWGTSWGESGYMRMQRGIGAREGLCG  329

Query  482   LARDATYPV  456
             +A DA+YP 
Sbjct  330   VAMDASYPT  338



>ref|XP_006449486.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
 gb|ESR62726.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
Length=312

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ QI T KL SLSEQELVDCD SGED GCEGGLM++AF FII+NKGL TE  Y
Sbjct  123   AVAAMEGINQITTRKLTSLSEQELVDCDTSGEDQGCEGGLMDDAFEFIINNKGLATEAKY  182

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN K+A  +AAKISGYE VP+++E AL++AVA+QPVSVAI+ +  DFQFY  
Sbjct  183   PYKASDGSCNKKEANPSAAKISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQFYSS  242

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYGTA DG+KYWL+KNSWG +WGE+GY+R+ RD   KEGLCG
Sbjct  243   GVFTGQCGTELDHGVTAVGYGTADDGTKYWLVKNSWGTTWGENGYIRMQRDIDAKEGLCG  302

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  303   IAMQASYPT  311



>emb|CDP18637.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+KTGKL+SLSEQELVDCD +GED GC GGLM++AF+FII+N GLTTE NY
Sbjct  54    AVAAMEGIHQLKTGKLISLSEQELVDCDTAGEDEGCNGGLMDDAFTFIINNNGLTTEANY  113

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN+ K A  AAKI+GYE VPA++E ALL+AVA+QPVSVAI+ +   FQFY  
Sbjct  114   PYQAVDGTCNSNKEANHAAKITGYEDVPANNEAALLKAVANQPVSVAIDASGNGFQFYSS  173

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYGT+ DG+KYWL+KNSWG  WGE GY+ + RD   KEGLCG
Sbjct  174   GVFAGDCGTELDHGVTAVGYGTSSDGTKYWLVKNSWGTGWGEKGYILMQRDIEAKEGLCG  233

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  234   IAMQASYPT  242



>ref|XP_008780330.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -3

Query  1010  VEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYPYSA  831
             +EG+T++KTG L+SLSEQELVDCDV+GED GCEGGLM++AF FII   GLTTETNYPY  
Sbjct  1     MEGITKLKTGNLISLSEQELVDCDVAGEDQGCEGGLMDDAFKFIIRTGGLTTETNYPYKG  60

Query  830   QDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEGVFD  651
              DG CN KK+   AA I GYE VPA+ E ALL+AV +QPVSVAI  +   FQFY  G+F 
Sbjct  61    IDGTCNNKKSPSHAASIKGYEDVPANSEAALLKAVTNQPVSVAIEASGSSFQFYSSGIFT  120

Query  650   GDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGLARD  471
             G C   L+H VTA+GYGTA DG+KYWL+KNSWG+SWGE GY+R+ RD A KEGLCG+A  
Sbjct  121   GSCGTDLDHGVTAVGYGTAKDGTKYWLVKNSWGSSWGEKGYVRMERDVAAKEGLCGIAMQ  180

Query  470   ATYPVL  453
             A+YP +
Sbjct  181   ASYPTV  186



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL SLSEQELVDCDV GED GC GGLM+NAF F+  NKG+TTETNY
Sbjct  152   AVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTETNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK+ A  AAKI+G+E VPA+ E AL++AVA+QPVSVAI+   FDFQFY  
Sbjct  212   PYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG A DG+KYWL+KNSWG SWGE GY+R+ RD   K+GLCG
Sbjct  272   GVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAKQGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_009786836.1| PREDICTED: vignain-like, partial [Nicotiana sylvestris]
Length=195

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             A+AA EG+T++ TGKL+SLSEQELVDCD   ED GCEGG ME+AF F++ NKG+TTET+Y
Sbjct  6     AIAATEGITKLSTGKLISLSEQELVDCDRKSEDQGCEGGYMEDAFDFMVKNKGITTETSY  65

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN KK +   A I GYEKVP ++EKALL AVA+QP+SV+I+ + F FQFY  
Sbjct  66    PYEAADGKCNTKKESSHVADIKGYEKVPKNNEKALLNAVANQPISVSIDASDFTFQFYTS  125

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H +TA+GYG A DG+K WLIKNSWG+SWGE+GY+R+ RD   KEGLCG
Sbjct  126   GVFTGTCGMELDHGITAVGYGKAEDGTKCWLIKNSWGSSWGENGYIRMERDIDAKEGLCG  185

Query  482   LARDATYPV  456
             +A DA+YP 
Sbjct  186   IAMDASYPT  194



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+KTGKL+SLSEQELVDCD +GED GCEGGLM+ AF FI  N GL+TETNY
Sbjct  152   AVAAMEGITQLKTGKLISLSEQELVDCDTNGEDQGCEGGLMDYAFDFIQQNHGLSTETNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PYS  DG CNA K A  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+ +  DFQFY  
Sbjct  212   PYSGTDGTCNANKEANHAATITGHEDVPANSESALLKAVANQPISVAIDASGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYGTA DG+KYWL+KNSWG SWGE GY+++ R  A  EGLCG
Sbjct  272   GVFTGECGTELDHGVTAVGYGTAADGTKYWLVKNSWGTSWGEEGYIQMQRGVAAAEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+KTGKL+SLSEQELVDCD +GED GC GGLM++AF+FII+NKGLTTE NY
Sbjct  149   AVAATEGIHQLKTGKLISLSEQELVDCDTAGEDQGCNGGLMDDAFTFIINNKGLTTEANY  208

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN  K A  AAKI+G+E VPA++E ALL+AVA+QPVSVAI+ +   FQFY  
Sbjct  209   PYQAVDGTCNTNKEAKPAAKITGFEDVPANNEAALLKAVANQPVSVAIDASGSAFQFYSS  268

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG + DG+KYWL+KNSWG SWGE+GY+ + RD   KEGLCG
Sbjct  269   GVFTGDCGTELDHGVTAVGYGKSSDGTKYWLVKNSWGTSWGENGYILMQRDIDAKEGLCG  328

Query  482   LARDATYPV  456
             +A  ++YP 
Sbjct  329   IAMQSSYPT  337



>gb|ADV74756.1| cysteine protease [Lactuca sativa]
Length=363

 Score =   259 bits (663),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ +++ GKLVSLSEQELVDCD+ G D GCEGGLMENAF FI   KGL  E+ Y
Sbjct  171   AVAAMEGINKLENGKLVSLSEQELVDCDIDGIDQGCEGGLMENAFQFIEKRKGLAAESVY  230

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+ +DG+CN KKAA+ AAKISG+EKVPA++EKALLQAVA+QPVS+AI+ + ++FQFY  
Sbjct  231   PYTGEDGICNTKKAAIPAAKISGHEKVPANNEKALLQAVANQPVSIAIDASGYEFQFYSG  290

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+HA+TA+GYG   DG+KYWL+KNSWG SWGE+GY+RI RD   KEGLCG
Sbjct  291   GVFTGSCGTELDHAITAVGYGATMDGTKYWLMKNSWGASWGENGYIRIKRDSLAKEGLCG  350

Query  482   LARDATYPVL  453
             +A D +YPV+
Sbjct  351   IAMDPSYPVV  360



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ TGKL+SLSEQEL+DCD  GED GCEGGLM++AF FI++NKGLTTE  Y
Sbjct  152   AVAATEGITKLSTGKLISLSEQELIDCDTKGEDQGCEGGLMDDAFKFILNNKGLTTEATY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK  +  AA I GYE VPA+ E ALL+AVA+QPVSVAI+ + ++FQFY  
Sbjct  212   PYEGIDGTCNAKAESSHAASIKGYEDVPANSESALLKAVANQPVSVAIDASGYEFQFYAG  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF+G C+  L+H VTA+GYG + DGSKYWL+KNSWG  WGE GY+R+ RD + KEGLCG
Sbjct  272   GVFNGSCDTNLDHGVTAVGYGVSDDGSKYWLVKNSWGVKWGEKGYIRMQRDVSAKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMLASYPT  340



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+  I T KL SLSEQELVDCD SGED GCEGGLM++AF FII NKGL TE  Y
Sbjct  157   AVAAMEGINHITTRKLTSLSEQELVDCDTSGEDQGCEGGLMDDAFEFIISNKGLATEAKY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN K+A  +AAKISGYE VP+++E AL++AVA+QPVSVAI+ +  DFQFY  
Sbjct  217   PYKASDGSCNKKEANPSAAKISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYGTA DG+KYWL+KNSWG +WGE+GY+R+ RD   KEGLCG
Sbjct  277   GVFTGQCGTELDHGVTAVGYGTADDGTKYWLVKNSWGTTWGENGYIRMQRDIDAKEGLCG  336

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  337   IAMQASYPT  345



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AV A+EG  Q+ TGKL+SLSEQELVDCD SGED GCEGG M+NAF FII N GLTTETNY
Sbjct  153   AVGAMEGNNQLTTGKLISLSEQELVDCDTSGEDQGCEGGFMDNAFEFIIGNHGLTTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CNA+K A +AAKI+GYE VPA+ E ALL+AVA QPVSVAI+     FQFY  
Sbjct  213   PYQAVDGTCNARKEASSAAKITGYEDVPANSESALLKAVAHQPVSVAIDAGESAFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G+C   L+H VTA+GYGT+ DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  273   GIFTGECGTNLDHGVTAVGYGTSEDGTKYWLVKNSWGTGWGEEGYIRMKRDIDAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>gb|KDP38777.1| hypothetical protein JCGZ_05113 [Jatropha curcas]
Length=222

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SGED GCEGGLM++AF FI  N GLTTE NY
Sbjct  33    AVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFGFIKKNGGLTTEANY  92

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CN KKAA  AAKI+GYE VPA+ E+ALL+AVA+QPVSVAI+ +   FQFY  
Sbjct  93    PYQGTDDTCNTKKAADKAAKINGYEDVPANSEQALLKAVANQPVSVAIDASGSAFQFYSG  152

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYGT+ DG+KYWL+KNSWG SWGE+GY+R+ RD   KEGLCG
Sbjct  153   GVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSWGTSWGENGYIRMERDIDAKEGLCG  212

Query  482   LARDATYPV  456
             +A + +YP 
Sbjct  213   IAMEPSYPT  221



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA EG+ Q+ TGKLVSLSEQELVDCD  GED GCEGGLME+ F FII N G+TTE NYP
Sbjct  154   VAATEGINQLTTGKLVSLSEQELVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITTEANYP  213

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y A DG CN++K A   AKI+GYE VPA+ E ALL+AVASQP+SV+I+    DFQFY  G
Sbjct  214   YQAADGTCNSRKEASRIAKITGYESVPANSEAALLKAVASQPISVSIDAGGSDFQFYSSG  273

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   +EGLCG+
Sbjct  274   VFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNSWGTSWGEEGYIRMQRDTEAEEGLCGI  333

Query  479   ARDATYPV  456
             A D++YP 
Sbjct  334   AMDSSYPT  341



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL SLSEQELVDCDV GED GC GGLM+NAF F+  NKG+TTETNY
Sbjct  152   AVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTETNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK+ A  AAKI+G+E VPA+ E AL++AVA+QPVSVAI+    DFQFY  
Sbjct  212   PYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG A DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  272   GVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SGED GCEGGLM++AF FI  N GLTTE NY
Sbjct  153   AVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTTEANY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  KA   AAKI+GYE VPA+ E ALL+AVASQPVSVAI+ +   FQFY  
Sbjct  213   PYQGTDGTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQFYSG  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYGT+ DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  273   GVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSWGTSWGEDGYIRMERDIEAKEGLCG  332

Query  482   LARDATYPV  456
             +A   +YP 
Sbjct  333   IAMQPSYPT  341



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELV CD SG D GCEGG ME+AF FIIHN G+TTE NY
Sbjct  135   AVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEANY  194

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN    A   AKI GYE VPA+ E+ALL+AVA+QPV+V+I+ +   FQFY  
Sbjct  195   PYQAVDGTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQFYSS  254

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG   +G+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  255   GVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSWGTSWGEEGYIRMKRDIDAKEGLCG  314

Query  482   LARDATYPV  456
             +A D++YP 
Sbjct  315   IAMDSSYPT  323



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCD SGED GC GGLM++AF FI  N GLTTE NY
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA++EKAL +AVA QP++VAI+   F+FQFY  
Sbjct  212   PYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDAGGFEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H V+A+GYGT+ DG KYWL+KNSWG  WGE GY+R+ RD  +KEGLCG
Sbjct  272   GVFTGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSWGTGWGEEGYIRMQRDVTEKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AV A+EG  Q+ TGKL+SLSEQELVDCD SGED GCEGG M+NAF FII N GLTTETNY
Sbjct  153   AVGAMEGNNQLTTGKLISLSEQELVDCDTSGEDQGCEGGFMDNAFEFIIGNHGLTTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CNA+K A +AAKI+GYE VPA+ E ALL+AVA QPVSVAI+     FQFY  
Sbjct  213   PYQAVDGTCNARKEASSAAKINGYEDVPANSESALLKAVAHQPVSVAIDAGESAFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G+C   L+H VTA+GYGT+ DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  273   GIFTGECGTNLDHGVTAVGYGTSEDGTKYWLVKNSWGTGWGEEGYIRMKRDIDAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELV CD SG D GCEGG ME+AF FIIHN G+TTE NY
Sbjct  154   AVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEANY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN  K A   AKI GYE VPA+ E+ALL+AVA+QPV+V+I+ +   FQFY  
Sbjct  214   PYQAADGTCNKTKEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQFYSS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG   +G+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  274   GVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSWGTSWGEEGYIRMKRDIDAKEGLCG  333

Query  482   LARDATYPV  456
             +A D++YP 
Sbjct  334   IAMDSSYPT  342



>ref|XP_010494742.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=346

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG  QIK GKL+SLSEQ+LVDCD +  D GCEGGLM+ AF  I    GLTTE+NY
Sbjct  159   AVAAIEGAAQIKKGKLISLSEQQLVDCDTN--DFGCEGGLMDTAFEHIKVTGGLTTESNY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DG CN+KK    A  I+GYE VPA+DE AL++AVA QPVSV I G  FDFQFY  
Sbjct  217   PYKGEDGTCNSKKTNPKATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTAIGYG + +GSKYW+IKNSWG  WGESGYMRI +D   KEGLCG
Sbjct  277   GVFTGECTTYLDHAVTAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKAKEGLCG  336

Query  482   LARDATYPVL  453
             LA  A+YP L
Sbjct  337   LAMKASYPTL  346



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL SLSEQELVDCDV GED GC GGLM+NAF F+  NKG+TTETNY
Sbjct  152   AVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTETNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK+ A  AAKI+G+E VPA+ E AL+ AVA+QPVSVAI+    DFQFY  
Sbjct  212   PYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMNAVANQPVSVAIDAGGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG A DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  272   GVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_002865220.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41479.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG TQIK GKL+SLSEQ+LVDCD +  D GCEGGLM+ AF  I+   GLTTE+NY
Sbjct  159   AVAAIEGATQIKKGKLISLSEQQLVDCDTN--DFGCEGGLMDTAFEHIMATGGLTTESNY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +D  CN+KK    A  I+GYE VP +DE+AL++AVA QPVSV I G  FDFQFY  
Sbjct  217   PYKGEDATCNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTAIGYG + +GSKYW+IKNSWG  WGESGYMRI +D   K+GLCG
Sbjct  277   GVFTGECTTYLDHAVTAIGYGQSTNGSKYWIIKNSWGTKWGESGYMRIQKDIKDKQGLCG  336

Query  482   LARDATYPVL  453
             LA  A+YP +
Sbjct  337   LAMKASYPTI  346



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQI TGKL+SLSEQELVDCD  G D GCEGGLM+ AF FII+N GLTTE+NY
Sbjct  155   AVAAIEGITQISTGKLISLSEQELVDCDTKGIDHGCEGGLMDTAFEFIINNGGLTTESNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DG CN  K    A  I+GYE VPA+DE+AL++AVA QPVSVAI     DFQFY  
Sbjct  215   PYKGEDGTCNFNKTNPIAVSITGYEDVPANDEQALMKAVAHQPVSVAIEAGGSDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+HAVTA+GYG + DGSKYW++KNSWG  WGESGY+ + +D   K+GLCG
Sbjct  275   GVFTGECGTELDHAVTAVGYGESEDGSKYWIVKNSWGTKWGESGYIEMQKDIKVKQGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMQASYPT  343



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELV CD SG D GCEGG ME+AF FIIHN G+TTE NY
Sbjct  154   AVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEANY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN    A   AKI GYE VPA+ E+ALL+AVA+QPV+V+I+ +   FQFY  
Sbjct  214   PYQAVDGTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQFYSS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG   +G+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  274   GVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSWGTSWGEEGYIRMKRDIDAKEGLCG  333

Query  482   LARDATYPV  456
             +A D++YP 
Sbjct  334   IAMDSSYPT  342



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             A+AA EG+T++ TGKL+SLSEQEL+DCD + ED GCEGG ME+AF FI+ NKGLTTET Y
Sbjct  145   AIAATEGITKLSTGKLISLSEQELMDCDRNSEDQGCEGGYMEDAFEFIVKNKGLTTETTY  204

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A D  CN KK +   A I GYEKVP  +EKALL AVA+QP+SV+I+ + F FQFY  
Sbjct  205   PYKAADEKCNTKKESSHVADIKGYEKVPKYNEKALLNAVANQPISVSIDASDFSFQFYTS  264

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG A DG+KYWLIKNSWG+SWGE+GY+R+ RD   KEGLCG
Sbjct  265   GVFTGTCGTELDHGVTAVGYGKAEDGTKYWLIKNSWGSSWGENGYIRMERDIDAKEGLCG  324

Query  482   LARDATYPV  456
             +A DA+YP 
Sbjct  325   IAMDASYPT  333



>gb|KFK31512.1| hypothetical protein AALP_AA6G122300 [Arabis alpina]
Length=342

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG TQIK GKL+SLSEQ+LVDCD++  D GC GGLM+ AF  II   GLTTE+NY
Sbjct  155   AVAAIEGATQIKKGKLISLSEQQLVDCDIN--DYGCRGGLMDTAFEHIIATGGLTTESNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DG CN+KK    A  ISGYE VP +DEKAL++AVA QPVSV I G  FDFQFY  
Sbjct  213   PYKGEDGTCNSKKTNPKATSISGYEDVPVNDEKALMKAVAYQPVSVGIEGGGFDFQFYST  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+HAVTA+GYG + +GSKYW+IKNSWG  WGESGYMRI +D   K+GLCG
Sbjct  273   GVFTGECTTSLDHAVTAVGYGESANGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCG  332

Query  482   LARDATYPVL  453
             LA  A+YP +
Sbjct  333   LAMKASYPTI  342



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL SLSEQELVDCDV GED GC GGLM+NAF F+  NKG+TTE NY
Sbjct  152   AVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTEINY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK+ A  AAKI+G+E VPA+ E AL++AVA+QPVSVAI+   FDFQFY  
Sbjct  212   PYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG A DG+KYWL+KNSWG +WGE GY+R+ RD   K+GLCG
Sbjct  272   GVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWGATWGEEGYIRMQRDIDAKQGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   255 bits (652),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD SGED GCEGGLM++AF FI  N GL+ E NY
Sbjct  137   AVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSAEANY  196

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA+ EKALL AVA QPVSVAI+    DFQFY  
Sbjct  197   PYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYSS  256

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  257   GVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCG  316

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  317   IAMEASYPT  325



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N G++TETNY
Sbjct  144   AVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNY  203

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  204   PYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  263

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  264   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAPEGLCG  323

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  324   IAMSASYPT  332



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             A+AA EG+ QI TGKL+SLSEQE+VDCD + +D GCEGG ME+AF FII NKG+ +E+ Y
Sbjct  151   AIAATEGINQISTGKLISLSEQEIVDCDKTSQDQGCEGGYMEDAFEFIIDNKGIASESTY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PYSA DG CN K+ +  AAKI+ YEKVP ++EKALL+AVA QPVSV+I+    +FQFY  
Sbjct  211   PYSATDGTCNKKEESPIAAKITSYEKVPENNEKALLKAVAKQPVSVSIDAGGMEFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+ + RD A KEGLCG
Sbjct  271   GVFTGDCGTDLDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGEEGYIMMERDVAAKEGLCG  330

Query  482   LARDATYPV  456
             +A D++YP+
Sbjct  331   IAMDSSYPI  339



>ref|XP_010441658.1| PREDICTED: senescence-specific cysteine protease SAG12 [Camelina 
sativa]
Length=346

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG  QIK GKL+SLSEQ+LVDCD +  D GC+GGLM+ AF  I    GLTTE+NY
Sbjct  159   AVAAIEGAAQIKKGKLISLSEQQLVDCDTN--DFGCDGGLMDTAFEHIKATGGLTTESNY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DG CN+KK    A  I+GYE VPA+DE AL++AVA QPVSV I G  FDFQFY  
Sbjct  217   PYKGEDGTCNSKKTNPKATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTAIGYG + +GSKYW+IKNSWG  WGESGYMRI +D   KEGLCG
Sbjct  277   GVFTGECTTYLDHAVTAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKAKEGLCG  336

Query  482   LARDATYPVL  453
             LA  A+YP L
Sbjct  337   LAMKASYPTL  346



>ref|XP_007216164.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
 gb|EMJ17363.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
Length=196

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N GL TE NY
Sbjct  7     AVAATEGITQLTTGKLISLSEQELVDCDTNGEDQGCEGGLMDDAFQFIQQNHGLGTEANY  66

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PYS  DG CN KK A  AAKI+GYE VP + E+ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  67    PYSGVDGTCNTKKEASIAAKITGYEDVPTNSEQALLKAVANQPVSVAIDASGSDFQFYSS  126

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+K+WL+KNSWG  WGE GY+R+ RD    EGLCG
Sbjct  127   GVFTGTCGTSLDHGVTAVGYGVGDDGTKFWLVKNSWGTEWGEEGYIRMQRDVDAAEGLCG  186

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  187   IAMSASYPT  195



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKLVSLSEQELVDCD  G D GCEGGLM++AF FI  N GL+TE NY
Sbjct  156   AVAATEGITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+DEKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  216   PYNGVDGTCNTKKEANIAAKITGHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSS  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  276   GVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCG  335

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  336   IAMEASYPT  344



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKLVSLSEQELVDCD  G D GCEGGLM++AF FI  N GL+TE NY
Sbjct  156   AVAATEGITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+DEKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  216   PYNGVDGTCNTKKEANIAAKITGHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSS  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  276   GVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCG  335

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  336   IAMEASYPT  344



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD SG D GCEGGLM++AF FI  N GL+TE NY
Sbjct  137   AVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQNHGLSTEANY  196

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA+ EKALL AVA QPVSVAI+    DFQFY  
Sbjct  197   PYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYSS  256

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  257   GVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCG  316

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  317   IAMEASYPT  325



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EGL Q+KTGKL+SLSEQELVDCD S ED GC GGLM+NAF FII N GLTTE+NY
Sbjct  137   AVAATEGLNQLKTGKLISLSEQELVDCDTS-EDQGCNGGLMDNAFEFIISNNGLTTESNY  195

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK +   AKI+GYE VPA+ E ALL+AVA+QP+SVAI+ +  DFQFY  
Sbjct  196   PYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFYSG  255

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG+SWGE+GY+R+ RD    EGLCG
Sbjct  256   GVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAEGLCG  315

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  316   IAMQASYPT  324



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 3/189 (2%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD SGED GC GGLM++AF FII NKGLTTE NY
Sbjct  176   AVAATEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGLMDDAFDFIIQNKGLTTEANY  235

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+ KAA     I+GYE VPA+ E ALL+AVA+QPVSVAI+     FQFY  
Sbjct  236   PYQGADGACNSGKAAAK---ITGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQFYSS  292

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG + DG+KYWL+KNSWG SWGE+GY+R+ RD   +EGLCG
Sbjct  293   GVFTGDCGTDLDHGVTAVGYGMSDDGTKYWLVKNSWGTSWGENGYIRMERDIDAQEGLCG  352

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  353   IAMEASYPT  361



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TG L+SLSEQELVDCDV G D GCEGGLM++AFSFII+NKGLTTE+NY
Sbjct  150   AVAAMEGITKLSTGNLISLSEQELVDCDVKGTDQGCEGGLMDDAFSFIINNKGLTTESNY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C   K++ +AAKISGYE VPA+ E AL +AVA+QPVSVAI+    DFQFY  
Sbjct  210   PYQGTDGSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG A DGSKYWL+KNSWG SWGE GY+R+ +D   KEGLCG
Sbjct  270   GVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCG  329

Query  482   LARDATYP  459
             +A  ++YP
Sbjct  330   IAMQSSYP  337



>ref|XP_010481519.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=342

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG  QIK GKL+SLSEQ+LVDCD +  + GCEGGLM+ AF  I    GLTTE+NY
Sbjct  155   AVAAIEGAAQIKKGKLISLSEQQLVDCDTN--NFGCEGGLMDTAFEHIKATGGLTTESNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +DG CN+KK    A  I+GYE VPA+DE AL++AVA QPVSV I G  FDFQFY  
Sbjct  213   PYKGEDGSCNSKKTNPKATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTAIGYG + +GSKYW+IKNSWG  WGESGYMRI +D   KEGLCG
Sbjct  273   GVFTGECTTYLDHAVTAIGYGESTNGSKYWIIKNSWGKKWGESGYMRIQKDVKAKEGLCG  332

Query  482   LARDATYPVL  453
             LA  A+YP L
Sbjct  333   LAMKASYPTL  342



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD SGED GCEGGLM++AF FI  N GL+ E NY
Sbjct  150   AVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSAEANY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA+ EKALL AVA QPVSVAI+    DFQFY  
Sbjct  210   PYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYSS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  270   GVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCG  329

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  330   IAMEASYPT  338



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N G++TETNY
Sbjct  155   AVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  215   PYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  275   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAPEGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMSASYPT  343



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 3/189 (2%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD SGED GC GG M++AF FII NKGLTTE NY
Sbjct  176   AVAATEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGFMDDAFEFIIQNKGLTTEANY  235

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+ KAA     I+GYE VPA+ E ALL+AVA+QPVSVAI+     FQFY  
Sbjct  236   PYQGADGTCNSGKAAAK---ITGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQFYSS  292

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG + DG+KYWL+KNSWG SWGE+GY+R+ RD   KEGLCG
Sbjct  293   GVFTGDCGTDLDHGVTAVGYGMSDDGTKYWLVKNSWGTSWGENGYIRMERDIDAKEGLCG  352

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  353   IAMEASYPT  361



>ref|XP_008362418.1| PREDICTED: vignain-like [Malus domestica]
Length=198

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQ LVDCD +GED GCEGGLM++AF F   N G++TE NY
Sbjct  9     AVAATEGITQLTTGKLISLSEQXLVDCDTAGEDQGCEGGLMDBAFQFXQQNHGISTEXNY  68

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  69    PYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  128

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  129   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  188

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  189   IAMSASYPT  197



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD SGED GCEGGLM++AF FI  N GL+TE NY
Sbjct  150   AVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSTEANY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA+ EKALL AVA QPVSVAI+    DFQFY  
Sbjct  210   PYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYSS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+K+WL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  270   GVFTGACGTSLDHGVTAVGYGVSDDGTKFWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCG  329

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  330   IAMEASYPT  338



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SGED GCEGGLM++AF FI  N GLTTE NY
Sbjct  153   AVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTTEANY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  KA   AAKI+GYE VPA+ E ALL+AVASQPVSVAI+ +   FQFY  
Sbjct  213   PYQGTDGTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQFYSG  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYGT+ DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  273   GVFTGDCGTELDHGVTAVGYGTS-DGTKYWLVKNSWGTSWGEDGYIRMERDIEAKEGLCG  331

Query  482   LARDATYPV  456
             +A  ++YP 
Sbjct  332   IAMQSSYPT  340



>ref|XP_008780633.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -3

Query  1010  VEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYPYSA  831
             +EG+T++ TGKL+SLSEQELVDCD  GED GC GGLM++AF FII N GLTTE NYPY A
Sbjct  1     MEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTEANYPYEA  60

Query  830   QDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEGVFD  651
              DG CN  K+   AA I GYE VPA+ E ALL+AVA+QPVSVAI+   F FQ Y  GVF 
Sbjct  61    TDGTCNTGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGFAFQLYSSGVFT  120

Query  650   GDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGLARD  471
             GDC   L+H VTA+GY    DG+KYWL+KNSWG+SWGE+GY+R+ RD   KEGLCG+A +
Sbjct  121   GDCGTDLDHGVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIRMQRDVDAKEGLCGIAME  180

Query  470   ATYPV  456
             A+YP 
Sbjct  181   ASYPT  185



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCD SGED GC GGLM++AF FI  N GLTTE NY
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGLMDDAFKFIKQNHGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA++EKAL +AV  QP++VAI+   F+FQFY  
Sbjct  212   PYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKAVVHQPIAVAIDAGGFEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H V A+GYGT+ DG KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  272   GVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA EG+ Q+ TGKLVSLSEQELVDCD  GED GCEGGLME+ F FII N G+T+E NYP
Sbjct  154   VAATEGINQLTTGKLVSLSEQELVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITSEANYP  213

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y A DG CN+KK A   AKI+GYE VPA+ E ALL+AVA+QP+SV+I+    DFQFY  G
Sbjct  214   YQAADGTCNSKKEASHIAKITGYESVPANSEAALLKAVANQPISVSIDAGGSDFQFYSSG  273

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   +EGLCG+
Sbjct  274   VFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNSWGTSWGEEGYIRMQRDVDAEEGLCGI  333

Query  479   ARDATYPV  456
             A D++YP 
Sbjct  334   AMDSSYPT  341



>ref|NP_568651.1| cysteine protease SAG12 [Arabidopsis thaliana]
 sp|Q9FJ47.1|SAG12_ARATH RecName: Full=Senescence-specific cysteine protease SAG12; AltName: 
Full=Cysteine proteinase SAG12; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK43946.1|AF370131_1 putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 dbj|BAB09317.1| senescence-specific cysteine protease [Arabidopsis thaliana]
 gb|AAK64131.1| putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 gb|AED95312.1| cysteine protease [Arabidopsis thaliana]
Length=346

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG TQIK GKL+SLSEQ+LVDCD +  D GCEGGLM+ AF  I    GLTTE+NY
Sbjct  159   AVAAIEGATQIKKGKLISLSEQQLVDCDTN--DFGCEGGLMDTAFEHIKATGGLTTESNY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +D  CN+KK    A  I+GYE VP +DE+AL++AVA QPVSV I G  FDFQFY  
Sbjct  217   PYKGEDATCNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTAIGYG + +GSKYW+IKNSWG  WGESGYMRI +D   K+GLCG
Sbjct  277   GVFTGECTTYLDHAVTAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCG  336

Query  482   LARDATYPVL  453
             LA  A+YP +
Sbjct  337   LAMKASYPTI  346



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TG+L+SLSEQELVDCD +GED GCEGGLM++AF FI  N G++TETNY
Sbjct  155   AVAATEGVTQLTTGRLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  215   PYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD A  EGLCG
Sbjct  275   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGXEWGEXGYIRMQRDVAAAEGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMSASYPT  343



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N+G++TE NY
Sbjct  154   AVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGISTEANY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAKK A  AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  214   PYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  274   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMAASYPT  342



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD SG D GCEGGLM++AF FI  N GL+TE NY
Sbjct  150   AVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQNHGLSTEANY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA+ EKALL AVA QPVSVAI+    DFQFY  
Sbjct  210   PYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYSS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  270   GVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVEAKEGLCG  329

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  330   IAMEASYPT  338



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N+G++TE NY
Sbjct  154   AVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGISTEANY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAKK A  AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  214   PYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  274   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGTEWGEAGYIRMQRDVAAGEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMAASYPT  342



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TG L+SLSEQELVDCDV G D GCEGGLM++AFSFII+NKGLTTE+NY
Sbjct  152   AVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFSFIINNKGLTTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C   K++ +AAKISGYE VPA+ E AL +AVA+QPVSVAI+    DFQFY  
Sbjct  212   PYQGTDGSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG A DGSKYWL+KNSWG SWGE GY+R+ +D   KEGLCG
Sbjct  272   GVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCG  331

Query  482   LARDATYP  459
             +A  ++YP
Sbjct  332   IAMQSSYP  339



>ref|XP_010052197.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76117.1| hypothetical protein EUGRSUZ_D00494 [Eucalyptus grandis]
Length=369

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T +K GKLVSLSEQELVDCDV+G + GCEGGLM++AF FI    GLT+E NY
Sbjct  180   AVAAMEGITMLKKGKLVSLSEQELVDCDVNGVNEGCEGGLMDSAFQFIKSKGGLTSEANY  239

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C   KAA   A I+GY+ VPA++EKALLQAVA+QPVSVAI G+ F FQFY  
Sbjct  240   PYQGNDGTCRTAKAANIVASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFSFQFYSG  299

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+HAVTA+GYGT   G+KYWL+KNSWG  WGESGYMRI RD   K GLCG
Sbjct  300   GVFTGSCGTSLDHAVTAVGYGTTSGGAKYWLLKNSWGTGWGESGYMRIRRDVTSKAGLCG  359

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  360   LAMEPSYPT  368



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 143/188 (76%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA EG+ Q+ TGKLVSLSEQELVDCD+ GED GCEGGLME+ F FII N G+TTE NYP
Sbjct  154   VAATEGINQLTTGKLVSLSEQELVDCDIQGEDQGCEGGLMEDGFEFIIKNHGITTEANYP  213

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y A DG CN+K  A   AKI+GYE VPA+ E ALL+AVA+QP+SV+I+    DFQFY  G
Sbjct  214   YQAADGTCNSKIEASRIAKITGYESVPANSEAALLKAVANQPISVSIDAGGSDFQFYSSG  273

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
              F G C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   +EGLCG+
Sbjct  274   DFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNSWGTSWGEEGYIRMQRDTEAEEGLCGI  333

Query  479   ARDATYPV  456
             A D++YP 
Sbjct  334   AMDSSYPT  341



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 143/188 (76%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA EG+ Q+ TGKLVSLSEQELVDCD  GED GCEGGLME+ F FII N G+TTE NYP
Sbjct  154   VAATEGINQLTTGKLVSLSEQELVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITTEANYP  213

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y A DG CN +K A   AKI+GYE VPA+ E  LL+AVA+QP+SV+I+    DFQFY  G
Sbjct  214   YQAADGTCNPEKRASHIAKITGYESVPANSEAELLKAVANQPISVSIDAGGSDFQFYSSG  273

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G+C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   +EGLCG+
Sbjct  274   VFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAEEGLCGI  333

Query  479   ARDATYPV  456
             A D++YP 
Sbjct  334   AMDSSYPT  341



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N G++TETNY
Sbjct  204   AVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNY  263

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  264   PYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  323

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  324   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAPEGLCG  383

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  384   IAMSASYPT  392



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA EG+ Q+ TGKLVSLSEQELVDCD  GED GCEGGLME+ F FII N G+T+E NYP
Sbjct  154   VAATEGINQLTTGKLVSLSEQELVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITSEANYP  213

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y A DG CN+KK A   AKI+GYE VPA+ E ALL+AVA+QP+SV+I+    DFQFY  G
Sbjct  214   YQAADGTCNSKKEASHIAKITGYESVPANSEAALLKAVANQPISVSIDAGGSDFQFYSSG  273

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G C   L+H VTA+GYG   DG+KYWL KNSWG SWGE+GY+R+ RD   +EGLCG+
Sbjct  274   VFTGQCGTELDHGVTAVGYGETSDGTKYWLFKNSWGTSWGEAGYIRMQRDIDAEEGLCGI  333

Query  479   ARDATYPV  456
             A D++YP 
Sbjct  334   AMDSSYPT  341



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCD SGED GC GGLM++AF FI  N GL TE NY
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCNGGLMDDAFKFIEQNHGLATEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA++EKAL +AVA QP++VAI+   F+FQFY  
Sbjct  212   PYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDAGGFEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H V A+GYGT+ DG KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  272   GVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWGTGWGEVGYIRMQRDVTAKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCD SGED GC GGLM++AF FI  N GLTTE NY
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA++EKAL +AVA QP++VAI+    +FQFY  
Sbjct  212   PYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDAGGSEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H V+A+GYGT+ DG KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  272   GVFTGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SG D GCEGGLM++AF FI  N GL+TETNY
Sbjct  149   AVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFITQNHGLSTETNY  208

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+    DFQFY  
Sbjct  209   PYTGVDGTCNTKKEASHAATITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFYSS  268

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+G+G + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  269   GVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVKNSWGAEWGEEGYIRMQRDVEAKEGLCG  328

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  329   IAMEASYPT  337



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKLVSLSEQELVDCD  G D GCEGGLM++AF FI  N GL+TE NY
Sbjct  156   AVAATEGITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+ +E VPA+DEKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  216   PYNGVDGTCNTKKEANIAAKITDHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSS  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  276   GVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCG  335

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  336   IAMEASYPT  344



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TG L+SLSEQELVDCDV G D GCEGGLM++AF+FII+NKGLTTE+NY
Sbjct  150   AVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C   K++ +AAKISGYE VPA+ E AL +AVA+QPVSVAI+    DFQFY  
Sbjct  210   PYQGTDGSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG A DGSKYWL+KNSWG SWGE GY+R+ +D   KEGLCG
Sbjct  270   GVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCG  329

Query  482   LARDATYP  459
             +A  ++YP
Sbjct  330   IAMQSSYP  337



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  152   AVAATEGINKIKTGKLISLSEQELVDCDTSS-DMGCEGGLMDDAFKFIIKNHGLTTESNY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C   K +  AAKI+ YE VPA+ E ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  211   PYEGTDGTCKTGKESSHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG A DG+KYWL+KNSWG SWGE+GY+R+ R+   +EGLCG
Sbjct  271   GVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENGYIRMQRNVDTEEGLCG  330

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  331   IAMEASYPT  339



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD  GED GC GGLM++AF FII N GLTTE NY
Sbjct  153   AVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTEANY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CNA K+   AA I GYE VPA+ E ALL+AVA+QPVSVAI+     FQ Y  
Sbjct  213   PYEAADGTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQLYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GY    DG+KYWL+KNSWG+SWGE+GY+R+ RD   KEGLCG
Sbjct  273   GVFTGDCGTELDHGVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIRMERDVDAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N GL+TE NY
Sbjct  156   AVAATEGITQLTTGKLISLSEQELVDCDTNGEDQGCEGGLMDDAFQFIQQNHGLSTEANY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PYS  DG CN KK A  AAKI+GYE VP + E+ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  216   PYSGVDGTCNTKKEASIAAKITGYEDVPTNSEQALLKAVANQPVSVAIDASGSDFQFYSS  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+K+WL+KNSWG  WGE GY+R+ RD    EGLCG
Sbjct  276   GVFTGTCGTSLDHGVTAVGYGVGDDGTKFWLVKNSWGTEWGEEGYIRMQRDVDAAEGLCG  335

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  336   IAMSASYPT  344



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL SLSEQELVDCD SGED GC GGLM++AF FII N GLTTE NY
Sbjct  175   AVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTTEANY  234

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A D  CNA+KAA  AAKISGYE VP++ E ALL+AVA QPVSVAI+    DFQFY  
Sbjct  235   PYQAVDNTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAGETDFQFYST  294

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G+C   L+H VTA+GYGT+ +G+KYWL+KNSWG  WGE GY+R+ RD    EGLCG
Sbjct  295   GIFTGECGTDLDHGVTAVGYGTSENGTKYWLVKNSWGTGWGEEGYIRMQRDIDAAEGLCG  354

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  355   IAMEASYPT  363



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N G++TE NY
Sbjct  144   AVAATEGITQLTTGKLMSLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEANY  203

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KK    AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  204   PYEGVDGTCNTKKETSHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDFQFYSS  263

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  264   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  323

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  324   IAMAASYPT  332



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQELVDCD +GED GCEGGLM++AF FI  N G++TE NY
Sbjct  155   AVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEANY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAKK A  AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  215   PYDGVDGACNAKKEASHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  275   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMAASYPT  343



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCDV+GED GCEGGLM++AF FI  N GL+TE NY
Sbjct  151   AVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDDAFEFINQNHGLSTEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CNA+K A  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+ +  DFQFY  
Sbjct  211   PYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ RD    EGLCG
Sbjct  271   GVFTGACGTSLDHGVTAVGYGVGDDGTKYWLVKNSWGAEWGEQGYIRMQRDVDAPEGLCG  330

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  331   IAMEASYPT  339



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD  GED GC+GGLM++AF FI +NKGLTTE++Y
Sbjct  154   AVAAMEGVTKLTTGKLISLSEQELVDCDTKGEDQGCQGGLMDDAFQFIQNNKGLTTESDY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  K A  AAKI+G+E VPA+ E AL +AVA+QPVSVAI+   F FQFY  
Sbjct  214   PYKGVDGTCNTNKEANHAAKINGFEDVPANSEDALQKAVANQPVSVAIDAGGFKFQFYSG  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  274   GVFTGDCGTALDHGVTAVGYGVDDDGTKYWLVKNSWGTSWGEEGYIRMQRDVDAKEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMQASYPT  342



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF+FII N GLTTE+NY
Sbjct  152   AVAATEGINKIKTGKLISLSEQELVDCDTS-SDMGCEGGLMDDAFTFIIKNHGLTTESNY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C  +K +   AKI+GYE VPA+ E ALL AVA+QPVSVAI+ +  DFQFY  
Sbjct  211   PYEGTDGTCKTRKESNHVAKITGYEDVPANSESALLSAVANQPVSVAIDASGSDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTAIGYG   DG+KYWL+KNSWG SWGE+GY+R+ RD    EG CG
Sbjct  271   GVFTGECGTELDHGVTAIGYGKTSDGTKYWLVKNSWGTSWGENGYIRMQRDIDAAEGTCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TGKL+SLSEQELVDCD S ED GC GGLM+NAF FII N G+TTE+NY
Sbjct  153   AVAATEGINQLTTGKLISLSEQELVDCDTS-EDEGCNGGLMDNAFEFIISNGGITTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KK + +AAKI+GYE VPA+ E ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  212   PYEGVDGTCNTKKESSSAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG   DG+KYWL+KNSWG SWGE+GY+R+ RD    EGLCG
Sbjct  272   GVFTGDCGTELDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGENGYIRMQRDIDAPEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>gb|KDP38773.1| hypothetical protein JCGZ_05109 [Jatropha curcas]
Length=215

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SGED GCEGGLM++AF FI  N GLTTE NY
Sbjct  26    AVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFGFIKKNGGLTTEANY  85

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CN KKAA  AAKI+GYE V A+ E+ALL+AVA+QPVSV I+ +   FQFY  
Sbjct  86    PYQGTDDTCNTKKAADKAAKITGYEDVAANSEQALLKAVANQPVSVTIDASGSAFQFYSG  145

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYGT+ DG+KYWL+KNSWG SWGE+GY+R+ RD   KEGLCG
Sbjct  146   GVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSWGTSWGENGYIRMERDIDAKEGLCG  205

Query  482   LARDATYPV  456
             +A + +YP 
Sbjct  206   IAMEPSYPT  214



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD  GED GC GGLM++AF FII N GLTTE NY
Sbjct  153   AVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTEANY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CNA K+   AA I GYE VPA+ E ALL+AVA+QPVSVAI+     FQ Y  
Sbjct  213   PYEAADGTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQLYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GY    DG+KYWL+KNSWG+SWGE+GY+R+ RD   KEGLCG
Sbjct  273   GVFTGDCGTDLDHGVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIRMERDVDAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>gb|AAC49135.1| SAG12 protein [Arabidopsis thaliana]
Length=346

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG TQIK GKL+SLSEQ+LVDCD +  D GCEGGLM+ AF  I    GLTTE++Y
Sbjct  159   AVAAIEGATQIKKGKLISLSEQQLVDCDTN--DFGCEGGLMDTAFEHIKATGGLTTESDY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +D  CN+KK    A  I+GYE VP +DE+AL++AVA QPVSV I G  FDFQFY  
Sbjct  217   PYKGEDATCNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTAIGYG + +GSKYW+IKNSWG  WGESGYMRI +D   K+GLCG
Sbjct  277   GVFTGECTTYLDHAVTAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCG  336

Query  482   LARDATYPVL  453
             LA  A+YP +
Sbjct  337   LAMKASYPTI  346



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQ LVDCD +GED GCEGGLM++AF FI  N G++TE NY
Sbjct  144   AVAATEGITQLTTGKLISLSEQVLVDCDTAGEDQGCEGGLMDBAFQFIQQNHGISTEANY  203

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  204   PYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  263

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  264   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  323

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  324   IAMSASYPT  332



>ref|XP_004294729.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCDV+G D GC GG M++AF F+I N G+ TE NY
Sbjct  151   AVAAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCSGGEMDDAFKFVIQNHGINTEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG CNAKK A  AA I+G+E VPA+ E ALL+AVA+QP++VAI+ + FDFQ Y  
Sbjct  211   PYTAADGTCNAKKEAGHAATITGHEDVPANSESALLKAVANQPIAVAIDASGFDFQLYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ RD A  EGLCG
Sbjct  271   GVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKNSWGAQWGEEGYIRMQRDVAAPEGLCG  330

Query  482   LARDATYPV  456
             +A DA+YP 
Sbjct  331   IAMDASYPT  339



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TGKL+SLSEQELVDCD S ED GC GGLM+NAF FII N G+TTE+NY
Sbjct  153   AVAATEGINQLTTGKLISLSEQELVDCDTS-EDEGCNGGLMDNAFEFIISNGGITTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN+KK +  AAKI+GYE VPA+ E ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  212   PYEAVDGTCNSKKESSHAAKITGYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYTS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE+GY+R+ RD    EGLCG
Sbjct  272   GVFTGQCGTELDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGENGYIRMQRDVDAAEGLCG  331

Query  482   LARDATYP  459
             +A  A+YP
Sbjct  332   IAMQASYP  339



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAAVEG+TQ+ + KL+SLSEQELVDCD  GED GC+GGLM++AF FI +N+GLTTETNY
Sbjct  152   AVAAVEGITQLTSHKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIENNQGLTTETNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNA K A  AAKI+GYE VPA+DE ALL+AVA QPVSVAI+   F FQFY  
Sbjct  212   PYEGSDGTCNANKEANHAAKITGYEDVPANDEAALLKAVAQQPVSVAIDAGGFQFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F GDC   L+H V A+GYG + +G KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  272   GIFTGDCGTELDHGVAAVGYGVS-NGMKYWLVKNSWGTQWGEVGYIRMQRDIEAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SG D GCEGGLM++AF FI  N GL+TETNY
Sbjct  153   AVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFINQNHGLSTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+ E+ALL+AVA+QP+SVAI+    DFQFY  
Sbjct  213   PYTGVDGTCNTKKEANHAAKITGHEDVPANSEEALLKAVANQPISVAIDAGGSDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  273   GVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVKNSWGTEWGEEGYIRMQRGIKAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SG D GCEGGLM++AF FI  N GL+TETNY
Sbjct  153   AVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFINQNHGLSTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+ E+ALL+AVA+QP+SVAI+    DFQFY  
Sbjct  213   PYTGVDGTCNTKKEANHAAKITGHEDVPANSEEALLKAVANQPISVAIDAGGSDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  273   GVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVKNSWGTEWGEEGYIRMQRGIKAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCDV+GED GCEGGLM+NAF FI  N GL+TE NY
Sbjct  152   AVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFDFINQNHGLSTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CNA+K A  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+ +  DFQ Y  
Sbjct  212   PYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQLYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG++YWL+KNSWG  WGE GY+R+ RD    EGLCG
Sbjct  272   GVFTGTCGTSLDHGVTAVGYGVSDDGTQYWLVKNSWGAQWGEEGYIRMQRDVTAPEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMAASYPT  340



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TGKL+SLSEQ LVDCD +GED GCEGGLM++AF FI  N G++TE NY
Sbjct  144   AVAATEGITQLTTGKLISLSEQXLVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEANY  203

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  204   PYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  263

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  264   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  323

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  324   IAMSASYPT  332



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCD SGED GC GGLM++AF FI  N GLTTE NY
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA++EKAL +AVA QP++VAI+ +  +FQFY  
Sbjct  212   PYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDASGSEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H V A+GYGT+ DG KYWL+KNSW   WGE GY+R+ RD   KEGLCG
Sbjct  272   GVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWSTGWGEEGYIRMQRDVTAKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EGL QIKTG L+SLSEQELVDCD S ED GC  GLM+NAF FII N GLTTE+NY
Sbjct  137   AVAATEGLNQIKTGNLISLSEQELVDCDTS-EDQGCNDGLMDNAFEFIISNNGLTTESNY  195

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK +   AKI+GYE VPA+ E ALL+AVA+QP+SVAI+ +  DFQFY  
Sbjct  196   PYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFYSG  255

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG+SWGE+GY+R+ RD    EGLCG
Sbjct  256   GVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAEGLCG  315

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  316   IAMQASYPT  324



>ref|XP_004308524.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AV A+EG+TQ+ TGKL+SLSEQELVDCDV+G D GC GGLM++AF F+I N G+ TE NY
Sbjct  152   AVGAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCSGGLMDDAFQFVIQNHGINTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG CNAKKAA  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+ + +DFQ Y  
Sbjct  212   PYTAADGTCNAKKAAGHAATITGHEDVPANSESALLKAVANQPISVAIDASGYDFQLYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ RD A  EGLCG
Sbjct  272   GVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKNSWGAQWGEEGYIRMQRDVAAPEGLCG  331

Query  482   LARDATYPVL  453
             +A +A+YP +
Sbjct  332   IAMEASYPTV  341



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  152   AVAATEGINEIKTGKLISLSEQELVDCDTS-SDMGCEGGLMDDAFKFIIKNHGLTTESNY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C   K +  AAKI+GYE VPA+ E ALL AVA+QPVSVAI+ +  DFQFY  
Sbjct  211   PYEGTDGTCKTGKESNDAAKITGYEDVPANSESALLNAVANQPVSVAIDASGSDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG   DG+KYWLIKNSWG SWGE+GY+R+ R    +EGLCG
Sbjct  271   GVFTGECGTELDHGVTAVGYGITSDGTKYWLIKNSWGTSWGENGYIRMQRGVVPEEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             A+AA EG+T++ TGKL+SLSEQE+VDCD + +D GC GG ME+AF+FI+ NKG+ +E  Y
Sbjct  148   AIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCNGGEMEDAFAFIVKNKGIASEATY  207

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C+  K A  AAKI+GYEKVPA++E ALL+AVA+QPVSV+I+ +   FQFY  
Sbjct  208   PYTAADGTCSKTKEASHAAKIAGYEKVPANNEAALLKAVANQPVSVSIDASGMAFQFYTS  267

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG A +G+KYWL+KNSWG SWGESGY+R+ R  + KEGLCG
Sbjct  268   GVFTGDCGTDLDHGVTAVGYGKASNGTKYWLVKNSWGTSWGESGYIRMQRGISAKEGLCG  327

Query  482   LARDATYPV  456
             +A D++YP 
Sbjct  328   IAMDSSYPT  336



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+T++ TGKL+SLSEQELVDCDV GED GC GGLM+ AF FI HN GLTTE NYP
Sbjct  160   VAAMEGITKLSTGKLLSLSEQELVDCDVKGEDQGCNGGLMDEAFKFIQHNGGLTTEANYP  219

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG CNAKK A  AAKI+GYE VPA+ EK LL+AV  QPVSVAI+ + F+FQFY  G
Sbjct  220   YEGVDGTCNAKKEATHAAKITGYEDVPANSEKDLLKAVTHQPVSVAIDASGFEFQFYSGG  279

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG+
Sbjct  280   VFTGACGTNLDHGVTAVGYGATKDGTKYWLVKNSWGKQWGEKGYIRMQRDVDAKEGLCGI  339

Query  479   ARDATYPV  456
             A  A+YP 
Sbjct  340   AMMASYPT  347



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+  GKL+SLSEQELVDCD SGED GCEGGLM++AF FI  N GL+TE NY
Sbjct  151   AVAAMEGITQLTMGKLISLSEQELVDCDKSGEDQGCEGGLMDDAFEFINQNHGLSTEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CNA+K A  AA I+G+E VPA+ E ALL+AVASQP+SVAI+ +  DFQFY  
Sbjct  211   PYTGVDGKCNARKEASHAASITGHEDVPANSESALLKAVASQPISVAIDASGSDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD    EGLCG
Sbjct  271   GVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGAQWGEEGYIRMQRDVDAAEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMAASYPT  339



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCDV+GED GCEGGLM++AF FI  N GL+TE NY
Sbjct  151   AVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDDAFQFINQNHGLSTEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CNA+K A  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+ +  DFQFY  
Sbjct  211   PYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + +G+KYWL+KNSWG  WGE GY+R+ RD   +EGLCG
Sbjct  271   GVFTGTCGTSLDHGVTAVGYGVSDNGTKYWLVKNSWGAEWGEGGYIRMQRDVDAQEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMAASYPT  339



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TG L+SLSEQELVDCD +GED GCEGGLM++AF FI  N G++TE NY
Sbjct  155   AVAATEGITQLTTGNLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEXNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  215   PYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  275   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMSASYPT  343



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  134   AVAATEGINKIKTGKLISLSEQELVDCDTSS-DMGCEGGLMDDAFKFIIKNHGLTTESNY  192

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  C   K +  AAKI+ YE VPA+ E ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  193   PYEGTDSTCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYSS  252

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG A DG+KYWL+KNSWG SWGE+GY+R+ R+   +EGLCG
Sbjct  253   GVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENGYIRMQRNVDTEEGLCG  312

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  313   IAMEASYPT  321



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             +VAA+E +T+IKTG LVSLSEQ+LVDCD +  + GC+GGLM  AF ++I N G+TTE NY
Sbjct  137   SVAAIEAITEIKTGNLVSLSEQQLVDCDTNDGNKGCDGGLMTRAFQYVIDNGGITTEDNY  196

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG C+  +A+ +AA ISGYE VPA+DE +LLQAVA+QPVSV I+G+  DFQ Y  
Sbjct  197   PYKAADGTCDTNRASSSAATISGYETVPANDESSLLQAVANQPVSVGIDGSGPDFQHYSS  256

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G CE  + HAVTA+GYGTA DG+KYWL+KNSWG +WGE GYMRI RD    EGLCG
Sbjct  257   GIFTGPCETEMTHAVTAVGYGTAEDGTKYWLVKNSWGTTWGEMGYMRIQRDVGAPEGLCG  316

Query  482   LARDATYPV  456
             +A+ A+YP 
Sbjct  317   IAKLASYPT  325



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD  G+D GC+GGLM++AF FI +NKGLTTE++Y
Sbjct  154   AVAAMEGVTKLTTGKLISLSEQELVDCDTKGDDQGCQGGLMDDAFQFIQNNKGLTTESDY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  K A  AA I+G+E VPA++E+AL +AVA+QPVSVAI+   ++FQFY  
Sbjct  214   PYKGVDGKCNTNKEANHAANINGHEDVPANNEEALHKAVANQPVSVAIDAGGYEFQFYSS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  274   GVFTGDCGTDLDHGVTAVGYGADDDGTKYWLVKNSWGTSWGEEGYIRMQRDVDAKEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMQASYPT  342



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCD SGED GC GGLM++AF FI  N GLTTE NY
Sbjct  152   AVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSGGLMDDAFKFIEQNHGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KKAA  AAKI+GYE VPA++EKAL +AVA QP++VAI+ +  +FQFY  
Sbjct  212   PYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKAVAHQPIAVAIDASGSEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H V A+GYGT+ DG KYWL+KNSW   WGE GY+R+ RD   KEGLCG
Sbjct  272   GVFTGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWSTGWGEEGYIRMQRDVTVKEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA EG+ Q+ TGKLVSLSEQELVDCD  GED GCEGGLME+ F FII N G+TTE NYP
Sbjct  154   VAATEGINQLTTGKLVSLSEQELVDCDNQGEDQGCEGGLMEDGFEFIIKNHGITTEANYP  213

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y A DG CN+KK A   AKI+GYE VPA+ E  LL+ VA+QP+SV+I+    DFQFY  G
Sbjct  214   YQAADGTCNSKKQASHIAKITGYESVPANSEAELLKVVANQPISVSIDAGGSDFQFYSSG  273

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   +EGLCG+
Sbjct  274   VFTGKCGTELDHGVTAVGYGETSDGTKYWLVKNSWGTSWGEEGYIRMQRDIDTEEGLCGI  333

Query  479   ARDATYPV  456
             A D++YP 
Sbjct  334   AMDSSYPT  341



>ref|XP_006857794.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
 gb|ERN19261.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
Length=342

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 3/189 (2%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ +IKTGKLVSLSEQE+VDCD  GED GC GGLM++AF FII+N GLTTE  Y
Sbjct  156   AVAAMEGIHEIKTGKLVSLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIINNHGLTTEAKY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG C   KA+  AA I+GYE VP ++EKALL+AVASQPVSVAI+ + ++FQFY  
Sbjct  216   PYKAVDGTCK--KASSIAATITGYEDVPTNNEKALLKAVASQPVSVAIDASGYEFQFYSR  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYGT+G G+KYWL+KNSWG  WGE+GY+ + RD A KEGLCG
Sbjct  274   GVFTGNCGTELDHGVTAVGYGTSG-GTKYWLVKNSWGKQWGEAGYIMMQRDVASKEGLCG  332

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  333   IAMQASYPT  341



>ref|XP_004306836.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AV A+EG+TQ+ TGKL+SLSEQELVDCDV+G D GC GGLM++AF F+I N G+ TE NY
Sbjct  152   AVGAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCSGGLMDDAFQFVIQNHGINTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG CNAKK A  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+ + +DFQ Y  
Sbjct  212   PYTAADGTCNAKKEAGHAATITGHEDVPANSESALLKAVANQPISVAIDASGYDFQLYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ RD A  EGLCG
Sbjct  272   GVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKNSWGAQWGEEGYIRMQRDVAAPEGLCG  331

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  332   IAMEASYPT  340



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  152   AVAATEGINKIKTGKLISLSEQELVDCDTSS-DMGCEGGLMDDAFKFIIKNHGLTTESNY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  C   K +  AAKI+ YE VPA+ E  LL+AVA+QPVSVAI+ +A DFQFY  
Sbjct  211   PYEGTDSTCKTGKESNHAAKITSYEDVPANSESDLLKAVANQPVSVAIDASASDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG A DG+KYWL+KNSWG SWGE+GY+R+ R+   +EGLCG
Sbjct  271   GVFTGECGTELDHGVTAVGYGKASDGTKYWLVKNSWGTSWGENGYIRMQRNVDTEEGLCG  330

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  331   IAMEASYPT  339



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  152   AVAATEGINKIKTGKLISLSEQELVDCDTSS-DMGCEGGLMDDAFKFIIKNHGLTTESNY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  C   K +  AAKI+ YE VPA+ E ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  211   PYEGTDNTCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG A DG+KYWL+KNSWG SWGE+GY+R+ R+   +EGLCG
Sbjct  271   GVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENGYIRMQRNVDTEEGLCG  330

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  331   IAMEASYPT  339



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+  I TGKL+SLSEQELVDCD  GED GC+GGLM++AF FI   +GLTTET+Y
Sbjct  155   AVAAMEGINMITTGKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIQKIQGLTTETDY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  K A  AAKI+GYE VPA+ E  LL+AVA+QPVSVAI+   F+FQFY  
Sbjct  215   PYRGVDGTCNTNKEANHAAKINGYEDVPANSETVLLKAVANQPVSVAIDAGGFEFQFYSG  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G CE  L+H VTA+GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  275   GIFTGACETQLDHGVTAVGYGVGDDGTKYWLVKNSWGTSWGEKGYIRMQRDVDAKEGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMAASYPT  343



>ref|XP_006398274.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
 dbj|BAJ33714.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ39727.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
Length=347

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG T+IK GKL+SLSEQ+LVDCD +  D GC GGLM+ AF  I+   GLTTE+NY
Sbjct  160   AVAAIEGATKIKKGKLISLSEQQLVDCDTN--DFGCSGGLMDTAFEHIMATGGLTTESNY  217

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +D  C  K     A  I+GYE VP +DEKAL++AVA QPVS+ I G  FDFQFY  
Sbjct  218   PYKGKDATCKIKNTKPTATSITGYEDVPVNDEKALMKAVAHQPVSIGIEGGGFDFQFYGS  277

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTA+GYG + +GSKYW+IKNSWG  WGESGYMRI +D   K+GLCG
Sbjct  278   GVFTGECTTYLDHAVTAVGYGQSSNGSKYWIIKNSWGTKWGESGYMRIKKDVKDKKGLCG  337

Query  482   LARDATYPVL  453
             LA  A+YP +
Sbjct  338   LAMKASYPTI  347



>gb|EYU43350.1| hypothetical protein MIMGU_mgv1a021555mg [Erythranthe guttata]
Length=325

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TG L+SLSEQELVDCD S ED GC GGLM+NAF FII N GLTTE+NY
Sbjct  137   AVAATEGINQLTTGNLISLSEQELVDCDTS-EDQGCNGGLMDNAFEFIISNNGLTTESNY  195

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK +   AKI+GYE VPA+ E ALL+AVA QP+SVAI+ +  DFQFY  
Sbjct  196   PYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVAKQPISVAIDASGSDFQFYSG  255

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG+SWGE+GY+R+ RD   +EGLCG
Sbjct  256   GVFTGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAEEGLCG  315

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  316   IAMQASYPT  324



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ TG+L+SLSEQELVDCD SG D GCEGGLM+NAF+FI HN GL +E NY
Sbjct  151   AVAATEGITKLTTGELISLSEQELVDCDTSGVDQGCEGGLMDNAFTFIQHNHGLASEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  K A+ AA+I+G+E VPA+ E+ALL AVA QPVSVAI+     FQFY +
Sbjct  211   PYKGVDGTCNTNKQAIHAAEINGFEDVPANSEEALLNAVAHQPVSVAIDAGGSGFQFYSK  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYGT+ DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  271   GVFIGACGTQLDHGVTAVGYGTSDDGTKYWLVKNSWGTQWGEEGYIRMQRDVDAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMKASYPT  339



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             ++AA+EG+TQI TG LVSLSEQ+LVDCDV   + GC GGLM  AF ++I N G+TTE NY
Sbjct  150   SIAAIEGITQINTGNLVSLSEQQLVDCDVKDGNNGCNGGLMTRAFQYVIDNGGITTENNY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG C+  +A+ +AA ISGYE VP +DE +LLQAV++QPVSV I+G   DFQ Y  
Sbjct  210   PYMAADGTCDTDRASSSAATISGYENVPVNDESSLLQAVSNQPVSVGIDGGGQDFQHYSS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C+  ++HAVTAIGYGTA DG+KYWLIKNSWG +WGE GYMRI RD    EGLCG
Sbjct  270   GIFTGPCKTNMDHAVTAIGYGTAEDGTKYWLIKNSWGTTWGEKGYMRIQRDVGAPEGLCG  329

Query  482   LARDATYPV  456
             +A+ A+YP 
Sbjct  330   IAKLASYPT  338



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  154   AVAATEGINKIKTGKLISLSEQELVDCDTSS-DMGCEGGLMDDAFKFIIKNNGLTTESNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   +  C   K +  AAKI+GYE VPA+ E ALL+AVA+QP+SVAI+ +  DFQFY  
Sbjct  213   PYEGTNATCKTGKESNHAAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFYST  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTAIGYG   DG++YWL+KNSWG SWGE+GY+R+ RD   +EGLCG
Sbjct  273   GVFTGECGTELDHGVTAIGYGKTSDGTQYWLVKNSWGTSWGENGYIRMQRDVDAEEGLCG  332

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  333   IAMQASYPT  341



>ref|XP_006857796.1| hypothetical protein AMTR_s00061p00215230 [Amborella trichopoda]
 gb|ERN19263.1| hypothetical protein AMTR_s00061p00215230 [Amborella trichopoda]
Length=344

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ QIKTGKLVSLSEQE+VDCD  GED GC GGLM++AF FII+N GLTTE  Y
Sbjct  158   AVAAMEGIHQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIINNHGLTTEAKY  217

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG C   KA+  AA I+GYE VP ++EKALL+AV SQPVSVAI+ + ++FQFY  
Sbjct  218   PYKAVDGTCK--KASSIAATITGYEDVPTNNEKALLKAVTSQPVSVAIDASGYEFQFYSG  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G+C   L+H VTA+GYGT+G G+KYWL+KNSWG  WGE+GY+R+ RD A KEGLCG
Sbjct  276   GIFTGNCGTELDHGVTAVGYGTSG-GTKYWLVKNSWGEQWGEAGYIRMQRDVASKEGLCG  334

Query  482   LARDATYPV  456
             +A   +YP 
Sbjct  335   IAMQPSYPT  343



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG T++K+GKLVSLSEQELVDCD  GE+ GCEGGLM++AF F++ NKGL  E NY
Sbjct  155   AVAATEGTTKLKSGKLVSLSEQELVDCDTQGENQGCEGGLMDDAFKFVMRNKGLAAEANY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG+CN  K A  AAKI+GYE VPA+ E ALL+AVA+QPVSVAI+   ++FQFY  
Sbjct  215   PYRGIDGICNKNKVAYHAAKITGYEDVPAN-ELALLKAVANQPVSVAIDAGGYEFQFYSR  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+  GDC  +LNH VT +GYGT  DG+KYWL+KNSWG  WGE GY+RI RD   ++GLCG
Sbjct  274   GILTGDCGTHLNHGVTVVGYGTGADGTKYWLVKNSWGAEWGEGGYVRIQRDVHTRQGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMKASYPT  342



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCDV+GED GCEGGLM+NAF FI  N GL+TE +Y
Sbjct  152   AVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFDFINQNHGLSTEAHY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CNA+K A  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+ +  DFQ Y  
Sbjct  212   PYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQLYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD    EGLCG
Sbjct  272   GVFTGTCGTSLDHGVTAVGYGISDDGTKYWLVKNSWGAQWGEEGYIRMQRDVDAPEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMAASYPT  340



>gb|KDP38776.1| hypothetical protein JCGZ_05112 [Jatropha curcas]
Length=222

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SGED GCEGG M++AF FI  N GLTTE NY
Sbjct  33    AVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQGCEGGFMDDAFGFIKKNGGLTTEANY  92

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CNAKKAA  AAKI+GYE V A+ E+ALL+AVA+QPVSV I+ +   FQFY  
Sbjct  93    PYQGTDDPCNAKKAADKAAKITGYEDVAANSEQALLKAVANQPVSVTIDASGSAFQFYSG  152

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYGT+ DG+KYWL+KNSWG SWGE+GY+R+ RD   KEGLCG
Sbjct  153   GVFTGDCGTELDHGVTAVGYGTSDDGTKYWLVKNSWGTSWGENGYIRMERDIDAKEGLCG  212

Query  482   LARDATYPV  456
             +A + +YP 
Sbjct  213   IAMEPSYPT  221



>ref|XP_011014387.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 2/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+ ++KTGKL+SLSEQ+LVDCDV   + GC GG+M+NAF +II N GL +E NYP
Sbjct  11    VAAIEGIIKLKTGKLISLSEQQLVDCDVG--NKGCGGGIMDNAFQYIIRNGGLASEDNYP  68

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG CN++KA+   A+I+GYE VP ++E ALLQAVA QPVSV I+G   DFQFY+ G
Sbjct  69    YQGVDGTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFYKSG  128

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF GDC    NHAVTAIGYGT  DG+ YWL+KNSWG SWGESGYMR+ R     EGLCG+
Sbjct  129   VFKGDCGTEQNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGESGYMRMQRGIGASEGLCGV  188

Query  479   ARDATYPV  456
             A DA+YP 
Sbjct  189   AMDASYPT  196



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SG D GC GGLM++AF FI  N GL+TETNY
Sbjct  153   AVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCGGGLMDDAFQFINKNHGLSTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+GYE VPA+ E+ALL+AVA+QP+SVAI+    DFQFY  
Sbjct  213   PYTGVDGTCNTKKEASHAAKITGYEDVPANSEEALLKAVANQPISVAIDAGGSDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  273   GVFTGTCGTSLDHGVTAVGYGISADGTKYWLVKNSWGTQWGEEGYIRMQRGVEAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>gb|KHN05669.1| Vignain [Glycine soja]
Length=315

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T+++TGKL+SLSEQELVDCD  G D GCEGGLM++AF FI+ NKGL TE  Y
Sbjct  126   AVAATEGITKLRTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLATEAIY  185

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK     A  I GYE VPA+ E ALL+AVA+QPVSVAI  + F FQFY  
Sbjct  186   PYEGFDGTCNAKADGNHAGSIKGYEDVPANSESALLKAVANQPVSVAIEASGFKFQFYSG  245

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VT++GYG + DG+KYWL+KNSWG  WGE GY+R+ RD A KEGLCG
Sbjct  246   GVFTGSCGTNLDHGVTSVGYGVSDDGTKYWLVKNSWGVKWGEKGYIRMQRDVAAKEGLCG  305

Query  482   LARDATYP  459
             +A  A+YP
Sbjct  306   IAMLASYP  313



>ref|XP_011005484.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+ ++KTGKL+SLSEQ+LVDCDV   + GC GG M+NAF +II N GL +E NYP
Sbjct  11    VAAIEGIIKLKTGKLISLSEQQLVDCDVG--NNGCHGGFMDNAFQYIIRNGGLASEDNYP  68

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG CN++KA+   A+I+GYE VP ++E ALLQAVA QPVSV I+G   DFQFY+ G
Sbjct  69    YQGVDGTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFYKSG  128

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF GDC    NHAVTAIGYGT  DG+ YWL+KNSWG SWGESGYMR+ R     EGLCG+
Sbjct  129   VFKGDCGTEQNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGESGYMRMQRGIGASEGLCGV  188

Query  479   ARDATYPV  456
             A DA+YP 
Sbjct  189   AMDASYPT  196



>gb|AHA62780.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              VAA EGL Q+KTGKL+SLSEQELVDCD S  D GCEGGL++ A++FI+ N GLTTE+NY
Sbjct  156   TVAATEGLNQLKTGKLISLSEQELVDCDTSF-DQGCEGGLLDTAYTFILKNGGLTTESNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG+C  K +A +AA I GY+ VPA+DE ALL+AVA QPVSVA+ G  FDFQFY  
Sbjct  215   PYMATDGICTTKHSAKSAASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+HAV  IGYG + DG KYWLIKNSWG  WGE+GYMRI RD   K GLCG
Sbjct  275   GVFQGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKYGLCG  334

Query  482   LARDATYPV  456
             LA   +YP+
Sbjct  335   LAMQPSYPI  343



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TGKL+SLSEQELVDCD S ED GC GGLM++AF FII N G+TTE+NY
Sbjct  153   AVAATEGINQLTTGKLISLSEQELVDCDTS-EDEGCNGGLMDDAFEFIISNGGITTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK +  AAKI+GYE VPA+ E ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  212   PYEGVDGTCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG   DG+KYWL+KNSWG+SWGE+GY+R+ RD    EGLCG
Sbjct  272   GVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_004306813.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AV A+EG+TQ+  GKL+SLSEQELVDCDV+G D GC GGLM++AF F+I N G+ TE NY
Sbjct  152   AVGAMEGITQLTIGKLISLSEQELVDCDVNGVDQGCSGGLMDDAFQFVIQNHGINTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG CNAKK A  AA I+G+E VPA+ E ALL+AVA+QP+SVAI+ + +DFQ Y  
Sbjct  212   PYTAADGTCNAKKEAGHAATITGHEDVPANSESALLKAVANQPISVAIDASGYDFQLYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ RD A  EGLCG
Sbjct  272   GVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKNSWGAQWGEQGYIRMQRDVAAPEGLCG  331

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  332   IAMEASYPT  340



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++ TGKL+SLSEQELVDCDV GED GCEGGLM++AF FI++N GLTTE+NY
Sbjct  154   AVAAMEGIVKLSTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIVNNGGLTTESNY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C     + AA  I GYE VPA+DE AL++AVASQPVSVA++G    FQFY  
Sbjct  214   PYTAADGKCKGGSGSAAAT-IKGYEDVPANDEAALMKAVASQPVSVAVDGGDMTFQFYSG  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYGTAGDG+KYWL+KNSWG +WGE+G++R+ +D + K G+CG
Sbjct  273   GVMSGSCGTDLDHGIVAIGYGTAGDGTKYWLLKNSWGTTWGENGFLRMEKDISDKRGMCG  332

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  333   LAMEPSYPT  341



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TG L+SLSEQELVDCD SG D GCEGGLM++AF FII N GLTTE NY
Sbjct  155   AVAAMEGITKLSTGTLISLSEQELVDCDTSGMDQGCEGGLMDDAFEFIIENNGLTTEANY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN +KAA  AAKI+GYE VPA DE+AL +AVA+QPVSVAI+     FQ Y  
Sbjct  215   PYEGVDGSCNTRKAANHAAKITGYENVPAYDEEALRKAVANQPVSVAIDAGESAFQHYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F GDC   L+H VT +GYGT+ DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  275   GIFTGDCGTELDHGVTVVGYGTSDDGTKYWLVKNSWGTSWGEDGYIRMERDIDAKEGLCG  334

Query  482   LARDATYPV  456
             +A + +YP 
Sbjct  335   IAMEPSYPT  343



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAAVEG+ +I TGKL+SLSEQELVDCDV G+D GCEGG M++AF F+    GLTTETNY
Sbjct  152   AVAAVEGVNEITTGKLISLSEQELVDCDVGGQDQGCEGGWMDSAFQFV-EKHGLTTETNY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN K  +  A  I GYE VPA+ E ALL+AVA QPVSVAI+   FDFQFY  
Sbjct  211   PYNGTDGKCNVKSESNRAVIIKGYEDVPANSEGALLKAVAKQPVSVAIDAGGFDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYGT+ DG+K+WL+KNSWG  WGE GY+R+ RD + KEGLCG
Sbjct  271   GVFTGACGTELDHGVTAVGYGTSDDGTKFWLVKNSWGEEWGEKGYIRMQRDVSAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMKASYPT  339



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCD SG D GCEGGLM++AF FI+ N+GLTTE+ Y
Sbjct  154   AVAAMEGITQLTTGKLISLSEQELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTTESKY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CN KKA+  AA I+G+E VPA+ EKAL +AVA+QPVSVAI+    DFQ Y  
Sbjct  214   PYKGVDETCNKKKASSHAASITGHEDVPANSEKALQKAVANQPVSVAIDAGGSDFQLYSS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG   DG+KYWL+KNSWG+SWGE GY+R+ RD   +EGLCG
Sbjct  274   GVFTGECGTELDHGVTAVGYGKTEDGTKYWLVKNSWGSSWGEEGYIRMERDVDAEEGLCG  333

Query  482   LARDATYP  459
             +A +A+YP
Sbjct  334   IAMEASYP  341



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             +AA EG+T++KTGKL+SLSEQELVDCD +GED GCEGG ME+ F FI+ NKG+  E +YP
Sbjct  173   IAATEGITKLKTGKLISLSEQELVDCDKTGEDQGCEGGYMEDGFEFIVKNKGIALEASYP  232

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y+A DG CN+K+ A  AAKISGYEKVPA+ E ALL+AVA+QPVSV+I+ +   FQFY  G
Sbjct  233   YTAADGTCNSKEEASRAAKISGYEKVPANSETALLKAVANQPVSVSIDASGVAFQFYSSG  292

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G+C   L+H VTA+GYG   DG+KYWL+KNSWG SWG+SGY+ + R  A K GLCG+
Sbjct  293   VFTGECGTDLDHGVTAVGYGKTSDGTKYWLVKNSWGASWGDSGYIMMQRGVAAKGGLCGI  352

Query  479   ARDATYPV  456
             A DA+YP 
Sbjct  353   AMDASYPT  360



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             +VAA+E +TQIKTG LVSLSEQ+LVDCDV+  + GC+GGLM  AF ++I N G+TTE NY
Sbjct  147   SVAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGCDGGLMTRAFQYVIDNGGITTEDNY  206

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A +G C+  K + +AA ISGYE VPA+DE +LLQAVA+QPVSV I+G+  DF+ Y  
Sbjct  207   PYMAANGTCDTNKTSSSAATISGYESVPANDESSLLQAVANQPVSVGIDGSGQDFRHYSS  266

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G CE  + HAVTA+GYG A DG++YWL+KNSWG +WGE+GYMRI RD    EGLCG
Sbjct  267   GIFTGPCETQMTHAVTAVGYGIAEDGTEYWLVKNSWGTTWGETGYMRIQRDVGAPEGLCG  326

Query  482   LARDATYPV  456
             +A+ A+YP 
Sbjct  327   MAKLASYPT  335



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             A+AA EG+T++ TGKL+SLSEQE+VDCD + +D GC GG ME+AF FI+ NKG+ TET Y
Sbjct  147   AIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCSGGYMEDAFEFIVKNKGIATETTY  206

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C+  K A  AAKI+ YEKVPA+ E ALL+AVA+QPVSV+I+     FQFY  
Sbjct  207   PYTAADGTCSKTKEASHAAKIASYEKVPANSEAALLKAVANQPVSVSIDAGGMAFQFYSS  266

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VTA+GYG   +G+KYWL+KNSWG SWGESGY+++ R  A KEGLCG
Sbjct  267   GVFTGDCGTDLDHGVTAVGYGKTSNGTKYWLVKNSWGTSWGESGYIKMKRGIAAKEGLCG  326

Query  482   LARDATYPV  456
             +A D++YP 
Sbjct  327   IAMDSSYPT  335



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TG LVSLSEQELVDCD S ED GC GGLM+NAF FII N GLTTE+NY
Sbjct  155   AVAATEGINQLTTGNLVSLSEQELVDCDTS-EDQGCNGGLMDNAFEFIISNNGLTTESNY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK +  AA+I+GYE VP++ E ALL+AVA+QP+SVAI+ +  DFQFY  
Sbjct  214   PYEGVDGTCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVAIDASGSDFQFYSG  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE+GY+R+ RD    EGLCG
Sbjct  274   GVFTGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGTSWGENGYIRMQRDIDAAEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMQASYPT  342



>gb|KFK23231.1| hypothetical protein AALP_AAs59427U000100 [Arabis alpina]
Length=248

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+ QIK GKL+SLSEQ+LVDCD +  D GC GG M++AF  II   GLTTE+NYP
Sbjct  62    VAAIEGVAQIKKGKLISLSEQQLVDCDTN--DFGCSGGWMDSAFEHIIATGGLTTESNYP  119

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y  +DG CN+KK    A  ISGYE VP +DE+AL++AVA QPVS+AI G  FDFQFY  G
Sbjct  120   YIGEDGTCNSKKTNPKATSISGYEDVPVNDEQALMKAVAHQPVSIAIEGGGFDFQFYSTG  179

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G C   L+HAV  +GYG + +GSKYW+IKNSWG +WGESGYMRI +D  +KEGLCGL
Sbjct  180   VFTGGCTTSLDHAVLMVGYGESTNGSKYWIIKNSWGTNWGESGYMRIQKDVKEKEGLCGL  239

Query  479   ARDATYPVL  453
             A  A+YP +
Sbjct  240   AMKASYPTI  248



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  153   AVAATEGINKIKTGKLISLSEQELVDCDTSS-DMGCEGGLMDDAFKFIIKNHGLTTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  C   K +  AAKI+ YE VPA+ E +LL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  212   PYEGTDSTCKTGKESNHAAKITSYEDVPANSESSLLKAVANQPVSVAIDASGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG A DG+KYWL+KNSWG SWGE+GY+R+ R+   +EGLCG
Sbjct  272   GVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENGYIRMQRNVDAEEGLCG  331

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  332   IAMEASYPT  340



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             +VAA+E +TQIKTG LVSLSEQ+LVDCDV+  + GC+GGLM  AF ++I N G+TTE NY
Sbjct  173   SVAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGCDGGLMTRAFQYVIDNGGITTEDNY  232

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A +G C+  K + +AA ISGYE VPA+DE +LLQAVA+QPVSV I+G+  DF+ Y  
Sbjct  233   PYMAANGTCDTNKTSSSAATISGYESVPANDESSLLQAVANQPVSVGIDGSGQDFRHYSS  292

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G CE  + HAVTA+GYG A DG++YWL+KNSWG +WGE+GYMRI RD    EGLCG
Sbjct  293   GIFTGPCETQMTHAVTAVGYGIAEDGTEYWLVKNSWGTTWGETGYMRIQRDVGAPEGLCG  352

Query  482   LARDATYPV  456
             +A+ A+YP 
Sbjct  353   MAKLASYPT  361



>ref|XP_007050065.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX94222.1| Senescence-associated gene 12 [Theobroma cacao]
Length=342

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TGKL+SLSEQELVDCD  GED GC GG ME+AF FII N G+ +E  Y
Sbjct  153   AVAATEGIHQLTTGKLISLSEQELVDCDTQGEDQGCAGGEMEDAFEFIIRNHGIASEVTY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  K A  AA I+GYE VPA+ EKAL++AVA+QPVSV+I+   + FQFY  
Sbjct  213   PYKGDDGTCNKTKEASHAATITGYEVVPANSEKALMKAVANQPVSVSIDAGGYAFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F GDC   L+H VTA+GYGT+ DG+ YWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  273   GIFTGDCGTELDHGVTAVGYGTSEDGTMYWLVKNSWGTGWGEKGYIRMQRDIKAKEGLCG  332

Query  482   LARDATYPV  456
             +A D++YP 
Sbjct  333   IAMDSSYPT  341



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   248 bits (634),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL+SLSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  152   AVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN +K A  AAKI+G+E VPA+ E AL++AVA QPVSVAI+   F+FQFY  
Sbjct  212   PYTGTDGTCNTQKEATHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGFEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ +D + KEGLCG
Sbjct  272   GIFTGSCGTQLDHGVTAVGYGIS-DGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCG  330

Query  482   LARDATYP  459
             +A  A+YP
Sbjct  331   IAMQASYP  338



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TG L+SLSEQELVDCD +GED GCEGGLM++AF F   N G++TE NY
Sbjct  144   AVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFXQQNHGISTEXNY  203

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  204   PYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  263

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD A  EGLCG
Sbjct  264   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEXGYIRMQRDVAAPEGLCG  323

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  324   IAMSASYPT  332



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TG L+SLSEQELVDCD +GED GCEGGLM++AF FI  N G++TE NY
Sbjct  144   AVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEXNY  203

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  204   PYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  263

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+ NSWG  WGE GY+R+ RD A  EGLCG
Sbjct  264   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVXNSWGAEWGEXGYIRMQRDVAAPEGLCG  323

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  324   IAMSASYPT  332



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             +VAA+E +TQIKTG LV LSEQ+LVDCD +  + GC GG M  AF ++I+N G+TTE NY
Sbjct  137   SVAAIEAITQIKTGNLVYLSEQQLVDCDANDGNHGCHGGFMTGAFQYVINNGGITTENNY  196

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG C+  +A+ +AA I GYE VPA+DE +LLQAV +QPVSV I+G+  DF+ Y+ 
Sbjct  197   PYRANDGTCDTNRASSSAATIGGYESVPANDESSLLQAVTNQPVSVGIDGSGQDFRHYKG  256

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G CE  +NHAVTA+GYGTA DG+KYWL+KNSWG +WGE GYMRI RD A  EGLCG
Sbjct  257   GIFTGACETNMNHAVTAVGYGTAEDGTKYWLVKNSWGTTWGEMGYMRIQRDVAAPEGLCG  316

Query  482   LARDATYPV  456
             +A+ A+YP 
Sbjct  317   IAKLASYPT  325



>gb|KCW76128.1| hypothetical protein EUGRSUZ_D00504 [Eucalyptus grandis]
Length=318

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T IK GKL+ LS QELVDCDV  +D GC GGLM+ AF FI    GL+TE NY
Sbjct  131   AVAAMEGITMIKKGKLMPLSVQELVDCDV--DDNGCHGGLMDRAFKFIKSKGGLSTEANY  188

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A +G CN  K A  AA I+GY+ VPA++EKALLQAVA+QPVSVAI G+ F+FQFY  
Sbjct  189   PYQANNGTCNTAKMANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFNFQFYSS  248

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   ++HAVTA+GYG    G+KYWL+KNSWG  WGESGYMRI RD + K GLCG
Sbjct  249   GVFSGSCGTSIDHAVTAVGYGKTSRGTKYWLLKNSWGTGWGESGYMRIQRDVSSKAGLCG  308

Query  482   LARDATYPV  456
             LA +A+YP 
Sbjct  309   LAMEASYPT  317



>ref|XP_006857795.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
 gb|ERN19262.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
Length=342

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 148/189 (78%), Gaps = 3/189 (2%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ QIKTGKLVSLSEQE+VDCD  GED GC GG M++AF FII+N GLTTE  Y
Sbjct  156   AVAAMEGIHQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGFMDDAFKFIINNHGLTTEAKY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG C   KA+  AA I+GYE VP ++EKALL+AV SQPVSVAI+ + ++FQFY  
Sbjct  216   PYKAVDGSCK--KASSLAATITGYEDVPTNNEKALLKAVTSQPVSVAIDASGYEFQFYSG  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYGT+G G+KYWL+KNSWG  WGE+GY+R+ RD A KEGLCG
Sbjct  274   GVFTGNCGTELDHGVTAVGYGTSG-GTKYWLVKNSWGKQWGEAGYIRMQRDVASKEGLCG  332

Query  482   LARDATYPV  456
             +A   +YP 
Sbjct  333   IAMQPSYPT  341



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +IKTGKL+SLSEQELVDCD    DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  153   AVAATEGINKIKTGKLISLSEQELVDCDTR-SDMGCEGGLMDDAFKFIIKNNGLTTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  C   K +  AAKI+GYE VP + E ALL+AVA+QP+SVAI+ +  DFQFY  
Sbjct  212   PYEGTDATCKTGKESNHAAKITGYEDVPDNSESALLKAVANQPISVAIDASGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG  GDG+KYWL+KNSWG SWGE+GY+R+ RD   +EGLCG
Sbjct  272   GVFTGKCGTELDHGVTAVGYGKIGDGTKYWLVKNSWGTSWGENGYIRMQRDVDAEEGLCG  331

Query  482   LARDATYP  459
             +A  A+YP
Sbjct  332   IAMQASYP  339



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TG LVSLSEQELVDCD S ED GC GGLM+NAF FII N GLTTE+NY
Sbjct  140   AVAATEGINQLTTGNLVSLSEQELVDCDTS-EDQGCNGGLMDNAFEFIISNNGLTTESNY  198

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK +  AA+I+GYE VP++ E ALL+AVA+QP+SVAI+ +  D QFY  
Sbjct  199   PYEGVDGTCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVAIDASGPDIQFYST  258

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE+GY+R+ RD    EGLCG
Sbjct  259   GVFTGQCGTELDHGVTAVGYGATNDGTKYWLVKNSWGTSWGENGYIRMQRDIHAAEGLCG  318

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  319   IAMQASYPT  327



>ref|XP_010052200.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T IK GKL+ LS QELVDCDV  +D GC GGLM+ AF FI    GL+TE NY
Sbjct  155   AVAAMEGITMIKKGKLMPLSVQELVDCDV--DDNGCHGGLMDRAFKFIKSKGGLSTEANY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A +G CN  K A  AA I+GY+ VPA++EKALLQAVA+QPVSVAI G+ F+FQFY  
Sbjct  213   PYQANNGTCNTAKMANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFNFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   ++HAVTA+GYG    G+KYWL+KNSWG  WGESGYMRI RD + K GLCG
Sbjct  273   GVFSGSCGTSIDHAVTAVGYGKTSRGTKYWLLKNSWGTGWGESGYMRIQRDVSSKAGLCG  332

Query  482   LARDATYPV  456
             LA +A+YP 
Sbjct  333   LAMEASYPT  341



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCD SG D GCEGGLM++AF FI+ N+GLTTE+ Y
Sbjct  170   AVAAMEGITQLTTGKLISLSEQELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTTESKY  229

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CN KKA+  AA I+G+E VPA+ EKAL +AVA+QPVSVAI+    DFQ Y  
Sbjct  230   PYKGVDETCNKKKASSHAASITGHEDVPANSEKALQKAVANQPVSVAIDAGGSDFQLYSS  289

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG   DG+KYWL+KNSWG+SWGE GY+R+ RD   +EGLCG
Sbjct  290   GVFTGECGTELDHGVTAVGYGKTEDGTKYWLVKNSWGSSWGEEGYIRMERDVDAEEGLCG  349

Query  482   LARDATYP  459
             +A +A+YP
Sbjct  350   IAMEASYP  357



>gb|AHA62781.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              VAA EGL Q+KTGKL+SLSEQELVDCD +  D GCEGGL++ A++FI+ N GLTTE+NY
Sbjct  156   TVAATEGLNQLKTGKLISLSEQELVDCD-TNFDQGCEGGLLDTAYTFILKNGGLTTESNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG+C  K +A + A I GY+ VPA+DE ALL+AVA QPVSVA+ G  FDFQFY  
Sbjct  215   PYMATDGICTTKHSAKSDASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+HAV  IGYG + DG KYWLIKNSWG  WGE+GYMRI RD   K GLCG
Sbjct  275   GVFQGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKYGLCG  334

Query  482   LARDATYPV  456
             LA   +YP+
Sbjct  335   LAMQPSYPI  343



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL+SLSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  151   AVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN +K A  AAKI+G+E VPA+ E AL++AVA QPVSVAI+   F+FQFY  
Sbjct  211   PYTGTDGTCNTQKEANHAAKITGFEDVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ +D + KEGLCG
Sbjct  271   GIFTGSCGTQLDHGVTAVGYGIS-DGTKYWLVKNSWGAQWGEGGYIRMQKDISAKEGLCG  329

Query  482   LARDATYP  459
             +A  A+YP
Sbjct  330   IAMQASYP  337



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             +VAA+EG+TQI TG LVSLSEQ+LV+CDV+  D GC+GG M  AF ++I+N G+T+E NY
Sbjct  150   SVAAIEGITQINTGNLVSLSEQQLVNCDVNDGDNGCQGGFMTRAFHYVINNGGITSEANY  209

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG C+  KA+ + A ISGYE VPA+DE +LLQAV+ QPVSV I+G   DFQ+Y  
Sbjct  210   PYKAADGTCDTNKASSSVATISGYENVPANDESSLLQAVSKQPVSVGIDGGGKDFQYYSS  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   ++HAVTAIGYG A DG+KYWL+KNSWG +WGE GYMR+ RD    EGLCG
Sbjct  270   GIFTGACTTDMDHAVTAIGYGKAKDGTKYWLLKNSWGTTWGEKGYMRLQRDVGASEGLCG  329

Query  482   LARDATYPV  456
             +A+ A+YP 
Sbjct  330   IAKLASYPT  338



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+ TGKL+SLSEQELVDCDV+GED GCEGGLM+NAF FI  N GL+TE NY
Sbjct  151   AVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFEFINQNHGLSTEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CNAKK A  AA I+G+E VP +DE AL +AVA+QP+SVAI+ +   FQFY  
Sbjct  211   PYTGVDGTCNAKKEANHAASITGHEDVPPNDESALQKAVANQPISVAIDASGSGFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+K+WL+KNSWG  WGE GY+R+ RD    EGLCG
Sbjct  271   GVFTGPCGTSLDHGVTAVGYGVSDDGTKFWLVKNSWGAQWGEEGYIRMQRDIPAPEGLCG  330

Query  482   LARDATYPV  456
             +A + +YP 
Sbjct  331   IAMEPSYPT  339



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ +GKLVSLSEQELVDCD+ G D GCEGGLM++AF F++ NKGLTTE  Y
Sbjct  153   AVAATEGITKLSSGKLVSLSEQELVDCDIKGVDQGCEGGLMDDAFKFMLQNKGLTTEVVY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK      A I GYE VPA+ E ALL+AVA+QP+SVAI+ +  +FQFY  
Sbjct  213   PYQGVDGTCNAKAEGNHVASIKGYEDVPANSESALLKAVANQPISVAIDASGSEFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R+   KEGLCG
Sbjct  273   GVFTGTCGTELDHGVTAVGYGVSEDGTKYWLVKNSWGTQWGEQGYIRMERNVVAKEGLCG  332

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  333   IAMQASYPT  341



>gb|AHA62779.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              VAA EGL Q+KTGKL+SLSEQELVDCD +  D GCEGGL++ A++FI+ N GLTTE+NY
Sbjct  156   TVAATEGLNQLKTGKLISLSEQELVDCD-TNFDQGCEGGLLDTAYTFILKNGGLTTESNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG+C  K +A + A I GY+ VPA+DE ALL+AVA QPVSVA+ G  FDFQFY  
Sbjct  215   PYMATDGICTTKHSAKSDASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+HAV  IGYG + DG KYWLIKNSWG  WGE+GYMRI RD   K GLCG
Sbjct  275   GVFQGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKYGLCG  334

Query  482   LARDATYPV  456
             LA   +YP+
Sbjct  335   LAMQPSYPI  343



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TG L+SLSEQELVDCD S ED GC GGLM+NAF FII N G+TTE+NY
Sbjct  153   AVAATEGINQLTTGNLISLSEQELVDCDTS-EDEGCNGGLMDNAFEFIISNGGITTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK +   AKI+GYE VPA+ E ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  212   PYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYTS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG SWGE+GY+R+ RD    EGLCG
Sbjct  272   GVFTGQCGTELDHGVTAVGYGKTSDGTKYWLVKNSWGTSWGENGYIRMQRDIDAAEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AV A+EG+ Q+ TGKL+SLSEQELVDCD SG+D GCEGG M++AF FII   GLTTETNY
Sbjct  153   AVGAMEGIIQLTTGKLISLSEQELVDCDTSGKDHGCEGGYMDDAFKFIIGRHGLTTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CNA+KA  +AAKI+GY  VPA++E ALL+AV  QPVSVAI+   + FQFY  
Sbjct  213   PYQAVDGTCNARKANSSAAKITGYADVPANNESALLKAVGHQPVSVAIDAGEWAFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G+C   L+H VTA+GYGT+ +G+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  273   GIFTGECGTNLDHGVTAVGYGTSENGTKYWLVKNSWGTGWGEKGYIRMKRDIDAKEGLCG  332

Query  482   LARDATYPV  456
             +A  A++P+
Sbjct  333   IAMMASFPI  341



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ TGKL+SLSEQELVDCD  G D GCEGGLM++AF FI+ NKGL  E  Y
Sbjct  119   AVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAAEAIY  178

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK     AA I GYE VPA+ E ALL+AVA+QPVSVAI  + F+FQFY  
Sbjct  179   PYEGVDGTCNAKAEGNHAASIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQFYSG  238

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WG+ GY+R+ RD A KEGLCG
Sbjct  239   GVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLVKNSWGVKWGDKGYIRMQRDVAAKEGLCG  298

Query  482   LARDATYP  459
             +A  A+YP
Sbjct  299   IAMLASYP  306



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAAVEG+TQ+ T KL+SLSEQELVDCD  GED GC+GGLM++AF FI +N+GLTTE NYP
Sbjct  153   VAAVEGITQLTTKKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIENNQGLTTEANYP  212

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG CN KK A  AAKI+GYE VPA++E ALL+AV +QPVSVAI+   F FQFY  G
Sbjct  213   YVGSDGTCNTKKEANHAAKITGYEDVPANNEAALLKAVTNQPVSVAIDAGGFAFQFYSSG  272

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             +F GDC   L+H V A+GYG + +G+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG+
Sbjct  273   IFTGDCGTELDHGVAAVGYGVS-NGTKYWLVKNSWGTQWGEEGYIRMQRDIDAKEGLCGI  331

Query  479   ARDATYPV  456
             A  A+YP 
Sbjct  332   AMQASYPT  339



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TG L+SLSEQELVDCD  G D GCEGGLM++AF FI  N GL+TETNY
Sbjct  153   AVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+ E ALL+AVA+QP+SVAI+    DFQFY  
Sbjct  213   PYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  273   GVFTGSCGTSLDHGVTAVGYGVSADGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL+SLSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  121   AVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  180

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN +K    AAKI+G++ VPA+ E AL++AVA QPVSVAI+   F+FQFY  
Sbjct  181   PYTGTDGTCNTQKEVSHAAKITGFQDVPANSEAALMKAVAKQPVSVAIDAGGFEFQFYSS  240

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ +D + KEGLCG
Sbjct  241   GIFTGSCGTELDHGVTAVGYG-GSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCG  299

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  300   IAMQASYPT  308



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ Q+ TGKL+SLSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  177   AVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  236

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN +K A  AAKI+G+E VPA+ E AL++AVA QPVSVAI+   F+FQFY  
Sbjct  237   PYTGTDGTCNTQKEANHAAKITGFEDVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSS  296

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ +D + KEGLCG
Sbjct  297   GIFTGSCGTELDHGVTAVGYG-GSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCG  355

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  356   IAMQASYPT  364



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++ TGKL+SLSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  152   AVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  KAA+ AAKI+G+E VPA+ E AL++AVA QPVSVAI+    DFQFY  
Sbjct  212   PYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C+  L+H VTA+GYG + DGSKYWL+KNSWG  WGE GY+R+ +D + KEGLCG
Sbjct  272   GIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TG L+SLSEQELVDCD  G D GCEGGLM++AF FI  N GL TETNY
Sbjct  153   AVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFISQNHGLRTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+ E ALL+AVA+QP+SVAI+    DFQFY  
Sbjct  213   PYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  273   GVFTGSCGTSLDHGVTAVGYGVSADGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++ TGKL+SLSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  152   AVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KK+A+ AAKI+G+E VPA+ E AL++AVA QPVSVAI+    DFQFY  
Sbjct  212   PYKGTDGTCNTKKSAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C+  L+H VTA+GYG + DGSKYWL+KNSWG  WGE GY+R+ +D + KEGLCG
Sbjct  272   GIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++ TGKL+SLSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  152   AVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  KAA+ AAKI+G+E VPA+ E AL++AVA QPVSVAI+    DFQFY  
Sbjct  212   PYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C+  L+H VTA+GYG + DGSKYWL+KNSWG  WGE GY+R+ +D + KEGLCG
Sbjct  272   GIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_006281607.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
 gb|EOA14505.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
Length=346

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG  QIK GKL+SLSEQ+LVDCD +  D GCEGGLM+ AF+ I    GLTTE+NYP
Sbjct  160   VAAIEGAAQIKKGKLISLSEQQLVDCDPN--DYGCEGGLMDTAFAHIKATGGLTTESNYP  217

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y  +D  CN+KK +  A  I+GYE VPA+DE AL++AVA QPVSVAI G  F FQFY  G
Sbjct  218   YKGEDATCNSKKTSPKATTITGYEDVPANDESALMKAVAHQPVSVAIEGGGFAFQFYSSG  277

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G+C   L+HAVTA+GYG   +GSKYW+IKNSWG  WGESGYMRI +D   K+GLCGL
Sbjct  278   VFSGECTTNLDHAVTAVGYGETTNGSKYWIIKNSWGTKWGESGYMRIQKDIKDKQGLCGL  337

Query  479   ARDATYPVL  453
             A +A+YP +
Sbjct  338   AMEASYPTI  346



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ T KL+SLSEQELVDCD S ED GC GGLM++AF FII N G+TTE+NY
Sbjct  153   AVAATEGINQLTTRKLISLSEQELVDCDTS-EDEGCNGGLMDDAFEFIISNGGITTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK +  AAKI+GYE VPA+ E ALL+AVA+QPVSVAI+ +  DFQFY  
Sbjct  212   PYEGVDGTCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+H VTA+GYG   DG+KYWL+KNSWG+SWGE+GY+R+ RD    EGLCG
Sbjct  272   GVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNSWGSSWGENGYIRMQRDIDAAEGLCG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TG L+SLSEQELVDCD + ED GCEGGLM++AF FI  N G++TE NY
Sbjct  155   AVAATEGITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGISTEANY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAKK A  AAKI+G+E VPA+ EK LL AVA QPVSVAI+ +  DFQFY  
Sbjct  215   PYEGVDGTCNAKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  275   GVFSGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMAASYPT  343



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ T KL+SLSEQEL+DCD SG D GCEGGLM++AF FII N GLTTE NY
Sbjct  137   AVAAMEGITKLSTEKLISLSEQELIDCDTSGIDQGCEGGLMDDAFEFIIQNNGLTTEANY  196

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A+DG CN +KAA  AA I+ YE VP ++E+AL  AVA+QPVSVAI+     FQ Y  
Sbjct  197   PYQAEDGTCNTEKAANHAATITSYEDVPENNEEALRMAVANQPVSVAIDAGESAFQHYSS  256

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F GDC   L+H VT +GYGT+ DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  257   GIFTGDCGTELDHGVTVVGYGTSDDGTKYWLVKNSWGTSWGEDGYIRMQRDIDAKEGLCG  316

Query  482   LARDATYPV  456
             +A   +YP 
Sbjct  317   IAMQPSYPT  325



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SG D GC+GGLM++AF FI  N GL+TE NY
Sbjct  153   AVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCQGGLMDDAFQFINQNHGLSTEANY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+ E AL++AVA+QP+SVAI+ +  DFQFY  
Sbjct  213   PYTGVDGTCNTKKEANHAAKITGHEDVPANREDALMKAVANQPISVAIDASGSDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  273   GVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRGIEAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TG L+SLSEQELVDCD  G D GCEGGLM++AF FI  N GL+TETNY
Sbjct  153   AVAAMEGITKLSTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+ E ALL+AVA+QPVSVAI+    DFQFY  
Sbjct  213   PYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPVSVAIDAGGSDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  273   GVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>ref|XP_009128825.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY50483.1| BnaA02g24130D [Brassica napus]
Length=346

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG TQIK GKL+SLSEQ+LVDCD +  D GC GGLM+ AF  I+   GLTTE+NY
Sbjct  159   AVAAIEGATQIKKGKLISLSEQQLVDCDTN--DFGCSGGLMDTAFEHIMATGGLTTESNY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +D  C  K    +AA I+GYE VP +DE AL++AVA QPVSV I G  FDFQFY  
Sbjct  217   PYKGEDATCKIKSTKPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTA+GY  +  GSKYW+IKNSWG  WGE GYMRI +D   KEGLCG
Sbjct  277   GVFTGECTTYLDHAVTAVGYSQSSAGSKYWIIKNSWGTKWGEGGYMRIKKDIKDKEGLCG  336

Query  482   LARDATYPVL  453
             LA  A+YP +
Sbjct  337   LAMKASYPTI  346



>gb|AHA62783.1| RCR3-like cysteine protease [Mirabilis viscosa]
Length=343

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              VAA EGL Q+KTGKL+SLSEQELVDCD S  D GCEGGL++ A++FI+ N GLTTE+NY
Sbjct  156   TVAATEGLNQLKTGKLISLSEQELVDCDTSF-DQGCEGGLLDTAYTFILKNGGLTTESNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG+C  K +A +AA I GY+ VPA+DE ALL+AVA QPVSVA+ G  FDFQFY  
Sbjct  215   PYMATDGICTTKHSAKSAASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+HAV  IGYG + DG KYWLIKNSWG  WGE+GYMRI RD   K GLCG
Sbjct  275   GVFQGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRD-VDKYGLCG  333

Query  482   LARDATYPV  456
             LA   +YP+
Sbjct  334   LAMQPSYPI  342



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ TGKL+SLSEQELVDCD  G D GCEGGLM++AF FI+ NKGL TE  Y
Sbjct  153   AVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNTEAKY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CNA   A  AA I G+E VPA+ E ALL+AVA+QP+SVAI+ +  +FQFY  
Sbjct  213   PYQGVDATCNANAEAKDAASIKGFEDVPANSESALLKAVANQPISVAIDASGSEFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ RD A +EGLCG
Sbjct  273   GLFTGSCGTELDHGVTAVGYGVSDDGTKYWLVKNSWGEQWGEEGYIRMQRDVAAEEGLCG  332

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  333   IAMQASYPT  341



>ref|XP_004975184.1| PREDICTED: vignain-like [Setaria italica]
Length=340

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VA++EG+ ++ TGKL+SLSEQELVDCDV+G D GCEGG M+NAF FII N GLTTE+NYP
Sbjct  152   VASMEGIVKLSTGKLISLSEQELVDCDVNGMDQGCEGGEMDNAFEFIIDNGGLTTESNYP  211

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y+A DG CN+ KA+  AA I GYE VPA+DE +L +AVA+QPVSVA++G    F+FY+ G
Sbjct  212   YTASDGTCNSNKASNDAASIKGYEDVPANDEASLRKAVANQPVSVAVDGGDSLFRFYKGG  271

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             V  G C   L+H + A+GYG A DG+KYWL+KNSWG SWGE GY+R+ RD A +EGLCGL
Sbjct  272   VLSGSCGTELDHGIAAVGYGVASDGTKYWLMKNSWGTSWGEGGYIRMERDIADEEGLCGL  331

Query  479   ARDATYPVL  453
             A   +YP +
Sbjct  332   AMQPSYPTV  340



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TG L+SLSEQELVDCD  G D GCEGGLM++AF FI  N GL+TETNY
Sbjct  153   AVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AAKI+G+E VPA+ E ALL+AVA+QP+SVAI+    DFQFY  
Sbjct  213   PYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  273   GVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEKGYIRMQRGVEAKEGLCG  332

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  333   IAMEASYPT  341



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ TGKL+SLSEQE+VDCDV+ +D GC GG M++AF +II NKG+TTE NY
Sbjct  151   AVAATEGITKLSTGKLISLSEQEVVDCDVTSDDQGCNGGEMDDAFEYIIKNKGITTEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CN KKAA  AA I+GYE V  + E ALL+A A+QP++VAI+   F FQ Y  
Sbjct  211   PYKAADGTCNTKKAASHAASITGYEDVTVNSEAALLKAAANQPIAVAIDAGDFAFQMYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   L+H VT +GYG   DG+KYWL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  271   GVFTGDCGTDLDHGVTLVGYGATSDGTKYWLVKNSWGTSWGEDGYIRMERDVDAKEGLCG  330

Query  482   LARDATYPV  456
             +A DA+YP 
Sbjct  331   IAMDASYPT  339



>ref|XP_010906195.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X2 [Elaeis guineensis]
Length=246

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+T++KT KL+SLSEQELV+CDV GED GC GGL + A  FII N GL TETNYP
Sbjct  57    VAAMEGITKLKTHKLISLSEQELVECDVGGEDEGCNGGLPDAALEFIIKNGGLATETNYP  116

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG CN KK+A  AA I GYE+VPA+ E ALL+AVA+QPVSV I+     FQFY  G
Sbjct  117   YKGMDGTCNTKKSASHAASIKGYEQVPANSEAALLKAVANQPVSVNIDSGGSSFQFYASG  176

Query  659   VFD-GDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             VF  G CE  L+H+VTA+GYG A DG+KYWL+KNSWG+SWGE GY+R+ RD + KEGLCG
Sbjct  177   VFTGGSCETDLDHSVTAVGYGKAKDGTKYWLVKNSWGSSWGEKGYIRMERDVSAKEGLCG  236

Query  482   LARDATYPV  456
             +A  A YP 
Sbjct  237   IAMQAYYPT  245



>gb|AAP32194.1| cysteine protease 1 [Trifolium repens]
Length=292

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TGKLVSLSEQEL+DCD  G D GCEGGLM++AF FII N GL+TE  Y
Sbjct  103   AVAATEGIHQLSTGKLVSLSEQELIDCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEVQY  162

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNA KA++ A  I+GYE VPA++E AL +AVA+QP+SVAI+ +  DFQFY  
Sbjct  163   PYEGVDGTCNANKASIHAVTITGYEDVPANNELALQKAVANQPISVAIDASGSDFQFYNS  222

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ R  A  EGLCG
Sbjct  223   GVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSWGADWGEEGYIRMQRGIAAAEGLCG  282

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  283   IAMQASYPT  291



>ref|XP_008780645.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=286

 Score =   244 bits (622),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ QI TGKL SLSEQ+LVDCD   ++ GC+GG+M++AF FII NKG+TTE NY
Sbjct  99    AVAATEGIAQISTGKLTSLSEQQLVDCD--KKNGGCDGGIMDDAFKFIISNKGITTEANY  156

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A+DG C+  K++  AA ISGYE VP + E +LLQAVA QPVSVAI G+  DFQFY  
Sbjct  157   PYMAKDGTCDTNKSSSVAATISGYEDVPRNSESSLLQAVAKQPVSVAIEGSGKDFQFYSG  216

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+HAVT +GYGTA DG+KYWL+KNSWG +WGE+GYMR+ RD    EGLCG
Sbjct  217   GVFMGNCGTDLDHAVTVVGYGTATDGTKYWLLKNSWGTTWGENGYMRLLRDIDDAEGLCG  276

Query  482   LARDATYPV  456
             +A   +YP 
Sbjct  277   IAMQPSYPT  285



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ TGKL+SLSEQELVDCD  G D GCEGGLM++AF FI+ NKGL  E  Y
Sbjct  154   AVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAAEAIY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNAK     A  I GYE VPA+ E ALL+AVA+QPVSVAI  + F+FQFY  
Sbjct  214   PYEGVDGTCNAKAEGNHATSIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQFYSG  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WG+ GY+R+ RD A KEGLCG
Sbjct  274   GVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLVKNSWGVKWGDKGYIRMQRDVAAKEGLCG  333

Query  482   LARDATYP  459
             +A  A+YP
Sbjct  334   IAMLASYP  341



>gb|AHA62782.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=343

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              VAA EGL Q+KTGKL+SLSEQELVDCD S  D GCEGGL++ A++FI+ N GLTTE+NY
Sbjct  156   TVAATEGLNQLKTGKLISLSEQELVDCDTSF-DQGCEGGLLDTAYTFILKNGGLTTESNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG+C  K +A + A I GY+ VPA+DE ALL+AVA QPVSVA+ G  FDFQFY  
Sbjct  215   PYMATDGICTTKHSAKSDASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C   L+HAV  IGYG + DG KYWLIKNSWG  WGE+GYMRI RD   K GLCG
Sbjct  275   GVFQGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRD-VDKYGLCG  333

Query  482   LARDATYPV  456
             LA   +YP+
Sbjct  334   LAMQPSYPI  342



>ref|XP_007048673.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOX92830.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=304

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++  GKL+SLSEQELVDCD  GED GC+GGLM++AF FI  N+GLTTE  Y
Sbjct  115   AVAAMEGITKLTNGKLISLSEQELVDCDTKGEDQGCQGGLMDDAFEFIEKNQGLTTEAIY  174

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  K A  A KI+G+E VPA+ E ALL+AVA+QPVSVAI+   F FQFY  
Sbjct  175   PYKGVDGTCNTNKEANHATKINGHEDVPANSEAALLKAVANQPVSVAIDAGGFGFQFYSG  234

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   L+H VTAIGYG   DG+K+WL+KNSWG SWGE GY+R+ RD   KEGLCG
Sbjct  235   GIFSGACGTQLDHGVTAIGYGVGDDGTKHWLVKNSWGTSWGEKGYIRMQRDVDAKEGLCG  294

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  295   IAMQASYPT  303



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++ TGKL+ LSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  172   AVAAIEGINKLTTGKLIFLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  231

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN KKA   AAKI+G+E VPA+ E AL++AVA QPVSVAI+   +DFQFY  
Sbjct  232   PYKGTDGTCNTKKATNHAAKITGFEYVPANSEAALMKAVAEQPVSVAIDAGGYDFQFYSS  291

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C+  L+H VTA+GYG + DGSKYWL+KNSWG  WGE GY+R+ +D   KEGLCG
Sbjct  292   GIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSWGAQWGEEGYIRMQKDIPAKEGLCG  350

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  351   IAMQASYPT  359



>gb|AEK97329.1| chromoplast senescence-associated protein 12 [Brassica rapa var. 
parachinensis]
Length=260

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG TQIK GKL+SLSEQ+LVDCD +  D GC GGL++ AF  I+   GLTTE+NY
Sbjct  73    AVAAIEGATQIKKGKLISLSEQQLVDCDTN--DFGCSGGLIDTAFEHIMATGGLTTESNY  130

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +D  C  K    +AA I+GYE VP +DE AL++AVA QPVSV I G  FDFQFY  
Sbjct  131   PYKGEDATCKIKSTXPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFDFQFYSS  190

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTA+GY  +  GSKYW+IKNSWG  WGE GYMRI +D   KEGLCG
Sbjct  191   GVFTGECTTYLDHAVTAVGYSQSSAGSKYWIIKNSWGTKWGEGGYMRIKKDIKDKEGLCG  250

Query  482   LARDATYP  459
             LA  A+YP
Sbjct  251   LAMKASYP  258



>gb|AAD53011.1|AF089848_1 senescence-specific cysteine protease [Brassica napus]
Length=346

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG TQIK GKL+SLSEQ+LVDCD +  D GC GGLM+ AF  I+   GLTTE+NY
Sbjct  159   AVAAIEGATQIKKGKLISLSEQQLVDCDTN--DFGCSGGLMDTAFEHIMATGGLTTESNY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +D  C  K    +AA I+GYE VP +DE AL++AVA QPVSV I G  FDFQFY  
Sbjct  217   PYKGEDANCKIKSTKPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTA+GY  +  GSKYW+IKNSWG  WGE GYMRI +D   KEGLCG
Sbjct  277   GVFTGECTTYLDHAVTAVGYSQSSAGSKYWIIKNSWGTKWGEGGYMRIKKDIKDKEGLCG  336

Query  482   LARDATYPVL  453
             LA  A+YP +
Sbjct  337   LAMKASYPTI  346



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAAVEG+TQ+ T KL+SLSEQELVDCD  GED GC+GGLM++AF FI  N+GLTTE NY
Sbjct  152   AVAAVEGITQLTTQKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIETNQGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+ K A  AAKI+GYE VPA++E ALL+AVA QPVSVAI+   ++FQFY  
Sbjct  212   PYEGSDGTCNSNKEANHAAKITGYEDVPANNEAALLKAVAKQPVSVAIDAGGYEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F GDC   L+H V A+GYG +  G+ YWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  272   GIFTGDCGTELDHGVAAVGYGVS-QGTNYWLVKNSWGTQWGEEGYIRMQRDIDAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T++ TGKL+SLSEQELVDCD SG D GC GGLM++AF FI  N GL+TETNY
Sbjct  295   AVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCGGGLMDDAFQFINKNHGLSTETNY  354

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN KK A  AA+I+GYE VPA+ E+ALL+AVA+QP+SVAI+    DFQFY  
Sbjct  355   PYTGVDGTCNTKKEASHAAQITGYEDVPANSEEALLKAVANQPISVAIDAGGSDFQFYSS  414

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R    KEGLCG
Sbjct  415   GVFTGTCGTSLDHGVTAVGYGISADGTKYWLVKNSWGTQWGEEGYIRMQRGVKAKEGLCG  474

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  475   IAMEASYPT  483



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+ ++KTGKL+SLSEQ+LVDCDV   + GC GG M+NAF +II N GL +E NYP
Sbjct  119   VAAIEGIIKLKTGKLISLSEQQLVDCDVG--NNGCHGGFMDNAFQYIIRNGGLASEDNYP  176

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG CN++KA+   A+I+GYE VP ++E ALLQAVA QPVSV ++G   DFQFY+ G
Sbjct  177   YQGVDGTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVVVDGGGQDFQFYKSG  236

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF GDC    NHAVTAIGYGT  DG+ YWL+KNSWG SWGESGYMR+ R     EGLCG+
Sbjct  237   VFKGDCGTEQNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGESGYMRMQRGIGASEGLCGV  296

Query  479   ARDATYPV  456
             A DA+YP 
Sbjct  297   AMDASYPT  304



>emb|CDX87758.1| BnaC02g31910D [Brassica napus]
Length=346

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG TQIK GKL+SLSEQ+LVDCD +  D GC GGLM+ AF  I+   GLTTE+NY
Sbjct  159   AVAAIEGATQIKKGKLISLSEQQLVDCDTN--DFGCSGGLMDTAFEHIMATGGLTTESNY  216

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY  +D  C  K    +AA I+GYE VP +DE AL++AVA QPVSV I G  FDFQFY  
Sbjct  217   PYKGEDANCKIKSTKPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFDFQFYSS  276

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+C  YL+HAVTA+GY  +  GSKYW+IKNSWG  WGE GYMRI +D   KEGLCG
Sbjct  277   GVFTGECTTYLDHAVTAVGYSQSSAGSKYWIIKNSWGTKWGEGGYMRIKKDIKDKEGLCG  336

Query  482   LARDATYPVL  453
             LA  A+YP +
Sbjct  337   LAMKASYPTI  346



>ref|XP_008650514.1| PREDICTED: vignain-like [Zea mays]
 gb|AFW76901.1| hypothetical protein ZEAMMB73_101481 [Zea mays]
Length=232

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +I TGKL+SLSEQELVDCDV GED GCEGGLM++AF FII N GLTTE+NY
Sbjct  45    AVAATEGIVKISTGKLISLSEQELVDCDVYGEDQGCEGGLMDDAFKFIIKNGGLTTESNY  104

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C +   + A   I GYE VP +DE AL++AVA+QPVSVA++G    FQFY  
Sbjct  105   PYTAADGKCKSGSNSAAN--IKGYEDVPTNDEAALMKAVANQPVSVAVDGGDMTFQFYSG  162

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG   DG+KYWL+KNSWG +WGE+GY+R+ +D + K+G+CG
Sbjct  163   GVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKKGMCG  222

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  223   LAIEPSYPT  231



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAAVEG+TQ+ T KL+SLSEQELVDCD  GED GC+GGLM++AF FI  N+GLTTE NY
Sbjct  152   AVAAVEGITQLATSKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIEQNQGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN K+ A  AAKI+G+E VPA++E AL++AVA QPVSVAI+   F+FQFY  
Sbjct  212   PYEGSDGTCNTKQEANHAAKINGFEDVPANNEGALMKAVAKQPVSVAIDAGGFEFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F GDC   L+H V A+GYG + +G  YWL+KNSWG  WGE GY+R+ +D   KEGLCG
Sbjct  272   GIFTGDCGTELDHGVAAVGYGES-NGMNYWLVKNSWGTQWGEEGYIRMQKDIDAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_008368631.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG TQ+ TG L+SLSEQELVDCD +GED GCEGGLM++AF F   N G++TE NY
Sbjct  155   AVAATEGXTQLTTGXLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFXQQNHGISTEXNY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+   G CN KK A+ AAKI+G+E VPA+ EKALL AVA QPVSVAI+ +  DFQFY  
Sbjct  215   PYNGVXGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  275   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAXEGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMSASYPT  343



>gb|KHN05804.1| Vignain [Glycine soja]
Length=295

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             V AVEG+ QIKT KLVSLSEQELVDCD   ++ GC GGLME+AF FI    G+TTE+NYP
Sbjct  91    VVAVEGINQIKTNKLVSLSEQELVDCDTK-KNAGCNGGLMESAFEFIKQKGGITTESNYP  149

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y+AQDG C+A KA   A  I G+E VPA+DE ALL+AVA+QPVSVAI+    DFQFY EG
Sbjct  150   YTAQDGTCDASKANDLAVSIDGHENVPANDENALLKAVANQPVSVAIDAGGSDFQFYSEG  209

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF GDC   LNH V  +GYGT  DG+ YW ++NSWG  WGE GY+R+ R  +KKEGLCG+
Sbjct  210   VFTGDCSTELNHGVAIVGYGTTVDGTDYWTVRNSWGPEWGEQGYIRMQRSISKKEGLCGI  269

Query  479   ARDATYPV  456
             A  A+YP+
Sbjct  270   AMMASYPI  277



>ref|XP_003609015.1| Cysteine proteinase [Medicago truncatula]
 gb|AES91212.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ TGKLVSLSEQELVDCD  G D GCEGGLM++AF FII N GL+TE  Y
Sbjct  156   AVAATEGITKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEAAY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNA KA++ AA I+GYE VPA++E+AL +AVA+QP+SVAI+ +  DFQFY+ 
Sbjct  216   PYQGVDGTCNANKASIHAATITGYEDVPANNEQALQKAVANQPISVAIDASGSDFQFYKS  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ R     EGLCG
Sbjct  276   GVFSGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSWGTDWGEEGYIRMQRGVDAAEGLCG  335

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  336   IAMQASYPT  344



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++ TGKL+SLSEQE+VDCD  GED GC GGLM++AF FI  NKGLTTE NY
Sbjct  152   AVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEKNKGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY    G CN KKAA  AAKI+G+E VPA+ E AL++AVA QPVSVAI+   +DFQFY  
Sbjct  212   PYKGTHGTCNTKKAANHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGYDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F G C   L+H VTA+GYG + DGSKYWL+KNSWG  WGE GY+R+ +D + KEGLCG
Sbjct  272   GIFTGSCGTQLDHGVTAVGYGVS-DGSKYWLVKNSWGAQWGEEGYIRMQKDVSAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+TQI  G LVSLSEQ++VDCDV   + GC GG M  AF ++I N G+TTE NYP
Sbjct  149   VAAIEGITQINNGNLVSLSEQQVVDCDVKDGNRGCHGGFMTRAFQYVIDNGGITTEENYP  208

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y A DG C+  KA+ +AA ISGY+ VP +DE +LLQAV+ QPVSV I+G   DFQ Y  G
Sbjct  209   YMAADGTCDTNKASSSAATISGYQNVPVNDESSLLQAVSKQPVSVGIDGGGQDFQHYSSG  268

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             +F G CE  ++HAVTAIGYGTA DG+KYWL+KNSWG +WGE GYMRI RD +  EGLCG+
Sbjct  269   IFAGPCETNMDHAVTAIGYGTAEDGTKYWLLKNSWGTTWGEKGYMRIQRDVSAPEGLCGI  328

Query  479   ARDATYPV  456
             A+ A+YP 
Sbjct  329   AKLASYPT  336



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+TQ+ TG L+SLSEQELVDCD + ED GCEGGLM++AF FI  N G+ TE NY
Sbjct  155   AVAATEGITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGIGTEANY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN+KK A  AAKI+G+E VPA+ EK LL AVA QPVSVAI+ +  DFQFY  
Sbjct  215   PYEGVDGTCNSKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDFQFYSS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE+GY+R+ RD A  EGLCG
Sbjct  275   GVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCG  334

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  335   IAMAASYPT  343



>gb|AAP32197.1| cysteine protease 10 [Trifolium repens]
Length=272

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 139/189 (74%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ Q+ TGKLVSLSEQEL+DCD  G D GCEGGLM++AF FII N GL+TE  Y
Sbjct  83    AVAATEGIHQLSTGKLVSLSEQELIDCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEVQY  142

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  +A++ A  I+GYE VPA++E AL +AVA+QP+SVAI+ +  DFQFY  
Sbjct  143   PYEGVDGTCNTNEASIHAVTITGYEDVPANNELALQKAVANQPISVAIDASGSDFQFYNS  202

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+R+ R     EGLCG
Sbjct  203   GVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSWGADWGEEGYIRMQRGIDAAEGLCG  262

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  263   IAMQASYPT  271



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+T++KT KL+SLSEQELV+CDV GED GC GGL + A  FII N GL TETNYP
Sbjct  154   VAAMEGITKLKTHKLISLSEQELVECDVGGEDEGCNGGLPDAALEFIIKNGGLATETNYP  213

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG CN KK+A  AA I GYE+VPA+ E ALL+AVA+QPVSV I+     FQFY  G
Sbjct  214   YKGMDGTCNTKKSASHAASIKGYEQVPANSEAALLKAVANQPVSVNIDSGGSSFQFYASG  273

Query  659   VFD-GDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             VF  G CE  L+H+VTA+GYG A DG+KYWL+KNSWG+SWGE GY+R+ RD + KEGLCG
Sbjct  274   VFTGGSCETDLDHSVTAVGYGKAKDGTKYWLVKNSWGSSWGEKGYIRMERDVSAKEGLCG  333

Query  482   LARDATYPV  456
             +A  A YP 
Sbjct  334   IAMQAYYPT  342



>gb|ACU23531.1| unknown [Glycine max]
Length=362

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             V AVEG+ QIKT KLVSLSEQELVDCD   ++ GC GGLME+AF FI    G+TTE+NYP
Sbjct  158   VVAVEGINQIKTNKLVSLSEQELVDCDTK-KNAGCNGGLMESAFEFIKQKGGITTESNYP  216

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y+AQDG C+A KA   A  I G+E VPA+DE ALL+AVA+QPVSVAI+   FDFQFY EG
Sbjct  217   YTAQDGTCDASKANDLAVSIDGHENVPANDENALLKAVANQPVSVAIDAGGFDFQFYFEG  276

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF GDC   LNH V  +GYGT  DG+ YW ++NSWG  WGE GY+R+ R   KKEGLCG+
Sbjct  277   VFTGDCSTELNHGVAIVGYGTTVDGTNYWTVRNSWGPEWGEQGYIRMQRSIFKKEGLCGI  336

Query  479   ARDATYPV  456
             A  A+YP+
Sbjct  337   AMMASYPI  344



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +I TGKLVSL+EQELVDCDV GED GCEGGLM++AF FII+N GLTTE++Y
Sbjct  153   AVAATEGIVKISTGKLVSLAEQELVDCDVHGEDQGCEGGLMDDAFKFIINNGGLTTESSY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C +   + A   I GYE VPA+DE AL++AVA+QPVSVA++G    FQFY  
Sbjct  213   PYTAADGKCKSGSNSAAT--IKGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG   DG+KYWL+KNSWG +WGE+GY+R+ +D + K G+CG
Sbjct  271   GVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCG  330

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  331   LAMEPSYPT  339



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAAVEG+TQ+ T KL+SLSEQELVDCD  GED GC+GGLM++AF FI  N+GLTTE NY
Sbjct  152   AVAAVEGITQLATSKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIEQNQGLTTEANY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN K+ A  AAKI+G+E VPA++E AL++AVA QPVSVAI+   F FQFY  
Sbjct  212   PYEGSDGTCNTKQEANHAAKINGFEDVPANNEGALMKAVAKQPVSVAIDAGGFGFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G+F GDC   L+H V A+GYG + +G  YWL+KNSWG  WGE GY+R+ +D   KEGLCG
Sbjct  272   GIFTGDCGTELDHGVAAVGYGES-NGMNYWLVKNSWGTQWGEEGYIRMQKDIDAKEGLCG  330

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  331   IAMQASYPT  339



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA +G+ +IKTGKL+SLSEQELVDCD S  DMGCEGGLM++AF FII N GLTTE+NY
Sbjct  153   AVAATKGINEIKTGKLISLSEQELVDCDTS-SDMGCEGGLMDDAFKFIIKNHGLTTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C   K +  AAKI+GYE VPA+ E ALL AVA+QPVSVAI+ +  DFQFY  
Sbjct  212   PYEGTDGTCKTGKESNDAAKITGYEDVPANSESALLNAVANQPVSVAIDASGSDFQFYSS  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G+    L+H VTA+GYG   DG+KYWL+KNSWG SWGE+GY+R+ R    +EG+CG
Sbjct  272   GVFTGEYGTDLDHGVTAVGYGITSDGTKYWLVKNSWGTSWGENGYIRMQRGVVPEEGICG  331

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  332   IAMQASYPT  340



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +I TGKL+SLSEQELVDCDV GED GCEGGLM++AF FII N GLTTE+NY
Sbjct  153   AVAATEGIVKISTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C +   + A   I GYE VP +DE AL++AVA+QPVSVA++G    FQFY  
Sbjct  213   PYTAADGKCKSGSNSAAN--IKGYEDVPTNDEAALMKAVANQPVSVAVDGGDMTFQFYSG  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG   DG+KYWL+KNSWG +WGE+GY+R+ +D + K+G+CG
Sbjct  271   GVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKKGMCG  330

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  331   LAMEPSYPT  339



>ref|NP_001237379.1| cysteine proteinase precursor [Glycine max]
 dbj|BAC77521.1| cysteine proteinase [Glycine max]
 dbj|BAC77522.1| cysteine proteinase [Glycine max]
Length=362

 Score =   244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             V AVEG+ QIKT KLVSLSEQELVDCD   ++ GC GGLME+AF FI    G+TTE+NYP
Sbjct  158   VVAVEGINQIKTNKLVSLSEQELVDCDTK-KNAGCNGGLMESAFEFIKQKGGITTESNYP  216

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y+AQDG C+A KA   A  I G+E VPA+DE ALL+AVA+QPVSVAI+    DFQFY EG
Sbjct  217   YTAQDGTCDASKANDLAVSIDGHENVPANDENALLKAVANQPVSVAIDAGGSDFQFYSEG  276

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF GDC   LNH V  +GYGT  DG+ YW ++NSWG  WGE GY+R+ R  +KKEGLCG+
Sbjct  277   VFTGDCSTELNHGVAIVGYGTTVDGTNYWTVRNSWGPEWGEQGYIRMQRSISKKEGLCGI  336

Query  479   ARDATYPV  456
             A  A+YP+
Sbjct  337   AMMASYPI  344



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ +I TGKL+SLSEQELVDCDV GED GC GG M++AF+FII N GLTTE++Y
Sbjct  153   AVAAMEGIVKISTGKLISLSEQELVDCDVHGEDQGCNGGEMDDAFTFIIKNGGLTTESSY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+AQDG C A   + A   I GYE VPA+DE AL++AVA+QPVSVA++G    FQFY  
Sbjct  213   PYAAQDGQCKAGSNSAAT--IKGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSG  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYGTA DG+KYWL+KNSWG +WGE+G++R+ +D + K G+CG
Sbjct  271   GVMTGSCGTDLDHGIAAIGYGTASDGTKYWLLKNSWGTTWGENGFLRMEKDISDKRGMCG  330

Query  482   LARDATYPV  456
             LA   +YP 
Sbjct  331   LAMQPSYPT  339



>ref|XP_004501841.1| PREDICTED: vignain-like [Cicer arietinum]
Length=362

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              V AVEG+ QIKT KLVSLSEQEL+DCD + E+ GC GGLMENAF FI    G+TTE+NY
Sbjct  157   TVVAVEGINQIKTNKLVSLSEQELIDCD-NQENQGCNGGLMENAFEFIKKTGGITTESNY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C++ K    A  I G+E VPA+DE +LL+AVA+QPVSVAI+    DFQFY E
Sbjct  216   PYTANDGSCDSLKENSPAVSIDGHETVPANDEDSLLKAVANQPVSVAIDAGGSDFQFYSE  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   LNH V  +GYGT  DG+ YW+++NSWG  WGE GY+R+ R+ ++KEGLCG
Sbjct  276   GVFSGDCGKELNHGVAVVGYGTTVDGTNYWIVRNSWGAEWGEQGYIRMKRNVSEKEGLCG  335

Query  482   LARDATYPV  456
             +A +A+YP+
Sbjct  336   IAMEASYPI  344



>ref|XP_006388352.1| hypothetical protein POPTR_0213s00210g, partial [Populus trichocarpa]
 gb|ERP47266.1| hypothetical protein POPTR_0213s00210g, partial [Populus trichocarpa]
Length=194

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+ +++TG L+SLSEQ+LVDC  +  + GC+GGLM+ AF +II N GLT+E NYP
Sbjct  8     VAAIEGIIKLQTGNLISLSEQQLVDC--TAGNKGCQGGLMDTAFQYIIRNGGLTSEDNYP  65

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG C+++KAA   A+I+GYE VP ++E ALLQAVA QPVSVA++G   DF+FY+ G
Sbjct  66    YQGVDGTCSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVDGGGNDFRFYKSG  125

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF+GDC   LNH VTAIGYGT  DG+ YWL+KNSWG SWGE+GYMR+ R     EGLCG+
Sbjct  126   VFEGDCGTNLNHGVTAIGYGTDSDGTDYWLVKNSWGTSWGENGYMRMRRGIGSSEGLCGV  185

Query  479   ARDATYPV  456
             A DA+YP 
Sbjct  186   AMDASYPT  193



>gb|KCW76140.1| hypothetical protein EUGRSUZ_D00517 [Eucalyptus grandis]
Length=324

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+E +TQIKTGKL+ LSEQ+LVDC +  E+ GC GG M+ AF +II N G+++ETNY
Sbjct  137   AVAAIESITQIKTGKLLELSEQQLVDCTI--ENYGCSGGWMDTAFDYIIQNGGISSETNY  194

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A DG CNA  A+++ AKI GYE VPA++E  +L+AVA QPVSVA++G+  +FQ Y  
Sbjct  195   PYDASDGTCNAHMASLSVAKIVGYEDVPANNEGEILKAVAMQPVSVALDGSGQEFQLYSS  254

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF+G+C   ++HAV  +GYGTA DG+KYW I+NSWG +WGE+GYMRI RDYA+ EGLCG
Sbjct  255   GVFNGNCGTNMSHAVAIVGYGTAEDGTKYWKIRNSWGKTWGEAGYMRIQRDYAQPEGLCG  314

Query  482   LARDATYPVL  453
             LA  A+YPV+
Sbjct  315   LAMHASYPVV  324



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +I TGKLVSL+EQELVDCDV GED GCEGGLM++AF FII N GLTTE++Y
Sbjct  153   AVAATEGIVKISTGKLVSLAEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C +   + A   I GYE VPA+DE AL++AVA+QPVSVA++G    FQFY  
Sbjct  213   PYTAADGKCKSGSNSAAT--IKGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSG  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG   DG+KYWL+KNSWG +WGE+GY+R+ +D + K G+CG
Sbjct  271   GVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCG  330

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  331   LAMEPSYPT  339



>ref|XP_010518799.1| PREDICTED: senescence-specific cysteine protease SAG12 [Tarenaya 
hassleriana]
Length=348

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG T+IK GKL+SLSEQ+LVDCD    D GCEGGL++ AF  I  + GLTTE NYP
Sbjct  162   VAAIEGATKIKKGKLISLSEQQLVDCD--KYDYGCEGGLLDTAFEHIKESHGLTTEANYP  219

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y+ +DG CN+KKA+  AA I+GYE VPA+DEKAL++AV +QPVSVAI G  F+FQFY  G
Sbjct  220   YNGEDGTCNSKKASAKAATITGYEDVPANDEKALMKAVTNQPVSVAIEGGGFEFQFYSSG  279

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF G C   L+HAV  +GYG   DG+K+W+IKNSWG  WGESGYMRI +D   K+GLCGL
Sbjct  280   VFTGQCGTDLDHAVAVVGYGETVDGTKHWIIKNSWGEHWGESGYMRIQKDVKDKQGLCGL  339

Query  479   ARDATYPVL  453
             A  A+YP++
Sbjct  340   AMKASYPIV  348



>gb|AFW86314.1| hypothetical protein ZEAMMB73_546353 [Zea mays]
Length=233

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +I TGKLVSL+EQELVDCDV  ED GCEGGLM++AF FII N GLTTE++Y
Sbjct  46    AVAATEGIVKISTGKLVSLAEQELVDCDVHDEDQGCEGGLMDDAFKFIIKNGGLTTESSY  105

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C +   + A   I GYE VPA+DE AL++AVA+QPVSVA++G    FQFY  
Sbjct  106   PYTAADGKCKSGSNSAAT--IKGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSG  163

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG   DG+KYWL+KNSWG +WGE+GY+R+ +D + K G+CG
Sbjct  164   GVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCG  223

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  224   LAMEPSYPT  232



>gb|AFW86315.1| hypothetical protein ZEAMMB73_539008 [Zea mays]
Length=314

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +I TGKLVSL++QELVDCDV GED GCEGGLM++AF FII N GLTTE++Y
Sbjct  127   AVAATEGIVKISTGKLVSLADQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSY  186

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG CN+   + A   I GYE VPA+DE AL++A+A+QPVSVA++G    F+FY  
Sbjct  187   PYTAADGKCNSGSNSAAT--IKGYEDVPANDEAALMKAMANQPVSVAVDGGDMTFRFYSG  244

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG   DG+KYWL+KNSWG +WGE+GY+R+ +D + K G+CG
Sbjct  245   GVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCG  304

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  305   LAMEPSYPT  313



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VAA+EG+ +++TG L+SLSEQ+LVDC  +  + GC+GGLM+ AF +II N GLT+E NYP
Sbjct  154   VAAIEGIIKLQTGNLISLSEQQLVDC--TAGNKGCQGGLMDTAFQYIIRNGGLTSEDNYP  211

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y   DG C+++KAA   A+I+GYE VP ++E ALLQAVA QPVSVA+ G   DFQFY+ G
Sbjct  212   YQGVDGTCSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFYKSG  271

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             VF+GDC   LNHAVTAIGYGT  DG+ YWL+KNSWG SWGE+GYMR+ R     EGLCG+
Sbjct  272   VFEGDCGTNLNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGENGYMRMRRGIGSSEGLCGV  331

Query  479   ARDATYPV  456
             A+DA+YP 
Sbjct  332   AKDASYPT  339



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+T++ TGKL+SLSEQELVDCD  G D GCEGGLM++AF FI+ NKGL TE  Y
Sbjct  153   AVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNTEAKY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CNA   A  AA I G+E VPA+ E ALL+AVA+QP+SVAI+ +  +FQFY  
Sbjct  213   PYQGVDATCNANAEAKDAASIKGFEDVPANSESALLKAVANQPISVAIDASGSEFQFYSS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG+ G G+KYWL+KNSWG  WGE GY+R+ RD A +EGLCG
Sbjct  273   GVFTGSCGTELDHGVTAVGYGSDG-GTKYWLVKNSWGEQWGEQGYIRMQRDVAAEEGLCG  331

Query  482   LARDATYPV  456
              A  A+YP 
Sbjct  332   FAMQASYPT  340



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA++G+T++ TGKL+SLSEQELVDCD S  D GCEGGLM++AF FI  N GL+TETNY
Sbjct  353   AVAAMKGITKLTTGKLISLSEQELVDCDTSSVDQGCEGGLMDDAFQFITQNHGLSTETNY  412

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+  DG CN K  A  AA I+G+E VPA+ E ALL+AVA+QP+SV I+    DFQFY  
Sbjct  413   PYTGVDGTCNTKNEASHAATITGHEDVPANSEAALLKAVANQPISVVIDAGGSDFQFYSS  472

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+G+G + DG+KYWL+KNSWG  WGE GY+R+ RD   KEGLCG
Sbjct  473   GVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVKNSWGAEWGEEGYIRMQRDVEVKEGLCG  532

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  533   IAMEASYPT  541



>ref|XP_010054319.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW76119.1| hypothetical protein EUGRSUZ_D00496 [Eucalyptus grandis]
Length=345

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 144/190 (76%), Gaps = 4/190 (2%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+T IK GKLV LS QELVDCD    D GC GGLM++AF FI+ N GLTTE NY
Sbjct  156   AVAAMEGITMIKKGKLVPLSVQELVDCD--DNDEGCGGGLMDSAFKFIVSNGGLTTEANY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  K A  AA I+GY+ VPA++EKALLQAVA+QPVSVAI G  FDFQFY  
Sbjct  214   PYQGDDGTCNTAKTANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGFDFQFYSS  273

Query  662   GVFDGDCEPYLNHAVTAIGYG-TAGD-GSKYWLIKNSWGNSWGESGYMRITRDYAKKEGL  489
             GVF G C   ++HAVTA+GYG T+G  G+KYWL+KNSWG  WGE GYMRI +D + K GL
Sbjct  274   GVFTGSCGSDIDHAVTAVGYGKTSGSGGTKYWLMKNSWGTGWGEKGYMRIQKDVSSKAGL  333

Query  488   CGLARDATYP  459
             CGLA +A+YP
Sbjct  334   CGLATEASYP  343



>ref|XP_010052203.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76130.1| hypothetical protein EUGRSUZ_D00506 [Eucalyptus grandis]
Length=345

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 137/188 (73%), Gaps = 0/188 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EGLTQ+K  KLV LS QELVDCDV+G+D GC GG M++AF F+I N GLTTE  Y
Sbjct  156   AVAAMEGLTQLKKRKLVPLSVQELVDCDVNGKDKGCRGGYMDSAFEFVISNGGLTTEAEY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CN  K A  AA I+GY+ VPA++EKALLQAVA+QPVSVAI G    FQ Y  
Sbjct  216   PYQGTDRTCNKAKTAKHAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGLKFQLYSS  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   ++HAVT +GYG    G KYWL+KNSW   WGESGYMRI RD + K GLCG
Sbjct  276   GVFTGSCGTDIDHAVTVVGYGKTSGGIKYWLLKNSWSTEWGESGYMRIQRDVSSKAGLCG  335

Query  482   LARDATYP  459
             LA +A+YP
Sbjct  336   LAMNASYP  343



>gb|AGT16936.1| vignain-like protein [Saccharum hybrid cultivar R570]
Length=341

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +I TGKL SLSEQEL+DCDV GED GCEGGLM++AF FI+ N GLTTE++Y
Sbjct  154   AVAATEGIVKISTGKLTSLSEQELIDCDVHGEDQGCEGGLMDDAFKFIVKNGGLTTESSY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG C ++  + A   I GYE VPA+DE AL++AVA+QPVSVA++G    FQFY  
Sbjct  214   PYTAADGKCKSRSNSAAT--IKGYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSG  271

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG   DG+KYWL+KNSWG +WGE+GY+R+ +D + K G+CG
Sbjct  272   GVIAGSCGTNLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCG  331

Query  482   LARDATYPV  456
             LA + +YP+
Sbjct  332   LAMEPSYPI  340



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+  + +GKL+SLSEQELVDCD  G D GCEGGLM++AF F+I N GL TE NY
Sbjct  137   AVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANY  196

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  +AA  AA I+GYE VPA++EKAL +AVA+QPVSVAI+ +  DFQFY+ 
Sbjct  197   PYKGVDGKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKS  256

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG++YWL+KNSWG  WGE GY+R+ R    +EGLCG
Sbjct  257   GVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCG  316

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  317   IAMQASYPT  325



>emb|CBI30671.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+KTG+L+SLSEQELVDCD SGED GC GGLM++AF FII N GLTTE NY
Sbjct  131   AVAAMEGVTQLKTGELISLSEQELVDCDTSGEDQGCGGGLMDSAFEFIIGNGGLTTEANY  190

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CN KKAA +AAKI  YE VPA+ E ALL+AVA  PVSVAI+    DFQFY  
Sbjct  191   PYKGVDATCNKKKAASSAAKIKNYEDVPANSEAALLKAVAQHPVSVAIDAGGSDFQFYSS  250

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+ + RD    EGLCG
Sbjct  251   GVFTGQCGTELDHGVTAVGYGKTDDGTKYWLVKNSWGTGWGEDGYIWMERDIGADEGLCG  310

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  311   IAMEASYPT  319



>gb|EMT12294.1| Vignain [Aegilops tauschii]
Length=342

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = -3

Query  1019  VAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYP  840
             VA++EG+ ++ TGKL+SLSEQELVDCDV G D GCEGGLM+NAF FII N GLTTE NYP
Sbjct  154   VASMEGIVKLSTGKLISLSEQELVDCDVDGMDQGCEGGLMDNAFEFIIDNGGLTTEGNYP  213

Query  839   YSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEG  660
             Y+  DG CN+ K + AAA I GYE VPA+DE +L +AVA+QPVSVA++G    F+FY+ G
Sbjct  214   YTGTDGSCNSNKESNAAASIKGYEDVPANDEASLQKAVAAQPVSVAVDGGDNLFRFYKGG  273

Query  659   VFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGL  480
             V  GDC   L+H + AIGYG A DG+KYW++KNSWG SWGE+G++R+ RD   ++GLCGL
Sbjct  274   VLSGDCGTELDHGIAAIGYGVASDGTKYWVMKNSWGTSWGENGFIRMERDITDEQGLCGL  333

Query  479   ARDATYPV  456
             A   +YP 
Sbjct  334   AMQPSYPT  341



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+  + +GKL+SLSEQELVDCD  G D GCEGGLM++AF F+I N GL TE NY
Sbjct  137   AVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANY  196

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNA +AA     I+GYE VPA++EKAL +AVA+QPVSVAI+ +  DFQFY+ 
Sbjct  197   PYKGVDGKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKS  256

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG++YWL+KNSWG  WGE GY+R+ R    +EGLCG
Sbjct  257   GVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCG  316

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  317   IAMQASYPT  325



>sp|P12412.1|CYSEP_VIGMU RecName: Full=Vignain; AltName: Full=Bean endopeptidase; AltName: 
Full=Cysteine proteinase; AltName: Full=Sulfhydryl-endopeptidase; 
Short=SH-EP; Contains: RecName: Full=Vignain-1; Contains: 
RecName: Full=Vignain-2; Flags: Precursor [Vigna mungo]
 emb|CAA33753.1| sulfhydryl-pre-endopeptidase (AA -20 to 342) [Vigna mungo]
 emb|CAA36181.1| sulfhydryl-endopeptidase [Vigna mungo]
Length=362

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              + AVEG+ QIKT KLVSLSEQELVDCD   E+ GC GGLME+AF FI    G+TTE+NY
Sbjct  157   TIVAVEGINQIKTNKLVSLSEQELVDCDKE-ENQGCNGGLMESAFEFIKQKGGITTESNY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+AQ+G C+  K    A  I G+E VP +DE ALL+AVA+QPVSVAI+    DFQFY E
Sbjct  216   PYTAQEGTCDESKVNDLAVSIDGHENVPVNDENALLKAVANQPVSVAIDAGGSDFQFYSE  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   LNH V  +GYGT  DG+ YW+++NSWG  WGE GY+R+ R+ +KKEGLCG
Sbjct  276   GVFTGDCNTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEQGYIRMQRNISKKEGLCG  335

Query  482   LARDATYPV  456
             +A  A+YP+
Sbjct  336   IAMMASYPI  344



>ref|XP_010052201.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76129.1| hypothetical protein EUGRSUZ_D00505 [Eucalyptus grandis]
Length=345

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = -3

Query  1016  AAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNYPY  837
             AA+EG+T +K GKL+SLS QELVDCDV+G++ GC+GG M++AF FII   GLTTE NYPY
Sbjct  158   AAIEGITMLKKGKLLSLSVQELVDCDVNGKNSGCKGGYMDSAFEFIISKGGLTTEANYPY  217

Query  836   SAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQEGV  657
                +  CN  K    AA I+GYE VPA++EKALLQAVA+QPVSVA+    +DFQFY  GV
Sbjct  218   RGNERTCNTAKTGYHAASITGYEDVPANNEKALLQAVANQPVSVAVEAGGYDFQFYSSGV  277

Query  656   FDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCGLA  477
             F G C   ++HAVT +GYG    G+ YWL+KNSWG  WGESGYMRI RD   + GLCGLA
Sbjct  278   FTGSCGTSVDHAVTVVGYGKTSGGTMYWLLKNSWGTGWGESGYMRIERDVRSRTGLCGLA  337

Query  476   RDATYPV  456
              +A+YP+
Sbjct  338   MNASYPI  344



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+TQ+KTG+L+SLSEQELVDCD SGED GC GGLM++AF FII N GLTTE NY
Sbjct  151   AVAAMEGVTQLKTGELISLSEQELVDCDTSGEDQGCGGGLMDSAFEFIIGNGGLTTEANY  210

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   D  CN KKAA +AAKI  YE VPA+ E ALL+AVA  PVSVAI+    DFQFY  
Sbjct  211   PYKGVDATCNKKKAASSAAKIKNYEDVPANSEAALLKAVAQHPVSVAIDAGGSDFQFYSS  270

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG   DG+KYWL+KNSWG  WGE GY+ + RD    EGLCG
Sbjct  271   GVFTGQCGTELDHGVTAVGYGKTDDGTKYWLVKNSWGTGWGEDGYIWMERDIGADEGLCG  330

Query  482   LARDATYPV  456
             +A +A+YP 
Sbjct  331   IAMEASYPT  339



>gb|KDP30997.1| hypothetical protein JCGZ_11373 [Jatropha curcas]
Length=360

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              V AVEG+ QIKT KLVSLSEQELVDCD   +D GC+GGLM+ AF FI    GLTTE NY
Sbjct  155   TVVAVEGINQIKTNKLVSLSEQELVDCDTE-QDQGCDGGLMDYAFEFIKQKGGLTTEANY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY A+DG C++KK    A  I GYEKVP +DE ALL+AVA+QPVSVAI+    DFQFY E
Sbjct  214   PYEAEDGTCDSKKENSPAVSIDGYEKVPENDENALLKAVANQPVSVAIDAGGSDFQFYSE  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H V  +GYGT  DG+KYW++KNSWG  WGE GY+R+ R  ++KEGLCG
Sbjct  274   GVFTGSCGTELDHGVAIVGYGTTLDGTKYWIVKNSWGEEWGEKGYIRMKRGISEKEGLCG  333

Query  482   LARDATYPV  456
             +A +A+YP+
Sbjct  334   IAMEASYPI  342



>ref|XP_008663073.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=352

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVA++EG+ ++ TGKLVSLSEQELVDCDV+G D GCEGG M++AF FI+ N GLTTE+ Y
Sbjct  163   AVASMEGVVKLSTGKLVSLSEQELVDCDVNGMDQGCEGGEMDDAFDFIVGNGGLTTESRY  222

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG CN+ +A+  AA I GYE VPA+DE +L +AVA+QPVSVA++G    F+FY+ 
Sbjct  223   PYTASDGTCNSNEASGDAASIKGYEDVPANDEASLRKAVANQPVSVAVDGGDSHFRFYKG  282

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + A+GYG A DG+KYW++KNSWG SWGE+GY+R+ RD A +EGLCG
Sbjct  283   GVLSGACGTELDHGIAAVGYGVASDGTKYWVMKNSWGTSWGEAGYIRMERDIADEEGLCG  342

Query  482   LARDATYPV  456
             LA   +YP 
Sbjct  343   LAMQPSYPT  351



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ +++TGKLVSLSEQELVDCDV GED GC+GGLME+AF FI  N G+TTE NY
Sbjct  153   AVAATEGVHKLRTGKLVSLSEQELVDCDVKGEDKGCQGGLMEDAFKFIKRNGGITTEANY  212

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
              Y  +DG C+ KK A   AKI+GY+ VP + E ALL+AVA QPVSV+I+  +  FQFYQ 
Sbjct  213   AYRGRDGKCDTKKEASHVAKITGYQVVPENSEAALLKAVAHQPVSVSIDAGSMSFQFYQS  272

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             G++ G C   LNH V A+GYGT+  GSKYW++KNSWG  WGE GY+R+ RD   ++GLCG
Sbjct  273   GIYAGSCGSDLNHGVAAVGYGTSSSGSKYWIVKNSWGPEWGERGYVRMKRDITSRKGLCG  332

Query  482   LARDATYPV  456
             +A D +YP 
Sbjct  333   IAMDCSYPT  341



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+  + +GKL+SLSEQELVDCD  G D GCEGGLM++AF F+I N GL TE NY
Sbjct  154   AVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CN  +AA  AA I+GYE VPA++EKAL +AVA+QPVSVAI+ +  DFQFY+ 
Sbjct  214   PYKGVDGKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG++YWL+KNSWG  WGE GY+R+ R    +EGLCG
Sbjct  274   GVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVNSEEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMQASYPT  342



>prf||1910332A Cys endopeptidase
Length=362

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
              + AVEG+ QIKT KLVSLSEQELVDCD   E+ GC GGLME+AF FI    G+TTE+NY
Sbjct  157   TIVAVEGINQIKTNKLVSLSEQELVDCDKE-ENQGCNGGLMESAFEFIKQKGGITTESNY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY AQ+G C+  K    A  I G+E VP +DE ALL+AVA+QPVSVAI+    DFQFY E
Sbjct  216   PYKAQEGTCDESKVNDLAVSIDGHENVPVNDENALLKAVANQPVSVAIDAGGSDFQFYSE  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF GDC   LNH V  +GYGT  DG+ YW+++NSWG  WGE GY+R+ R+ +KKEGLCG
Sbjct  276   GVFTGDCNTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEQGYIRMQRNISKKEGLCG  335

Query  482   LARDATYPV  456
             +A  A+YP+
Sbjct  336   IAMMASYPI  344



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             A+AA EG+ +I TGKLVSLSEQELVDCD +G D GCEGGLM++AF FII N G++TE  Y
Sbjct  154   AIAATEGIHKISTGKLVSLSEQELVDCDTNGVDQGCEGGLMDDAFKFIIQNNGISTEAGY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C A +A+ +AA I+GYE VPA++E AL +AVA+QP+SVAI+ +  DFQFY+ 
Sbjct  214   PYQGVDGTCKANEASTSAATITGYEDVPANNENALQKAVANQPISVAIDASGSDFQFYKS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R     EGLCG
Sbjct  274   GVFTGSCGTELDHGVTAVGYGISNDGTKYWLVKNSWGTDWGEEGYIRMQRSIDAAEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMQASYPT  342



>ref|XP_003607574.1| Cysteine protease [Medicago truncatula]
 gb|AES89771.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ ++ TGKLVSLSEQELVDCD  G D GCEGGLM++AF FII N GL TE  Y
Sbjct  156   AVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLHTEAQY  215

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C+A + +  AA I+GYE VPA++E AL +AVA+QP+SVAI+ +  DFQFY+ 
Sbjct  216   PYQGVDGTCSANETSTPAATIAGYEDVPANNENALQKAVANQPISVAIDASGSDFQFYKS  275

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWGN WGE GY+R+ R     +GLCG
Sbjct  276   GVFTGSCGTQLDHGVTAVGYGISNDGTKYWLVKNSWGNDWGEEGYIRMQRSVDAAQGLCG  335

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  336   IAMMASYPT  344



>gb|AAP32198.1| cysteine protease 12 [Trifolium repens]
Length=343

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             A+AA EG+ +I TGKLVSLSEQELVDCD +G D GCEGGLM++AF FII N G++TE  Y
Sbjct  154   AIAATEGIHKISTGKLVSLSEQELVDCDTNGVDQGCEGGLMDDAFKFIIQNNGISTEAGY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG C A +A+ +AA I+GYE VPA++E AL +AVA+QP+SVAI+ +  DFQFY+ 
Sbjct  214   PYQGVDGTCKANEASTSAATITGYEDVPANNENALQKAVANQPISVAIDASGSDFQFYKS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R     EGLCG
Sbjct  274   GVFTGSCGTELDHGVTAVGYGISNDGTKYWLVKNSWGTDWGEEGYIRMQRSIDAAEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMQASYPT  342



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+ ++ TGKL+SLSEQELVDCD  G D GCEGGLM++AF FII N GL TE  Y
Sbjct  155   AVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLDTEAQY  214

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNA +A++ AA I+GYE VP ++E+AL +AVA+QP+SVAI+ +  DFQFY+ 
Sbjct  215   PYQGVDGTCNANEASIHAATITGYEDVPVNNEQALQKAVANQPISVAIDASGSDFQFYKS  274

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG+KYWL+KNSWG  WGE GY+R+ R     EGLCG
Sbjct  275   GVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTDWGEQGYIRMQRGVDAAEGLCG  334

Query  482   LARDATYPVL  453
             +A  A+YP +
Sbjct  335   IAMQASYPTV  344



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA EG+  + +GKL+SLSEQELVDCD  G D GCEGGLM++AF F+I N GL TE NY
Sbjct  154   AVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANY  213

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY   DG CNA +AA     I+GYE VPA++EKAL +AVA+QPVSVAI+ +  DFQFY+ 
Sbjct  214   PYKGVDGKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKS  273

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GVF G C   L+H VTA+GYG + DG++YWL+KNSWG  WGE GY+R+ R    +EGLCG
Sbjct  274   GVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCG  333

Query  482   LARDATYPV  456
             +A  A+YP 
Sbjct  334   IAMQASYPT  342



>gb|EAY93078.1| hypothetical protein OsI_14879 [Oryza sativa Indica Group]
Length=339

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++ TGKL+SLSEQELVDCDV GED GCEGGLM++AF FII N GLTTE+ Y
Sbjct  152   AVAAMEGIVKLSTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESKY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A DG CN    + A   I GYE+VPA++E AL++AVA+QPVSVA++G    FQFY  
Sbjct  212   PYTAADGKCNGGSNSAAT--IKGYEEVPANNEAALMKAVANQPVSVAVDGGDMTFQFYSG  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG  GDG++YWL+KNSWG +WGE+G++R+ +D + K G+CG
Sbjct  270   GVMTGSCGTDLDHGIVAIGYGKDGDGTQYWLLKNSWGTTWGENGFLRMEKDISDKRGMCG  329

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  330   LAMEPSYPT  338



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = -3

Query  1022  AVAAVEGLTQIKTGKLVSLSEQELVDCDVSGEDMGCEGGLMENAFSFIIHNKGLTTETNY  843
             AVAA+EG+ ++ TGKL+SLSEQELVDCDV GED GCEGGLM++AF FII N GLTTE+NY
Sbjct  152   AVAAMEGIVKLSTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNY  211

Query  842   PYSAQDGVCNakkaavaaaKISGYEKVPADDEKALLQAVASQPVSVAINGAAFDFQFYQE  663
             PY+A D  C +   +VA+  I GYE VPA++E AL++AVA+QPVSVA++G    FQFY+ 
Sbjct  212   PYAAADDKCKSVSNSVAS--IKGYEDVPANNEAALMKAVANQPVSVAVDGGDMTFQFYKG  269

Query  662   GVFDGDCEPYLNHAVTAIGYGTAGDGSKYWLIKNSWGNSWGESGYMRITRDYAKKEGLCG  483
             GV  G C   L+H + AIGYG A DG+KYWL+KNSWG +WGE+G++R+ +D + K G+CG
Sbjct  270   GVMTGSCGTDLDHGIVAIGYGKASDGTKYWLLKNSWGTTWGENGFLRMEKDISDKRGMCG  329

Query  482   LARDATYPV  456
             LA + +YP 
Sbjct  330   LAMEPSYPT  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2381943541056