BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16339_g1_i1 len=535 path=[1:0-534]

Length=535
                                                                      Score     E

ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        189   3e-55   
gb|ADV41672.1|  cysteine protease                                       189   4e-55   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        188   6e-55   
gb|AAW78661.2|  senescence-specific cysteine protease                   187   1e-54   Nicotiana tabacum [American tobacco]
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    185   9e-54   
gb|AGT97048.1|  senescence-specific cysteine protease                   181   6e-52   
ref|XP_006362420.1|  PREDICTED: vignain-like                            176   3e-50   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    167   9e-47   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    165   4e-46   Vitis vinifera
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             162   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             162   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    161   1e-44   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             160   2e-44   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             160   3e-44   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    160   4e-44   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             159   6e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    157   3e-43   
emb|CBI21972.3|  unnamed protein product                                157   5e-43   
emb|CBI21976.3|  unnamed protein product                                156   6e-43   
emb|CBI21975.3|  unnamed protein product                                155   6e-43   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    156   8e-43   Vitis vinifera
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    156   8e-43   Vitis vinifera
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        157   8e-43   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        156   1e-42   
gb|ACU23533.1|  unknown                                                 152   1e-42   Glycine max [soybeans]
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             156   1e-42   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        156   1e-42   
emb|CAN70559.1|  hypothetical protein VITISV_032465                     156   2e-42   Vitis vinifera
ref|XP_010045989.1|  PREDICTED: vignain-like                            153   2e-42   
emb|CBI21973.3|  unnamed protein product                                155   2e-42   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    155   3e-42   Vitis vinifera
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             155   3e-42   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        155   3e-42   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    155   3e-42   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    155   3e-42   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             155   3e-42   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    155   4e-42   Vitis vinifera
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    155   4e-42   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             155   4e-42   
emb|CAN64655.1|  hypothetical protein VITISV_005140                     154   5e-42   Vitis vinifera
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            154   5e-42   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     153   1e-41   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        154   1e-41   
ref|XP_002513120.1|  cysteine protease, putative                        154   1e-41   Ricinus communis
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        154   1e-41   
ref|XP_003539989.1|  PREDICTED: vignain-like                            153   1e-41   
ref|XP_002522560.1|  cysteine protease, putative                        148   1e-41   Ricinus communis
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        153   1e-41   
ref|XP_007048674.1|  Senescence-associated gene 12                      153   1e-41   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        153   1e-41   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        153   1e-41   
gb|AFV30165.1|  cysteine proteinase                                     153   2e-41   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             153   2e-41   
gb|ADV74756.1|  cysteine protease                                       153   2e-41   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        153   2e-41   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        153   2e-41   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            153   2e-41   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             152   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             152   3e-41   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            152   4e-41   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         152   4e-41   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        152   5e-41   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    152   6e-41   
dbj|BAF56427.1|  cysteine proteinase                                    151   7e-41   Lotus japonicus
dbj|BAD29959.1|  cysteine protease                                      151   1e-40   Daucus carota [carrots]
ref|XP_003538185.1|  PREDICTED: vignain-like                            151   1e-40   
ref|XP_003539970.1|  PREDICTED: vignain-like                            151   1e-40   
ref|XP_008811650.1|  PREDICTED: vignain-like                            150   1e-40   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        150   1e-40   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        150   1e-40   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        150   1e-40   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             150   1e-40   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             150   1e-40   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        150   2e-40   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like              150   2e-40   
gb|KHN38752.1|  Vignain                                                 150   2e-40   
gb|AHA62782.1|  RCR3-like cysteine protease                             150   2e-40   
gb|AAR92154.1|  putative cysteine protease 1                            150   2e-40   Iris x hollandica [Dutch iris]
gb|AHA62779.1|  RCR3-like cysteine protease                             150   2e-40   
gb|AHA62780.1|  RCR3-like cysteine protease                             150   2e-40   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         150   2e-40   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             150   2e-40   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g             150   2e-40   
ref|XP_007048792.1|  Senescence-associated gene 12                      150   2e-40   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    150   2e-40   
gb|AHA62781.1|  RCR3-like cysteine protease                             150   2e-40   
dbj|BAF56429.1|  cysteine proteinase                                    150   2e-40   Lotus japonicus
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    150   3e-40   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             150   3e-40   
gb|KDP23191.1|  hypothetical protein JCGZ_00324                         149   3e-40   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             150   3e-40   Populus trichocarpa [western balsam poplar]
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         150   3e-40   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        149   4e-40   
gb|AAA50755.1|  cysteine proteinase                                     149   4e-40   Alnus glutinosa
ref|XP_008353751.1|  PREDICTED: actinidain-like                         146   4e-40   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                        149   5e-40   
ref|XP_002523448.1|  cysteine protease, putative                        149   5e-40   Ricinus communis
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    149   5e-40   Vitis vinifera
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        149   5e-40   
ref|XP_002523447.1|  cysteine protease, putative                        149   6e-40   Ricinus communis
ref|XP_006469011.1|  PREDICTED: vignain-like                            149   6e-40   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    149   7e-40   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        149   8e-40   
ref|XP_004306851.1|  PREDICTED: vignain-like                            149   9e-40   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    149   9e-40   
ref|XP_007025398.1|  Senescence-associated gene 12                      148   9e-40   
gb|KCW76121.1|  hypothetical protein EUGRSUZ_D00498                     146   1e-39   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like              148   1e-39   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             148   1e-39   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like              148   1e-39   
gb|KHN28095.1|  Thiol protease                                          148   1e-39   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        148   1e-39   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like              148   1e-39   
ref|XP_008354173.1|  PREDICTED: actinidain-like                         145   1e-39   
gb|AHA62783.1|  RCR3-like cysteine protease                             148   1e-39   
dbj|BAF56430.1|  cysteine proteinase                                    148   1e-39   Lotus japonicus
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             148   2e-39   
ref|XP_007048796.1|  Senescence-associated gene 12                      148   2e-39   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        148   2e-39   
ref|XP_006469012.1|  PREDICTED: vignain-like                            148   2e-39   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             147   2e-39   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        147   2e-39   
ref|XP_009365508.1|  PREDICTED: vignain-like                            150   2e-39   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         147   2e-39   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like              147   3e-39   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        147   3e-39   
emb|CDP18641.1|  unnamed protein product                                147   3e-39   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like              147   3e-39   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    147   3e-39   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        147   3e-39   
ref|XP_004306597.1|  PREDICTED: vignain-like                            147   4e-39   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    147   4e-39   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    147   5e-39   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    145   6e-39   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              146   6e-39   
ref|XP_004290089.1|  PREDICTED: vignain-like                            146   6e-39   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        146   7e-39   
ref|XP_008246197.1|  PREDICTED: vignain-like                            145   7e-39   
ref|XP_002531151.1|  cysteine protease, putative                        146   7e-39   Ricinus communis
gb|KHN13720.1|  Vignain                                                 145   8e-39   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             145   8e-39   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    145   1e-38   
ref|XP_003526232.1|  PREDICTED: vignain-like                            145   1e-38   
ref|XP_004297571.1|  PREDICTED: vignain-like                            145   1e-38   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        145   1e-38   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             145   1e-38   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        145   2e-38   
emb|CDP18645.1|  unnamed protein product                                145   2e-38   
ref|XP_007132868.1|  hypothetical protein PHAVU_011G1314000g            143   2e-38   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        145   2e-38   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        144   2e-38   
ref|XP_008228922.1|  PREDICTED: vignain-like                            144   2e-38   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             145   2e-38   
ref|XP_008340724.1|  PREDICTED: vignain-like                            145   3e-38   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    144   3e-38   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        145   3e-38   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             144   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_004505498.1|  PREDICTED: vignain-like                            144   3e-38   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             144   3e-38   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        144   3e-38   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        144   3e-38   
gb|KHN32068.1|  Vignain                                                 144   3e-38   
dbj|BAF56428.1|  cysteine proteinase                                    144   3e-38   Lotus japonicus
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     144   4e-38   
ref|XP_006467666.1|  PREDICTED: vignain-like                            144   4e-38   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             145   4e-38   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        144   4e-38   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        144   4e-38   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    144   5e-38   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     144   5e-38   
ref|XP_002525123.1|  cysteine protease, putative                        144   5e-38   Ricinus communis
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             144   6e-38   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        144   7e-38   
ref|XP_003599736.1|  Cysteine proteinase                                144   7e-38   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    144   7e-38   
emb|CDP05747.1|  unnamed protein product                                144   7e-38   
ref|XP_003556992.1|  PREDICTED: vignain-like                            144   8e-38   
ref|XP_003527349.1|  PREDICTED: vignain-like                            144   8e-38   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         143   9e-38   
ref|XP_002522559.1|  cysteine protease, putative                        143   1e-37   Ricinus communis
gb|AAP32196.1|  cysteine protease 8                                     143   1e-37   Trifolium repens [creeping white clover]
emb|CBI21977.3|  unnamed protein product                                142   1e-37   
gb|AGT16936.1|  vignain-like protein                                    143   1e-37   
gb|AAK27968.1|AF242372_1  cysteine protease                             143   1e-37   Ipomoea batatas [batate]
ref|XP_004305438.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    143   1e-37   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    143   1e-37   
ref|XP_011009181.1|  PREDICTED: senescence-specific cysteine prot...    141   1e-37   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    143   1e-37   
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    143   1e-37   
dbj|BAF46311.1|  cysteine proteinase precursor                          143   1e-37   Ipomoea nil [qian niu]
gb|AAL14199.1|  cysteine proteinase precursor                           142   2e-37   Ipomoea batatas [batate]
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    143   2e-37   
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg             142   2e-37   
ref|XP_003612210.1|  Cysteine proteinase                                142   2e-37   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        144   2e-37   
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    142   2e-37   
ref|XP_002525124.1|  cysteine protease, putative                        142   2e-37   Ricinus communis
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    142   2e-37   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     142   2e-37   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        142   2e-37   
ref|XP_009359967.1|  PREDICTED: vignain-like                            142   2e-37   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          142   2e-37   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        142   2e-37   
ref|XP_006592465.1|  PREDICTED: vignain-like                            142   2e-37   
ref|XP_004489011.1|  PREDICTED: vignain-like                            142   3e-37   
ref|XP_003557016.1|  PREDICTED: vignain-like                            142   3e-37   
ref|XP_006592467.1|  PREDICTED: vignain-like                            142   3e-37   
ref|XP_003596711.1|  Cysteine proteinase                                142   3e-37   
gb|KHN08187.1|  Thiol protease SEN102                                   142   3e-37   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             142   3e-37   
gb|KHN32069.1|  Vignain                                                 142   3e-37   
gb|KHN13721.1|  Vignain                                                 141   3e-37   
ref|XP_011005486.1|  PREDICTED: senescence-specific cysteine prot...    140   3e-37   
dbj|BAD29955.1|  cysteine protease                                      142   3e-37   Daucus carota [carrots]
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410          142   3e-37   Sorghum bicolor [broomcorn]
ref|XP_006492717.1|  PREDICTED: xylem cysteine proteinase 1-like        142   3e-37   
ref|XP_006592475.1|  PREDICTED: vignain-like                            142   3e-37   
gb|KHN33962.1|  Vignain                                                 140   5e-37   
ref|XP_003539770.1|  PREDICTED: vignain-like                            141   5e-37   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     140   5e-37   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        141   6e-37   
ref|XP_004297572.1|  PREDICTED: vignain-like                            141   6e-37   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        141   6e-37   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    141   6e-37   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        141   6e-37   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    141   7e-37   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         140   7e-37   
ref|XP_009349242.1|  PREDICTED: vignain-like                            143   7e-37   
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g             139   7e-37   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    140   8e-37   
ref|XP_002531152.1|  cysteine protease, putative                        140   8e-37   Ricinus communis
emb|CDP18644.1|  unnamed protein product                                140   9e-37   
ref|XP_003605890.1|  Cysteine proteinase                                140   1e-36   
ref|XP_008364019.1|  PREDICTED: zingipain-2-like                        140   1e-36   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 139   1e-36   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        140   1e-36   
ref|XP_003607647.1|  Cysteine proteinase                                140   1e-36   
gb|AFK44139.1|  unknown                                                 140   1e-36   
gb|KHG19386.1|  KDEL-tailed cysteine endopeptidase CEP2 -like pro...    139   1e-36   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             140   2e-36   
ref|XP_009798360.1|  PREDICTED: zingipain-2-like                        140   2e-36   
gb|KHN34255.1|  KDEL-tailed cysteine endopeptidase CEP1                 139   2e-36   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...    140   2e-36   
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                        140   2e-36   
ref|XP_009361500.1|  PREDICTED: vignain-like                            140   2e-36   
ref|XP_003540007.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    140   2e-36   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like              139   2e-36   
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    139   3e-36   
emb|CAL64936.1|  putative cysteine protease 8                           139   3e-36   Trifolium pratense [peavine clover]
ref|XP_004303175.1|  PREDICTED: vignain-like                            139   3e-36   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                        139   3e-36   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    139   3e-36   
gb|KDO63024.1|  hypothetical protein CISIN_1g018958mg                   138   3e-36   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like              139   3e-36   
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g             138   3e-36   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like              139   4e-36   
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                   139   4e-36   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                    140   4e-36   
emb|CDP20741.1|  unnamed protein product                                134   5e-36   
ref|XP_003596314.1|  Cysteine proteinase                                138   6e-36   
ref|XP_003527388.1|  PREDICTED: vignain-like                            138   6e-36   
ref|XP_009797968.1|  PREDICTED: vignain-like                            138   7e-36   
ref|XP_006445658.1|  hypothetical protein CICLE_v10015798mg             138   7e-36   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg             138   7e-36   
ref|XP_007050065.1|  Senescence-associated gene 12                      138   7e-36   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like              138   7e-36   
ref|XP_003527350.1|  PREDICTED: vignain-like                            138   9e-36   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    138   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             138   1e-35   
ref|XP_006362426.1|  PREDICTED: vignain-like                            137   1e-35   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                        137   1e-35   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        137   1e-35   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                        137   1e-35   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    137   2e-35   
ref|XP_009366072.1|  PREDICTED: zingipain-2-like                        137   2e-35   
ref|XP_006445663.1|  hypothetical protein CICLE_v10015799mg             137   2e-35   
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g             137   2e-35   
ref|XP_003527331.1|  PREDICTED: vignain-like                            137   2e-35   
gb|EYU28078.1|  hypothetical protein MIMGU_mgv1a009081mg                137   2e-35   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g             137   2e-35   
ref|XP_006652104.1|  PREDICTED: vignain-like                            137   2e-35   
ref|XP_009617814.1|  PREDICTED: zingipain-2-like                        137   2e-35   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             137   2e-35   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                     137   2e-35   
gb|KHN12137.1|  Thiol protease                                          137   3e-35   
ref|XP_008225326.1|  PREDICTED: actinidain-like                         135   3e-35   
gb|KDP21086.1|  hypothetical protein JCGZ_21557                         132   3e-35   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        137   3e-35   
dbj|BAB13759.1|  cysteine proteinase                                    137   3e-35   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    136   3e-35   
gb|EMT15489.1|  Thiol protease SEN102                                   136   3e-35   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             136   4e-35   
ref|XP_004301219.1|  PREDICTED: fruit bromelain-like                    131   4e-35   
ref|XP_008228971.1|  PREDICTED: zingipain-2-like                        136   4e-35   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             136   4e-35   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg             136   4e-35   
emb|CDP18639.1|  unnamed protein product                                136   4e-35   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        135   5e-35   
gb|KHN33935.1|  KDEL-tailed cysteine endopeptidase CEP1                 135   5e-35   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             136   6e-35   
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                        135   6e-35   
ref|XP_004487579.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    135   6e-35   
ref|NP_001239703.1|  uncharacterized protein LOC100799247 precursor     136   6e-35   
ref|XP_006469128.1|  PREDICTED: vignain-like                            135   6e-35   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          135   7e-35   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    135   8e-35   
gb|AHA62778.1|  RCR3-like cysteine protease                             135   8e-35   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    135   9e-35   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    135   9e-35   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             135   9e-35   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             135   9e-35   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    135   9e-35   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    135   9e-35   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        135   1e-34   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        135   1e-34   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                        135   1e-34   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                        135   1e-34   
ref|XP_010686292.1|  PREDICTED: zingipain-2-like                        135   1e-34   
emb|CAH66275.1|  OSIGBa0147O06.5                                        135   1e-34   
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1                 134   1e-34   
ref|XP_004308524.1|  PREDICTED: vignain-like                            135   1e-34   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        135   1e-34   
ref|XP_004234254.1|  PREDICTED: zingipain-2-like                        135   1e-34   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                        135   1e-34   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                        135   2e-34   
ref|XP_003599735.1|  Cysteine proteinase                                134   2e-34   
ref|XP_004980475.1|  PREDICTED: cysteine proteinase EP-B 2-like         134   2e-34   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             134   3e-34   
gb|EEC84514.1|  hypothetical protein OsI_31214                          134   3e-34   
emb|CDP18638.1|  unnamed protein product                                134   3e-34   
ref|XP_011047550.1|  PREDICTED: senescence-specific cysteine prot...    130   3e-34   
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1                 134   3e-34   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    134   3e-34   
ref|XP_010091035.1|  KDEL-tailed cysteine endopeptidase CEP1            134   3e-34   
ref|XP_004306836.1|  PREDICTED: vignain-like                            134   4e-34   
ref|XP_004505502.1|  PREDICTED: vignain-like                            134   4e-34   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    137   5e-34   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    133   5e-34   
ref|XP_004506025.1|  PREDICTED: vignain-like                            133   5e-34   
gb|KHN27801.1|  Vignain                                                 132   6e-34   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                   138   6e-34   
ref|XP_006471123.1|  PREDICTED: xylem cysteine proteinase 1-like        129   6e-34   
ref|XP_004306813.1|  PREDICTED: vignain-like                            133   8e-34   
ref|XP_004964022.1|  PREDICTED: cysteine proteinase EP-B 1-like         133   8e-34   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             132   8e-34   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like              132   1e-33   
ref|XP_004294729.1|  PREDICTED: vignain-like                            132   1e-33   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             132   1e-33   
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                        132   1e-33   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                        132   1e-33   
gb|EAY93078.1|  hypothetical protein OsI_14879                          132   1e-33   
emb|CAD40112.2|  OSJNBa0035O13.5                                        132   1e-33   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                132   1e-33   
gb|AAT34987.1|  putative cysteine protease                              132   1e-33   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   132   1e-33   
gb|KHN07749.1|  Vignain                                                 131   2e-33   
ref|NP_001052232.2|  Os04g0203500                                       132   2e-33   
ref|XP_009774375.1|  PREDICTED: fruit bromelain-like                    128   2e-33   
gb|EMT33085.1|  Vignain                                                 131   3e-33   
emb|CAE03344.2|  OSJNBb0005B05.11                                       131   3e-33   
ref|XP_003609015.1|  Cysteine proteinase                                131   3e-33   
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                        131   4e-33   
ref|XP_007132882.1|  hypothetical protein PHAVU_011G1328001g            126   4e-33   
gb|EAY97106.1|  hypothetical protein OsI_19029                          131   4e-33   
gb|AFW76903.1|  hypothetical protein ZEAMMB73_202256                    126   4e-33   
ref|XP_003607571.1|  Cysteine proteinase EP-B                           131   4e-33   
emb|CDX68527.1|  BnaC01g26050D                                          131   4e-33   
gb|ABA97421.1|  Vignain precursor, putative                             131   4e-33   
ref|XP_004487576.1|  PREDICTED: vignain-like                            130   5e-33   
ref|XP_003540991.1|  PREDICTED: vignain-like                            130   5e-33   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    130   5e-33   
gb|KHN27806.1|  Vignain                                                 130   6e-33   
ref|XP_002877667.1|  hypothetical protein ARALYDRAFT_348033             130   6e-33   
ref|XP_006367780.1|  PREDICTED: ananain-like                            130   6e-33   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        130   6e-33   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    134   6e-33   
gb|KHN27797.1|  Thiol protease SEN102                                   130   6e-33   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    130   7e-33   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                        130   7e-33   
ref|NP_001233949.1|  phytophthora-inhibited protease 1                  130   8e-33   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                        130   8e-33   
ref|XP_004505500.1|  PREDICTED: vignain-like                            130   9e-33   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        130   9e-33   
gb|EMT29823.1|  Vignain                                                 130   1e-32   
emb|CAH66233.1|  H0825G02.10                                            130   1e-32   
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g             130   1e-32   
ref|XP_004975183.1|  PREDICTED: vignain-like                            129   1e-32   
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                    132   1e-32   
ref|XP_004981743.1|  PREDICTED: cysteine proteinase EP-B 1-like         130   1e-32   
ref|XP_006362428.1|  PREDICTED: vignain-like                            129   1e-32   
ref|XP_004975182.1|  PREDICTED: vignain-like                            129   1e-32   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...    129   1e-32   
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                        130   1e-32   
ref|XP_010686290.1|  PREDICTED: zingipain-2-like                        129   1e-32   
ref|XP_007217611.1|  hypothetical protein PRUPE_ppa016402mg             124   1e-32   
ref|NP_568651.1|  cysteine protease SAG12                               129   1e-32   
ref|XP_006360708.1|  PREDICTED: vignain-like                            129   2e-32   
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                    130   2e-32   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                        129   2e-32   
ref|XP_006360707.1|  PREDICTED: vignain-like                            129   2e-32   
gb|AAP32198.1|  cysteine protease 12                                    129   2e-32   
gb|EMT29821.1|  Thiol protease SEN102                                   129   2e-32   
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    129   3e-32   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...    129   3e-32   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             129   3e-32   
gb|AAP32195.1|  cysteine protease 5                                     129   3e-32   
gb|ABF70145.1|  cysteine protease, putative                             129   3e-32   
ref|XP_003607548.1|  Cysteine protease                                  129   3e-32   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                129   3e-32   
gb|ADY68475.1|  stem bromelain                                          127   3e-32   
gb|KHN33266.1|  Xylem cysteine proteinase 1                             124   3e-32   
gb|EMT04560.1|  Vignain                                                 127   3e-32   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         129   3e-32   
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg             128   3e-32   
ref|XP_010557424.1|  PREDICTED: ervatamin-B-like                        128   4e-32   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g             128   4e-32   
ref|XP_002865220.1|  senescence-associated gene 12                      128   5e-32   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g             128   5e-32   
ref|XP_010426443.1|  PREDICTED: ervatamin-B                             128   5e-32   
gb|AFW80235.1|  hypothetical protein ZEAMMB73_542371                    126   6e-32   
ref|XP_006362435.1|  PREDICTED: fruit bromelain-like                    128   6e-32   
ref|XP_003540013.1|  PREDICTED: vignain-like                            127   7e-32   
ref|XP_002877666.1|  hypothetical protein ARALYDRAFT_906213             127   8e-32   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...    127   9e-32   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...    127   9e-32   
ref|XP_004487578.1|  PREDICTED: vignain-like isoform X2                 127   1e-31   
ref|XP_004963863.1|  PREDICTED: cysteine proteinase EP-B 2-like         127   1e-31   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...    127   1e-31   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...    127   1e-31   
ref|XP_009352792.1|  PREDICTED: zingipain-1-like                        127   1e-31   
ref|XP_010091714.1|  Fruit bromelain                                    129   1e-31   
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg             127   1e-31   
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like        127   1e-31   
ref|XP_002522571.1|  cysteine protease, putative                        127   1e-31   
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg             127   1e-31   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          127   1e-31   
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg             127   1e-31   
gb|EMT12294.1|  Vignain                                                 127   1e-31   
dbj|BAA21848.1|  bromelain                                              127   1e-31   
ref|XP_003607574.1|  Cysteine protease                                  127   1e-31   
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             127   1e-31   
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg             127   1e-31   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    127   1e-31   
ref|NP_566920.1|  putative cysteine proteinase                          127   2e-31   
ref|XP_009606934.1|  PREDICTED: zingipain-2                             126   2e-31   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1                 126   2e-31   
ref|XP_006421528.1|  hypothetical protein CICLE_v10006884mg             126   2e-31   
gb|AAC49135.1|  SAG12 protein                                           126   2e-31   
emb|CDX87758.1|  BnaC02g31910D                                          126   3e-31   
ref|XP_010523123.1|  PREDICTED: ervatamin-B-like                        126   3e-31   
ref|XP_006421532.1|  hypothetical protein CICLE_v10005342mg             126   3e-31   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                125   3e-31   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        126   3e-31   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                126   3e-31   
ref|XP_007213224.1|  hypothetical protein PRUPE_ppb014952mg             124   3e-31   
ref|XP_006280797.1|  hypothetical protein CARUB_v10026767mg             125   3e-31   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        125   3e-31   
ref|NP_001130503.1|  cysteine protease 1                                126   4e-31   
gb|EMT20795.1|  Vignain                                                 125   4e-31   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     125   5e-31   
ref|XP_009366071.1|  PREDICTED: ervatamin-B-like                        125   5e-31   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like              125   5e-31   
ref|XP_004975184.1|  PREDICTED: vignain-like                            125   5e-31   
ref|XP_010094328.1|  Fruit bromelain                                    125   5e-31   
ref|XP_010431170.1|  PREDICTED: senescence-specific cysteine prot...    124   6e-31   
gb|KHN08873.1|  Vignain                                                 125   7e-31   
ref|XP_006292980.1|  hypothetical protein CARUB_v10019256mg             125   7e-31   
ref|XP_006582264.1|  PREDICTED: vignain-like                            125   8e-31   
ref|XP_006582263.1|  PREDICTED: vignain-like                            124   8e-31   
ref|XP_008342800.1|  PREDICTED: thiol protease SEN102-like              122   8e-31   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                   124   1e-30   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...    124   1e-30   
ref|XP_010686291.1|  PREDICTED: zingipain-2-like                        124   1e-30   
ref|XP_006291442.1|  hypothetical protein CARUB_v10017578mg             124   1e-30   
ref|XP_006852527.1|  hypothetical protein AMTR_s00021p00178980          124   1e-30   
gb|KHN05669.1|  Vignain                                                 124   1e-30   
ref|XP_008349211.1|  PREDICTED: zingipain-2-like                        124   1e-30   
dbj|BAA22545.1|  FB22 precursor                                         124   1e-30   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                        124   1e-30   
ref|XP_002522572.1|  cysteine protease, putative                        124   1e-30   
ref|XP_009793843.1|  PREDICTED: zingipain-2-like                        124   2e-30   
ref|XP_008364021.1|  PREDICTED: ervatamin-B-like                        124   2e-30   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150          124   2e-30   
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170          124   2e-30   
gb|EMT08019.1|  Vignain                                                 123   2e-30   
gb|EMT20796.1|  Vignain                                                 124   3e-30   
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160          123   3e-30   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                122   3e-30   
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                        123   4e-30   
ref|XP_006362436.1|  PREDICTED: vignain-like                            123   4e-30   
ref|XP_002449458.1|  hypothetical protein SORBIDRAFT_05g013840          123   4e-30   
gb|KHN08598.1|  Cysteine proteinase RD21a                               124   4e-30   
ref|XP_009594088.1|  PREDICTED: zingipain-2-like                        123   4e-30   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          122   4e-30   
gb|EMT08022.1|  Vignain                                                 122   4e-30   
ref|XP_009775922.1|  PREDICTED: zingipain-2                             122   4e-30   
dbj|BAG16376.1|  cysteine protease                                      122   4e-30   
gb|AFP73357.1|  cysteine protease                                       122   5e-30   
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...    122   6e-30   
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                  122   6e-30   



>ref|XP_009759551.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=349

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 117/155 (75%), Gaps = 5/155 (3%)
 Frame = -1

Query  463  KLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            + LC  L F+ LG W S+  ASSR I + E SMRARH+ W+A H K+Y D  EK+ RFKI
Sbjct  8    QYLCLALFFIFLGVWRSQ-VASSRPI-NYEASMRARHDQWIAHHDKVYKDLNEKEMRFKI  65

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F ENV+RIEAFNA  DKGY+LGVNKF+DLTN++FR+L T GYKR   KV S SSK K +F
Sbjct  66   FKENVERIEAFNAGEDKGYKLGVNKFSDLTNEKFRVLHT-GYKRSHPKVMS-SSKPKTHF  123

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            RY NVT     +DWRKKGAVTP+KDQ++CGCCWAF
Sbjct  124  RYANVTDIPPTMDWRKKGAVTPIKDQKECGCCWAF  158



>gb|ADV41672.1| cysteine protease [Nicotiana tabacum]
Length=349

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 117/155 (75%), Gaps = 5/155 (3%)
 Frame = -1

Query  463  KLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            + LC  L F+ LG W S+  ASSR I + E SMRARH+ W+A H K+Y D  EK+ RFKI
Sbjct  8    QYLCLALFFIFLGVWRSQ-VASSRPI-NYEASMRARHDQWIAHHDKVYKDLNEKEMRFKI  65

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F ENV+RIEAFNA  DKGY+LGVNKF+DLTN++FR+L T GYKR   KV S SSK K +F
Sbjct  66   FKENVERIEAFNAGEDKGYKLGVNKFSDLTNEKFRVLHT-GYKRSHPKVMS-SSKPKTHF  123

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            RY NVT     +DWRKKGAVTP+KDQ++CGCCWAF
Sbjct  124  RYANVTDIPPTMDWRKKGAVTPIKDQKECGCCWAF  158



>ref|XP_009608954.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=349

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            ++  L   L F+ LG WSS+ A S  +  + E +MRARH+ W+  H K+Y D  EK+ RF
Sbjct  6    LSQYLCLALFFIFLGLWSSQVALSRPI--NYEATMRARHDQWIVHHEKVYKDLNEKEVRF  63

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            +IF ENV+RIEAFNA  DKGY+LG NKF+DLTN+EFR+L T GYKR   KV  TSSKGK 
Sbjct  64   QIFKENVERIEAFNAGEDKGYKLGFNKFSDLTNEEFRVLHT-GYKRSHPKVM-TSSKGKT  121

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +FRY NVT     +DWRKKGAVTP+KDQ++CGCCWAF
Sbjct  122  HFRYTNVTDIPPTMDWRKKGAVTPIKDQKECGCCWAF  158



>gb|AAW78661.2| senescence-specific cysteine protease [Nicotiana tabacum]
Length=349

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            ++  L   L F+ LG WSS+ A S  +  + E +MRARH+ W+  H K+Y D  EK+ RF
Sbjct  6    LSQYLCLALFFICLGLWSSQVALSRPI--NYEATMRARHDQWIVHHEKVYKDLNEKEVRF  63

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            +IF ENV+RIEAFNA  DKGY+LG NKF+DLTN+EFR+L T GYKR   KV  TSSKGK 
Sbjct  64   QIFKENVERIEAFNAGEDKGYKLGFNKFSDLTNEEFRVLHT-GYKRSHPKVM-TSSKGKT  121

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +FRY NVT     +DWRKKGAVTP+KDQ++CGCCWAF
Sbjct  122  HFRYTNVTDIPPTMDWRKKGAVTPIKDQKECGCCWAF  158



>ref|XP_004233054.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=351

 Score =   185 bits (470),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 113/155 (73%), Gaps = 4/155 (3%)
 Frame = -1

Query  463  KLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            K +C  L F++ G WSS+  ASSR I + E +MR RHE W+A H KIY D  EK+ RFKI
Sbjct  9    KYICLALFFIVFGLWSSQ-LASSRPI-NNETTMRVRHEQWIAHHDKIYNDLKEKEIRFKI  66

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F ENV+RIE FNA  DKGY+LGVNKFADLTN+EFR+L T GYK        +SSK K +F
Sbjct  67   FKENVERIETFNAGEDKGYKLGVNKFADLTNEEFRVLHT-GYKSSSHPKIMSSSKPKTHF  125

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            RY N+T    ++DWR+KGAVTP+KDQ +CGCCWAF
Sbjct  126  RYANITDVPPIMDWRRKGAVTPIKDQMECGCCWAF  160



>gb|AGT97048.1| senescence-specific cysteine protease [Capsicum annuum]
Length=347

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 110/158 (70%), Gaps = 3/158 (2%)
 Frame = -1

Query  472  MAPKLLCYLLFML-LGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            MA   LC  LF + LG WSS+  AS R I  +  SMRARHE W+A H K+Y +  EK+ R
Sbjct  1    MAFANLCLALFFISLGLWSSQ-VASPRPIHYDATSMRARHEQWIAHHEKVYNNLNEKEMR  59

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
             KIF ENV+RIE FNA  DKGY+LGVNKFADLTN+EFR+L   GYK        +SSK  
Sbjct  60   SKIFKENVERIETFNAGEDKGYKLGVNKFADLTNEEFRVLHL-GYKWSSHPKVMSSSKPN  118

Query  115  HYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             +FRY NVT     +DWRKKGAVTP+KDQ+DCGCCWAF
Sbjct  119  THFRYANVTDIPPTMDWRKKGAVTPIKDQKDCGCCWAF  156



>ref|XP_006362420.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=347

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 113/163 (69%), Gaps = 9/163 (6%)
 Frame = -1

Query  484  IPTFMAP-KLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAG  311
            +  F  P K +C   LF++ G WSS+   SSR I + E +MR RHE W+A H KIY D  
Sbjct  1    MAIFTNPSKYICLAFLFLVFGLWSSQ-LVSSRPI-NYETTMRVRHEQWIAHHDKIYNDLK  58

Query  310  EKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTST  131
            EK+ RFKIF ENVKRIE FNA  DKGY+LGVNKFADLTN+EFR++ T GYK        +
Sbjct  59   EKEMRFKIFKENVKRIETFNAGEDKGYKLGVNKFADLTNEEFRVVHT-GYKSSFM----S  113

Query  130  SSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            SSK K +FRY N+T     +DWRKKGAVTP+KDQ +CG CWAF
Sbjct  114  SSKPKTHFRYANITDVPPTMDWRKKGAVTPIKDQMECGSCWAF  156



>ref|XP_010686289.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Beta 
vulgaris subsp. vulgaris]
Length=344

 Score =   167 bits (423),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 6/153 (4%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            LC++L  +L  W S   ASSR++ D+E SM   HE WM  HG++YT+  EK  RFKIFNE
Sbjct  7    LCFILLFVLALWGS--LASSRLL-DDEPSMIIEHEKWMNIHGRVYTNDVEKTRRFKIFNE  63

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NVKRIE  N + ++G+ LGVN FADLTN+EFR  RTG YK+   +           FRYE
Sbjct  64   NVKRIELLN-KMNRGFTLGVNAFADLTNEEFRASRTG-YKKQSKQFGVVLKSKSKTFRYE  121

Query  97   NVT-AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVT A+ S +DWRKKGAVTP+KDQ DCGCCWAF
Sbjct  122  NVTYASSSTMDWRKKGAVTPIKDQGDCGCCWAF  154



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 12/148 (8%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L  +L AW+S+  A+SR +   E SM  RHE WMAR+G++Y DA EK++RFKIF +NV R
Sbjct  14   LLFILAAWASQ--ATSRSL--HEASMYERHEDWMARYGRMYKDANEKEKRFKIFKDNVAR  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FN   DK Y+L +N+FADLTN+EFR LR     R +  + S ++     F+YENVTA
Sbjct  70   IESFNKAMDKTYKLSINEFADLTNEEFRSLR----NRFKAHICSEATT----FKYENVTA  121

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWRKKGAVTP+KDQ+ CGCCWAF
Sbjct  122  VPSTIDWRKKGAVTPIKDQQQCGCCWAF  149



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 10/148 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
              ++L AW+++ A       DE++ M  RHE WMA+HG++Y D  EK++R+ IF EN++R
Sbjct  14   FLLILAAWATKIACRP---LDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKENIER  70

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   D+GY+LGVNKFADLTN+EFR +   GYKR  +K+ S+S      FRYEN++ 
Sbjct  71   IEAFNNGSDRGYKLGVNKFADLTNEEFRAMYH-GYKRQSSKLMSSS------FRYENLSD  123

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + +DWR  GAVTPVKDQ  CGCCWAF
Sbjct  124  IPTSMDWRNDGAVTPVKDQGTCGCCWAF  151



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 10/148 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
              ++L AW+++ A       DE++ M  RHE WMA+HG++Y D  EK++R+ IF EN++R
Sbjct  14   FLLILAAWATKIACRP---LDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKENIER  70

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   D+GY+LGVNKFADLTN+EFR +   GYKR  +K+ S+S      FRYEN++ 
Sbjct  71   IEAFNNGSDRGYKLGVNKFADLTNEEFRAMYH-GYKRQSSKLMSSS------FRYENLSD  123

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + +DWR  GAVTPVKDQ  CGCCWAF
Sbjct  124  IPTSMDWRNDGAVTPVKDQGTCGCCWAF  151



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 97/128 (76%), Gaps = 7/128 (5%)
 Frame = -1

Query  385  DEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFA  206
            DE++ M  RHE WMA+HG++Y D  EK++R+ IF EN++RIEAFN+  D+GY+LGVNKFA
Sbjct  28   DEQEYMLKRHEEWMAQHGRVYEDMKEKEKRYLIFKENIERIEAFNSGSDRGYKLGVNKFA  87

Query  205  DLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQR  26
            DLTN+EFR +   GYKR  +K+ S+S      FR+EN++A    +DWRK GAVTPVKDQ 
Sbjct  88   DLTNEEFRAMHH-GYKRQSSKLMSSS------FRHENLSAIPPSMDWRKAGAVTPVKDQG  140

Query  25   DCGCCWAF  2
             CGCCWAF
Sbjct  141  SCGCCWAF  148



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 97/128 (76%), Gaps = 7/128 (5%)
 Frame = -1

Query  385  DEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFA  206
            DE++ M  RHE WMA+HG++Y D  EK++R+ IF EN++RIEAFN   D+GY+LGVNKFA
Sbjct  28   DEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKENIERIEAFNNGSDRGYKLGVNKFA  87

Query  205  DLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQR  26
            DLTN+EFR +   GYKR  +K+ S+S      FR+EN++A  + +DWRK GAVTPVKDQ 
Sbjct  88   DLTNEEFRAMHH-GYKRQSSKLMSSS------FRHENLSAIPTSMDWRKAGAVTPVKDQG  140

Query  25   DCGCCWAF  2
             CGCCWAF
Sbjct  141  TCGCCWAF  148



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 10/155 (6%)
 Frame = -1

Query  463  KLLCYLLFML-LGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            K  C+  F+L LG W+   A  SR +  +E SM ARHE WM  +GK+Y DA EK+ RF+I
Sbjct  6    KRQCFFAFILILGTWAYEVA--SREL--QEPSMSARHEQWMETYGKVYADAAEKERRFEI  61

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F +NV+ IE+FN  G+K Y+L VNKFADLTN+E ++ R G  + +QT+    +S     F
Sbjct  62   FKDNVEYIESFNTAGNKPYKLSVNKFADLTNEELKVARNGYRRPLQTRPMKVTS-----F  116

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +YENVTA  + +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  KYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAF  151



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 104/150 (69%), Gaps = 9/150 (6%)
 Frame = -1

Query  451  YLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENV  272
            + +F++LG W+ +   + R +  +E SM ARHE WMA  GK+Y DA EK+ RF+IF +NV
Sbjct  11   FAIFLILGTWACQ--VTPREL--QEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDNV  66

Query  271  KRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENV  92
            + IE+FN  G+K Y+L VNKFADLTN+E ++ R G  + +QT+    +S     F YENV
Sbjct  67   EYIESFNTAGNKPYKLSVNKFADLTNEELKIARNGYRRPLQTRPMKVTS-----FEYENV  121

Query  91   TAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            TA  + +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  122  TAVPATMDWRKKGAVTPIKDQGQCGSCWAF  151



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 104/154 (68%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +LGAW S+ AA  R + D   SM  RHE WMA++G++Y D  EK+ R+ IF
Sbjct  8    QFICLALLFVLGAWPSKSAA--RTLQD--VSMYERHEQWMAQYGRVYKDDAEKETRYNIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV RI+AFN++  K Y+LGVN+FADL+N+EF+  R     R +  + S  +     FR
Sbjct  64   KENVARIDAFNSQTGKSYKLGVNQFADLSNEEFKASRN----RFKGHMCSPQAGP---FR  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV+A  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  117  YENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAF  150



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 10/155 (6%)
 Frame = -1

Query  463  KLLCYLLFML-LGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            K  C + F+L LG W+   A  SR +  +E SM ARHE WMA  GK+Y DA EK+ RF+I
Sbjct  6    KRQCIIAFILILGTWAYEVA--SREL--QEPSMSARHEQWMATFGKVYADAAEKERRFEI  61

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F +NV+ IE+FN  G+K Y+L VNKFADLT +E ++ R G  + +QT+    +S     F
Sbjct  62   FKDNVEYIESFNTAGNKPYKLSVNKFADLTTEELKVARNGYRRPLQTRPMKVTS-----F  116

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             YENVTA  + +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  EYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAF  151



>emb|CBI21972.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 100/154 (65%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +L AW+S+  A S      E SM  RHE WM ++G+ Y DA EK +R+KIF
Sbjct  8    QYICLALLFVLAAWASQATARSL----HEASMYERHEDWMVQYGREYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EFR  R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN----RFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YENVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAF  150



>emb|CBI21976.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 101/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +L AW+S+  A +      E SM  RHE WMA++G++Y DA EK +R+KIF
Sbjct  8    QYICLALLFVLAAWASQATARNL----HEASMYERHEDWMAQYGRVYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EF   R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFGTSRN----RFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YENVTAVPSTIDWRKKGAVTPIKDQGQCGSCWAF  150



>emb|CBI21975.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 101/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L   L AW+S+  A + +    E SM  RHE WMA++G++Y DA EK +R+KIF
Sbjct  8    QYICLALLFFLAAWASQATARNLL----EASMYERHEDWMAQYGRVYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EFR  R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN----RFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YE+V A  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YEHVAAVPSTVDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 100/154 (65%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +L AW+S+  A S      E SM  RHE WM ++G+ Y DA EK +R+KIF
Sbjct  8    QYICLALLFVLAAWASQATARSL----HEASMYERHEDWMVQYGREYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EFR  R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASR----NRFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YENVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 101/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +L AW+S+  A +      E SM  RHE WMA++G++Y DA EK +R+KIF
Sbjct  8    QYICLALLFVLAAWASQATARNL----HEASMYERHEDWMAQYGRVYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EF   R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFGTSR----NRFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YENVTAVPSTIDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   157 bits (396),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 106/155 (68%), Gaps = 12/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L +++GAWSS   A+SR + D   SM  R+E W+ R+G++Y +  EK+ RFKIF
Sbjct  10   KCMCLSLILMMGAWSS--GATSRTLQD--ASMYGRYEQWLTRYGRVYNNVNEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
            NENV  IE+ N   +K Y+L VN+FADLTN+EF+  R  G+K  +    +TS      F+
Sbjct  66   NENVAFIESSNKYANKPYKLSVNQFADLTNEEFKASRN-GFKGHECSTETTS------FK  118

Query  103  YENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA+  + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  119  YENVTASLPATMDWRKKGAVTPIKDQGQCGCCWAF  153



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 12/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C+ L ++LGAWSS+  A+SR + D   SM  R+E W+AR+G++Y D  EK+ RFKIF
Sbjct  10   KYMCFGLILMLGAWSSQ--ATSRSLQD--ASMYGRYEQWLARYGRVYNDVDEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K Y+L VN+FADLTN+EF+  R  G+K  +    +TS      F+
Sbjct  66   KENVAFIESSNKDANKPYKLSVNQFADLTNEEFKASRN-GFKGHECSTKTTS------FK  118

Query  103  YENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            Y+NVTAA  + +DWR KGAVTPVKDQ  CGCCWAF
Sbjct  119  YKNVTAALPATMDWRTKGAVTPVKDQGQCGCCWAF  153



>gb|ACU23533.1| unknown [Glycine max]
Length=208

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 96/128 (75%), Gaps = 8/128 (6%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            E+  MR RHE WMA HGK+YT + EK+++++ F ENV+RIEAFN  G+K Y+LG+N FAD
Sbjct  32   EDAPMRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNHAGNKPYKLGINHFAD  91

Query  202  LTNDEFRML-RTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQR  26
            LTN+EF+ + R  G+  V +K+T T +     FRYEN+TA  + LDWR++GAVTP+KDQ 
Sbjct  92   LTNEEFKAINRFKGH--VCSKITRTPT-----FRYENMTAVPATLDWRQEGAVTPIKDQG  144

Query  25   DCGCCWAF  2
             CGCCWAF
Sbjct  145  QCGCCWAF  152



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 103/155 (66%), Gaps = 10/155 (6%)
 Frame = -1

Query  463  KLLCYLLFML-LGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            K  C+  F+L LG W+   A  SR +  +E  M ARHE WMA +GK+Y DA EK+ RFKI
Sbjct  6    KRQCFFAFILILGMWAFEVA--SREL--QESYMSARHEQWMATYGKVYVDAAEKERRFKI  61

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F  NV+ IE+FN  G+K Y+L VNKFAD TN++F+  R G  +  QT+    +S     F
Sbjct  62   FKNNVEYIESFNTAGNKPYKLSVNKFADQTNEKFKGARNGYRRPFQTRPMKVTS-----F  116

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +YENVTA  + +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  KYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAF  151



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 106/155 (68%), Gaps = 12/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L ++LGAWSS+  A+SR + D   SM  R+E W+AR+G++Y D  EK+ RFKIF
Sbjct  10   KYMCLGLILMLGAWSSQ--ATSRSLQD--ASMYGRYEQWLARYGRVYNDVDEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +  Y+L VN+FADLTN+EF+  R  G+K  +    +TS      F+
Sbjct  66   KENVAFIESSNKDANTPYKLRVNQFADLTNEEFKASRN-GFKGHECSTKTTS------FK  118

Query  103  YENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTAA  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  119  YENVTAALPATMDWRKKGAVTPVKDQGQCGCCWAF  153



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 103/154 (67%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +L AW+S+  A++R +   E SM  RHE WM ++G+ Y DA EK +R+KIF
Sbjct  8    QYICLALLFVLAAWASQ--ATARXL--HEASMYERHEDWMVQYGREYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EFR  R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN----RFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YENVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_010045989.1| PREDICTED: vignain-like [Eucalyptus grandis]
 gb|KCW84693.1| hypothetical protein EUGRSUZ_B01513 [Eucalyptus grandis]
Length=255

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 102/148 (69%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            +  +LG W+S+  A SR + D   +MR RHE WMARHG++Y DA EK+  F IF  NV+ 
Sbjct  1    MVTILGLWASQ--AWSRELHD--ATMRERHEQWMARHGRVYEDAAEKERCFLIFKTNVEY  56

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FN  G+K Y+L +N FADLT++EF+  RT GYKR  +  T++       F+YE+VT 
Sbjct  57   IESFNQDGNKPYKLAINAFADLTSEEFKASRT-GYKRSSSLRTASMKP----FQYESVTT  111

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  112  IPSSMDWRKKGAVTPIKDQGQCGCCWAF  139



>emb|CBI21973.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 103/154 (67%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +L AW+S+  A++R +   E SM  RHE WM ++G+ Y DA EK +R+KIF
Sbjct  8    QYICLALLFVLAAWASQ--ATARNL--HEASMYERHEDWMVQYGREYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EFR  R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN----RFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YENVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 101/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L   L AW+S+  A + +    E SM  RHE WMA++G++Y DA EK +R+KIF
Sbjct  8    QYICLALLFFLAAWASQATARNLL----EASMYERHEDWMAQYGRVYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EFR  R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN----RFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YE+V A  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YEHVAAVPSTVDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L  +LGAWSS+  A+SR + D   SM  ++E WMAR+G++YTD  EK+ RFKIF
Sbjct  10   KCICLALIFMLGAWSSQ--ATSRNLQD--ASMYGKYEQWMARYGRVYTDIQEKEMRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N+  +K Y+L VN+FADLTN+EF+  R G      +  T+T       F+
Sbjct  66   KENVAFIESSNSDANKPYKLSVNQFADLTNEEFKASRNGFLGHECSTKTTT-------FK  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  +V DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  YENVTAPPTV-DWRTKGAVTPIKDQGQCGCCWAF  151



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 12/153 (8%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            +C  L ++LGAWSS+  A+SR + D   S+ AR+E W+AR+G++Y D  EK+ RFKIF E
Sbjct  1    MCLGLILMLGAWSSQ--ATSRSLQD--ASIYARYEQWLARYGRVYNDVDEKEIRFKIFKE  56

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IE+ N   +K ++L VN+FADLTN+EF+  R  G+K  +    +TS      F+YE
Sbjct  57   NVAFIESSNKDANKPHKLSVNQFADLTNEEFKASRN-GFKGHECSTKTTS------FKYE  109

Query  97   NVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTAA  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  110  NVTAALPATMDWRKKGAVTPVKDQGQCGCCWAF  142



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 105/166 (63%), Gaps = 11/166 (7%)
 Frame = -1

Query  499  TNSNIIPTFMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYT  320
            T +  I  F     +C  L  +L AW S+  A  R + D   SM  RHE WMA++G++Y 
Sbjct  21   TTAKSIMRFTKQSQICLALLFVLVAWPSKSVA--RTLQD--VSMYERHEQWMAQYGRVYK  76

Query  319  DAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKV  140
            D  EK+ R+ IF ENV RI+AFN++  K Y+LGVN+FADL+N+EF+  R     R +  +
Sbjct  77   DDAEKETRYNIFKENVARIDAFNSQTGKSYKLGVNQFADLSNEEFKASR----NRFKGHM  132

Query  139  TSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             S  +     FRYENV+A  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  133  CSPQAGP---FRYENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAF  175



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 98/143 (69%), Gaps = 9/143 (6%)
 Frame = -1

Query  430  GAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFN  251
            G W S+ AA  R +   E SM  RHE WMA HG +Y DA EK++RF IF +NV+RIEAFN
Sbjct  21   GIWVSQAAA--RTLP-AEASMLERHEQWMASHGVLYEDAVEKEKRFTIFKDNVERIEAFN  77

Query  250  ARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVL  71
              G+K Y+L VN+FAD TN+EF+  R  GYKR     ++  S  K  FRYEN+T+    +
Sbjct  78   MAGNKPYKLSVNRFADQTNEEFKASRN-GYKR-----STQPSSSKTSFRYENMTSVLPSM  131

Query  70   DWRKKGAVTPVKDQRDCGCCWAF  2
            DWR KGAVTP+KDQ DCGCCWAF
Sbjct  132  DWRSKGAVTPIKDQGDCGCCWAF  154



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L  +LGAWSS+  A+SR + D   SM  ++E WMAR+G++YTD  EK+ RFKIF
Sbjct  10   KCICLALIFMLGAWSSQ--ATSRNLQD--ASMYGKYEQWMARYGRVYTDIQEKEMRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N+  +K Y+L VN+FADLTN+EF+  R G      +  T+T       F+
Sbjct  66   KENVAFIESSNSDANKPYKLSVNQFADLTNEEFKASRNGFLGHECSTKTTT-------FK  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  +V DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  YENVTAPPTV-DWRTKGAVTPIKDQGQCGCCWAF  151



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 100/154 (65%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +L AW+S+  A +      E SM  RHE WM ++G+ Y DA EK +R+KIF
Sbjct  8    QYICLALLFVLAAWASQATARNL----HEASMYERHEDWMVQYGREYKDADEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   DK Y+L +N+FADLTN+EFR  R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN----RFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YENVTAVPSTVDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 102/155 (66%), Gaps = 10/155 (6%)
 Frame = -1

Query  463  KLLCYLLFML-LGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            K  C+  F+L LG W+   A  SR +  +E SM ARHE WMA +GK+Y DA E + RFKI
Sbjct  6    KRQCFFAFILILGMWAFEVA--SREL--QESSMSARHEQWMATYGKVYVDAAEIERRFKI  61

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F +NV+ IE+FN  G+K Y+L VNKFAD TN+EF+    G  +  QT+     S     F
Sbjct  62   FKDNVEYIESFNTAGNKPYKLSVNKFADQTNEEFKGAHNGYRRPFQTRPMKVKS-----F  116

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +YENVTA  + +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  KYENVTAIPAAMDWRKKGAVTPIKDQGQCGSCWAF  151



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 104/155 (67%), Gaps = 10/155 (6%)
 Frame = -1

Query  463  KLLCYLLFML-LGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            K LC+  F+L LG W+   A  SR +  +E SM ARHE WMA  GK+Y DA E + RF+I
Sbjct  6    KRLCFFAFILILGMWAYEVA--SREL--QEPSMSARHEQWMATFGKVYADAAETERRFEI  61

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F +NV+ IE+FN  G+K Y+L VNKFAD TN+E ++ R G  + +QT+    +S     F
Sbjct  62   FKDNVEYIESFNTTGNKPYKLSVNKFADQTNEELKVARNGYRRPLQTRPMKVTS-----F  116

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +YENVTA  + +DWRKKGAVT +KDQ  CG CWAF
Sbjct  117  KYENVTAVPATMDWRKKGAVTLIKDQGQCGSCWAF  151



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 101/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +L AW+S   A +      E SM  RHE WMA++G++Y DAGEK +R+KIF
Sbjct  8    RYICLALLFVLAAWASHAKARNL----HEASMYERHEDWMAQYGRVYKDAGEKSKRYKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV RIE+FN   +K Y+L +N+FADLTN+EFR  R     R +  + ST +     F+
Sbjct  64   KDNVARIESFNKAMNKSYKLSINEFADLTNEEFRASRN----RFKAHICSTEATS---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YE+V A  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  117  YEHVXAVPSTVDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 102/160 (64%), Gaps = 7/160 (4%)
 Frame = -1

Query  475  FMAPKLLCYL-LFMLLGAWSS-RPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKD  302
            F+      YL L + LG W+     A+SR + D   +++ RHE WM+RHG +Y DA EK 
Sbjct  3    FINKWQFVYLALVISLGTWAKYNVEATSRSLQDA-STLKIRHEEWMSRHGIVYKDADEKA  61

Query  301  ERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSK  122
            +RF+IF ENV RIEAFN    K Y+LG+NKFADLTN+EF   R     + +  V  +   
Sbjct  62   KRFEIFKENVARIEAFNRAAIKPYKLGINKFADLTNEEFITKRN----KFKAHVCDSGRA  117

Query  121  GKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                F+YENVT+  S LDWRKKGAVTPVKDQ  CGCCWAF
Sbjct  118  ISTSFKYENVTSVPSALDWRKKGAVTPVKDQGQCGCCWAF  157



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 99/146 (68%), Gaps = 9/146 (6%)
 Frame = -1

Query  439  MLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIE  260
            M+LG ++S+  A        E SMR RHE WMARHG++Y   GEK+ RF IF  NV+ IE
Sbjct  1    MVLGLYASQAWAREL----RELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIE  56

Query  259  AFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAG  80
            +FN    + Y+LG+N FADLTNDEF+  R  GYKR     +S SS G   FRYENVTA  
Sbjct  57   SFNENNTRPYKLGINGFADLTNDEFKATRN-GYKR----SSSVSSSGPKSFRYENVTAVP  111

Query  79   SVLDWRKKGAVTPVKDQRDCGCCWAF  2
            S +DWR+KGAVTPVK+Q  CGCCWAF
Sbjct  112  STVDWRQKGAVTPVKEQGQCGCCWAF  137



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 104/155 (67%), Gaps = 12/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K  C  L ++LGAWS    A+SR + D   S+  R+E W+ R+G++Y D  EK+ RFKIF
Sbjct  10   KYTCLSLILMLGAWSX--GATSRTLQD--ASIYGRYEQWLTRYGRVYNDVNEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K Y+L VN+FADLTN+EF++ R  G+K  +    +TS      F+
Sbjct  66   KENVAFIESSNXDANKPYKLSVNQFADLTNEEFKVSRN-GFKGHECSTKTTS------FK  118

Query  103  YENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA+  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  119  YENVTASLPATMDWRKKGAVTPVKDQGQCGCCWAF  153



>ref|XP_002513120.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49623.1| cysteine protease, putative [Ricinus communis]
Length=362

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 105/160 (66%), Gaps = 12/160 (8%)
 Frame = -1

Query  478  TFMAPKL-LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKD  302
             F  P + + + LF  +GAW+S+  A +     +E SM  RHE WMA + ++Y DA EK 
Sbjct  2    VFTEPYICITFALFFSIGAWTSQCMARTL----QEASMYERHEQWMASYARVYKDANEKQ  57

Query  301  ERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSK  122
             R+KIF ENV+RI++FN+  DK Y+L VN+FADLTN+EF+ LR G       K    S++
Sbjct  58   MRYKIFKENVQRIDSFNSESDKSYKLAVNQFADLTNEEFKSLRNG------FKGHMCSAQ  111

Query  121  GKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              H FRYENVTA  + +DWRKKGAVT +K+Q  CG CWAF
Sbjct  112  AGH-FRYENVTAVPASIDWRKKGAVTQIKEQGQCGSCWAF  150



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 99/146 (68%), Gaps = 9/146 (6%)
 Frame = -1

Query  439  MLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIE  260
            M+LG ++S+  A        E SMR RHE WMARHG++Y   GEK+ RF IF  NV+ IE
Sbjct  15   MVLGLYASQAWAREL----RELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIE  70

Query  259  AFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAG  80
            +FN    + Y+LG+N FADLTNDEF+  R  GYKR     +S SS G   FRYENVTA  
Sbjct  71   SFNENNTRPYKLGINGFADLTNDEFKATRN-GYKR----SSSVSSSGPKSFRYENVTAVP  125

Query  79   SVLDWRKKGAVTPVKDQRDCGCCWAF  2
            S +DWR+KGAVTPVK+Q  CGCCWAF
Sbjct  126  STVDWRQKGAVTPVKEQGQCGCCWAF  151



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   LG W+ +   +SR + D   SM  RHE WMAR+ K+Y D  E+++RFKIF ENV  
Sbjct  14   LLFCLGFWAFQ--VTSRTLQDA--SMYERHEEWMARYAKVYKDPEEREKRFKIFKENVNY  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   DK Y+LG+N+FADLTN+EF   R      + + +T T++     F+YENVTA
Sbjct  70   IEAFNNAADKPYKLGINQFADLTNEEFIAPRNKFKGHMCSSITRTTT-----FKYENVTA  124

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWR+KGAVTP+KDQ  CGCCWAF
Sbjct  125  LPSTVDWRQKGAVTPIKDQGQCGCCWAF  152



>ref|XP_002522560.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39860.1| cysteine protease, putative [Ricinus communis]
Length=160

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 101/143 (71%), Gaps = 9/143 (6%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            L+  ++G W+S+  A SR++ D   ++  RHE+WMA++G++Y D  EK+ERFKIF ENV+
Sbjct  23   LIHQVVGLWASQ--AWSRLLYD--ATINERHEMWMAKYGRVYKDRAEKEERFKIFKENVE  78

Query  268  RIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
             IE+FN  G+K Y+L +N+FADLTN+EFR  R  GYKR    V+  +S     F+YENVT
Sbjct  79   FIESFNKAGNKAYKLSINEFADLTNEEFRTSR-NGYKRFSNPVSPKTSS----FKYENVT  133

Query  88   AAGSVLDWRKKGAVTPVKDQRDC  20
            A  + +DWRK GAVTP+KDQ  C
Sbjct  134  AVSTSIDWRKNGAVTPIKDQGQC  156



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 104/153 (68%), Gaps = 12/153 (8%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            +C  L ++L AWSS+  A+SR + D   SM  R+E W+AR+G++Y D  EK+ RFKIF E
Sbjct  1    MCLGLILMLXAWSSQ--ATSRSLQD--ASMYGRYEQWLARYGRVYNDVDEKETRFKIFKE  56

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IE+ N   +K Y+L VN+F DLTN+EF+  R  G+K  +    +TS      F+YE
Sbjct  57   NVAFIESSNKDANKPYKLSVNQFXDLTNEEFKASRN-GFKGHECSTKTTS------FKYE  109

Query  97   NVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTAA  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  110  NVTAALPATMDWRKKGAVTPVKDQGQCGCCWAF  142



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 8/152 (5%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            LC  L  + G  +    A+SR +  ++ +M  RHE WMA++G++Y D+ +K++RFKIF E
Sbjct  10   LCLALIFIFGT-NLVFQATSRTLPIQDSAMYERHEQWMAQYGRVYKDSNDKEKRFKIFKE  68

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV RI+AFN    K Y+LG+N+FADLTN+EF   R     R +  + S ++     F+YE
Sbjct  69   NVARIDAFNTANGKPYKLGINQFADLTNEEFTASR----NRFKGHMCSNTAAS---FKYE  121

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA  S +DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  122  NVTAVPSAMDWRQKGAVTPVKDQGQCGCCWAF  153



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 103/155 (66%), Gaps = 13/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L ++LGAWSS   A+SR + D   SM  R+E W+ R+G++Y D  EK+ RFKIF
Sbjct  10   KYMCLSLILMLGAWSS--GATSRTLQD--ASMYGRYEQWLTRYGRVYNDVNEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K YRL VN+FADLTN+EF+  R  G+K  +          K  F+
Sbjct  66   KENVAFIESSNKDANKPYRLSVNQFADLTNEEFKASRN-GFKGHECST-------KTSFK  117

Query  103  YENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YEN+TA+  + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  118  YENLTASLPATMDWRKKGAVTPIKDQGQCGCCWAF  152



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 104/153 (68%), Gaps = 12/153 (8%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            +C  L ++L AWSS+  A+SR + D   SM  R+E W+AR+G++Y D  EK+ RFKIF E
Sbjct  1    MCLGLILMLXAWSSQ--ATSRSLQD--ASMYGRYEQWLARYGRVYNDVDEKETRFKIFKE  56

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IE+ N   +K Y+L VN+F DLTN+EF+  R  G+K  +    +TS      F+YE
Sbjct  57   NVAFIESSNKDANKPYKLSVNQFXDLTNEEFKASRN-GFKGHECSTKTTS------FKYE  109

Query  97   NVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTAA  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  110  NVTAALPATMDWRKKGAVTPVKDQGQCGCCWAF  142



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            + + L + LG W+ +   SSR + D   SM+ RHE WMAR+G++Y D  EK++RF IF E
Sbjct  10   VSFALVLCLGLWAFQ--VSSRTLQDA--SMQERHEQWMARYGRVYKDLQEKEKRFSIFKE  65

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IEA N  GDK Y+LGVN+FADLTN+EF   R      + + +T T++     F+YE
Sbjct  66   NVNYIEASNNAGDKPYKLGVNQFADLTNEEFIATRNKFKGHMSSSITRTTT-----FKYE  120

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA  S +DWR++GAVTPVK+Q  CGCCWAF
Sbjct  121  NVTAP-STVDWRQEGAVTPVKNQGTCGCCWAF  151



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 103/154 (67%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + LC L  +LLGAWS + A SSR + D   +M  R+E W AR+G++Y D  EK++RF IF
Sbjct  8    QCLC-LALILLGAWSPQ-AMSSRTLQD--AAMYERYEQWTARYGRVYRDNAEKEKRFTIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV  IEAFN   +K Y+L VN+FADLTN+EF+  R     R +  + S  +     F+
Sbjct  64   KQNVANIEAFNKASEKPYKLAVNEFADLTNEEFKASRN----RFKGHMCSEQTGP---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  117  YENVTAVPSTMDWRKKGAVTPVKDQGQCGCCWAF  150



>gb|ADV74756.1| cysteine protease [Lactuca sativa]
Length=363

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 92/135 (68%), Gaps = 6/135 (4%)
 Frame = -1

Query  406  ASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYR  227
            A+SR + D   +M ARHE WMA HG+IYTD  EK  RF+IF  NV  I+A NAR D+ Y 
Sbjct  41   ATSRTLNDP--TMIARHEQWMAHHGRIYTDENEKQLRFQIFKNNVAYIDAHNARSDQSYT  98

Query  226  LGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAV  47
            L VNKFADLTNDEFR  R  GYK+   +  S S      FRY NV+A    +DWRK+GAV
Sbjct  99   LEVNKFADLTNDEFRASRN-GYKK---QPDSDSHVVSGLFRYANVSAVPDEVDWRKEGAV  154

Query  46   TPVKDQRDCGCCWAF  2
            TPVKDQ DCGCCWAF
Sbjct  155  TPVKDQGDCGCCWAF  169



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 104/154 (68%), Gaps = 16/154 (10%)
 Frame = -1

Query  454  CYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNEN  275
            C  L ++LGAWSS+  A+SR + D   SM  RHE WM R+G++YTD  EK++RFKIF EN
Sbjct  14   CLALIIMLGAWSSK--ATSRSLQD--ASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKEN  69

Query  274  VKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRT--GGYKRVQTKVTSTSSKGKHYFRY  101
            V  IE+ NA   K Y+L VN+F DLTN+EF   R    G++   TK TS        F+Y
Sbjct  70   VAYIESSNADSSKPYKLRVNQFTDLTNEEFIASRNRFKGHE-CSTKTTS--------FKY  120

Query  100  ENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            ENVTA+  + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  121  ENVTASVPATMDWRKKGAVTPIKDQGQCGCCWAF  154



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 104/154 (68%), Gaps = 16/154 (10%)
 Frame = -1

Query  454  CYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNEN  275
            C  L ++LGAWSS+  A+SR + D   SM  RHE WM R+G++YTD  EK++RFKIF EN
Sbjct  14   CLALIIMLGAWSSK--ATSRSLQD--ASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKEN  69

Query  274  VKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRT--GGYKRVQTKVTSTSSKGKHYFRY  101
            V  IE+ NA   K Y+L VN+F DLTN+EF   R    G++   TK TS        F+Y
Sbjct  70   VAYIESSNADASKPYKLRVNQFTDLTNEEFIASRNRFKGHE-CSTKTTS--------FKY  120

Query  100  ENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            ENVTA+  + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  121  ENVTASVPATMDWRKKGAVTPIKDQGQCGCCWAF  154



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 101/154 (66%), Gaps = 8/154 (5%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K   ++  ++LG W++   A+ R + ++  SM  RHE WMAR+G+ Y D  EK++RF+IF
Sbjct  7    KTSIFVSLLVLGMWAA--LANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIF  64

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
              NV+ IE+ N  G+K Y+LG+N+FAD TN+EFR  R  GYKR         S     FR
Sbjct  65   KSNVEYIESVNKAGNKPYKLGINEFADQTNEEFRASRN-GYKRSPIPRPINPS-----FR  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YE+VT   S +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  119  YESVTKVPSSVDWRKKGAVTPVKDQGQCGCCWAF  152



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 100/154 (65%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +LGAW S+  A  R + D    M  RHE WM ++G++Y D  E+  R+ IF
Sbjct  8    QFVCLALLFILGAWPSKSTA--RTLLDA--PMYERHEQWMTQYGRVYKDDNERATRYSIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV RI+AFN++  K Y+LGVN+FADLTN+EF+  R     R +  + S  +     FR
Sbjct  64   KENVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASR----NRFKGHMCSPQAGP---FR  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV+A  S +DWRK+GAVTPVKDQ  CGCCWAF
Sbjct  117  YENVSAVPSTVDWRKEGAVTPVKDQGQCGCCWAF  150



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 100/154 (65%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  +LGAW S+  A  R + D    M  RHE WM ++G++Y D  E+  R+ IF
Sbjct  8    QFVCLALLFILGAWPSKSTA--RTLLDA--PMYERHEQWMTQYGRVYKDDNERATRYSIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV RI+AFN++  K Y+LGVN+FADLTN+EF+  R     R +  + S  +     FR
Sbjct  64   KENVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASR----NRFKGHMCSPQAGP---FR  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV+A  S +DWRK+GAVTPVKDQ  CGCCWAF
Sbjct  117  YENVSAVPSTVDWRKEGAVTPVKDQGQCGCCWAF  150



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 101/154 (66%), Gaps = 8/154 (5%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K   ++  ++LG W++   A+ R + ++  SM  RHE WMAR+G+ Y D  EK++RF+IF
Sbjct  7    KTSIFVSLLVLGMWAAL--ANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIF  64

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
              NV+ IE+ N  G+K Y+LG+N+FAD TN+EFR  R  GYKR         S     FR
Sbjct  65   KSNVEYIESVNKAGNKPYKLGINEFADQTNEEFRASRN-GYKRSPIPRPINPS-----FR  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YE+VT   S +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  119  YESVTKVPSSVDWRKKGAVTPVKDQGQCGCCWAF  152



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            E S+  RHE+WMA+H ++Y DA EK+ RF+IF ENVK IE+FN  G+K Y+LG+N F DL
Sbjct  15   EASLEERHEIWMAQHERVYKDATEKEMRFQIFRENVKFIESFNKAGNKSYKLGINAFTDL  74

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
            TN EFR  R  GYKR     + +SS G + F+YENVT   S LDWR KG VTP+KDQ  C
Sbjct  75   TNKEFRASRN-GYKR----SSYSSSSGTNSFKYENVTTIPSSLDWRSKGVVTPIKDQGQC  129

Query  19   GCCWAF  2
            GCCWAF
Sbjct  130  GCCWAF  135



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 106/164 (65%), Gaps = 17/164 (10%)
 Frame = -1

Query  490  NIIPTFMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAG  311
            N++P     K +C  L ++LGAWSS   A+SR + D    M  R+E W+ R+G+IY D  
Sbjct  5    NLLPW----KYMCLSLILMLGAWSS--GATSRTLQDAR--MYGRYEQWLTRYGRIYNDVN  56

Query  310  EKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTST  131
            EK+ RFKIF ENV  IE+ N   +K YRL VN+FADLTN+EF+  R  G+K  +      
Sbjct  57   EKETRFKIFKENVAFIESSNKDANKPYRLSVNQFADLTNEEFKTSRN-GFKGHECST---  112

Query  130  SSKGKHYFRYENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                K  F+YEN+TA+  + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  113  ----KTSFKYENLTASLPATMDWRKKGAVTPIKDQGQCGCCWAF  152



>ref|XP_011014388.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=340

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 101/148 (68%), Gaps = 10/148 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
              ++L AW+++ A       DE++ M  RH  WMA++G++Y D  EKD+R+ IF EN++R
Sbjct  14   FLLILAAWATKIACRP---LDEQEYMLKRHGEWMAQYGRVYGDMKEKDKRYLIFKENIER  70

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   D+GY+LGVNKFADLTN+EFR +   GYKR  +K+ S+S      FRYEN++ 
Sbjct  71   IEAFNNGSDRGYKLGVNKFADLTNEEFRAMYH-GYKRQSSKLMSSS------FRYENLSD  123

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + +DWR   AVTPVKDQ  CG CWAF
Sbjct  124  IPTSMDWRNAEAVTPVKDQGRCGSCWAF  151



>dbj|BAF56427.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            + + L + LG W+ +   SSR + D   SM  RHE WMAR+GK+Y D  EK++RF IF E
Sbjct  10   ISFALVLCLGLWAFQ--VSSRTLQDA--SMHERHEQWMARYGKVYKDLQEKEKRFNIFQE  65

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NVK IEA N  G+K Y+LGVN+F DLTN EF   R      + + +T T++     F+YE
Sbjct  66   NVKYIEASNNAGNKPYKLGVNQFTDLTNKEFIATRNKFKGHMSSSITRTTT-----FKYE  120

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA  S +DWR++GAVTPVK+Q  CGCCWAF
Sbjct  121  NVTAP-STVDWRQEGAVTPVKNQGTCGCCWAF  151



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 102/159 (64%), Gaps = 9/159 (6%)
 Frame = -1

Query  478  TFMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDE  299
            T MA K       +LLGAW+ +  A+SR +   E SM  RHE WM ++G++Y D  EK  
Sbjct  21   TNMAFKHFMIAALILLGAWACQ--ATSRTLP--EASMFERHEQWMIQYGRVYKDEAEKSV  76

Query  298  RFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKG  119
            RF+IF +NVK IE FN  G + Y+L VN+FAD TN+EF+  R G    V ++ + T+   
Sbjct  77   RFQIFMDNVKFIEEFNKDGRQSYKLAVNEFADQTNEEFQASRNGYKMAVSSRPSQTT---  133

Query  118  KHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
               FRYENVTA  S +DWRKKGAVTPVKDQ  CG CWAF
Sbjct  134  --LFRYENVTAVPSSMDWRKKGAVTPVKDQGQCGSCWAF  170



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 96/128 (75%), Gaps = 8/128 (6%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            E+  MR RHE WMA HGK+YT + EK+++++ F ENV+RIEAFN  G+K Y+LG+N FAD
Sbjct  32   EDAPMRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNHAGNKPYKLGINHFAD  91

Query  202  LTNDEFRML-RTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQR  26
            LTN+EF+ + R  G+  V +K+T T +     FRYEN+TA  + LDWR++GAVTP+KDQ 
Sbjct  92   LTNEEFKAINRFKGH--VCSKITRTPT-----FRYENMTAVPATLDWRQEGAVTPIKDQG  144

Query  25   DCGCCWAF  2
             CGCCWAF
Sbjct  145  QCGCCWAF  152



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 99/148 (67%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   LG W+ +   +SR + D   SM  RHE WMAR+ K+Y D  E+++RFKIF ENV  
Sbjct  14   LLFCLGFWAFQ--VTSRTLQDA--SMYERHEEWMARYAKVYKDPEEREKRFKIFKENVNY  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   +K Y+LG+N+FADLTN+EF   R      + + +T T++     F+YENVTA
Sbjct  70   IEAFNNAANKPYKLGINQFADLTNEEFIAPRNRFKGHMCSSITRTTT-----FKYENVTA  124

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWR+KGAVTP+KDQ  CGCCWAF
Sbjct  125  LPSTVDWRQKGAVTPIKDQGQCGCCWAF  152



>ref|XP_008811650.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=302

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 104/156 (67%), Gaps = 11/156 (7%)
 Frame = -1

Query  466  PKLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFK  290
            PK LC     +LL A +S   A++R ++  E +M  RHE WMA+ G+ Y D+ EK+ R++
Sbjct  6    PKSLCMGFSVLLLCACASH--ATARTLS--EMTMAERHEQWMAQQGRAYRDSAEKERRYQ  61

Query  289  IFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHY  110
            IF  NV+ IE+FNA G+  Y+LGVN+FADLTN+EFR +  G +K    K      K  + 
Sbjct  62   IFKSNVELIESFNA-GNSKYKLGVNQFADLTNEEFRAMMNG-FKPSTLKTL----KATNV  115

Query  109  FRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            FRYENVTA  + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  116  FRYENVTAVPTSMDWRAKGAVTPIKDQGQCGCCWAF  151



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 102/153 (67%), Gaps = 12/153 (8%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            +C  L ++LGAWSS   A+SR + D   SM  R++ W+AR+G+IY D  EK+ RFKIF E
Sbjct  1    MCLGLILMLGAWSSE--ATSRSLQD--ASMYGRYKQWLARYGRIYNDTNEKETRFKIFKE  56

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IE  N   +K Y+L VN+FADLTN+EF+  R  G+K  +    ++S      F+YE
Sbjct  57   NVAFIEFSNKDANKPYKLSVNQFADLTNEEFKATRN-GFKGHECSTKTSS------FKYE  109

Query  97   NVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVT    + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  110  NVTVPLPATMDWRKKGAVTPVKDQGQCGCCWAF  142



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 102/153 (67%), Gaps = 12/153 (8%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            +C  L ++LGAWSS   A+SR + D   SM  R++ W+AR+G+IY D  EK+ RFKIF E
Sbjct  1    MCLGLILMLGAWSSE--ATSRSLQD--ASMYGRYKQWLARYGRIYNDTNEKETRFKIFKE  56

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IE  N   +K Y+L VN+FADLTN+EF+  R  G+K  +    ++S      F+YE
Sbjct  57   NVAFIEFSNKDANKPYKLSVNQFADLTNEEFKATRN-GFKGHECSTKTSS------FKYE  109

Query  97   NVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVT    + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  110  NVTVPLPATMDWRKKGAVTPVKDQGQCGCCWAF  142



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 102/153 (67%), Gaps = 12/153 (8%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            +C  L ++LG WSS   A+SR + D    M  R+E W+ R+G++Y D  EK+ RFKIF E
Sbjct  1    MCLSLILMLGTWSS--GATSRTLQD--APMYGRYEQWLTRYGRVYNDVNEKETRFKIFKE  56

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IE+ N   +K Y+L VN+FADLTN+EF+  +  G+K  +    +TS      F+YE
Sbjct  57   NVAFIESSNKYANKPYKLSVNQFADLTNEEFKASKN-GFKGHECSTKTTS------FKYE  109

Query  97   NVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA+  + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  110  NVTASLPATMDWRKKGAVTPIKDQGQCGCCWAF  142



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 98/151 (65%), Gaps = 11/151 (7%)
 Frame = -1

Query  454  CYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNEN  275
            C  L  +LGAW S+  A  R + D    M  RHE WM ++G++Y D  E+  R+ IF EN
Sbjct  11   CLALLFILGAWPSKSTA--RTLLDA--PMYERHEQWMTQYGRVYKDDTERATRYSIFKEN  66

Query  274  VKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYEN  95
            V RI+AFN++  K Y+LGVN+FADLTN+EF+  R     R +  + S  +     FRYEN
Sbjct  67   VARIDAFNSQTGKSYKLGVNQFADLTNEEFKASR----NRFKGHMCSPQAGP---FRYEN  119

Query  94   VTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            V+A  S +DWRK+GAVTPVKDQ  CGCCWAF
Sbjct  120  VSAVPSTMDWRKEGAVTPVKDQGQCGCCWAF  150



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  472  MAP-KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            M P K + + L  +LGAWS    A+SR + D   SM  R+E WM R+G++Y D  EK+ R
Sbjct  1    MEPWKCIGFGLLFMLGAWSCE--ATSRSLQD--ASMYGRYEQWMTRYGRVYNDVNEKENR  56

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
            FKIF ENV  IE+ N   +K Y+LGVN+FADLTN+EF+  R  G+K  +    +TS    
Sbjct  57   FKIFKENVAFIESSNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTS----  111

Query  115  HYFRYENVTA-AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              F+YENV A   + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  112  --FKYENVKAPVPATMDWRKKGAVTPVKDQGQCGCCWAF  148



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 103/155 (66%), Gaps = 12/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K  C  L ++LGAWSS   A+SR + D   S+  R+E W+ R+G++Y D  EK+ RFKIF
Sbjct  10   KYTCLSLILMLGAWSS--GATSRTLQD--ASIYGRYEQWLTRYGRVYNDVNEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K  RL VN+FADLTN+EF+  R  G+K  +    ++S      F+
Sbjct  66   KENVAFIESSNKDANKPCRLSVNQFADLTNEEFKASRN-GFKGHECSTKTSS------FK  118

Query  103  YENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA+  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  119  YENVTASLPATMDWRKKGAVTPVKDQGQCGCCWAF  153



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 105/153 (69%), Gaps = 11/153 (7%)
 Frame = -1

Query  451  YLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENV  272
            +LL +L  A+    A ++R ++D+  +M ARHE WMA++ ++Y DA EK  RF++FN NV
Sbjct  7    FLLAILGCAFLFSGALAARALSDD-SAMVARHEQWMAQYSRVYKDAAEKARRFEVFNANV  65

Query  271  KRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFRYEN  95
            K IE+FNA G++ + LGVN+FADLTNDEFR  +T  G+K    KV +        FRYEN
Sbjct  66   KFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTG-------FRYEN  118

Query  94   VT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            V+  A  + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  VSIDALPATIDWRSKGAVTPIKDQGQCGCCWAF  151



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 94/124 (76%), Gaps = 8/124 (6%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            MR RHE WMA HGK+YT + EK+++++ F ENV+RIEAFN  G+K Y+LG+N FADLTN+
Sbjct  1    MRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNNAGNKPYKLGINHFADLTNE  60

Query  190  EFRML-RTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGC  14
            EF+ + R  G+  V +K T T++     FRYENVTA  + LDWR+KGAVTP+KDQ  CGC
Sbjct  61   EFKAINRFKGH--VCSKRTRTTT-----FRYENVTAVPASLDWRQKGAVTPIKDQGQCGC  113

Query  13   CWAF  2
            CWAF
Sbjct  114  CWAF  117



>gb|AHA62782.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=343

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 104/159 (65%), Gaps = 9/159 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            +  K+   LLF+L+      P+ S   +   E  M  +HE WM  +G+IY +  EK +RF
Sbjct  3    LVTKICSILLFILV----ILPSYSLSRLLHIESFMIEKHEQWMTLYGRIYENNNEKMKRF  58

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            KIF+EN+KRIEA N  G +G+ LGVN FADLTNDEFR  RT GYK+ Q   T+ ++    
Sbjct  59   KIFSENIKRIEAMNKMG-RGFTLGVNAFADLTNDEFRNSRT-GYKK-QLTTTNNNNLASK  115

Query  112  YFRYENVT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YF+YENVT  +  +  DWR KGAVTP+KDQ +CGCCWAF
Sbjct  116  YFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAF  154



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 104/161 (65%), Gaps = 12/161 (7%)
 Frame = -1

Query  484  IPTFMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEK  305
            +  F   KLL  L  +++  W+S+  A   +   E +SM  RHE WMA+HG++Y +A EK
Sbjct  1    MAAFKTVKLLPALALLIVAIWASQGEAGRSL--GENKSMLERHEQWMAQHGRVYKNAAEK  58

Query  304  DERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSS  125
              RF+IF  NV+RIE+FNA   K ++LGVN+FADLTN+EF+   T       +K+ ST S
Sbjct  59   AHRFEIFRANVERIESFNAENHK-FKLGVNQFADLTNEEFKTRNT----LKPSKMASTKS  113

Query  124  KGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                 F+YENVTA  + +DWR KGAVTP+KDQ  CG CWAF
Sbjct  114  -----FKYENVTAVPATMDWRTKGAVTPIKDQGQCGSCWAF  149



>gb|AHA62779.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 104/159 (65%), Gaps = 9/159 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            +  K+   LLF+L+      P+ S   +   E  M  +HE WM  +G+IY +  EK +RF
Sbjct  3    LVTKICSILLFILV----ILPSYSLSRLLHIESFMIEKHEQWMTLYGRIYENNNEKMKRF  58

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            KIF+EN+KRIEA N  G +G+ LGVN FADLTNDEFR  RT GYK+ Q   T+ ++    
Sbjct  59   KIFSENIKRIEAMNKMG-RGFTLGVNAFADLTNDEFRNSRT-GYKK-QLTTTNNNNLASK  115

Query  112  YFRYENVT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YF+YENVT  +  +  DWR KGAVTP+KDQ +CGCCWAF
Sbjct  116  YFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAF  154



>gb|AHA62780.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 104/159 (65%), Gaps = 9/159 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            +  K+   LLF+L+      P+ S   +   E  M  +HE WM  +G+IY +  EK +RF
Sbjct  3    LVTKICSILLFILV----ILPSYSLSRLLHIESFMIEKHEQWMTLYGRIYENNNEKMKRF  58

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            KIF+EN+KRIEA N  G +G+ LGVN FADLTNDEFR  RT GYK+ Q   T+ ++    
Sbjct  59   KIFSENIKRIEAMNKMG-RGFTLGVNAFADLTNDEFRNSRT-GYKK-QLTTTNNNNLASK  115

Query  112  YFRYENVT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YF+YENVT  +  +  DWR KGAVTP+KDQ +CGCCWAF
Sbjct  116  YFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAF  154



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 100/148 (68%), Gaps = 11/148 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L  +L A +S+  A S     ++ SM  RHE WMA++G++Y DA EK+ R+KIF ENV+R
Sbjct  14   LIFILAALASQAIARSL----QDASMYERHEDWMAQNGRVYKDANEKEIRYKIFKENVER  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FN  G K Y+LG+N+FADLTN+EF+  R     R +  + S     +  FRYENVTA
Sbjct  70   IESFNKAGGKSYKLGINQFADLTNEEFKTSRN----RFKGHMCSPQ---EGPFRYENVTA  122

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  123  VPSSMDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 102/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + LC L  +LLGAW  + A SSR + D   +M  R+E W AR+G++Y D  EK++RF IF
Sbjct  8    QCLC-LALILLGAWIPQ-ALSSRALQD--AAMYERYEQWTARYGRVYRDNAEKEKRFTIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV  IEAFN    K Y+L VN+FADLTN+EF++ R     R +  + S  +     F+
Sbjct  64   KQNVAHIEAFNKASKKPYKLAVNEFADLTNEEFKVSRN----RFKGHMCSEQTGP---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  117  YENVTAVPSTMDWRKKGAVTPVKDQGQCGCCWAF  150



>ref|XP_006380495.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
 gb|ERP58292.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
Length=321

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 101/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  + GAW S+  +++R + D    M  RHE WM ++G++Y D  E+  R+ IF
Sbjct  8    QFVCLALLFISGAWPSK--STARTLLDA--PMYERHEQWMTQYGRVYKDDTERATRYSIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV RI+AFN++  K Y+LGVN+FADLTN+EF+  R     R +  + S  +     FR
Sbjct  64   KENVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASR----NRFKGHMCSPQAGP---FR  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV+A  S +DWRK+GAVTPVKDQ  CGCCWAF
Sbjct  117  YENVSAVPSTMDWRKEGAVTPVKDQGQCGCCWAF  150



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 99/154 (64%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C     ++GA      A+SR + D   SM  RHE WMAR+G++Y D  E+++RF IF
Sbjct  10   QCICLAFIFIVGALVCE--ATSRTLQDA--SMYERHEQWMARYGRVYQDNNEREQRFNIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV RI++FN   DK Y+LGVN+FADLTNDEF   R     R +  + S  +     F+
Sbjct  66   KENVARIDSFNRAKDKPYKLGVNQFADLTNDEFTASR----NRFKGHMCSNQAT---TFK  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  119  YENVTALPSTMDWRKKGAVTPIKDQGQCGSCWAF  152



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 99/154 (64%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  + GAW S+  A  R + D    M  RHE WM ++G++Y D  E+  R+ IF
Sbjct  8    QFVCLALLFISGAWPSKSTA--RTLLDA--PMYERHEQWMTQYGRVYKDDNERATRYSIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV RI+AFN++  K Y+LGVN+FADLTN+EF+  R     R +  + S  +     FR
Sbjct  64   KENVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASRN----RFKGHMCSPQAGP---FR  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV+A  S +DWRK+GAVTPVKDQ  CGCCWAF
Sbjct  117  YENVSAVPSTMDWRKEGAVTPVKDQGQCGCCWAF  150



>gb|AHA62781.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 103/159 (65%), Gaps = 9/159 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            +  K+   LLF+L+      P+ S   +   E  M  +HE WM  HG+IY +  EK +RF
Sbjct  3    LVTKICSILLFILV----ILPSYSLSRLLHIESFMIEKHEQWMTLHGRIYENNNEKMKRF  58

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            KIF+EN+KRIEA N  G + + LGVN FADLTNDEFR  RT GYK+ Q   T+ ++    
Sbjct  59   KIFSENIKRIEAMNKMG-RSFTLGVNAFADLTNDEFRNSRT-GYKK-QLTTTNNNNLASK  115

Query  112  YFRYENVT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YF+YENVT  +  +  DWR KGAVTP+KDQ +CGCCWAF
Sbjct  116  YFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAF  154



>dbj|BAF56429.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 100/148 (68%), Gaps = 8/148 (5%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            LF+LL    SR    SR + + E S+  RHE WMA++ K+Y DA EK++RF IF +NV+ 
Sbjct  14   LFLLLAVGISR--VISRELHETETSLIERHEQWMAKYDKVYKDAAEKEKRFLIFKDNVEF  71

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FNA G+K Y+LGVN  ADLT +EF+  R G  +    +V +TS      F+YENVTA
Sbjct  72   IESFNAAGNKPYKLGVNHLADLTIEEFKASRNGLKRSYDYEVGTTS------FKYENVTA  125

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  126  IPASVDWRKKGAVTPIKDQGQCGSCWAF  153



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 11/160 (7%)
 Frame = -1

Query  478  TFMAPKLLCYLLFML-LGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKD  302
            T   PK L   LF+L L A +S   A++R +   E +M  RHE WM RHG++Y ++ EK+
Sbjct  2    TLPLPKSLGMALFVLVLCACASH--ATARTLT--EMTMAERHEQWMVRHGRVYKESAEKE  57

Query  301  ERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSK  122
             RF+IF  NV+ IE+FNA G+  Y+LGVN+FADLTN+EF+ +R G  K    K    +SK
Sbjct  58   RRFQIFKANVEFIESFNA-GNSKYKLGVNQFADLTNEEFKAMRNG-LKPSGVK----TSK  111

Query  121  GKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                FRY NVTA  + +DWR KGAVTP+KDQ DCG CWAF
Sbjct  112  ATSVFRYANVTAVPTRMDWRTKGAVTPIKDQGDCGSCWAF  151



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 102/154 (66%), Gaps = 16/154 (10%)
 Frame = -1

Query  454  CYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNEN  275
            C  L ++LGAWSS   A+SR + D   SM  RHE WM R+G++YTD  EK++RFKIF EN
Sbjct  14   CLALIIMLGAWSSE--ATSRSLQD--ASMYGRHEQWMTRYGRVYTDNEEKEKRFKIFKEN  69

Query  274  VKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRT--GGYKRVQTKVTSTSSKGKHYFRY  101
            V  IE+ NA   K Y+L VN+F DLTN+EF   R    G++   TK TS        F+Y
Sbjct  70   VAYIESSNADTSKPYKLRVNQFTDLTNEEFIASRNRFKGHE-CSTKTTS--------FKY  120

Query  100  ENV-TAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            ENV T+  + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  121  ENVTTSVPATMDWRKKGAVTPIKDQGQCGCCWAF  154



>gb|KDP23191.1| hypothetical protein JCGZ_00324 [Jatropha curcas]
Length=287

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 103/148 (70%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L ++LG ++S+  A +R + DE  +M+ RHE+WMA++G++Y D  EK++RF IF  NV+ 
Sbjct  62   LVLVLGLFASQ--ALARPLQDE--TMKERHEMWMAKYGRVYKDNAEKEKRFNIFKNNVEF  117

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FN  G+K Y+L +N FADL+N+EF+  R  GYKR     +S +      F+YENV A
Sbjct  118  IESFNKYGNKLYKLDINGFADLSNEEFKASRN-GYKRSSIAKSSETLS----FKYENVPA  172

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  173  VPTSMDWRNKGAVTPIKDQGQCGCCWAF  200



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -1

Query  475  FMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            F+    L + + +LLG W+S   + S      E SM  RHE WMA++G+ Y    EK+ R
Sbjct  26   FIPENKLIFAVVLLLGLWTSHVWSRSLY----EASMMERHETWMAQYGRAYKGHVEKERR  81

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
              IF  NV+ IE+FN  G K Y+L VN+FADLTN+EF+  R G   ++   ++S+S+K  
Sbjct  82   LNIFKNNVEFIESFNKVGKKPYKLSVNEFADLTNEEFQASRNG--YKMSAHLSSSSTKP-  138

Query  115  HYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              FRYENV+A  S +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  139  --FRYENVSAVPSTMDWRKKGAVTPIKDQGQCGCCWAF  174



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 105/161 (65%), Gaps = 15/161 (9%)
 Frame = -1

Query  472  MAPKL----LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEK  305
            MAP +    +C+   ++L A + +  A +R + D   SM  RHE WMA++G +Y DA EK
Sbjct  1    MAPTIQCRCICFAFILILVALAYQ--AEARSLPD--ASMYERHEEWMAKYGIVYKDANEK  56

Query  304  DERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSS  125
            + R KIFNENV+RIE FN   +K Y+LG+N+FADLTN+EF+  R     R +  + S  +
Sbjct  57   EMRHKIFNENVERIEYFNRAANKPYKLGINQFADLTNEEFKTSRN----RFKGHMCSPQA  112

Query  124  KGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                 FRYENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  113  GP---FRYENVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 102/154 (66%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L  +LGAWSS+  A+SR + D   SM  ++E WM R+G+++T   EK+ RFKIF
Sbjct  10   KCICLALIFMLGAWSSQ--ATSRNLQD--ASMYGKYEQWMTRYGRVFTGVQEKEMRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N+  +K Y+L VN+FADLTN+EF+  R G      +  T+T       F+
Sbjct  66   KENVAFIESSNSDANKPYKLSVNQFADLTNEEFKASRNGFLGHECSTKTTT-------FK  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  +V DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  YENVTAPPTV-DWRTKGAVTPIKDQGQCGCCWAF  151



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 101/154 (66%), Gaps = 10/154 (6%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            +  C ++ + LGA +S+ AA+  +   ++ SMR RHE WMA +G++Y D  EK +R+KIF
Sbjct  6    QCFCLVVMVTLGALASQLAAARSL---QDASMRERHEEWMASYGRVYKDINEKQKRYKIF  62

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K Y+L VN+FADLTN+EF+  R     R +  + ST S     F+
Sbjct  63   EENVALIESSNKDANKPYKLSVNQFADLTNEEFKASR----NRFKGHICSTKSTS---FK  115

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            Y NV+A  S +DWR KGAVTPVKDQ  CGCCWAF
Sbjct  116  YGNVSAVPSAMDWRMKGAVTPVKDQGQCGCCWAF  149



>ref|XP_008353751.1| PREDICTED: actinidain-like [Malus domestica]
Length=227

 Score =   146 bits (369),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 100/155 (65%), Gaps = 13/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K  C  L ++LGAWSS+  A+SR + D   SM  R+E W+AR+G+++ D  EK+ RFKIF
Sbjct  10   KYKCLGLILVLGAWSSQ--ATSRSLQD--ASMYGRYEQWLARYGRVHNDINEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE  N   +K Y+L VN+FADLTN+EF+  R G      +  TS        F+
Sbjct  66   KENVAFIEFSNKDANKPYKLSVNQFADLTNEEFKATRNGFKGHECSTKTS--------FK  117

Query  103  YENVTA-AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVT    + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  118  YENVTVPLPATMDWRKKGAVTPVKDQGQCGCCWAF  152



>ref|XP_008368631.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 102/155 (66%), Gaps = 12/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L ++LGAWSS+  A+SR + D   SM  R+E W+AR+G++Y D  E + RFKIF
Sbjct  10   KYMCLGLILMLGAWSSQ--ATSRSLKD--ASMYGRYEQWLARYGRVYNDINEMETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             E V  IE  N   +K Y+L VN+F DLTN+EF+  R  G+K  +    +TS      F+
Sbjct  66   KEXVAFIEXSNKDANKPYKLSVNQFXDLTNEEFKASRN-GFKGHECSTKTTS------FK  118

Query  103  YENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTAA  + +DWRKKGAVTP KDQ  CGCCWAF
Sbjct  119  YENVTAALPATMDWRKKGAVTPXKDQGQCGCCWAF  153



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            ++ + L ++  +++G W S+  A SR + D   +M  RHE+WM ++G++Y D  EK+ RF
Sbjct  4    ISERKLMFVALLVVGLWVSQ--AWSRSLHD--AAMNERHEMWMVKYGRVYKDNSEKERRF  59

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            +IF  NV+ IE+FN  G++ Y+L +N+FADLTN+EF+  R  GYKR      S  S    
Sbjct  60   EIFRNNVEFIESFNKPGNRPYKLDINEFADLTNEEFKASRN-GYKRSSNVGLSEKSS---  115

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             FRY NVTA  + +DWR+KGAVTP+KDQ  CGCCWAF
Sbjct  116  -FRYGNVTAVPTSMDWRQKGAVTPIKDQGQCGCCWAF  151



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 10/157 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            +  K++C  L +++G W+S+  A SR +   E SM  RHE WM  +G+ Y D  EK+ RF
Sbjct  3    LESKIICITL-LIMGVWASQ--ALSRTL--HEVSMSERHEDWMGLYGRTYKDIAEKERRF  57

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            KIF ENV+ IE+ N+ G++ Y+L +N+FAD TN+EF+  R G     + + +  +S    
Sbjct  58   KIFKENVEYIESVNSAGNRRYKLSINEFADQTNEEFKASRNGYNMSSRPRSSEITS----  113

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             FRYENV A  S +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  114  -FRYENVAAVPSSMDWRKKGAVTPIKDQGQCGCCWAF  149



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 101/154 (66%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L  +LGAWSS+  A+SR + D   SM  ++E WMAR+ ++Y D  EK+ RFKIF
Sbjct  10   KCICLALIFMLGAWSSQ--ATSRNLQD--ASMYGKYEQWMARYERVYMDIQEKEMRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K Y+L VN+FADLTN+EF+  R G      +  T+T       F+
Sbjct  66   KENVAFIESSNGNTNKPYKLSVNQFADLTNEEFKASRNGFLGHECSTKTTT-------FK  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  +V DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  YENVTAPPTV-DWRTKGAVTPIKDQGQCGCCWAF  151



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 104/152 (68%), Gaps = 9/152 (6%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L ++  +++G W+S+  A SR + D   +M  RHE+WMA++G++Y D  EK+ RF+IF  
Sbjct  9    LMFVALLVVGLWASQ--AWSRSLHD--AAMNERHEMWMAKYGRVYKDNSEKERRFEIFRN  64

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV+ IE+FN  G++ Y+L +N+FADLTN+EF++ + G  +     +T  SS     FRY 
Sbjct  65   NVEFIESFNKLGNRPYKLDINEFADLTNEEFKVSKNGYKRSSGVGLTEKSS-----FRYA  119

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA  + +DWR+ GAVTP+KDQ  CGCCWAF
Sbjct  120  NVTAVPTSMDWRQNGAVTPIKDQGQCGCCWAF  151



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 102/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + LC L  +LLGAW  + A SSR + D   +M  R+E W AR+G++Y D  EK++RF IF
Sbjct  8    QCLC-LALILLGAWIPQ-AMSSRTLQDA--AMYERYEQWTARYGRVYRDNVEKEKRFTIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV  IEAFN    K Y+L VN+FADLTN+EF++ R     R +  + S  +     F+
Sbjct  64   KQNVAHIEAFNKASKKPYKLAVNEFADLTNEEFKVSRN----RFKGHMCSEQTGP---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  117  YENVTAVPSTMDWRKKGAVTPVKDQGQCGCCWAF  150



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 99/158 (63%), Gaps = 11/158 (7%)
 Frame = -1

Query  475  FMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            F     +C  L  +L AW S+  A  R + D   SM  RHE WMA++G++Y D  EK+ R
Sbjct  3    FTKQSQICLALLFVLVAWPSKSVA--RTLQD--VSMYERHEQWMAQYGRVYKDNAEKETR  58

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
            + IF  NV RI+ FN++  K Y+LGVN+FADL+N+EF+  R     R +  + S  +   
Sbjct  59   YNIFKANVARIDEFNSQTGKSYKLGVNQFADLSNEEFKASRN----RFKGHMCSPQAGP-  113

Query  115  HYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              FRYENV+A    +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  114  --FRYENVSAVPDSMDWRKKGAVTPVKDQGQCGCCWAF  149



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   149 bits (375),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L  ++  +LG W+S+  A SR +   E +MR RH+ WMARHG++Y D  EK+ RF IF  
Sbjct  9    LVLVMVAVLGLWASQ--ARSREL--HEATMRERHDQWMARHGRVYQDDAEKERRFSIFKN  64

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  +E+FN  G+K Y L +N FADLT +EF+  R G  +    +  ST       FRYE
Sbjct  65   NVDLVESFNKNGNKPYTLAINAFADLTIEEFKASRNGYMRSSSPRQVSTKP-----FRYE  119

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA  S +DWRKKGAVTP+K+Q  CG CWAF
Sbjct  120  NVTAVPSSMDWRKKGAVTPIKNQGQCGSCWAF  151



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 100/154 (65%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K+LC  L ++LGAWSS   A+SR + D       R+E WMAR+G++Y DA EK+ERFKIF
Sbjct  8    KVLCLALVLMLGAWSSE--ATSRSLQD--ALAYGRYEQWMARYGRVYNDATEKEERFKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
              N   IE+ N  G+K Y+LG+N+FADLTN+EF   R     R      ST S     F+
Sbjct  64   KANEAFIESSNNEGNKPYKLGLNQFADLTNEEFIASR----NRFLGHECSTKST---TFK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YEN T   ++ DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  117  YENSTVPATI-DWRQKGAVTPVKDQGQCGCCWAF  149



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C  L  ++GAW S+  A  R + D    M  RHE WM ++G++Y D  E+  R+ IF
Sbjct  28   QFVCLALLFIVGAWPSKSIA--RTLLDA--PMYERHEQWMTQYGRVYKDDNERATRYSIF  83

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV R++AFN++  K Y+LGVN+FADLTN+EF+  R     R +  + S  +     FR
Sbjct  84   KENVARVDAFNSQTGKSYKLGVNQFADLTNEEFKASR----NRFKGHMCSPQAGP---FR  136

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV+A  S +DWRK+GAVTP KDQ  CGCCWAF
Sbjct  137  YENVSAVPSTMDWRKEGAVTPAKDQGQCGCCWAF  170



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   148 bits (374),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 101/157 (64%), Gaps = 10/157 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            MA       L  ++G W+ +  ASSR +   E SM  R E W+A  G++Y DA EK++R 
Sbjct  1    MASTSRSLALLFIVGIWACQ--ASSRSVP--EVSMSDRFEQWLASCGRVYQDASEKEKRL  56

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            +IF ENV+ IE+ NA   K Y+LGVN+F DLTN+EF+ +R G   R      STSSK K 
Sbjct  57   QIFKENVEYIESHNADTSKKYKLGVNEFTDLTNEEFKAMRNGYKLR-----PSTSSK-KS  110

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             FRYENV A  S +DWRKKGAVT +KDQ  CGCCWAF
Sbjct  111  SFRYENVAAVPSSMDWRKKGAVTNIKDQGQCGCCWAF  147



>gb|KCW76121.1| hypothetical protein EUGRSUZ_D00498 [Eucalyptus grandis]
Length=249

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EE+ +  +HE WMA HG++Y D+ EK +R++IF ENVKRI AFN   D GY++ VNKFAD
Sbjct  31   EEEQLLKQHEEWMAIHGRVYKDSVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNKFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V S+    K  F+Y N TA  + LDWR K AVTPVKDQ  
Sbjct  91   LTNEEFRASYT-GYKRRPTRVLSSGE--KKLFKYANFTAIPATLDWRTKKAVTPVKDQGG  147

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  148  CGDCWAF  154



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 104/153 (68%), Gaps = 11/153 (7%)
 Frame = -1

Query  451  YLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENV  272
            +LL +L  A+    A ++R ++D+  +M ARHE WMA++ ++Y DA EK  R ++FN NV
Sbjct  7    FLLAILGCAFLFSGALAARALSDD-SAMVARHEQWMAQYSRVYKDAAEKARRLEVFNANV  65

Query  271  KRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFRYEN  95
            K IE+FNA G++ + LGVN+FADLTNDEFR  +T  G+K    KV +        FRYEN
Sbjct  66   KFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTG-------FRYEN  118

Query  94   VT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            V+  A  + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  VSIDALPATIDWRSKGAVTPIKDQGQCGCCWAF  151



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  472  MAP-KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            M P K + + L ++ GAW     A+SR + D   SM  R+E WM R+G+IY D  EK+ R
Sbjct  1    MEPWKCIGFGLILMFGAWCCE--ATSRSLQD--ASMYGRYEQWMTRYGRIYNDVNEKENR  56

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
            FKIF ENV  IE+ N   +K Y+LGVN+FADLTN+EF+  R  G+K  +    +TS    
Sbjct  57   FKIFKENVAFIESSNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTS----  111

Query  115  HYFRYENVTA-AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              F+YENV A   + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  112  --FKYENVKAPVPATMDWRKKGAVTPIKDQGQCGCCWAF  148



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 104/153 (68%), Gaps = 11/153 (7%)
 Frame = -1

Query  451  YLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENV  272
            +LL +L  A+    A ++R ++D+  +M ARHE WMA++ ++Y DA EK  R ++FN NV
Sbjct  7    FLLAILGCAFLFSGALAARALSDD-SAMVARHEQWMAQYSRVYKDAAEKARRLEVFNANV  65

Query  271  KRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFRYEN  95
            K IE+FNA G++ + LGVN+FADLTNDEFR  +T  G+K    KV +        FRYEN
Sbjct  66   KFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTG-------FRYEN  118

Query  94   VT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            V+  A  + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  VSIDALPATIDWRTKGAVTPIKDQGQCGCCWAF  151



>gb|KHN28095.1| Thiol protease [Glycine soja]
Length=336

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            E SMR RHE WM  +GK+Y DA EKD+RF+IF +NV+ IE+FNA G+K Y+LGVN  ADL
Sbjct  31   ETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNHLADL  90

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
            T +EF+  R  G+KR     T+T       F+YENVTA  + +DWR KGAVTP+KDQ  C
Sbjct  91   TVEEFKASRN-GFKRPHEFSTTT-------FKYENVTAIPAAIDWRTKGAVTPIKDQGQC  142

Query  19   GCCWAF  2
            G CWAF
Sbjct  143  GSCWAF  148



>ref|XP_010054320.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76122.1| hypothetical protein EUGRSUZ_D00499 [Eucalyptus grandis]
Length=345

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EE+ +  +HE WMA HG++Y DA EK +R++IF ENVKRI AFN   D GY+L VNKFAD
Sbjct  31   EEEHLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENVKRINAFNNGKDVGYKLAVNKFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V S+    K  F+Y N TA  + LDWR K AVTPVKDQ +
Sbjct  91   LTNEEFRASYT-GYKRRPTRVLSSGE--KKPFKYANFTAIPAALDWRTKKAVTPVKDQGN  147

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  148  CGSCWAF  154



>ref|XP_003526207.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            E SMR RHE WM  +GK+Y DA EKD+RF+IF +NV+ IE+FNA G+K Y+LGVN  ADL
Sbjct  31   ETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNHLADL  90

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
            T +EF+  R  G+KR     T+T       F+YENVTA  + +DWR KGAVTP+KDQ  C
Sbjct  91   TVEEFKASRN-GFKRPHEFSTTT-------FKYENVTAIPAAIDWRTKGAVTPIKDQGQC  142

Query  19   GCCWAF  2
            G CWAF
Sbjct  143  GSCWAF  148



>ref|XP_008354173.1| PREDICTED: actinidain-like [Malus domestica]
Length=227

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 99/155 (64%), Gaps = 13/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K  C  L ++LGAWSS+  A+SR + D   SM   +E W+AR+G+++ D  EK+ RFKIF
Sbjct  10   KYKCLGLILVLGAWSSQ--ATSRSLQD--ASMYGXYEQWLARYGRVHNDINEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE  N   +K Y+L VN+FADLTN+EF+  R G      +  TS        F+
Sbjct  66   KENVAFIEFSNKDANKPYKLSVNQFADLTNEEFKATRNGXKGHECSTKTS--------FK  117

Query  103  YENVTA-AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVT    + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  118  YENVTVPLPATMDWRKKGAVTPVKDQGQCGCCWAF  152



>gb|AHA62783.1| RCR3-like cysteine protease [Mirabilis viscosa]
Length=343

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 9/159 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            +  K+   LLF+L+      P+ S   +   E  M  +HE WM  +G+IY +  EK +RF
Sbjct  3    LVTKICSILLFILV----ILPSYSLSRLLHIESFMIEKHEQWMTLYGRIYENNNEKMKRF  58

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            KIF+EN+KRIEA N  G + + LGVN FADLTNDEFR  RT GYK+ Q   T+ ++    
Sbjct  59   KIFSENIKRIEAMNKMG-RSFTLGVNAFADLTNDEFRNSRT-GYKK-QLTTTNNNNLASK  115

Query  112  YFRYENVT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YF+YENVT  +  +  DWR KGAVTP+KDQ +CGCCWAF
Sbjct  116  YFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCCWAF  154



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 103/148 (70%), Gaps = 10/148 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L ++ G  S    A++R +  E+ SM  RHE WMA++GK+Y D+ EK+ R KIF ENV+R
Sbjct  14   LLLVFGFLSFE--ANARTL--EDASMHERHEQWMAQYGKVYKDSYEKELRSKIFKENVQR  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN  G+K Y+LG+N+FADLTN+EF+        R +  + S S++    F+YE+VT+
Sbjct  70   IEAFNNAGNKSYKLGINQFADLTNEEFK-----ARNRFKGHMCSNSTR-TPTFKYEHVTS  123

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + LDWR+KGAVTP+KDQ  CGCCWAF
Sbjct  124  VPASLDWRQKGAVTPIKDQGQCGCCWAF  151



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 8/149 (5%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            L  ++LG W+S+  A+ R + D   SM  RHE WMAR+  IY D  E+++RF+IF +NV+
Sbjct  13   LTLLVLGVWASQ--ANCRTLLDAHTSMLDRHEQWMARYVPIYKDDEEREKRFQIFKDNVE  70

Query  268  RIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
             IE+FN   ++ Y+L +N FAD +++EF+  R     R +T + + SSK    FRYENVT
Sbjct  71   FIESFNYASNQPYKLNINGFADQSHEEFQASR----NRYRTSLNTMSSKTP--FRYENVT  124

Query  88   AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            A  S +DWRKKGAVTP+KDQ +CGCCWAF
Sbjct  125  AIPSSMDWRKKGAVTPIKDQGECGCCWAF  153



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 99/154 (64%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C     ++GA      A+SR + D   SM  RHE WMAR+G++Y D  E+++RF IF
Sbjct  10   QCICLAFIFIVGALVCE--ATSRTLQDA--SMYERHEQWMARYGRVYHDNNEREQRFNIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  I++FN   DK Y+LGVN+FADLTN+EF   R     R +  + S  +     F+
Sbjct  66   KENVAHIDSFNRAKDKPYKLGVNQFADLTNEEFTASR----NRFKGHMCSNKAT---TFK  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YEN+TA  S +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  119  YENLTALPSTVDWRKKGAVTPIKDQGQCGCCWAF  152



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 12/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K + + L ++ GAWS    A+SR + D   SM  ++E WM R+G++Y D  EK+ RFKIF
Sbjct  5    KCIGFGLILMFGAWSCE--ATSRSLQD--ASMYGKYEQWMTRYGRVYNDVNEKENRFKIF  60

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K Y+LGVN+FADLTN+EF+  R  G+K  +    +TS      F+
Sbjct  61   KENVAFIESSNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTS------FK  113

Query  103  YENVTA-AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV A   + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  114  YENVKAPVPAAMDWRKKGAVTPIKDQGQCGCCWAF  148



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 101/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + LC L  +LLGAW  + A SSR + D   +M  R+E W AR+G++Y D  EK++RF IF
Sbjct  8    QCLC-LALILLGAWIPQ-ALSSRALQD--AAMYERYEQWTARYGRVYRDNVEKEKRFTIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
              NV  IEAFN    K Y+L VN+FADLTN+EF++ R     R +  + S  +     F+
Sbjct  64   KRNVAHIEAFNKASKKPYKLAVNEFADLTNEEFKVSRN----RFKGHMCSEQTGP---FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  S +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  117  YENVTAVPSTMDWRKKGAVTPVKDQGQCGCCWAF  150



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = -1

Query  406  ASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYR  227
            A++R + D   SMR RHE WM  HGK+Y D+ EK+++++IF ENV+RIEAFN  G+K Y+
Sbjct  24   ANARTLQD--ASMRERHEQWMVTHGKLYLDSSEKEQKYQIFKENVQRIEAFNNAGNKPYK  81

Query  226  LGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAV  47
            LG+N+FADLTN+EF+        R +  + ST ++    F+YE+VTA  + LDWR+KGAV
Sbjct  82   LGINQFADLTNEEFK-----ARNRFKGHICSTITR-TPTFKYEHVTALPTSLDWRQKGAV  135

Query  46   TPVKDQRDCGCCWAF  2
            TP+KDQ  CG CWAF
Sbjct  136  TPIKDQGQCGSCWAF  150



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 98/150 (65%), Gaps = 13/150 (9%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            LLF +LG W+S+  A  R + DE   +  ++E WM ++G++Y +  EKD  FKIF +N +
Sbjct  6    LLFAILGIWASKTTA--RTLVDE--PLMLKYEQWMIQYGRVYKNNAEKDSHFKIFKKNAE  61

Query  268  RIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFRYENV  92
            RIEAFN   ++ Y+LG+N FADLTN+EFR  R G      + K+TS        FRYENV
Sbjct  62   RIEAFNDAANQPYKLGINAFADLTNEEFRAARNGLKIPFCEPKITS--------FRYENV  113

Query  91   TAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            TA  + +DWR KGAVTP+KDQ  CG CWAF
Sbjct  114  TAIPTTMDWRIKGAVTPIKDQGQCGSCWAF  143



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 104/156 (67%), Gaps = 16/156 (10%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C+ L  +LGA SS   A+SR + D   SM  ++E WMAR+G++YTD  EK++RF IF
Sbjct  210  KCMCFALIFMLGALSSH--ATSRTLQD--ASMYGKYEQWMARYGRVYTDINEKEKRFNIF  265

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRT--GGYKRVQTKVTSTSSKGKHY  110
              NV  IE+ N   +K Y+L VN+FADLTN+EF+  R    G++   TK TS        
Sbjct  266  KANVDFIESSNNDANKPYKLKVNQFADLTNEEFKTSRNRFMGHE-CSTKTTS--------  316

Query  109  FRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            F+YENVTA  +V DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  317  FKYENVTAPATV-DWRKKGAVTPIKDQGQCGCCWAF  351



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 103/155 (66%), Gaps = 12/155 (8%)
 Frame = -1

Query  466  PKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            P++   L+F +LGA +S+  A S     ++ S+  RHE WMA++GK+Y DA EK  R KI
Sbjct  8    PRISLALIF-ILGALASQAIARSL----QDASINERHEKWMAQYGKVYKDANEKVIRRKI  62

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F  NV+RIE+FN  G K Y+LG+N+FADLTN+EF+  R     R +  + S  +     F
Sbjct  63   FKRNVERIESFNKAGGKPYKLGINQFADLTNEEFKTSRN----RFKGHMCSPQA---GPF  115

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            RYENVTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  116  RYENVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 104/153 (68%), Gaps = 11/153 (7%)
 Frame = -1

Query  451  YLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENV  272
            +LL +L  A+    A ++R ++D+  +M ARHE WMA++ ++Y DA EK  RF++F  NV
Sbjct  7    FLLAILGCAFLFSGALAARTLSDD-SAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANV  65

Query  271  KRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFRYEN  95
            K IE+FNA G++ + LGVN+FADLTNDEFR  +T  G+K    KV +        FRYEN
Sbjct  66   KFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPMKVPTG-------FRYEN  118

Query  94   VT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            V+  A  + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  VSIDALPATIDWRTKGAVTPIKDQGQCGCCWAF  151



>ref|XP_010054322.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76126.1| hypothetical protein EUGRSUZ_D00502 [Eucalyptus grandis]
Length=345

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EE+ +  +HE WMA HG++Y DA EK +R++IF EN+KRI AFN   D GY++ VNKFAD
Sbjct  31   EEEQLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENIKRINAFNNGKDVGYKMAVNKFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V S+    K  F+Y N TA  + LDWR K AVTPVKDQ +
Sbjct  91   LTNEEFRASYT-GYKRRPTRVLSSGE--KKPFKYANFTAIPAALDWRTKKAVTPVKDQGN  147

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  148  CGSCWAF  154



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 99/157 (63%), Gaps = 13/157 (8%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            +A   L +  F++L   +S+    +      E SM  +HE WMA++G++Y +  EK  R+
Sbjct  4    IATSKLIFTAFLMLTVLASQAVCRNL----NEASMIEKHEQWMAQNGRVYKNEAEKGNRY  59

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
            KIF ENV+ IE+FN  G K Y+LG+N+FADLTN EFR  R  GYK  + K T        
Sbjct  60   KIFKENVEFIESFNKAGTKSYKLGINQFADLTNVEFRAARN-GYKPKECKGT--------  110

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             FRYENV+A  + +DWRKKGAVT +KDQ  CGCCWAF
Sbjct  111  LFRYENVSAVPAAMDWRKKGAVTGIKDQGQCGCCWAF  147



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 104/153 (68%), Gaps = 11/153 (7%)
 Frame = -1

Query  451  YLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENV  272
            +LL +L  A+    A ++R ++D+  +M ARHE WMA++ ++Y DA EK  RF++F  NV
Sbjct  7    FLLAILGCAFLFSGALAARALSDD-SAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANV  65

Query  271  KRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFRYEN  95
            K IE+FNA G++ + LGVN+FADLTNDEFR  +T  G+K    KV +        FRYEN
Sbjct  66   KFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPMKVPTG-------FRYEN  118

Query  94   VT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            V+  A  + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  119  VSIDALPATIDWRTKGAVTPIKDQGQCGCCWAF  151



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 101/158 (64%), Gaps = 9/158 (6%)
 Frame = -1

Query  475  FMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            F+    L + + +LLG W+S   + S      E SM  RHE WMA++G+ Y D  EK+ R
Sbjct  26   FIPENKLIFAVVLLLGLWTSHVWSRSLY----EASMMERHETWMAQYGRAYKDRVEKERR  81

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
               F  NV+ IE+FN  G K Y+L VN+FADL N+EFR  R G   ++   ++S+S+   
Sbjct  82   LNTFKNNVEFIESFNKDGKKPYKLSVNEFADLMNEEFRASRNG--YKMPAHLSSSST---  136

Query  115  HYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            + FRYEN++A  S +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  137  NPFRYENISAVPSTMDWRKKGAVTPIKDQGQCGCCWAF  174



>ref|XP_010052198.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76120.1| hypothetical protein EUGRSUZ_D00497 [Eucalyptus grandis]
Length=345

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EE+ +  +HE WMA HG++Y DA EK +R++IF ENVKRI AFN   D GY++ VNKFAD
Sbjct  31   EEEHLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNKFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V S+    K  F+Y N TA  + LDWR K AVTPVKDQ +
Sbjct  91   LTNEEFRASYT-GYKRRPTRVLSSGE--KKPFKYANFTAIPAALDWRTKKAVTPVKDQGN  147

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  148  CGSCWAF  154



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 102/154 (66%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +   L ++LGAWSS   A+SR + D   +M  R+E WMARHG++++   EK+ RFKIF
Sbjct  8    KCISLALILMLGAWSSE--ATSRTLQD--VTMYGRYEQWMARHGRVFSSIDEKESRFKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             EN+  IE+ N    K +RLGVN+FA LTN+EF  L + G+K  ++   ++S      FR
Sbjct  64   KENLAYIESSNNDASKTFRLGVNQFAHLTNEEFTSL-SNGFKGHESSTKTSS------FR  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVT   + +DWR KGAVTP+K+Q  CGCCWAF
Sbjct  117  YENVTVP-ATMDWRSKGAVTPIKNQGQCGCCWAF  149



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 103/156 (66%), Gaps = 11/156 (7%)
 Frame = -1

Query  466  PKLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFK  290
            PK LC     +LL A +S   A++R ++  E +M  RHE WMA+ G+ Y D+ EK+ R++
Sbjct  6    PKSLCMGFSVLLLCACASH--ATARTLS--EMTMAERHEQWMAQQGRAYRDSAEKERRYQ  61

Query  289  IFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHY  110
            IF  NV+ IE+FNA G+  Y+LGVN+FADLTN+EF+ +  G +K    K      K  + 
Sbjct  62   IFKANVELIESFNA-GNSKYKLGVNQFADLTNEEFKAMMNG-FKPSTLKTL----KATNV  115

Query  109  FRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            F YENVTA  S +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  116  FSYENVTAVPSSMDWRAKGAVTPIKDQGQCGCCWAF  151



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 11/160 (7%)
 Frame = -1

Query  478  TFMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDE  299
            T    K LC  LF+LL   +    A++R+++  E +M  RHE WM++HG++Y D+ EK+ 
Sbjct  2    TLPLTKSLCMALFVLL-LCTFASHATARMLS--EMTMHERHEQWMSQHGRVYGDSAEKER  58

Query  298  RFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSS-K  122
            RF+IF  NV+ IE+FNA G+  Y+LGVN+FADLT +EF+ +  G       K +S ++ K
Sbjct  59   RFQIFKANVELIESFNA-GNSKYKLGVNQFADLTIEEFKAMMNG------FKPSSVNTFK  111

Query  121  GKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + FRYENVTA  + +DWR +GAVTP+KDQ D GCCWAF
Sbjct  112  ATNVFRYENVTAVPTSMDWRAEGAVTPIKDQGDYGCCWAF  151



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            M  RH  WMA++G++Y D  EKD+R+ IF EN++RIEAFN   D+GY+LGVNKFADLTN+
Sbjct  1    MLKRHGEWMAQYGRVYGDMKEKDKRYLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNE  60

Query  190  EFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCC  11
            EFR +   GYKR  +K+ S+S      FRYEN++   + +DWR   AVTPVKDQ  CGCC
Sbjct  61   EFRAMYH-GYKRQSSKLMSSS------FRYENLSDIPTSMDWRNAEAVTPVKDQGRCGCC  113

Query  10   WAF  2
            WAF
Sbjct  114  WAF  116



>ref|XP_006582267.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            E SMR RHE WM  +GK+Y DA EK++RF+IF +NV+ IE+FNA G+K Y+LGVN  ADL
Sbjct  31   ETSMRERHEQWMTEYGKVYKDAAEKEKRFQIFKDNVEFIESFNADGNKPYKLGVNHLADL  90

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
            T +EF+  R  G+KR     T+T       F+YENVTA  + +DWR KGAVTP+KDQ  C
Sbjct  91   TVEEFKASRN-GFKRPHEFSTTT-------FKYENVTAIPAAIDWRTKGAVTPIKDQGQC  142

Query  19   GCCWAF  2
            G CWAF
Sbjct  143  GSCWAF  148



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 100/154 (65%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L ++LGAWSS   A+SR + D    M  R+E WM R+G+IY+D  EK++RFKIF
Sbjct  8    KFICLALILILGAWSSE--ATSRSLQD--ALMYGRYEQWMIRYGRIYSDTDEKEKRFKIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K Y+L VN FADLTN+EF   R   +K  +    +TS      F+
Sbjct  64   KENVAFIESSNDEANKPYKLSVNGFADLTNEEFTASRN-RFKGHECSTKTTS------FK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YEN T   + +DWR+KGAVTP+KDQ  CGCCWAF
Sbjct  117  YENATVP-TKMDWRQKGAVTPIKDQGQCGCCWAF  149



>ref|XP_010054319.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW76119.1| hypothetical protein EUGRSUZ_D00496 [Eucalyptus grandis]
Length=345

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EE+ +  +HE WMA HG++Y DA EK +R++IF ENVKRI AFN   D GY++ VNKFAD
Sbjct  31   EEEHLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNKFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V S+    K  F+Y N TA  + LDWR K AVTPVKDQ  
Sbjct  91   LTNEEFRASYT-GYKRRPTRVLSSGE--KKPFKYANFTAIPAALDWRTKKAVTPVKDQGG  147

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  148  CGSCWAF  154



>ref|XP_008246197.1| PREDICTED: vignain-like, partial [Prunus mume]
Length=286

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 12/146 (8%)
 Frame = -1

Query  436  LLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEA  257
            + GAWS    A+SR + D   SM  R+E WM R+G++Y D  EK+ RFKIF ENV  IE+
Sbjct  1    MFGAWSCE--ATSRSLQD--ASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIES  56

Query  256  FNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA-AG  80
             N   +K Y+LGVN+FADLTN+EF+  R  G+K  +    +TS      F+YENV A   
Sbjct  57   SNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTS------FKYENVKAPVP  109

Query  79   SVLDWRKKGAVTPVKDQRDCGCCWAF  2
            + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  110  AAMDWRKKGAVTPIKDQGQCGCCWAF  135



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 99/148 (67%), Gaps = 11/148 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L  LLGA  S+  A +R + D   SM  +HE WM+R G++Y D  EK+ R+KIF ENV+R
Sbjct  14   LIFLLGALVSQ--AMARTLQD--ASMHEKHEEWMSRFGRVYNDGNEKEIRYKIFKENVQR  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FN    K Y+LG+N+FADLTN+EF+  R     R +  + S+ +     FRYEN+TA
Sbjct  70   IESFNKASGKSYKLGINQFADLTNEEFKTSRN----RFKGHMCSSQAG---PFRYENLTA  122

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            A S +DWRKKGAVT +KDQ  CG CWAF
Sbjct  123  APSSMDWRKKGAVTAIKDQGQCGSCWAF  150



>gb|KHN13720.1| Vignain [Glycine soja]
Length=309

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 87/123 (71%), Gaps = 5/123 (4%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            M  RHE WMAR+ K+Y D  E+++RFKIF ENV  IEAFN   DK Y+LG+N+FADLTN+
Sbjct  1    MYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAADKPYKLGINQFADLTNE  60

Query  190  EFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCC  11
            EF   R      + + +T T++     F+YENVTA  S +DWR+KGAVTP+KDQ  CGCC
Sbjct  61   EFIAPRNRFKGHMCSSITRTTT-----FKYENVTALPSTVDWRQKGAVTPIKDQGQCGCC  115

Query  10   WAF  2
            WAF
Sbjct  116  WAF  118



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 12/146 (8%)
 Frame = -1

Query  436  LLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEA  257
            +LGAWS    A+SR + D   SM  R+E WM R+G++Y D  EK+ RFKIF ENV  IE+
Sbjct  1    MLGAWSCE--ATSRSLQD--ASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIES  56

Query  256  FNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA-AG  80
             N   +K Y+LGVN+FADLTN+EF+  R  G+K  +    +TS      F+YEN+ A   
Sbjct  57   SNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTS------FKYENIKAPVP  109

Query  79   SVLDWRKKGAVTPVKDQRDCGCCWAF  2
            + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  110  ATMDWRKKGAVTPIKDQGQCGCCWAF  135



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L + + ++L  W+ +  A++R + D   SM  RHE WMA+HG+ Y D  EK +RFKIF E
Sbjct  9    LIFAVLLVLEMWTYQ--ATARSLPD--ASMIERHEEWMAQHGRAYKDDVEKAKRFKIFKE  64

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV+ I++FN  G + Y+L VNKFADLTN+EF+  R G       K +  SS     FRY 
Sbjct  65   NVEYIQSFNEAGTRPYKLAVNKFADLTNEEFQASRNGYKMGSYGKASKVSS-----FRYA  119

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA  + +DWR+KGAVT VKDQ  CGCCWAF
Sbjct  120  NVTAVPTSMDWRQKGAVTGVKDQGQCGCCWAF  151



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 89/127 (70%), Gaps = 5/127 (4%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            ++ SM  RHE WM R+GK+Y D  E+++RF++F ENV  IEAFN   +K Y+LG+N+FAD
Sbjct  31   QDASMYERHEQWMTRYGKVYKDPQEREKRFRVFKENVNYIEAFNNAANKSYKLGINQFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN EF   R G    + + +  T++     F++ENVTA  S +DWR+KGAVTP+KDQ  
Sbjct  91   LTNKEFIAPRNGFKGHMCSSIIRTTT-----FKFENVTATPSTVDWRQKGAVTPIKDQGQ  145

Query  22   CGCCWAF  2
            CGCCWAF
Sbjct  146  CGCCWAF  152



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 101/155 (65%), Gaps = 13/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLL-GAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            K LC  L +L+ GAWSS   A+SR + D   SM  R+E WMAR+G++Y D  EK++RF+I
Sbjct  8    KCLCLALILLMFGAWSSE--ATSRTLQD--ASMYGRYEQWMARYGRVYNDINEKEKRFQI  63

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F  NV  +E+ N    K Y+L VN+FADLTN+EF   R   +K  +    +TS      F
Sbjct  64   FKANVAIVESSNNDASKPYKLSVNQFADLTNEEFITSRN-RFKGHECSTKTTS------F  116

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +YENVT   +V DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  117  KYENVTVPATV-DWRQKGAVTPVKDQGQCGCCWAF  150



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 100/154 (65%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L  +LG  SS+  A+SR + D   SM  ++E WMAR+G++YT   EK++RF IF
Sbjct  10   KCICLALIFMLGDLSSQ--ATSRALQD--ASMYGKYEQWMARYGRVYTGINEKEKRFNIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K Y+L VN+FADLTN++F+  R G        +    S  K  F+
Sbjct  66   KENVAFIESSNKDANKLYKLSVNQFADLTNEQFKASRNG-------FMGHECSAAKTSFK  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA  +V DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  119  YENVTAPPTV-DWRKKGAVTPIKDQGQCGCCWAF  151



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 96/148 (65%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   +  W+ +   +SR + D   SM  RHE WM R+G++Y D  E+++R +IF ENV  
Sbjct  14   LLFCMAIWTFQ--VTSRTLQD--ASMNERHEEWMTRYGRVYKDPPEREKRLRIFKENVNY  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   +K Y+L VN+FADLTN+EF   R      + + +T T+S     F+YENVTA
Sbjct  70   IEAFNNAANKPYKLAVNQFADLTNEEFIAPRNRFKGHMCSSITRTTS-----FKYENVTA  124

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  125  VPSTVDWRQKGAVTPVKDQGQCGCCWAF  152



>ref|XP_010052199.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76124.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EE+ +  +HE WMA HG++Y D  EK +R++IF ENVKRI AFN   D GY++ VNKFAD
Sbjct  31   EEEQLLKQHEEWMAIHGRVYKDTVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNKFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V S+    K  F+Y N TA  + LDWR K AVTPVKDQ  
Sbjct  91   LTNEEFRASYT-GYKRRPTRVLSSGE--KKPFKYANFTAIPAALDWRTKKAVTPVKDQGG  147

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  148  CGSCWAF  154



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 7/132 (5%)
 Frame = -1

Query  397  RVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGV  218
            R + DE  +M  RHE WM+ HG++YTD  EK+ RF+IF +NV+ IEAFN  G + Y+LGV
Sbjct  22   RTLNDE--AMVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGV  79

Query  217  NKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPV  38
            N+FADLTN+EF+  R G       K+   +S     F+YENVTA  + +DWRKKGAV P+
Sbjct  80   NQFADLTNEEFKASRNGFKASSSLKLIRGAS-----FKYENVTAVPATMDWRKKGAVAPI  134

Query  37   KDQRDCGCCWAF  2
            KDQ  CG CWAF
Sbjct  135  KDQGQCGSCWAF  146



>ref|XP_007132868.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
 gb|ESW04862.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
Length=256

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 98/153 (64%), Gaps = 8/153 (5%)
 Frame = -1

Query  457  LCYL-LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFN  281
            LC++ L ML          +SR + D   S+  RHE WMAR+ ++Y D  EK++RFKIF 
Sbjct  7    LCHISLAMLFCMAFCALQVTSRTLQDA--SIYERHEEWMARYSRVYKDPQEKEKRFKIFK  64

Query  280  ENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRY  101
            +N+  IEAFN   +K Y+L +N+FADLTN+EF   R      + + +  T++     F+Y
Sbjct  65   QNMNYIEAFNNAANKPYKLAINQFADLTNEEFIAPRNRFKGHMCSSIIKTTT-----FKY  119

Query  100  ENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            ENVT+  S +DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  120  ENVTSVPSTVDWRQKGAVTPVKDQGQCGCCWAF  152



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 11/152 (7%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            +L +L  A+    A ++R ++D+  +M ARHE WMA++ ++Y DA EK  RF++F  NVK
Sbjct  8    ILAILGFAFFCGAALAARDLSDD-SAMVARHEQWMAQYSRVYKDASEKARRFEVFKANVK  66

Query  268  RIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFRYENV  92
             IE+FNA G+  + LGVN+FADLTNDEFR ++T  G+K    K+ +        FRYENV
Sbjct  67   FIESFNAGGNNKFWLGVNQFADLTNDEFRSIKTNKGFKSSNMKIPTG-------FRYENV  119

Query  91   T--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +  A  + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  120  SVDALPTTIDWRTKGAVTPIKDQGQCGCCWAF  151



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 100/146 (68%), Gaps = 11/146 (8%)
 Frame = -1

Query  439  MLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIE  260
            M+LG W S   A +R IADE   M  RHE WMA++G++Y DA EK+ RF+IF  N + IE
Sbjct  1    MVLGVWVS--GAMARGIADE--PMLRRHEQWMAQYGRVYKDAAEKERRFQIFRGNYEYIE  56

Query  259  AFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAG  80
            + N  GD+ Y+LG+N+FAD+TN+EF+  R  G+K + T+ T+ S      F+Y N++ A 
Sbjct  57   SINRAGDRKYKLGLNQFADMTNEEFKASRL-GFKPMPTESTTGS------FQYANLSDAP  109

Query  79   SVLDWRKKGAVTPVKDQRDCGCCWAF  2
              +DWR KGAVT VK+QR CGCCWAF
Sbjct  110  DSMDWRTKGAVTAVKNQRSCGCCWAF  135



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 12/146 (8%)
 Frame = -1

Query  436  LLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEA  257
            + GAWS    A+SR + D   SM  R+E WM R+G++Y D  EK+ RFKIF ENV  IE+
Sbjct  1    MFGAWSCE--ATSRSLQD--ASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIES  56

Query  256  FNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA-AG  80
             N   +K Y+LGVN+FADLTN+EF+  R  G+K  +    +TS      F+YENV A   
Sbjct  57   SNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTS------FKYENVKAPVP  109

Query  79   SVLDWRKKGAVTPVKDQRDCGCCWAF  2
            + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  110  AAMDWRKKGAVTPIKDQGQCGCCWAF  135



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 96/148 (65%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   +  W+ +   +SR + D   SM  RHE WM R+G++Y D  E+++R +IF ENV  
Sbjct  14   LLFCMAIWAFQ--VTSRTLQD--ASMNERHEEWMTRYGRVYKDPQEREKRLRIFKENVNY  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   +K Y+L +N+FADLTN+EF   R      + + +T T+S     F+YENVTA
Sbjct  70   IEAFNNAANKPYKLAINQFADLTNEEFIAPRNRFKGHMCSSITRTTS-----FKYENVTA  124

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  125  VPSTVDWRQKGAVTPVKDQGQCGCCWAF  152



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 103/156 (66%), Gaps = 16/156 (10%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C+ L  +LGA SS   A+SR + D   SM  ++E WMA +G++YT+  EK++RF IF
Sbjct  6    KCMCFALIFMLGALSSH--ATSRTLQDP--SMYGKYEQWMAHYGRVYTNINEKEKRFNIF  61

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRT--GGYKRVQTKVTSTSSKGKHY  110
              NV  IE+ N   +K Y+L VN+FADLTN+EF+  R    G++   TK TS        
Sbjct  62   KANVDFIESSNNDANKPYKLKVNQFADLTNEEFKASRNRFMGHE-CSTKTTS--------  112

Query  109  FRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            F+YENVTA  +V DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  113  FKYENVTAPATV-DWRKKGAVTPIKDQGQCGCCWAF  147



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 106/158 (67%), Gaps = 13/158 (8%)
 Frame = -1

Query  472  MAPKLLCYLL-FMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            MAP+  C++L  ++LG W S   A++R IAD    M  RHE WMA++G++Y DA EK+ R
Sbjct  3    MAPQ--CFVLKLIVLGVWVS--GATARGIADVP--MSTRHEQWMAQYGRVYKDAVEKERR  56

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
            F+IF +N   IE+ N  G++ Y+LG+N+FAD+TN+EF+     G+K ++   ++T S   
Sbjct  57   FQIFKDNSNYIESVNRAGNRKYKLGLNQFADMTNEEFKASHL-GFKPMRLTKSTTGS---  112

Query  115  HYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              F+Y N+T     +DWR +GAVTPVKDQ  CGCCWAF
Sbjct  113  --FQYANLTDVSDSMDWRTRGAVTPVKDQGSCGCCWAF  148



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L  ++  +LG W+S+    SR +   + +MR RHE WMARHG +Y D  EK+ RF IF  
Sbjct  9    LVLVMVAILGLWASQ--VRSREL--HKATMRQRHEQWMARHGWVYQDDAEKERRFSIFKN  64

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IE+FN  G+K Y L +N FADLT +EF+  R  GYKR  +    ++      FRYE
Sbjct  65   NVDFIESFNKDGNKPYTLAINAFADLTIEEFKASRN-GYKRSSSPRQVSTKP----FRYE  119

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +VTA  S +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  120  HVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAF  151



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 87/124 (70%), Gaps = 7/124 (6%)
 Frame = -1

Query  373  SMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTN  194
            SM  RHE WMA++G++Y D  EK+ R+ IF ENV RI+AFN++  K Y LGVN+FADLTN
Sbjct  3    SMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYNLGVNQFADLTN  62

Query  193  DEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGC  14
            +EF+  R     R +  + S  +     FRYENV+A  + +DWRKKGAVTPVKDQ  CGC
Sbjct  63   EEFKASR----NRFKGHMCSPQAGP---FRYENVSAVPATMDWRKKGAVTPVKDQGQCGC  115

Query  13   CWAF  2
            CWAF
Sbjct  116  CWAF  119



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 100/149 (67%), Gaps = 10/149 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            LF+ LG W+ +   +SR + D+  SM   HE WM  +GK+Y D+ EK++R KIF +N+  
Sbjct  14   LFLCLGLWAIQ--GTSRTLQDD--SMYESHEQWMRHYGKVYKDSQEKEKRSKIFTQNINY  69

Query  265  IEAFNARG-DKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
            I+AFN  G DK Y+LG+N++ADLTN+EF   R      + + +  T++     F+YENV+
Sbjct  70   IQAFNNAGNDKAYKLGINQYADLTNEEFISSRNKFKGHMCSSIIRTTT-----FKYENVS  124

Query  88   AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            A  S +DWRKKGAVTPVK+Q  CGCCWAF
Sbjct  125  AVPSTVDWRKKGAVTPVKNQGQCGCCWAF  153



>ref|XP_007132888.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
 gb|ESW04882.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
Length=343

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            ++ SM  RHE WM R+ ++Y D  EK++RF+IF ENVK IEAFN   +K Y L +N+FAD
Sbjct  31   QDASMHERHEQWMTRYSRVYKDPEEKEKRFRIFKENVKYIEAFNNAANKAYNLAINQFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EF   R      V + +T T++     F+YENV+A  S +DWR+KGAVTPVKDQ  
Sbjct  91   LTNEEFIAPRNRFKGHVCSSITRTTT-----FKYENVSAVPSTVDWRQKGAVTPVKDQGQ  145

Query  22   CGCCWAF  2
            CGCCWAF
Sbjct  146  CGCCWAF  152



>ref|XP_010052200.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EEQ +  +HE WMA HG+IY DA EK +R +IF ENVKRI AFN   D GY+L VNKFAD
Sbjct  31   EEQQLLKQHEEWMAIHGRIYKDAIEKAKRLEIFKENVKRINAFNNGKDVGYKLAVNKFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V   SS  +  F+Y N TA  + LDWR K AVT VKDQ D
Sbjct  91   LTNEEFRASST-GYKR-PTRV--LSSGDEKPFKYANFTAIPAALDWRTKKAVTTVKDQGD  146

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  147  CGSCWAF  153



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 102/156 (65%), Gaps = 16/156 (10%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C     +LGA SS+  A+SR + D   SM A++E WMA +G+ Y D  EK++RF IF
Sbjct  10   KCICLAFIFILGALSSQ--ATSRTLQD--ASMYAKYEQWMASYGRAYADINEKEKRFNIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG--GYKRVQTKVTSTSSKGKHY  110
             ENV  IE+ N   +K Y+L VN+FADLTN+EF+  R G  G++   TK T+        
Sbjct  66   KENVAFIESSNNDANKLYKLSVNQFADLTNEEFKASRNGFMGHE-CSTKTTA--------  116

Query  109  FRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            F+YENVTA  +V DWR KGAVTP+KDQ  CGCCWAF
Sbjct  117  FKYENVTAPPTV-DWRNKGAVTPIKDQGQCGCCWAF  151



>gb|KHN32068.1| Vignain [Glycine soja]
Length=309

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 87/125 (70%), Gaps = 9/125 (7%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            M  RHE WMAR+ K+Y D  E+++RFKIF ENV  IEAFN   +K Y+LG+N+FADLTN+
Sbjct  1    MYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAANKPYKLGINQFADLTNE  60

Query  190  EFRMLRT--GGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCG  17
            EF + R    G+ R     T+T       F+YENVTA  S +DWR+KGAVTP+KDQ  CG
Sbjct  61   EFIVPRNRFNGHMRFSFITTTT-------FKYENVTALPSTVDWRQKGAVTPIKDQGQCG  113

Query  16   CCWAF  2
            CCWAF
Sbjct  114  CCWAF  118



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 98/135 (73%), Gaps = 8/135 (6%)
 Frame = -1

Query  406  ASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYR  227
            A++R +  E+ S++ RHE WM ++GK+YTD+ EK+ R  IF ENV+RIEAFN  G+K Y+
Sbjct  25   ANARTL--EDVSLKERHEQWMTQYGKVYTDSYEKELRSNIFKENVQRIEAFNNAGNKPYK  82

Query  226  LGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAV  47
            LG+N+FADLTN+EF+        R +  + S S++    F+YE+V++  + LDWR+KGAV
Sbjct  83   LGINQFADLTNEEFK-----ARNRFKGHMCSNSTR-TPTFKYEDVSSVPASLDWRQKGAV  136

Query  46   TPVKDQRDCGCCWAF  2
            TP+KDQ  CGCCWAF
Sbjct  137  TPIKDQGQCGCCWAF  151



>gb|KCW76128.1| hypothetical protein EUGRSUZ_D00504 [Eucalyptus grandis]
Length=318

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EEQ +  +HE WMA HG+IY DA EK +R +IF ENVKRI AFN   D GY+L VNKFAD
Sbjct  7    EEQQLLKQHEEWMAIHGRIYKDAIEKAKRLEIFKENVKRINAFNNGKDVGYKLAVNKFAD  66

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V S+    +  F+Y N TA  + LDWR K AVT VKDQ D
Sbjct  67   LTNEEFRASST-GYKR-PTRVLSSGD--EKPFKYANFTAIPAALDWRTKKAVTTVKDQGD  122

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  123  CGSCWAF  129



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 101/153 (66%), Gaps = 8/153 (5%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L     ++LG W+  P + SR + D   +M  RHE+WMA++G++Y D  EK+ RFKIF E
Sbjct  10   LVLAAILVLGVWA--PQSWSRTLND--ATMNERHEMWMAQYGRVYRDNAEKEMRFKIFKE  65

Query  277  NVKRIEAFNARG-DKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRY  101
            NV+ I +FN +  +K Y+LG+N+FAD TN+EFR  R  GYKR    V S+ +     FRY
Sbjct  66   NVEYIASFNNKARNKPYKLGINEFADQTNEEFRAPRN-GYKRRLPSVRSSETTDVS-FRY  123

Query  100  ENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            EN +   S+ DWRKKGAVT VKDQ  CGCCWAF
Sbjct  124  ENASVPASI-DWRKKGAVTGVKDQGQCGCCWAF  155



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 114/175 (65%), Gaps = 16/175 (9%)
 Frame = -1

Query  523  MHHLPQNQTNSNIIPTFMAPKLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELW  347
            +  +P+  + S  + T MA +  C+ L  M+LG W S   A++R IADE   MR +HE W
Sbjct  12   LRSIPKQSSQS--LYTAMAHQ--CFELALMVLGVWVS--GATARGIADEP--MRTKHEQW  63

Query  346  MARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG  167
            MA++G++YTDA EK+ RF+IF +N + I++ N  GD+ Y+LG+N+FADLTN EF+  R  
Sbjct  64   MAQNGRVYTDAAEKERRFQIFRDNYEYIKSVNRAGDRKYKLGLNQFADLTNGEFKASRL-  122

Query  166  GYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             +K + T  T+ S      F+Y N+T   + +DWR +GAVTPVK+Q  CGC WAF
Sbjct  123  AFKPMPTASTTGS------FQYANLTDVPNSMDWRTRGAVTPVKNQGSCGCFWAF  171



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 91/136 (67%), Gaps = 7/136 (5%)
 Frame = -1

Query  409  AASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGY  230
            AASSR + D   SM+ +HE WMA +G++Y DA EK+ RFKIF  NV+ IE+FNA G+  +
Sbjct  23   AASSRTLTD--VSMKEKHEQWMALYGRVYKDAAEKERRFKIFQANVELIESFNA-GNHKF  79

Query  229  RLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGA  50
            +LG N+FADLTN+EFR + T           ++S      F+YEN TA    +DWR KGA
Sbjct  80   KLGANQFADLTNEEFRAVHT----XXXXXXXASSGMATKSFKYENATAVPVSMDWRAKGA  135

Query  49   VTPVKDQRDCGCCWAF  2
            VTP+KDQ  CGCCWAF
Sbjct  136  VTPIKDQGQCGCCWAF  151



>ref|XP_009354265.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L ++LGAWSS+  A+SR + D   +M  RHE W+AR+G++Y +  EK+ RFKI  ENV  
Sbjct  16   LILMLGAWSSQ--ATSRSLQDA--AMYGRHEQWLARYGRVYNNVNEKETRFKILKENVAF  71

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            +E+ N   +K Y+L VN+FADLTN+EF+  R G   + Q   T T+S     F+YE VTA
Sbjct  72   VESSNKDANKPYKLSVNQFADLTNEEFKASRNG--FKGQEYSTKTNS-----FKYEKVTA  124

Query  85   A-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            A  + +DWRKKGAVTPVKDQ  CG CWAF
Sbjct  125  ALPATMDWRKKGAVTPVKDQGQCGSCWAF  153



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 100/155 (65%), Gaps = 12/155 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +C  L ++LGAWSS   A+SR + D   SM  R+E W+A +G+++ D  EK+ RFKIF
Sbjct  10   KYMCLGLILMLGAWSSE--ATSRSLKD--ASMYGRYEQWLALYGRVHNDINEKETRFKIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE  N    K Y+L VN+FADLTN+EF+  R  G+K  +    ++S      F+
Sbjct  66   KENVAFIEFSNKDAHKPYKLSVNQFADLTNEEFKATRN-GFKGHECSTKASS------FK  118

Query  103  YENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVT    + +DWRKKGAVTPVKD   CGCCWAF
Sbjct  119  YENVTVPLPATMDWRKKGAVTPVKDXGQCGCCWAF  153



>gb|KCW76123.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            EE+ +  +HE WMA HG++Y D  EK +R++IF ENVKRI AFN   D GY++ VNKFAD
Sbjct  31   EEEQLLKQHEEWMAIHGRVYKDTVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNKFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EFR   T GYKR  T+V S+    K  F+Y N TA  + LDWR K AVTPVKDQ  
Sbjct  91   LTNEEFRASYT-GYKRRPTRVLSSGE--KKPFKYANFTAIPAALDWRTKKAVTPVKDQGG  147

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  148  CGDCWAF  154



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 98/157 (62%), Gaps = 16/157 (10%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K+L   LF +L   + +  A+SR +   E  M  RHE WMA+HGK+Y D  EK  RF+IF
Sbjct  8    KILPIALFFVLAMCADQ--AASREL--HELEMTGRHEKWMAKHGKVYKDDKEKLRRFQIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKR---VQTKVTSTSSKGKH  113
              NV  IE+FN  G+K Y LG+NKFADLTN+EFR     GYKR      K+T        
Sbjct  64   KSNVVFIESFNTAGNKSYMLGINKFADLTNEEFRAFWN-GYKRPLGASRKITP-------  115

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             F+YENVTA  S +DWR KGAVTP+KDQ  CG CWAF
Sbjct  116  -FKYENVTALPSSIDWRSKGAVTPIKDQGVCGSCWAF  151



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 12/152 (8%)
 Frame = -1

Query  454  CY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            C+ L  M+LG W S   A++R IADE   MR +HE WMA++G++YTDA EK+ RF+IF +
Sbjct  5    CFELALMVLGVWVS--GATARGIADEP--MRTKHEQWMAQNGRVYTDAAEKERRFQIFRD  60

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            N + I++ N  GD+ Y+LG+N+FADLTN EF+  R   +K + T  T+ S      F+Y 
Sbjct  61   NYEYIKSVNRAGDRKYKLGLNQFADLTNGEFKASRL-AFKPMPTASTTGS------FQYA  113

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            N+T   + +DWR +GAVTPVK+Q  CGC WAF
Sbjct  114  NLTDVPNSMDWRTRGAVTPVKNQGSCGCFWAF  145



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 98/161 (61%), Gaps = 11/161 (7%)
 Frame = -1

Query  484  IPTFMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEK  305
            + +F     +   L  LLGAW+ + A  +      +  M   H  WMAR+G++Y D  E+
Sbjct  1    MGSFRNQYFILVPLVFLLGAWAHQAAGRT---FQRDDPMYEMHGQWMARYGRVYKDVEER  57

Query  304  DERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSS  125
              RF+IF  N + IE+FN   DK YRLGVN+FADLTN+EF+        R ++ + ST +
Sbjct  58   QSRFEIFKANAQGIESFNHANDKPYRLGVNQFADLTNEEFKAR-----NRFKSHMCSTEA  112

Query  124  KGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                 FRYEN+TA  S +DWRKKGAVTPVK+Q  CGCCWAF
Sbjct  113  AS---FRYENITAVPSSMDWRKKGAVTPVKNQGQCGCCWAF  150



>ref|XP_003599736.1| Cysteine proteinase [Medicago truncatula]
 ref|XP_003607644.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89841.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 89/127 (70%), Gaps = 7/127 (6%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            E  S++ RHE WM  HGK+Y DA EK++RF IF +NV+ IE+FNA  ++ Y+L VN  AD
Sbjct  32   ESLSLQERHEQWMTEHGKVYEDAIEKEKRFMIFKDNVEFIESFNAADNQPYKLSVNHLAD  91

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LT DEF+  R  GYK++  + T+TS      F+YENVTA  + +DWR KGAVTP+KDQ  
Sbjct  92   LTLDEFKASRN-GYKKIDREFTTTS------FKYENVTAIPAAVDWRVKGAVTPIKDQGQ  144

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  145  CGSCWAF  151



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L +   ++L  W S+  A++R + D   +M  +HE WMA+ G++Y D  EK +RF+IF E
Sbjct  9    LVFAALLVLEMWGSQ--ATARTLPD--AAMIEKHEQWMAQFGRVYKDDAEKSKRFRIFKE  64

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV+ IE+FN  G + Y L +NKFADLTN+EF+  R  GYK      +S  S     FRY 
Sbjct  65   NVEYIESFNEAGARPYTLAINKFADLTNEEFQASRN-GYKMGSYPKSSMFSS----FRYA  119

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA  + +DWRKKGAVT VKDQ  CGCCWAF
Sbjct  120  NVTAVPASMDWRKKGAVTGVKDQGQCGCCWAF  151



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 106/162 (65%), Gaps = 15/162 (9%)
 Frame = -1

Query  484  IPTFMAPKLLCYLLFMLLGAWSSRPAASSRVI-ADEEQSMRARHELWMARHGKIYTDAGE  308
            +P  + P L+ + + +++GA      A+SR++  ++E +M   HE WMA +G++Y D  E
Sbjct  3    VPLKLMPILVSFFV-LVIGA----SQATSRLLHENDEAAMVEEHEKWMATYGRVYKDDAE  57

Query  307  KDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTS  128
            K +RF+IF +N + IE+FN  G K Y L +N+FAD+TN+EFR     GYK        TS
Sbjct  58   KAKRFQIFKKNFEYIESFNKAGTKTYSLSINRFADMTNEEFRARN--GYKPF------TS  109

Query  127  SKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            SK    FRYENVT   S LDWR++GAVTPVK+Q DCGCCWAF
Sbjct  110  SKSAS-FRYENVTDVPSSLDWREEGAVTPVKNQGDCGCCWAF  150



>ref|XP_003556992.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            ++ SM  RHE WM R+ K+Y D  E++ RFKIF ENV  IEAFN   +K Y LG+N+FAD
Sbjct  31   QDASMYERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EF   R      + + +T T++     F+YENVTA  S +DWR+KGAVTP+KDQ  
Sbjct  91   LTNEEFIAPRNRFKGHMCSSITRTTT-----FKYENVTAIPSTVDWRQKGAVTPIKDQGQ  145

Query  22   CGCCWAF  2
            CGCCWAF
Sbjct  146  CGCCWAF  152



>ref|XP_003527349.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            ++ SM  RHE WM R+ K+Y D  E++ RFKIF ENV  IEAFN   +K Y LG+N+FAD
Sbjct  31   QDASMYERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EF   R      + + +T T++     F+YENVTA  S +DWR+KGAVTP+KDQ  
Sbjct  91   LTNEEFIAPRNRFKGHMCSSITRTTT-----FKYENVTAIPSTVDWRQKGAVTPIKDQGQ  145

Query  22   CGCCWAF  2
            CGCCWAF
Sbjct  146  CGCCWAF  152



>gb|KDP40484.1| hypothetical protein JCGZ_24483 [Jatropha curcas]
Length=339

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  472  MAPKLLC--YLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDE  299
            ++ + LC  + L  +LGAW+    A  R +   +  M  +HE WM R+G++Y D  EK+ 
Sbjct  3    LSKQYLCIGFGLLFILGAWTCESMA--RTV--HKPPMYRKHEQWMTRYGRVYKDDNEKEM  58

Query  298  RFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKG  119
            R+KIF ENV+RI++FN+   + YRLGVN+FADLTN+EF   R     R +  + S  +  
Sbjct  59   RYKIFKENVERIDSFNSDTRRSYRLGVNQFADLTNEEFNTARN----RFKGHMCSAQAGP  114

Query  118  KHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
               FRY+NVTA  + +DWRKKGAVTP+KDQ  CG CWAF
Sbjct  115  ---FRYQNVTAVPATMDWRKKGAVTPIKDQGQCGSCWAF  150



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 96/152 (63%), Gaps = 7/152 (5%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L  +  +L+  W+S+  + S      E SM  RH+ WM ++G++Y    EK++RFKIF E
Sbjct  9    LVLMAMLLVTLWASQSWSRSL----HEASMELRHKTWMTQYGRVYKGNVEKEKRFKIFKE  64

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV+ IE+FN  G+K Y+LG+N F DLTN+EFR    G    + +  +S  +K    FRYE
Sbjct  65   NVEFIESFNNNGNKPYKLGINAFTDLTNEEFRASHNGYTMSMSSHQSSYRTKS---FRYE  121

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA    LDWR KGAVT +KDQ  CGCCWAF
Sbjct  122  NVTAVPPSLDWRTKGAVTHIKDQGQCGCCWAF  153



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 98/148 (66%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   LG ++ +   +SR + D+  SM  RH  WM+++GKIY D  E++ RFKIF ENV  
Sbjct  14   LVFCLGLFAIQ--VTSRTLQDD--SMYERHGQWMSQYGKIYKDHQERETRFKIFTENVNY  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            +EA NA   K Y+LG+N+FADLTN+EF   R      + + +T T++     F+YENV+A
Sbjct  70   VEASNADDTKSYKLGINQFADLTNEEFVASRNKFKGHMCSSITRTTT-----FKYENVSA  124

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWRKKGAVTPVK+Q  CGCCWAF
Sbjct  125  IPSTVDWRKKGAVTPVKNQGQCGCCWAF  152



>emb|CBI21977.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 86/115 (75%), Gaps = 8/115 (7%)
 Frame = -1

Query  346  MARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG  167
            MAR+G++Y DA EK++RFKIF +NV RIE+FN   DK Y+L +N+FADLTN+EFR LR  
Sbjct  1    MARYGRMYKDANEKEKRFKIFKDNVARIESFNKAMDKTYKLSINEFADLTNEEFRSLRN-  59

Query  166  GYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
               R +  + S ++     F+YENVTA  S +DWRKKGAVTP+KDQ+ CGCCWAF
Sbjct  60   ---RFKAHICSEATT----FKYENVTAVPSTIDWRKKGAVTPIKDQQQCGCCWAF  107



>gb|AGT16936.1| vignain-like protein [Saccharum hybrid cultivar R570]
Length=341

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 105/158 (66%), Gaps = 12/158 (8%)
 Frame = -1

Query  466  PKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            PK L  +  +L+GA+    A ++R + D++ +M  RHE WMA++ ++Y DA EK +RF++
Sbjct  4    PKAL--IFGILVGAFLCSAALAARDLNDDDSAMVERHEQWMAQYSRVYKDATEKAQRFEV  61

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHY  110
            F  NVK IE+FNA  ++ + LGVN+FADLT DEFR  +T  G+K  + KV +        
Sbjct  62   FKVNVKFIESFNAARNRKFWLGVNQFADLTIDEFRATKTNKGFKPSRVKVPTG-------  114

Query  109  FRYENVT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            FRYENV+     + +DWR KGAVTP+KDQ  CGCCWAF
Sbjct  115  FRYENVSVDVLPASVDWRTKGAVTPIKDQGQCGCCWAF  152



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 90/135 (67%), Gaps = 9/135 (7%)
 Frame = -1

Query  406  ASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYR  227
            A+SR ++D    M  RHE WMA++G++Y    EK +RF IF ENV+ IE+FN  G K Y+
Sbjct  23   ATSRTLSD--SLMVVRHEQWMAQYGRVYKTEAEKTKRFNIFKENVEYIESFNKAGTKPYK  80

Query  226  LGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAV  47
            LG+N FADLTN EF+  R  GYK      ++T       FRYENV++  + +DWR KGAV
Sbjct  81   LGINAFADLTNQEFKASRN-GYKLPHDCSSNTP------FRYENVSSVPTTVDWRTKGAV  133

Query  46   TPVKDQRDCGCCWAF  2
            TPVKDQ  CGCCWAF
Sbjct  134  TPVKDQGQCGCCWAF  148



>ref|XP_004305438.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Fragaria 
vesca subsp. vesca]
Length=337

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 98/157 (62%), Gaps = 10/157 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            M  K +C  L ++ GAWSS   A+SR + D   SM  R+E WMAR+G+ Y++  EK+ RF
Sbjct  1    MYLKSICLCLILMFGAWSSE--ATSRNVQD--ASMYERYEQWMARYGRQYSNMNEKETRF  56

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
             IF +NV  IE+ N   DK Y+L VN+FADLT +EF+  RTG          +T+     
Sbjct  57   NIFKKNVAFIESSNNNADKPYKLSVNQFADLTAEEFKSQRTGFKGPGDLPPLTTT-----  111

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             F+YENV+   S LDWR KGAV PVKDQ +CG CWAF
Sbjct  112  -FKYENVSVVPSSLDWRTKGAVMPVKDQGECGSCWAF  147



>ref|XP_003526215.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Glycine 
max]
Length=339

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            +LF++L  W+      SR ++  E     RHE WMA++GK+YTDA EK++RF+IF  NV+
Sbjct  11   ILFLILTVWTFH--VMSRRLS--EVCTSERHEKWMAQYGKLYTDAAEKEKRFQIFKNNVQ  66

Query  268  RIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
             IE+FNA GDK + L +N+FADL N+EF+         VQ K +   +  +  FRYE++T
Sbjct  67   FIESFNAAGDKPFNLSINQFADLHNEEFK----ASLINVQKKESGVETATETSFRYESIT  122

Query  88   AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                 +DWRK+GAVTP+KDQ +CG CWAF
Sbjct  123  KIPVTMDWRKRGAVTPIKDQGNCGSCWAF  151



>ref|XP_011009181.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=276

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 109/187 (58%), Gaps = 27/187 (14%)
 Frame = -1

Query  514  LPQNQTNSNIIPTFMAPK----------LLCYLLFMLLGAWSSRPAASSRVIADEEQSMR  365
            +P +   +++I   + PK           +C  L  + GAW S+  +++R + D    M 
Sbjct  1    MPTSLLIASLIYRLLIPKAAMRFTKQFQFVCLALLFISGAWPSK--STARTLLDAP--MY  56

Query  364  ARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEF  185
             RHE WM ++G++Y D  E+  R+ IF ENV R++AFN++  K Y+LGVN+FADLTN+EF
Sbjct  57   ERHEQWMTQYGRVYKDDNERATRYSIFKENVARVDAFNSQTGKSYKLGVNQFADLTNEEF  116

Query  184  RMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCG----  17
            +  R     R +  + S  +     FRYENV+A  S +DWRK+GAVTP KDQ  CG    
Sbjct  117  KASR----NRFKGHMCSPQAGP---FRYENVSAVPSTMDWRKEGAVTPAKDQGQCGECLS  169

Query  16   --CCWAF  2
              CCWAF
Sbjct  170  LCCCWAF  176



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 105/158 (66%), Gaps = 11/158 (7%)
 Frame = -1

Query  472  MAPKLLCYLL-FMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            MA    C++L  ++LG W S  AA++R IAD    +  RHE WMAR+G++Y DA EK+ R
Sbjct  1    MAMASQCFVLKLIVLGVWVS--AATARGIADVP--ISTRHEQWMARYGRVYKDAVEKERR  56

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
            F+IF +N   IE+ N  G++ Y+LG+N+FAD+TN+EF+     G+K +    ++T S   
Sbjct  57   FQIFKDNHNYIESVNRAGNRKYKLGLNQFADMTNEEFKASHL-GFKPMHLAKSATGS---  112

Query  115  HYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              F+Y N+T     +DWR +GAVTP+K+Q+ CGCCWAF
Sbjct  113  --FQYANLTDVSDSMDWRTRGAVTPIKNQKSCGCCWAF  148



>ref|XP_003526208.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Glycine 
max]
Length=339

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            +LF++L  W+      SR ++  E     RHE WMA++GK+YTDA EK++RF+IF  NV+
Sbjct  11   ILFLILTVWTFH--VMSRRLS--EVCTSERHEKWMAQYGKLYTDAAEKEKRFQIFKNNVQ  66

Query  268  RIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
             IE+FNA GDK + L +N+FADL N+EF+         VQ K +   +  +  FRYE++T
Sbjct  67   FIESFNAAGDKPFNLSINQFADLHNEEFK----ASLINVQKKESGVETATETSFRYESIT  122

Query  88   AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                 +DWRK+GAVTP+KDQ +CG CWAF
Sbjct  123  KIPVTMDWRKRGAVTPIKDQGNCGSCWAF  151



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 95/157 (61%), Gaps = 9/157 (6%)
 Frame = -1

Query  472  MAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERF  293
            MA   L  L+ + L   +S   A+SR + D    M  RHE WMA++G++Y +  EK +R+
Sbjct  1    MASNSLKLLIALALVFATSAYLATSRTLLD--SLMAVRHEQWMAQYGRVYKNEVEKTKRY  58

Query  292  KIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKH  113
             IF ENV+ IE+FN  G K Y+LG+N FADLTN EF   R G        +         
Sbjct  59   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNG-------YILPHECSSNT  111

Query  112  YFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
             FRYENV+A  + +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  112  PFRYENVSAVPTTVDWRKKGAVTPVKDQGQCGCCWAF  148



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 91/135 (67%), Gaps = 9/135 (7%)
 Frame = -1

Query  406  ASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYR  227
            A+SR ++D    M  RHE WMA++G++Y +  EK +RF IF ENV+ IE+FN  G K Y+
Sbjct  25   ATSRTLSD--SLMVVRHEQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAGTKPYK  82

Query  226  LGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAV  47
            LG+N FADLTN EF+  R  GYK      ++T       FRYENV++  + +DWR KGAV
Sbjct  83   LGINAFADLTNQEFKASRN-GYKLPHDCSSNTP------FRYENVSSVPTTVDWRTKGAV  135

Query  46   TPVKDQRDCGCCWAF  2
            TPVKDQ  CGCCWAF
Sbjct  136  TPVKDQGQCGCCWAF  150



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 105/166 (63%), Gaps = 18/166 (11%)
 Frame = -1

Query  487  IIPTFMAPKLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAG  311
             I        +C  L+ ++LGA SS   A+SR + D   SM  RHE WMAR+G+ Y D  
Sbjct  3    FISRLQGKACVCLALILIMLGACSSE--ATSRSLQD--ASMYGRHEQWMARYGRTYNDIR  58

Query  310  EKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRT--GGYKRVQTKVT  137
            EK++RF IF ENV  IE+ N   +K Y+L VN+FADLTNDEF+  R    G++   TK T
Sbjct  59   EKEKRFNIFKENVX-IESSNDDANKLYKLSVNQFADLTNDEFKASRNRFKGHE-CSTKTT  116

Query  136  STSSKGKHYFRYENVTAA-GSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            S        F+YENVTA+  + +DWRKKGAVTP+KDQ  CGCCWAF
Sbjct  117  S--------FKYENVTASVPTTMDWRKKGAVTPIKDQGQCGCCWAF  154



>ref|XP_007214465.1| hypothetical protein PRUPE_ppa023848mg [Prunus persica]
 gb|EMJ15664.1| hypothetical protein PRUPE_ppa023848mg [Prunus persica]
Length=340

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 100/154 (65%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C +L ++LG WSS   A+SR + D   SM  R+E WM R+G+ Y D  EK +RF+IF
Sbjct  9    RCVCLVLILMLGTWSSE--ATSRNLQD--ASMYERYEQWMVRYGREYNDVNEKQKRFEIF  64

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV  IE+ N+  +K Y+L VN+FAD TN+E +  R  G+KR +    +TS      F+
Sbjct  65   KKNVAYIESSNSDVNKSYKLSVNQFADQTNEEVKASRN-GFKRREYSTKTTS------FK  117

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVT   + +DWR KGAVTP+KDQ  CG CWAF
Sbjct  118  YENVTVVPAAMDWRSKGAVTPMKDQGQCGSCWAF  151



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 98/149 (66%), Gaps = 10/149 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   LG W+ +   +SR + D   SM  RHE WM  +GK+Y D  E+++RFKIF EN+K 
Sbjct  14   LVFCLGLWAIQ--VTSRTLQD--GSMHERHERWMNHYGKVYKDHQEREKRFKIFTENMKY  69

Query  265  IEAFN-ARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
            IEAFN    ++ Y+LG+N+FADLTN+EF   R      + + +  T++     F+YENV+
Sbjct  70   IEAFNNGDNNESYKLGINQFADLTNEEFVASRNKFKGHMCSSIIRTTT-----FKYENVS  124

Query  88   AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            A  S +DWRKKGAVTPVK+Q  CGCCWAF
Sbjct  125  AIPSTVDWRKKGAVTPVKNQGQCGCCWAF  153



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 99/143 (69%), Gaps = 12/143 (8%)
 Frame = -1

Query  427  AWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNA  248
            AWSS+  A+SR + D   SM  R+E W+AR+G++Y D  EK+ RFKIF ENV  IE+ N 
Sbjct  71   AWSSQ--ATSRSLQD--ASMYGRYEQWLARYGRVYNDVDEKEIRFKIFKENVAFIESSNK  126

Query  247  RGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAA-GSVL  71
              +K ++L VN+FADLTN+EF+  R  G+K  +    +TS      F+YENVTAA  + +
Sbjct  127  DANKPHKLSVNQFADLTNEEFKASRN-GFKGHECSTKTTS------FKYENVTAALPATM  179

Query  70   DWRKKGAVTPVKDQRDCGCCWAF  2
            DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  180  DWRKKGAVTPVKDQGQCGCCWAF  202



>ref|XP_003527330.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Glycine 
max]
Length=342

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            +LF++L  W+S     SR ++  E     RHE WMA++G++Y DA EK++RF++F  NV 
Sbjct  11   ILFLVLAVWTSH--VMSRRLS--EACTSERHEKWMAQYGRVYKDAAEKEKRFQVFKNNVH  66

Query  268  RIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
             IE+FNA GDK + L +N+FADL ++EF+ L     K+     TST +     FRYE+VT
Sbjct  67   FIESFNAAGDKPFNLSINQFADLNDEEFKALLINVQKKASWVETSTETS----FRYESVT  122

Query  88   AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
               + +DWRK+GAVTP+KDQ  CG CWAF
Sbjct  123  KIPATIDWRKRGAVTPIKDQGRCGSCWAF  151



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 100/154 (65%), Gaps = 10/154 (6%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + L   LF +L  W+ +  AS+R +   E +M  RHE WMA+HGK+Y D  EK  RF+IF
Sbjct  8    QFLLIALFFVLAMWADQ--ASTREL--HESTMVERHEKWMAKHGKVYKDDEEKLRRFQIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
              NV+ IE+ NA G+  Y LG+N+FADLTN+EFR     GYKR        +S+    F+
Sbjct  64   KNNVEFIESSNAAGNNSYMLGINRFADLTNEEFRA-SWNGYKR-----PLDASRIVTPFK  117

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA    +DWR+KGAVT +KDQR+CG CWAF
Sbjct  118  YENVTALPYSMDWRRKGAVTSIKDQRECGSCWAF  151



>ref|XP_003526217.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Glycine 
max]
Length=342

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            +LF++L  W+S     SR ++  E     RHE WMA++G++Y DA EK++RF++F  NV 
Sbjct  11   ILFLVLSVWTSH--VMSRRLS--EACTSERHEKWMAQYGRVYKDAAEKEKRFQVFKNNVH  66

Query  268  RIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
             IE+FNA GDK + L +N+FADL ++EF+ L       VQ K +   +  +  FRYE+VT
Sbjct  67   FIESFNAAGDKPFNLSINQFADLNDEEFKALLI----NVQKKASWVETSTQTSFRYESVT  122

Query  88   AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
               + +DWRK+GAVTP+KDQ  CG CWAF
Sbjct  123  KIPATIDWRKRGAVTPIKDQGRCGSCWAF  151



>gb|KCW76116.1| hypothetical protein EUGRSUZ_D00493 [Eucalyptus grandis]
Length=354

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 103/163 (63%), Gaps = 6/163 (4%)
 Frame = -1

Query  490  NIIPTFMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAG  311
            N++      +L+  L+  +L  W+  PA    +    E ++ +RHE WMA+HG+ Y DA 
Sbjct  8    NLMAFKKQSRLILLLVSFVLVFWA-LPAECRSI--HRESTLLSRHEQWMAQHGRTYKDAE  64

Query  310  EKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTST  131
            EKD RF IF  NV+ IE+FN+   + Y+L +N+FADLTN+EFR  R GG++  +T++   
Sbjct  65   EKDRRFAIFQSNVEYIESFNSAPGRDYKLKINQFADLTNEEFRAFR-GGFRLPKTRI--G  121

Query  130  SSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            S K    FRYEN T   S +DWR+KGAVTPVKDQ  C  CWAF
Sbjct  122  SKKDDTPFRYENFTDVPSSIDWREKGAVTPVKDQGHCSSCWAF  164



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 96/152 (63%), Gaps = 10/152 (7%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L ++  ++LG W+S+   +SR +   E SM  +HE WMAR G++Y D  EK +R KIF  
Sbjct  9    LAFVALLVLGMWASQT--TSRDL--NEASMVQKHEYWMARFGRVYRDDAEKAKRLKIFKN  64

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV  IE+ N  G + Y+LG+N+FADLTN+EFR    G       K + T S     FRYE
Sbjct  65   NVDYIESVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMSSHQKSSKTIS-----FRYE  119

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NVTA  ++ DWR KGAVT VKDQ  CGCCWAF
Sbjct  120  NVTAPATI-DWRTKGAVTGVKDQGQCGCCWAF  150



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 101/154 (66%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +   L  +LGA SS+  A+SR + D   SM  R+E WMAR+G++Y+D  EK++RF IF
Sbjct  10   KCIILALIFMLGALSSQ--ATSRTLQD--ASMYGRYEQWMARYGRVYSDINEKEKRFNIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  IE+ N   +K ++L VN+FADLTN+EF+  R   +   +    +TS      F+
Sbjct  66   KENVAFIESSNNDANKLHKLSVNQFADLTNEEFKASRN-RFMGHECSAKTTS------FK  118

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVTA    LDWRKKGAVTPVKDQ  CGCCWAF
Sbjct  119  YENVTAP-PTLDWRKKGAVTPVKDQGQCGCCWAF  151



>ref|XP_006857794.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
 gb|ERN19261.1| hypothetical protein AMTR_s00061p00214890 [Amborella trichopoda]
Length=342

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 106/164 (65%), Gaps = 17/164 (10%)
 Frame = -1

Query  472  MAPKL------LCYLLFMLLGAWSSRPAASSRVIADEE-QSMRARHELWMARHGKIYTDA  314
            MAP++      LC  LF L+G W   P+A+ R + +E   SM AR E WMA HG++Y DA
Sbjct  1    MAPRVASPLSCLCLALF-LMGLW--LPSATPRRLEEESLSSMSARFEQWMALHGRLYKDA  57

Query  313  GEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTS  134
             EK++R +IF EN+K I++ NA G + Y+L  NKFADLTNDEF+ +   G+K  +     
Sbjct  58   QEKEQRSQIFEENLKFIDSVNAEG-RLYKLSTNKFADLTNDEFKAMHM-GFKGHECATRE  115

Query  133  TSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            + +     F Y NV+A  S +DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  116  SDAP----FMYANVSAPAS-MDWRKKGAVTPVKDQGQCGCCWAF  154



>ref|XP_010052196.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=345

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 100/154 (65%), Gaps = 6/154 (4%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            +L+  L+  +L  W+  PA    +    E ++ +RHE WMA+HG+ Y DA EKD RF IF
Sbjct  8    RLILLLVSFVLVFWA-LPAECRSI--HRESTLLSRHEQWMAQHGRTYKDAEEKDRRFAIF  64

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
              NV+ IE+FN+   + Y+L +N+FADLTN+EFR  R GG++  +T++   S K    FR
Sbjct  65   QSNVEYIESFNSAPGRDYKLKINQFADLTNEEFRAFR-GGFRLPKTRI--GSKKDDTPFR  121

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YEN T   S +DWR+KGAVTPVKDQ  C  CWAF
Sbjct  122  YENFTDVPSSIDWREKGAVTPVKDQGHCSSCWAF  155



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 99/159 (62%), Gaps = 8/159 (5%)
 Frame = -1

Query  475  FMAPKLLCYL-LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDE  299
             +A    C++ L MLL         + R + D   SM  RHE WM R+GK+Y D  E+++
Sbjct  1    MVAKNHFCHISLAMLLCMAFLAFQVTCRSLQD--ASMYERHEQWMTRYGKVYKDPQEREK  58

Query  298  RFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKG  119
            RF+IF ENV  IEAFN   +K Y+L +N+FADLTN+EF   R      + + +  T++  
Sbjct  59   RFRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEFIAPRNRFKGHMCSSIIRTTT--  116

Query  118  KHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
               F+YENVTA  S +DWR+KGAVTP+KDQ  CGCCWAF
Sbjct  117  ---FKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAF  152



>ref|XP_004489011.1| PREDICTED: vignain-like [Cicer arietinum]
Length=343

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 97/150 (65%), Gaps = 9/150 (6%)
 Frame = -1

Query  451  YLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENV  272
            +   + LG W+ +  A+SR + D+  SM  RHE WM ++GK+Y +A E+++RF IF ENV
Sbjct  12   FTFVLCLGLWAFQ--ATSRNLQDD--SMHERHEQWMGQYGKVYKNAKEREKRFGIFKENV  67

Query  271  KRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENV  92
              IE  N+ G+K Y+LG+N+FADLTN EF   R      +    T T++     F+Y NV
Sbjct  68   NYIEVSNSVGNKSYKLGINEFADLTNHEFVASRNKFNAYLDGSSTKTTT-----FKYHNV  122

Query  91   TAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +A  S +DWR +GAVTPVKDQ  CGCCWAF
Sbjct  123  SAVPSTVDWRLEGAVTPVKDQGQCGCCWAF  152



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 99/159 (62%), Gaps = 8/159 (5%)
 Frame = -1

Query  475  FMAPKLLCYL-LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDE  299
             +A    C++ L MLL         + R + D   SM  RHE WM R+GK+Y D  E+++
Sbjct  1    MVAKNHFCHISLAMLLCMAFLAFQVTCRSLQD--ASMYERHEQWMTRYGKVYKDPQEREK  58

Query  298  RFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKG  119
            RF+IF ENV  IEAFN   +K Y+L +N+FADLTN+EF   R      + + +  T++  
Sbjct  59   RFRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEFIAPRNRFKGHMCSSIIRTTT--  116

Query  118  KHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
               F+YENVTA  S +DWR+KGAVTP+KDQ  CGCCWAF
Sbjct  117  ---FKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAF  152



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            ++ SM  RHE WM R+GK+Y D  E+++RF+IF ENV  IEAFN   +K Y+L +N+FAD
Sbjct  31   QDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFAD  90

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EF   R      + + +  T++     F+YENVTA  S +DWR+KGAVTP+KDQ  
Sbjct  91   LTNEEFIAPRNRFKGHMCSSIIRTTT-----FKYENVTAVPSTVDWRQKGAVTPIKDQGQ  145

Query  22   CGCCWAF  2
            CGCCWAF
Sbjct  146  CGCCWAF  152



>ref|XP_003596711.1| Cysteine proteinase [Medicago truncatula]
 gb|AES66962.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            LF +L  W+S    SSR++         +HE WM  HGK Y DA EK++RF+IF EN++ 
Sbjct  15   LFFILTLWTSL-VISSRLLE--------KHEQWMEEHGKFYKDAAEKEQRFQIFKENLEF  65

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FNA GD G+ L +N+F D TNDEF+     G K+    V   + + +  FRYENVT 
Sbjct  66   IESFNAAGDNGFNLSINQFGDQTNDEFKANYLNGKKKPLIGVGIAAIEEESVFRYENVTE  125

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + +DWR++GAVTP+K Q  CG CWAF
Sbjct  126  VPATMDWRERGAVTPIKHQHLCGSCWAF  153



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            ++ SM  RHE WM R+GK+Y D  E+++RF+IF ENV  IEAFN   +K Y+L +N+FAD
Sbjct  14   QDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFAD  73

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EF   R      + + +  T++     F+YENVTA  S +DWR+KGAVTP+KDQ  
Sbjct  74   LTNEEFIAPRNRFKGHMCSSIIRTTT-----FKYENVTAVPSTVDWRQKGAVTPIKDQGQ  128

Query  22   CGCCWAF  2
            CGCCWAF
Sbjct  129  CGCCWAF  135



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   +  W+ +   +SR + D   SM  RH  WM R+G++Y D  E+++R +IF ENV  
Sbjct  14   LLFCMAIWAFQ--VTSRTLQD--TSMNERHAEWMTRYGRVYKDPQEREKRLRIFKENVNY  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   +K Y+L VN+FADLTN+EF   R      + + +T T+S     F+YENVTA
Sbjct  70   IEAFNNAANKPYKLAVNQFADLTNEEFIAPRNRFKGHMCSSITRTTS-----FKYENVTA  124

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  125  VPSKVDWRQKGAVTPVKDQGQCGCCWAF  152



>gb|KHN32069.1| Vignain [Glycine soja]
Length=333

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            ++ SM  RHE WM R+GK+Y D  E+++RF+IF ENV  IEAFN   +K Y+L +N+FAD
Sbjct  14   QDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFAD  73

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EF   R      + + +  T++     F+YENVTA  S +DWR+KGAVTP+KDQ  
Sbjct  74   LTNEEFIAPRNRFKGHMCSSIIRTTT-----FKYENVTAVPSTVDWRQKGAVTPIKDQGQ  128

Query  22   CGCCWAF  2
            CGCCWAF
Sbjct  129  CGCCWAF  135



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            ++ SM  RHE WM R+GK+Y D  E+++RF+IF ENV  IEAFN   +K Y+L +N+FAD
Sbjct  14   QDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFAD  73

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LTN+EF   R      + + +  T++     F+YENVTA  S +DWR+KGAVTP+KDQ  
Sbjct  74   LTNEEFIAPRNRFKGHMCSSIIRTTT-----FKYENVTAVPSTVDWRQKGAVTPIKDQGQ  128

Query  22   CGCCWAF  2
            CGCCWAF
Sbjct  129  CGCCWAF  135



>ref|XP_011005486.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=284

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 97/143 (68%), Gaps = 10/143 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
              ++L AW+++ A       DE++ M  RH  WMA++G++Y D  EKD+R+ IF EN++R
Sbjct  14   FLLILAAWATKIACRP---LDEQEYMLKRHGEWMAQYGRVYGDMKEKDKRYLIFKENIER  70

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IEAFN   D+GY+LGVNKFADLTN+EFR +   GYKR  +K+ S+S      FRYEN++ 
Sbjct  71   IEAFNNGSDRGYKLGVNKFADLTNEEFRAMYH-GYKRQSSKLMSSS------FRYENLSD  123

Query  85   AGSVLDWRKKGAVTPVKDQRDCG  17
              + +DWR   AVTPVKDQ  CG
Sbjct  124  IPTSMDWRNAEAVTPVKDQGRCG  146



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 91/148 (61%), Gaps = 11/148 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   +G  +S  AA S      E SM   H+ WMAR+G++Y  A EK+ R  IF EN+K 
Sbjct  14   LLFTIGVLASLAAARSL----NEASMTETHDQWMARYGRVYKTANEKNRRSTIFQENLKY  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            I+ FN   +K Y+LGVN+FADLTN+EF   R      V   VT+        FRYENVTA
Sbjct  70   IQTFNKANNKPYKLGVNEFADLTNEEFTTSRNKFKSHVCATVTNV-------FRYENVTA  122

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + +DWRKKGAVTP+K+Q  CGCCWAF
Sbjct  123  VPATMDWRKKGAVTPIKNQGQCGCCWAF  150



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 93/131 (71%), Gaps = 10/131 (8%)
 Frame = -1

Query  385  DEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFA  206
            +++ +M ARHE WMA++ ++Y DA EK +RF++F  NVK IE+FNA G++ + LGVN+FA
Sbjct  28   NDDSAMVARHEQWMAQYNRVYKDATEKAQRFEVFKANVKFIESFNAGGNRKFWLGVNQFA  87

Query  205  DLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFRYENVT--AAGSVLDWRKKGAVTPVK  35
            DLTNDEFR  +T  G+K    KV +        FRYENV+  A  + +DWR KGAVTP+K
Sbjct  88   DLTNDEFRATKTNKGFKPSPVKVPTG-------FRYENVSVDALPASIDWRTKGAVTPIK  140

Query  34   DQRDCGCCWAF  2
            DQ  CGCCWAF
Sbjct  141  DQGQCGCCWAF  151



>ref|XP_006492717.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|KDO63019.1| hypothetical protein CISIN_1g018968mg [Citrus sinensis]
Length=348

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 105/165 (64%), Gaps = 17/165 (10%)
 Frame = -1

Query  490  NIIPTFMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAG  311
            N IP F        ++ +LL + +S+   SSR  +  EQS+   HE WMA+HG+ Y D  
Sbjct  14   NTIPMF--------IIIILLVSCASQ-VVSSR--STHEQSVVEMHEKWMAQHGRSYKDEL  62

Query  310  EKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTST  131
            EK+ RFKIF EN++ IE  N  G++ Y+LG N+F+DLTNDEFR L T GYK       ST
Sbjct  63   EKEMRFKIFKENLEYIEKANKEGNRTYKLGTNRFSDLTNDEFRALYT-GYKMPSPSHRST  121

Query  130  SSKGKHYFRYENV--TAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +S     F+Y+N+  T   + LDWR K AVTP+KDQ++CGCCWAF
Sbjct  122  TSST---FKYQNLSMTDVPTSLDWRDKKAVTPIKDQQECGCCWAF  163



>ref|XP_006592475.1| PREDICTED: vignain-like [Glycine max]
Length=336

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 95/158 (60%), Gaps = 12/158 (8%)
 Frame = -1

Query  475  FMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            F + K     LF+LL      P   SR +   E SMR RHE WMA +GK+Y DA EK++R
Sbjct  3    FTSQKQYTIALFLLLAL--GIPQMMSRKL--HETSMRERHEQWMAEYGKVYKDAAEKEKR  58

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGK  116
            F IF  NV+ IE+FNA  +K Y+LGVN  ADLT +EF+  R G  +  +   T       
Sbjct  59   FLIFKHNVEFIESFNAAANKPYKLGVNHLADLTVEEFKASRNGLKRPYELSTTP------  112

Query  115  HYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              F+YENVTA  + +DWR KGAVT +KDQ  CG CWAF
Sbjct  113  --FKYENVTAIPAAIDWRTKGAVTSIKDQGQCGSCWAF  148



>gb|KHN33962.1| Vignain [Glycine soja]
Length=309

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            M  RHE WM R+ K+Y D  E++ RFKIF ENV  IEAFN   +K Y LG+N+FADLTN+
Sbjct  1    MYERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFADLTNE  60

Query  190  EFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCC  11
            EF   R      + + +T T++     F+YENVTA  S +DWR+KGAVTP+KDQ  CGCC
Sbjct  61   EFIAPRNRFKGHMCSSITRTTT-----FKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCC  115

Query  10   WAF  2
            WAF
Sbjct  116  WAF  118



>ref|XP_003539770.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 104/150 (69%), Gaps = 13/150 (9%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L +L G W+   +A++R +  E+ SM  RHE WMA+HGK+Y D  EK+ R+KIF +NVK 
Sbjct  14   LLLLFGFWAF--SANTRTL--EDASMHERHEQWMAQHGKVYKDHHEKELRYKIFQQNVKG  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRML-RTGGYKRVQTKVTSTSSKGKHYFRYENVT  89
            IE FN  G+K ++LGVN+FADLT +EF+ + +  GY  + +K++ TS+     F+YE+VT
Sbjct  70   IEGFNNAGNKSHKLGVNQFADLTEEEFKAINKLKGY--MWSKISRTST-----FKYEHVT  122

Query  88   AAGSVLDWRKKGAVTPVKDQ-RDCGCCWAF  2
               + LDWR+KGAVTP+K Q   CG CWAF
Sbjct  123  KVPATLDWRQKGAVTPIKSQGLKCGSCWAF  152



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            MR RHE WMARHG++Y DA EK+  F IF   V+ IE+FN  G+K Y+L +N FADLT++
Sbjct  1    MRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPYKLAINAFADLTSE  60

Query  190  EFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCC  11
            EF+  RT GYKR     +S  +     F+YE+VTA  S +DWRKKGAVTP+KDQ  CGC 
Sbjct  61   EFKASRT-GYKR----SSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQCGCR  115

Query  10   WAF  2
            WAF
Sbjct  116  WAF  118



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            + +MR RHE WMARHG++Y DA EK+  F IF   V+ IE+FN  G+K Y+L +N FADL
Sbjct  53   DATMRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPYKLAINAFADL  112

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
            T++EF+  RT GYKR     +S  +     F+YE+VTA  S +DWRKKGAVTP+KDQ  C
Sbjct  113  TSEEFKASRT-GYKR----SSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQC  167

Query  19   GCCWAF  2
            GC WAF
Sbjct  168  GCRWAF  173



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 97/155 (63%), Gaps = 13/155 (8%)
 Frame = -1

Query  463  KLLCY-LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            K LC  L+ M+ G W S   A+SR + D   SM  R+E WMAR+G++Y D  EK++RF+I
Sbjct  8    KCLCLALILMMFGGWYSE--ATSRTLQD--ASMYGRYEQWMARYGRVYNDINEKEKRFQI  63

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F ENV  +E+ N    K Y L VN+FADLTN+EF   R     R +    ST +     F
Sbjct  64   FKENVAIVESSNNDASKPYTLSVNQFADLTNEEFIASR----NRFKGHECSTKTMS---F  116

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +YEN T   +V DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  117  KYENFTVPATV-DWRQKGAVTPVKDQGQCGCCWAF  150



>ref|XP_010052197.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76117.1| hypothetical protein EUGRSUZ_D00494 [Eucalyptus grandis]
Length=369

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            E+ +  +HE WMA HG++Y DA EK +R++IF +NV RI AFN   D  Y+L VNKFADL
Sbjct  56   EEHLLKQHEQWMAVHGRVYKDADEKAKRYEIFKQNVNRINAFNNDKDAAYKLAVNKFADL  115

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
            TN+EFR   T GYKR  T+V   SS  +  F+Y N TAA  VLDWR K AVT VKDQ  C
Sbjct  116  TNEEFRASFT-GYKRRSTRV--LSSVDEKPFKYANFTAAPPVLDWRTKKAVTSVKDQSSC  172

Query  19   GCCWAF  2
            G CWAF
Sbjct  173  GACWAF  178



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 11/156 (7%)
 Frame = -1

Query  460  LLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFN  281
            L   +L +L  A+    A ++R + +E+ +M ARHE WMA++ ++Y DA EK  RF++F 
Sbjct  4    LQASILAVLSFAFFCGAALAARDL-NEDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFK  62

Query  280  ENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG-GYKRVQTKVTSTSSKGKHYFR  104
             NVK IE+FN  G++ + LG+N+FADLTNDEFR  +T  G+K    KV++        FR
Sbjct  63   ANVKFIESFNTGGNRKFWLGINQFADLTNDEFRTTKTNKGFKPSLDKVSTG-------FR  115

Query  103  YENVT--AAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV+  A  + +DWR  GAVTP+KDQ  CGCCWAF
Sbjct  116  YENVSVDAIPATIDWRTNGAVTPIKDQGQCGCCWAF  151



>ref|XP_010052203.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76130.1| hypothetical protein EUGRSUZ_D00506 [Eucalyptus grandis]
Length=345

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            E+ +  +HE WMA HG+IY DA EK +R++IF ENVK I AFN   D GY++ VNKFADL
Sbjct  32   EEHLLKQHEEWMAIHGRIYKDAVEKAKRYEIFKENVKHINAFNNGKDVGYKMAVNKFADL  91

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
            TN+EFR   T GYKR  T+V   SS     F+Y N TA  + LDWR K AVT VKDQ  C
Sbjct  92   TNEEFRASYT-GYKRRPTRV--LSSVDVKPFKYANFTAIPAALDWRTKKAVTSVKDQGGC  148

Query  19   GCCWAF  2
            GCCWAF
Sbjct  149  GCCWAF  154



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 100/152 (66%), Gaps = 10/152 (7%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            +   + ++L  W+ +   +SR++  E  +M  RHE WM R+G++Y +  EK  R+KIF +
Sbjct  8    ISVFIVLILTLWAYQ--TTSRLVP-ERLAMLERHEEWMERYGRVYKNEEEKMMRYKIFKD  64

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            NV+ IEAFNA G + Y+LG+N FAD TN+EF+  R G +K VQ    +T       F+YE
Sbjct  65   NVEFIEAFNAAGTRPYKLGINAFADQTNEEFKAARNGLFK-VQKLSKATP------FKYE  117

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            NV+A  S +DWRKKGAVTPVKDQ  CG CWAF
Sbjct  118  NVSALPSSMDWRKKGAVTPVKDQGQCGSCWAF  149



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            M  RHE W A+HG++Y D  EK +++ +F +N++RIE+FN   D+GY+LG+NKFADLT++
Sbjct  1    MLKRHEEWRAQHGRVYKDTAEKQKKYLVFKDNLERIESFNNGVDRGYKLGLNKFADLTDE  60

Query  190  EFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCC  11
            EF+ +   GYK   +K+ STS      FRY NVT+  + +DWRK GAVTPVKDQ  CG C
Sbjct  61   EFQAMHL-GYKSPPSKLMSTSK--SRSFRYRNVTSVPTTIDWRKAGAVTPVKDQGSCGSC  117

Query  10   WAF  2
            WAF
Sbjct  118  WAF  120



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 16/160 (10%)
 Frame = -1

Query  475  FMAPKLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDER  296
            F    + C     +LGA SS+  A+SR + D   SM A++E WMAR+G+ Y +  EK++ 
Sbjct  148  FTTANVFCLAFIFILGALSSQ--ATSRTLQD--ASMYAKYEQWMARYGRAYAEINEKEKH  203

Query  295  FKIFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTG--GYKRVQTKVTSTSSK  122
            F IF ENV  IE+ N   +K Y+L VN+FADLTN+EF+  R G  G++   TK T+    
Sbjct  204  FNIFKENVAFIESSNNDANKLYKLSVNQFADLTNEEFKASRNGFMGHE-CSTKTTA----  258

Query  121  GKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
                F+YENVTA  +V DWR KGAVTP+KDQ  CGCCWAF
Sbjct  259  ----FKYENVTAPPTV-DWRNKGAVTPIKDQGQCGCCWAF  293



>ref|XP_007132871.1| hypothetical protein PHAVU_011G131700g [Phaseolus vulgaris]
 gb|ESW04865.1| hypothetical protein PHAVU_011G131700g [Phaseolus vulgaris]
Length=270

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            M  RHE WM R+GK+Y D  E+++RF+IF ENV  IE FN   +K Y+LG N+FADLTN+
Sbjct  1    MYERHEEWMTRYGKVYKDPEEREKRFRIFKENVNYIETFNNAANKPYQLGTNQFADLTNE  60

Query  190  EFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCC  11
            EF    T G  R++  + S+  +    F+YENVTA  S +DWR+KGAVTPVKDQ  CGCC
Sbjct  61   EF----TAGRNRLKGHMCSSILR-TTTFKYENVTAIPSTVDWRQKGAVTPVKDQGQCGCC  115

Query  10   WAF  2
            WAF
Sbjct  116  WAF  118



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 10/156 (6%)
 Frame = -1

Query  466  PKLLCYLL-FMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFK  290
            P  + +L   ++L  W S+  A++R + D   SM  +HE W+A+ G++Y D  EK +RF 
Sbjct  5    PNWILFLAALVVLEIWGSQ--ATARTLPD--ASMVEKHEQWIAQFGRVYKDDAEKAKRFN  60

Query  289  IFNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHY  110
            IF ENV+ I++FN  G + Y+L +NKFADLTN+EF+  R G       K +  SS     
Sbjct  61   IFKENVEYIQSFNEAGARPYKLAINKFADLTNEEFQASRNGYKMGSYGKSSKVSS-----  115

Query  109  FRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            FRY NVTA  + +DWRKKGAVT VKDQ  CGCCWAF
Sbjct  116  FRYANVTAVPASMDWRKKGAVTGVKDQGQCGCCWAF  151



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 98/148 (66%), Gaps = 11/148 (7%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
            L   LGA +S+  A  R + D   S+  +HE WM R  ++Y+DA EK+ R+KIF ENV+R
Sbjct  14   LIFFLGALASQAIA--RTLQD--ASIHEKHEEWMTRFKRVYSDAKEKEIRYKIFKENVQR  69

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FN   +K Y+LG+N+FADLTN+EF+  R     R +  + S+ +     FRYEN+TA
Sbjct  70   IESFNKASEKSYKLGINQFADLTNEEFKTSRN----RFKGHMCSSQAGP---FRYENITA  122

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              S +DWRK+GAVT +KDQ  CG CWAF
Sbjct  123  VPSSMDWRKEGAVTAIKDQGQCGSCWAF  150



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   140 bits (354),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 98/148 (66%), Gaps = 9/148 (6%)
 Frame = -1

Query  445  LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKR  266
             F LLG  + + AA  R + DE  +M  R+E WM+ HG++Y D+ EK+ RFKIF +NV+ 
Sbjct  7    FFFLLGLLAIQGAA--RNLNDE--AMVERYEQWMSLHGRVYKDSAEKERRFKIFKDNVEF  62

Query  265  IEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTA  86
            IE+FN  G++ Y+LG+N+FADLTN+EF     G       ++  ++S     F+YENVTA
Sbjct  63   IESFNRAGNRPYKLGINQFADLTNEEFVASHNGLKMSSSPRLFMSTS-----FKYENVTA  117

Query  85   AGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              + +DWR KGAVTP+KDQ  CG CWAF
Sbjct  118  VPATVDWRTKGAVTPIKDQGQCGSCWAF  145



>ref|XP_003605890.1| Cysteine proteinase [Medicago truncatula]
 gb|AES88087.1| papain family cysteine protease [Medicago truncatula]
Length=343

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 94/136 (69%), Gaps = 11/136 (8%)
 Frame = -1

Query  403  SSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGD--KGY  230
            +SR + D+   M  RH  WM+++GK+Y D+ E+++RFKIF ENV  IEAFN +GD  K Y
Sbjct  26   TSRTLQDD---MYERHRQWMSQYGKVYKDSQEREKRFKIFTENVNYIEAFN-KGDNNKLY  81

Query  229  RLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGA  50
             LGVN+FADLTNDEF   R      + + +T TS+     F+YEN +A  S +DWRKKGA
Sbjct  82   TLGVNQFADLTNDEFTSSRNKFKGHMCSSITRTST-----FKYENASAIPSSVDWRKKGA  136

Query  49   VTPVKDQRDCGCCWAF  2
            VTPVK+Q  CGCCWAF
Sbjct  137  VTPVKNQGQCGCCWAF  152



>ref|XP_008364019.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=359

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 100/155 (65%), Gaps = 5/155 (3%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L   L ++LG  SS+ A  SR ++D+E+ M  RH+ WMARHG +Y DA EKD R+  F  
Sbjct  12   LALFLVLVLGFCSSQ-AFCSRQLSDDEKIMLERHKEWMARHGXVYKDAQEKDRRYNTFKS  70

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQT-KVTSTSSKG--KHYF  107
            NV+ I+ FN + +  YRL +NKFADLTN+EF+ + + GYKR+   ++ S SSK    + F
Sbjct  71   NVEFIKGFNKKSENKYRLDINKFADLTNEEFQAM-SQGYKRIHLPEIMSNSSKAAPDNNF  129

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            RYENVT      D+   GAVT VK Q  CGCCWAF
Sbjct  130  RYENVTDVPISKDYFSIGAVTTVKYQGQCGCCWAF  164



>gb|KHN07750.1| KDEL-tailed cysteine endopeptidase CEP1 [Glycine soja]
Length=309

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            M  RHE WMAR+ K+Y D  E+++RF+IF ENV  IE FN+  +K Y+L +N+FADLTN+
Sbjct  1    MYERHEQWMARYAKVYKDPQEREKRFRIFKENVNYIETFNSADNKSYKLDINQFADLTNE  60

Query  190  EFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCC  11
            EF   R      + + +T T++     F+YENVTA  S +DWR+KGAVTP+KDQ  CGCC
Sbjct  61   EFIAPRNRFKGHMCSSITRTTT-----FKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCC  115

Query  10   WAF  2
            WAF
Sbjct  116  WAF  118



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 7/136 (5%)
 Frame = -1

Query  409  AASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGY  230
            AASSR + D   S + +HE WMA +G+ Y DA EK+ RFKIF  NV+ IE+FNA G+  +
Sbjct  23   AASSRTLTD--VSTKEKHEQWMALYGRAYKDAAEKERRFKIFQANVELIESFNA-GNHKF  79

Query  229  RLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGA  50
            +LG N+FADLTN+EFR + T           ++S      F+YEN TA    +DWR KGA
Sbjct  80   KLGANQFADLTNEEFRAVHT----XXXXXXXASSGMATKSFKYENATAVPVSMDWRAKGA  135

Query  49   VTPVKDQRDCGCCWAF  2
            VTP+KDQ  CGCCWAF
Sbjct  136  VTPIKDQGQCGCCWAF  151



>ref|XP_003607647.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89844.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 7/127 (6%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            E  S++ RHE WM+ +GK+Y DA EK++RF IF +NV+ IE+FNA  +K Y+L VN  AD
Sbjct  32   ESPSLQERHEQWMSEYGKLYKDAIEKEKRFMIFKDNVEFIESFNAADNKPYKLSVNHLAD  91

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LT DEF+  R  GYK++  +  +TS      F+YENVTA    +DWR KGAVTP+KDQ  
Sbjct  92   LTLDEFKASRN-GYKKIDREFATTS------FKYENVTAIPEAVDWRVKGAVTPIKDQGQ  144

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  145  CGSCWAF  151



>gb|AFK44139.1| unknown [Medicago truncatula]
Length=340

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 7/127 (6%)
 Frame = -1

Query  382  EEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFAD  203
            E  S++ RHE WM+ +GK+Y DA EK++RF IF +NV+ IE+FNA  +K Y+L VN  AD
Sbjct  32   ESPSLQERHEQWMSEYGKLYKDAIEKEKRFMIFKDNVEFIESFNAADNKPYKLSVNHLAD  91

Query  202  LTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRD  23
            LT DEF+  R  GYK++  +  +TS      F+YENVTA    +DWR KGAVTP+KDQ  
Sbjct  92   LTLDEFKASRN-GYKKIDREFATTS------FKYENVTAIPEAVDWRVKGAVTPIKDQGQ  144

Query  22   CGCCWAF  2
            CG CWAF
Sbjct  145  CGSCWAF  151



>gb|KHG19386.1| KDEL-tailed cysteine endopeptidase CEP2 -like protein [Gossypium 
arboreum]
Length=274

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = -1

Query  370  MRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADLTND  191
            M  RH+ WM + G++Y DA E+ +RF+IF +NV RI+ FNA  +K Y+LGVN+FADLTN 
Sbjct  1    MYERHQQWMVQFGRVYKDANERQKRFQIFKQNVARIDYFNAANNKPYKLGVNQFADLTNQ  60

Query  190  EFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCC  11
            EF   R G    + +   +T       F+YEN TA  S +DWRKKGAVTP+KDQ  CGCC
Sbjct  61   EFTASRNGLKGHMCSNTATT-------FKYENATALPSTVDWRKKGAVTPIKDQGQCGCC  113

Query  10   WAF  2
            WAF
Sbjct  114  WAF  116



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 101/155 (65%), Gaps = 12/155 (8%)
 Frame = -1

Query  457  LCYL---LFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKI  287
            LC++   +   +  W+ +   +SR + D   S+  RHE WMAR+ ++Y D  EK++RF+I
Sbjct  7    LCHISLAMLFCMAFWALQ--VTSRTLQD--ASIYERHEEWMARYSRVYKDPQEKEKRFRI  62

Query  286  FNENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYF  107
            F +N+  IEAFN   +K Y+L +N+FADLTN+EF   R      +++ +  T++     F
Sbjct  63   FKQNMNYIEAFNNAANKPYKLAINQFADLTNEEFIAPRNRFKGHMRSSIIKTTT-----F  117

Query  106  RYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +YENVT+  S +DWR+KGAVTPVKDQ  CGCCWAF
Sbjct  118  KYENVTSVPSTVDWRQKGAVTPVKDQGQCGCCWAF  152



>ref|XP_009798360.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=341

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 100/150 (67%), Gaps = 10/150 (7%)
 Frame = -1

Query  448  LLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVK  269
            LLF+++G + S+   +SR I  +E SM  +HELWMA HG+ Y +  EK++R  IF ENVK
Sbjct  13   LLFVIIGMYESQ--VTSRNI--QELSMLEKHELWMANHGRTYKNEEEKEKRLNIFKENVK  68

Query  268  RIEAFNARG-DKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENV  92
             IE+FN  G  K Y++G+N FADLT +EF    T G      K++++ S+ +  F+YEN+
Sbjct  69   FIESFNNNGIKKPYKIGINAFADLTAEEFLSYYTTG-----IKLSNSYSQIQSSFKYENL  123

Query  91   TAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            +   S++DWRK GAVT +K Q  CGCCWAF
Sbjct  124  SDVPSIMDWRKSGAVTRIKHQGQCGCCWAF  153



>gb|KHN34255.1| KDEL-tailed cysteine endopeptidase CEP1 [Glycine soja]
Length=321

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            E     RHE WMA++GK+Y DA EK +RF+IF  NV  IE+FN  GDK + L +N+FADL
Sbjct  7    EACTSERHENWMAQYGKVYKDAAEKKKRFQIFKNNVHFIESFNTAGDKPFNLSINQFADL  66

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
             ++EF+ L T G K+V++ V  T+++ +  F+Y  VT   + +DWRK+GAVTP+KDQR C
Sbjct  67   HDEEFKALLTNGNKKVRS-VVGTATETETSFKYNRVTKLLATMDWRKRGAVTPIKDQRRC  125

Query  19   GCCWAF  2
            G CWAF
Sbjct  126  GSCWAF  131



>ref|XP_007021896.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY13421.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
Length=333

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 98/152 (64%), Gaps = 12/152 (8%)
 Frame = -1

Query  457  LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFNE  278
            L ++LF + G  +S+  A SR +    ++  A HELWMA++G+ Y +  EKD RFKIF E
Sbjct  3    LNFVLFFVFGILASQ--AMSRTM---NEAAIAEHELWMAKYGRTYQNKTEKDRRFKIFKE  57

Query  277  NVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYE  98
            N++ I+ FN  G++ Y+LG+N+FAD+++DEF   RT GYK      TS+       F Y 
Sbjct  58   NLEYIQNFNNAGNRSYKLGINEFADMSHDEFVAART-GYKNPGNLATSSP------FSYA  110

Query  97   NVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
              T   + LDWR+KGAVT VKDQ DCGCCWAF
Sbjct  111  EFTDVPTSLDWREKGAVTAVKDQGDCGCCWAF  142



>ref|XP_008244477.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=340

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 11/154 (7%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            + +C +L ++LG WSS   A+SR + D   SM  R+E WM R+G+ Y D  EK +RF+IF
Sbjct  9    RCVCLVLILMLGTWSSE--ATSRNLQD--ASMYERYEQWMVRYGREYDDVNEKQKRFEIF  64

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             +NV  IE+ N+  +K Y+L VN+FAD TN+E +  R  G+K  +    +TS      F+
Sbjct  65   KKNVAYIESSNSDVNKSYKLSVNQFADQTNEEVKASRN-GFKGREYSTKNTS------FK  117

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVT   S +DWR KGAVTP+KDQ  CG CWAF
Sbjct  118  YENVTVVPSTMDWRGKGAVTPMKDQGQCGSCWAF  151



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 102/156 (65%), Gaps = 16/156 (10%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +   L  +LGA SS+  A+SR + D   SM  R+E WMA +G++Y+D  EK++RF IF
Sbjct  10   KCIILALIFMLGALSSQ--ATSRTLQD--ASMYGRYEQWMAHYGRVYSDINEKEKRFNIF  65

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRT--GGYKRVQTKVTSTSSKGKHY  110
             ENV  IE+ N   +K ++L VN+FADLTN+EF+  R    G++    K TS        
Sbjct  66   KENVAFIESSNNDANKLHKLSVNQFADLTNEEFKASRNRFMGHE-CSAKTTS--------  116

Query  109  FRYENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            F+YENVTA  +V DWRKKGAVTPVKDQ  CGCCWAF
Sbjct  117  FKYENVTAPPTV-DWRKKGAVTPVKDQGQCGCCWAF  151



>ref|XP_003540007.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Glycine 
max]
Length=345

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = -1

Query  379  EQSMRARHELWMARHGKIYTDAGEKDERFKIFNENVKRIEAFNARGDKGYRLGVNKFADL  200
            E     RHE WMA++GK+Y DA EK +RF+IF  NV  IE+FN  GDK + L +N+FADL
Sbjct  31   EACTSERHENWMAQYGKVYKDAAEKKKRFQIFKNNVHFIESFNTAGDKPFNLSINQFADL  90

Query  199  TNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRYENVTAAGSVLDWRKKGAVTPVKDQRDC  20
             ++EF+ L T G K+V++ V  T+++ +  F+Y  VT   + +DWRK+GAVTP+KDQR C
Sbjct  91   HDEEFKALLTNGNKKVRS-VVGTATETETSFKYNRVTKLLATMDWRKRGAVTPIKDQRRC  149

Query  19   GCCWAF  2
            G CWAF
Sbjct  150  GSCWAF  155



>ref|XP_006582265.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 98/154 (64%), Gaps = 10/154 (6%)
 Frame = -1

Query  460  LLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFN  281
            +L   LF+ +G     P    R +   + ++R RHE WMA +GKIY DA EK++RF+IF 
Sbjct  10   MLALFLFLAVGISQVMP----RKL--HQTALRERHENWMAEYGKIYKDAAEKEKRFQIFK  63

Query  280  ENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFRY  101
            +NV+ IE+FNA G+K Y+LGVN  ADLT +EF+  R G  +  +   T+    G   F+Y
Sbjct  64   DNVEFIESFNAAGNKPYKLGVNHLADLTLEEFKDSRNGLKRTYEFSTTTFKLNG---FKY  120

Query  100  ENVTAAGSVLDWRKKGAVTPVKDQRD-CGCCWAF  2
            ENVT     +DWR KGAVTP+KDQ D CG CWAF
Sbjct  121  ENVTDIPEAIDWRVKGAVTPIKDQGDQCGSCWAF  154



>ref|XP_010481519.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=342

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 105/162 (65%), Gaps = 14/162 (9%)
 Frame = -1

Query  472  MAPKL--LCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDE  299
            MA KL  +C L+ ++L  W S   A SR + + E  M+ RH  WM +HG++Y D  EK+ 
Sbjct  1    MAFKLMQICLLVSLILSIWFS--IALSRPL-ENELIMQKRHIEWMTKHGRVYADMKEKNN  57

Query  298  RFKIFNENVKRIEAFNA-RGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSK  122
            R+ +F  NV+RIE  N+    + ++L VN+FADLTNDEFR   TG YK + T     SS 
Sbjct  58   RYVVFKSNVERIELLNSMSAGRPFKLAVNQFADLTNDEFRSTYTG-YKGLST----LSSL  112

Query  121  GKHYFRYENVTAAG--SVLDWRKKGAVTPVKDQRDCGCCWAF  2
            G+  FRY+NV++ G    +DWR KGAVTP+KDQR CGCCWAF
Sbjct  113  GQT-FRYQNVSSGGLPISVDWRTKGAVTPIKDQRSCGCCWAF  153



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 95/154 (62%), Gaps = 16/154 (10%)
 Frame = -1

Query  460  LLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIFN  281
            L C  LF +          +SR + D+  SM  RH  WM+++GKIY D  E++ RFKIF 
Sbjct  15   LFCLGLFAI--------QVTSRTLQDD--SMYERHGQWMSQYGKIYKDHQERETRFKIFK  64

Query  280  ENVKRIEAFNARGD-KGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
            ENV  IE FN   D K Y+LG+N+FADLTN+EF   R      + + +  T+S     F+
Sbjct  65   ENVNYIETFNNADDTKSYKLGINQFADLTNEEFIASRNKFKGHMCSSIMRTTS-----FK  119

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENV+   S +DWRKKGAVTPVK+Q  CGCCWAF
Sbjct  120  YENVSGIPSTVDWRKKGAVTPVKNQGQCGCCWAF  153



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 101/154 (66%), Gaps = 12/154 (8%)
 Frame = -1

Query  463  KLLCYLLFMLLGAWSSRPAASSRVIADEEQSMRARHELWMARHGKIYTDAGEKDERFKIF  284
            K +   L ++LGAWSS   A+SR + D    M  R+E WMAR+ ++Y+D  EK++RF+IF
Sbjct  8    KCIYLALIIMLGAWSSE--ATSRSLQD--VIMYGRYEQWMARYERVYSDFDEKEKRFQIF  63

Query  283  NENVKRIEAFNARGDKGYRLGVNKFADLTNDEFRMLRTGGYKRVQTKVTSTSSKGKHYFR  104
             ENV  +E+ N   +K Y+L VN+FADLTN+EF   R   +K  +    +TS      ++
Sbjct  64   KENVAFVESSNGEANKPYKLSVNRFADLTNEEFTASRN-RFKGHECSTETTS------YK  116

Query  103  YENVTAAGSVLDWRKKGAVTPVKDQRDCGCCWAF  2
            YENVT   + +DWR+KGAVTP+KDQ  CGCCWAF
Sbjct  117  YENVTVP-ATMDWRQKGAVTPIKDQGQCGCCWAF  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510262503360