BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16316_g1_i1 len=1746 path=[1:0-258 @260@!:259-1477 1479:1478-1745]

Length=1746
                                                                      Score     E

ref|XP_007014476.1|  Sodium transporter hkt1-like protein, putative     462   1e-152   
ref|XP_002325229.1|  sodium transporter family protein                  450   1e-148   Populus trichocarpa [western balsam poplar]
ref|XP_011017751.1|  PREDICTED: sodium transporter HKT1-like            447   4e-147   
ref|XP_006474646.1|  PREDICTED: probable cation transporter HKT6-...    436   2e-142   
ref|XP_009789271.1|  PREDICTED: sodium transporter HKT1-like            429   3e-140   
ref|XP_006474312.1|  PREDICTED: probable cation transporter HKT6-...    427   2e-139   
ref|XP_011094146.1|  PREDICTED: sodium transporter HKT1-like            427   4e-139   
ref|XP_009599985.1|  PREDICTED: sodium transporter HKT1 isoform X1      426   1e-138   
ref|XP_002270986.1|  PREDICTED: sodium transporter HKT1                 424   5e-138   Vitis vinifera
ref|XP_006592483.1|  PREDICTED: cation transporter HKT8-like            419   1e-135   
ref|XP_007226668.1|  hypothetical protein PRUPE_ppa021550mg             416   2e-135   
emb|CDP16110.1|  unnamed protein product                                413   9e-135   
gb|KHN15418.1|  Sodium transporter HKT1                                 416   2e-134   
ref|XP_008223810.1|  PREDICTED: sodium transporter HKT1-like            412   2e-133   
ref|XP_003517618.1|  PREDICTED: sodium transporter HKT1-like            409   2e-132   
ref|XP_011017602.1|  PREDICTED: probable cation transporter HKT6        409   2e-132   
ref|XP_011017605.1|  PREDICTED: probable cation transporter HKT6        408   4e-132   
ref|XP_007152990.1|  hypothetical protein PHAVU_004G177200g             407   7e-132   
emb|CCJ09642.1|  Na+ transporter                                        406   1e-131   
ref|XP_011017603.1|  PREDICTED: probable cation transporter HKT6 ...    406   4e-131   
ref|XP_011017604.1|  PREDICTED: probable cation transporter HKT6 ...    405   6e-131   
ref|XP_010263271.1|  PREDICTED: sodium transporter HKT1-like            406   7e-131   
ref|XP_010263268.1|  PREDICTED: sodium transporter HKT1-like isof...    406   7e-131   
ref|XP_006582258.1|  PREDICTED: cation transporter HKT8-like            407   9e-131   
gb|KHN28104.1|  Putative cation transporter HKT6-like protein           406   1e-130   
emb|CDI45388.1|  membrane Na+ transporter                               403   2e-130   
emb|CBI40144.3|  unnamed protein product                                402   3e-130   
ref|XP_006359731.1|  PREDICTED: sodium transporter HKT1-like            401   9e-130   
ref|NP_001289833.1|  sodium transporter HKT1                            401   2e-129   
ref|XP_007226528.1|  hypothetical protein PRUPE_ppa025255mg             402   2e-129   
ref|XP_010690257.1|  PREDICTED: sodium transporter HKT1-like            402   2e-129   
ref|XP_009597173.1|  PREDICTED: sodium transporter HKT1-like            402   3e-129   
ref|XP_010050941.1|  PREDICTED: sodium transporter HKT1-like            400   8e-129   
ref|XP_008361077.1|  PREDICTED: sodium transporter HKT1-like            398   8e-128   
ref|XP_007152992.1|  hypothetical protein PHAVU_004G177300g             397   8e-128   
ref|XP_006453233.1|  hypothetical protein CICLE_v10010667mg             397   9e-128   
ref|XP_010263423.1|  PREDICTED: probable cation transporter HKT7        398   1e-127   
ref|XP_004301408.1|  PREDICTED: sodium transporter HKT1-like            395   3e-127   
ref|XP_009789270.1|  PREDICTED: sodium transporter HKT1-like            395   2e-126   
ref|XP_008223908.1|  PREDICTED: sodium transporter HKT1-like            394   2e-126   
ref|XP_004513135.1|  PREDICTED: LOW QUALITY PROTEIN: probable cat...    394   4e-126   
ref|XP_010263413.1|  PREDICTED: probable cation transporter HKT7        393   5e-126   
gb|EYU25742.1|  hypothetical protein MIMGU_mgv1a005209mg                391   1e-125   
ref|XP_008781917.1|  PREDICTED: cation transporter HKT8-like            392   1e-125   
gb|KEH27269.1|  high-affinity potassium transporter                     392   2e-125   
ref|XP_002270300.1|  PREDICTED: sodium transporter HKT1-like            391   4e-125   Vitis vinifera
gb|AAO73474.1|  high affinity potassium transporter 2                   390   6e-125   Mesembryanthemum crystallinum
ref|XP_004513109.1|  PREDICTED: sodium transporter HKT1-like isof...    390   7e-125   
gb|AAF97728.1|AF176035_1  potassium-sodium symporter HKT1               390   8e-125   Eucalyptus camaldulensis
ref|XP_011077901.1|  PREDICTED: sodium transporter HKT1-like            388   5e-124   
ref|XP_010913849.1|  PREDICTED: LOW QUALITY PROTEIN: probable cat...    387   6e-124   
ref|XP_010048559.1|  PREDICTED: sodium transporter HKT1-like            387   1e-123   
ref|XP_010263267.1|  PREDICTED: probable cation transporter HKT7        387   2e-123   
emb|CBI40134.3|  unnamed protein product                                385   3e-123   
ref|XP_010048550.1|  PREDICTED: sodium transporter HKT1-like            386   4e-123   
ref|XP_002270183.2|  PREDICTED: probable cation transporter HKT7        385   6e-123   Vitis vinifera
ref|XP_010048551.1|  PREDICTED: sodium transporter HKT1-like            384   1e-122   
ref|XP_010050921.1|  PREDICTED: sodium transporter HKT1-like            382   1e-121   
emb|CAN68938.1|  hypothetical protein VITISV_025919                     384   2e-121   Vitis vinifera
ref|XP_010656787.1|  PREDICTED: sodium transporter HKT1-like            380   8e-121   
emb|CBI40133.3|  unnamed protein product                                379   2e-120   
ref|XP_010062271.1|  PREDICTED: sodium transporter HKT1-like            379   3e-120   
gb|AFK46164.1|  unknown                                                 377   3e-120   
ref|XP_008781920.1|  PREDICTED: probable cation transporter HKT6        377   5e-120   
gb|AES77170.2|  high-affinity potassium transporter                     377   5e-120   
ref|XP_010048558.1|  PREDICTED: sodium transporter HKT1-like            376   2e-119   
ref|XP_009339408.1|  PREDICTED: sodium transporter HKT1-like isof...    374   1e-118   
ref|XP_010542389.1|  PREDICTED: sodium transporter HKT1                 373   1e-118   
emb|CCJ09643.1|  Na+ transporter                                        374   3e-118   
ref|XP_010323376.1|  PREDICTED: sodium transporter HKT1-like            374   3e-118   
emb|CBI40132.3|  unnamed protein product                                371   1e-117   
ref|XP_010688439.1|  PREDICTED: sodium transporter HKT1-like            371   2e-117   
gb|AAD53890.1|AF176036_1  potassium-sodium symporter HKT2               370   5e-117   Eucalyptus camaldulensis
gb|KCW80896.1|  hypothetical protein EUGRSUZ_C02265                     367   2e-116   
ref|NP_001046052.1|  Os02g0175000                                       367   5e-116   Oryza sativa Japonica Group [Japonica rice]
gb|EYU38770.1|  hypothetical protein MIMGU_mgv1a004645mg                364   6e-115   
sp|Q6H501.1|HKT6_ORYSJ  RecName: Full=Probable cation transporter...    361   1e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646953.1|  PREDICTED: probable cation transporter HKT6-...    360   2e-113   
ref|XP_008781916.1|  PREDICTED: cation transporter HKT8-like            357   3e-113   
ref|XP_004149678.1|  PREDICTED: sodium transporter HKT1-like            359   3e-113   
gb|KEH27274.1|  high-affinity potassium transporter                     359   6e-113   
ref|XP_008453532.1|  PREDICTED: sodium transporter HKT1-like            357   1e-112   
ref|XP_010263272.1|  PREDICTED: probable cation transporter HKT6        358   1e-112   
gb|EYU22104.1|  hypothetical protein MIMGU_mgv1a005068mg                357   2e-112   
gb|ABG33945.1|  HKT8                                                    356   4e-112   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003620952.1|  Cation transporter HKT8                            358   5e-112   
ref|XP_009600055.1|  PREDICTED: sodium transporter HKT1 isoform X2      353   2e-111   
gb|KEH27275.1|  sodium transporter HKT1                                 351   2e-111   
ref|XP_010690256.1|  PREDICTED: cation transporter HKT8-like            352   1e-110   
ref|XP_010913851.1|  PREDICTED: cation transporter HKT8-like            352   2e-110   
gb|ADG45565.1|  putative high-affinity potassium transporter            350   3e-109   
gb|AAK52962.1|AF367366_1  putative potassium-sodium transporter         348   7e-109   Mesembryanthemum crystallinum
ref|XP_002268082.1|  PREDICTED: sodium transporter HKT1                 348   7e-109   Vitis vinifera
ref|XP_009134189.1|  PREDICTED: sodium transporter HKT1-like            346   4e-108   
ref|XP_003564102.2|  PREDICTED: cation transporter HKT8-like            345   1e-107   
gb|EYU22103.1|  hypothetical protein MIMGU_mgv1a018321mg                345   1e-107   
gb|KFK31992.1|  hypothetical protein AALP_AA6G186200                    344   2e-107   
emb|CAN69230.1|  hypothetical protein VITISV_008802                     344   2e-107   Vitis vinifera
ref|XP_004951743.1|  PREDICTED: probable cation transporter HKT6-...    344   3e-107   
ref|XP_009339409.1|  PREDICTED: sodium transporter HKT1-like isof...    341   3e-107   
ref|XP_002451638.1|  hypothetical protein SORBIDRAFT_04g005010          343   7e-107   Sorghum bicolor [broomcorn]
dbj|BAO66168.1|  sodium transporter HKT1;5                              342   8e-107   
ref|XP_009415063.1|  PREDICTED: sodium transporter HKT1-like isof...    342   9e-107   
emb|CDX94264.1|  BnaC02g29240D                                          342   2e-106   
gb|AAF68393.1|  sodium transporter                                      341   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567354.1|  sodium transporter HKT1                               341   3e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAT95386.1|  sodium transport protein                                340   4e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAS20529.2|  HKT1                                                    341   6e-106   Suaeda salsa
gb|ABG33939.1|  HKT8                                                    339   2e-105   Triticum monococcum [einkorn wheat]
ref|XP_006289667.1|  hypothetical protein CARUB_v10003226mg             338   3e-105   
ref|XP_006289290.1|  hypothetical protein CARUB_v10002759mg             338   5e-105   
gb|ABK58096.1|  sodium transporter HKT1;5                               337   1e-104   Hordeum vulgare subsp. vulgare [barley]
dbj|BAO66165.1|  sodium transporter HKT1;5                              337   1e-104   
ref|XP_010437244.1|  PREDICTED: sodium transporter HKT1                 336   3e-104   
ref|XP_002872505.1|  potassium transporter                              335   4e-104   
gb|ABG33940.1|  HKT8                                                    335   5e-104   Triticum turgidum subsp. durum
gb|ABG33941.1|  HKT8                                                    335   8e-104   Triticum turgidum subsp. durum
ref|XP_006397077.1|  hypothetical protein EUTSA_v10028595mg             334   1e-103   
dbj|BAO66166.1|  sodium transporter HKT1;5                              334   2e-103   
emb|CDX90754.1|  BnaA03g24340D                                          335   3e-103   
ref|XP_010437235.1|  PREDICTED: sodium transporter HKT1-like            331   7e-103   
ref|XP_010424497.1|  PREDICTED: sodium transporter HKT1-like            331   8e-103   
ref|XP_009415042.1|  PREDICTED: cation transporter HKT8-like            330   4e-102   
gb|KDP35912.1|  hypothetical protein JCGZ_09884                         324   4e-102   
dbj|BAO66167.1|  sodium transporter HKT1;5                              330   7e-102   
ref|XP_010421950.1|  PREDICTED: sodium transporter HKT1-like            329   1e-101   
ref|XP_006289285.1|  hypothetical protein CARUB_v10002754mg             328   2e-101   
ref|XP_006645804.1|  PREDICTED: cation transporter HKT8-like            329   2e-101   
ref|XP_004967537.1|  PREDICTED: cation transporter HKT8-like            329   3e-101   
gb|AGZ93642.1|  HKT1;4-1                                                328   9e-101   
ref|XP_009128719.1|  PREDICTED: sodium transporter HKT1-like            326   2e-100   
ref|XP_002448492.1|  hypothetical protein SORBIDRAFT_06g027900          327   5e-100   Sorghum bicolor [broomcorn]
gb|ABK30935.1|  potassium transporter                                   325   5e-100   Eutrema halophilum
dbj|BAE44386.1|  high-affinity potassium transporter                    325   9e-100   Phragmites australis
ref|XP_003570995.1|  PREDICTED: probable cation transporter HKT6 ...    324   1e-99    
ref|XP_004968907.1|  PREDICTED: cation transporter HKT8-like isof...    324   2e-99    
gb|ABK41858.1|  putative sodium transporter HKT7-A1                     324   4e-99    Triticum monococcum [einkorn wheat]
dbj|BAE44385.1|  high-affinity potassium transporter                    323   5e-99    Phragmites australis
ref|XP_002457736.1|  hypothetical protein SORBIDRAFT_03g012590          320   3e-98    Sorghum bicolor [broomcorn]
gb|EMT13934.1|  Putative cation transporter HKT6                        318   4e-98    
gb|EMT29177.1|  Cation transporter HKT8                                 317   5e-98    
gb|AID46989.1|  putative Na+/K+ transporter                             320   7e-98    
ref|XP_008801453.1|  PREDICTED: cation transporter HKT1-like            319   8e-98    
ref|XP_004150748.1|  PREDICTED: cation transporter HKT8-like            317   1e-97    
gb|EMT30073.1|  Cation transporter HKT1                                 319   2e-97    
ref|XP_004976741.1|  PREDICTED: probable cation transporter HKT7-...    318   5e-97    
gb|AGZ93643.1|  HKT1;4-2                                                318   8e-97    
ref|XP_008673123.1|  PREDICTED: uncharacterized protein LOC100382...    317   1e-96    
ref|XP_010240387.1|  PREDICTED: cation transporter HKT4-like            317   2e-96    
ref|XP_006397079.1|  hypothetical protein EUTSA_v10028594mg             314   4e-96    
gb|AAA52749.1|  HKT1                                                    315   5e-96    Triticum aestivum [Canadian hard winter wheat]
gb|KGN65514.1|  hypothetical protein Csa_1G433620                       311   9e-96    
gb|ABK41857.1|  putative sodium transporter HKT7-A2                     315   9e-96    Triticum monococcum [einkorn wheat]
gb|AFY08297.1|  sodium transporter HKT1.5                               314   2e-95    
gb|AFY08294.1|  sodium transporter HKT1.5                               314   3e-95    
gb|AFY08289.1|  sodium transporter HKT1.5                               313   4e-95    
gb|EEC70498.1|  hypothetical protein OsI_01579                          313   5e-95    Oryza sativa Indica Group [Indian rice]
gb|AAY42148.1|  high-affinity potassium uptake transporter              312   5e-95    Triticum aestivum [Canadian hard winter wheat]
gb|AAZ76552.1|  sodium transporter                                      313   8e-95    Oryza sativa Indica Group [Indian rice]
gb|AFY08290.1|  sodium transporter HKT1.5                               312   8e-95    
ref|NP_001042848.1|  Os01g0307500                                       312   1e-94    Oryza sativa Japonica Group [Japonica rice]
gb|AFY08287.1|  sodium transporter HKT1.5                               312   1e-94    
sp|A2WNZ9.2|HKT8_ORYSI  RecName: Full=Cation transporter HKT8; Sh...    312   1e-94    Oryza sativa Indica Group [Indian rice]
gb|AFY08288.1|  sodium transporter HKT1.5                               312   1e-94    
gb|AFY08295.1|  sodium transporter HKT1.5                               312   1e-94    
ref|XP_009113602.1|  PREDICTED: sodium transporter HKT1-like            310   1e-94    
ref|XP_006287554.1|  hypothetical protein CARUB_v10000766mg             309   5e-94    
gb|AID46987.1|  putative Na+/K+ transporter                             310   7e-94    
ref|NP_001058486.1|  Os06g0701700                                       309   1e-93    Oryza sativa Japonica Group [Japonica rice]
emb|CAD37196.1|  putative sodium transporter                            309   1e-93    Oryza sativa Japonica Group [Japonica rice]
gb|AFY08292.1|  sodium transporter HKT1.5                               309   2e-93    
gb|AAQ91202.1|  sodium transporter                                      308   3e-93    Oryza sativa Indica Group [Indian rice]
gb|AFH37929.1|  high-affinity K+ transporter 1                          306   4e-93    
gb|AAC62807.1|  similar to potassium transport proteins                 303   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008453695.1|  PREDICTED: cation transporter HKT8-like            305   2e-92    
gb|KDP36066.1|  hypothetical protein JCGZ_08710                         297   2e-92    
ref|XP_004150749.1|  PREDICTED: sodium transporter HKT1-like            304   3e-92    
ref|XP_008781919.1|  PREDICTED: probable cation transporter HKT6        301   3e-91    
ref|XP_010929481.1|  PREDICTED: cation transporter HKT2-like            303   4e-91    
ref|XP_010048540.1|  PREDICTED: probable cation transporter HKT7        302   7e-91    
gb|ACT21087.1|  high-affinity potassium transporter                     301   8e-91    Puccinellia tenuiflora
gb|AEM55590.1|  high-affinity potassium transporter                     301   1e-90    
emb|CAJ01326.1|  high-affinity sodium transporter                       301   1e-90    Hordeum vulgare [barley]
gb|AER42622.1|  high-affinity potassium uptake transporter              300   3e-90    
ref|XP_008798150.1|  PREDICTED: cation transporter HKT1-like            300   5e-90    
ref|XP_010929482.1|  PREDICTED: cation transporter HKT1-like            298   1e-89    
tpg|DAA54361.1|  TPA: hypothetical protein ZEAMMB73_606677              297   2e-89    
emb|CDX86866.1|  BnaA09g22560D                                          296   6e-89    
emb|CAH66787.1|  OSIGBa0113I13.13                                       295   1e-88    Oryza sativa [red rice]
ref|NP_001053810.1|  Os04g0607600                                       295   1e-88    Oryza sativa Japonica Group [Japonica rice]
gb|AEM44690.1|  high-affinity K+ transporter 4                          296   2e-88    
sp|Q93XI5.1|HKT2_ORYSI  RecName: Full=Cation transporter HKT2; Sh...    295   2e-88    Oryza sativa Indica Group [Indian rice]
gb|AEA08583.1|  high affinity potassium transporter                     296   2e-88    
gb|ABN48305.1|  potassium/sodium transporter HKT2;2                     295   3e-88    Oryza sativa Indica Group [Indian rice]
dbj|BAJ95374.1|  predicted protein                                      296   4e-88    
emb|CDX99535.1|  BnaC09g24570D                                          294   4e-88    
ref|XP_010927280.1|  PREDICTED: cation transporter HKT1-like            294   6e-88    
ref|XP_003560515.1|  PREDICTED: cation transporter HKT1-like            294   7e-88    
ref|XP_004967239.1|  PREDICTED: LOW QUALITY PROTEIN: cation trans...    293   2e-87    
ref|XP_009113604.1|  PREDICTED: sodium transporter HKT1-like            291   3e-87    
emb|CDX86865.1|  BnaA09g22550D                                          290   5e-87    
gb|AEM55592.1|  high-affinity potassium transporter                     291   7e-87    
ref|NP_001174084.1|  Os04g0607500                                       288   1e-85    
emb|CAH66785.1|  OSIGBa0113I13.11                                       287   4e-85    Oryza sativa [red rice]
ref|XP_010263269.1|  PREDICTED: probable cation transporter HKT6 ...    284   5e-85    
ref|NP_001168576.1|  uncharacterized protein LOC100382359               283   8e-85    Zea mays [maize]
ref|XP_006653745.1|  PREDICTED: probable cation transporter HKT7-...    284   3e-84    
ref|XP_008453696.1|  PREDICTED: probable cation transporter HKT7        279   4e-84    
gb|EMS57034.1|  Cation transporter HKT1                                 281   6e-84    
gb|EPS69224.1|  hypothetical protein M569_05541                         280   4e-83    
ref|XP_010910885.1|  PREDICTED: cation transporter HKT8-like            279   6e-83    
ref|XP_004978223.1|  PREDICTED: cation transporter HKT4-like            279   1e-82    
gb|KCW80827.1|  hypothetical protein EUGRSUZ_C02191                     276   3e-82    
ref|XP_009406676.1|  PREDICTED: cation transporter HKT2-like            278   9e-82    
emb|CDX99538.1|  BnaC09g24540D                                          265   4e-77    
gb|KDO61956.1|  hypothetical protein CISIN_1g0458092mg                  260   1e-76    
ref|XP_006653744.1|  PREDICTED: LOW QUALITY PROTEIN: cation trans...    261   3e-75    
gb|EMT13549.1|  Cation transporter HKT4                                 257   8e-75    
gb|EPS63622.1|  hypothetical protein M569_11162                         266   3e-74    
ref|XP_006657304.1|  PREDICTED: LOW QUALITY PROTEIN: probable cat...    258   5e-74    
ref|XP_004951744.1|  PREDICTED: probable cation transporter HKT6-...    251   3e-72    
emb|CCH26449.1|  high-affinity K+ transporter 1                         248   9e-72    
ref|XP_009415055.1|  PREDICTED: sodium transporter HKT1-like isof...    251   1e-71    
emb|CDY05096.1|  BnaC03g28940D                                          248   1e-71    
ref|XP_003563514.1|  PREDICTED: probable cation transporter HKT9        250   1e-71    
emb|CAB39784.1|  potassium uptake transporter-like protein              249   2e-71    Arabidopsis thaliana [mouse-ear cress]
emb|CCH26461.1|  high-affinity K+ transporter 1                         247   2e-71    
emb|CCH26450.1|  high-affinity K+ transporter 1                         247   3e-71    
emb|CCH26452.1|  high-affinity K+ transporter 1                         247   3e-71    
emb|CCH26448.1|  high-affinity K+ transporter 1                         247   3e-71    
emb|CCH26518.1|  high-affinity K+ transporter 1                         246   5e-71    
ref|XP_006453201.1|  hypothetical protein CICLE_v100106251mg            238   7e-69    
ref|XP_010233891.1|  PREDICTED: probable cation transporter HKT6 ...    238   9e-69    
ref|NP_001058485.1|  Os06g0701600                                       242   1e-68    Oryza sativa Japonica Group [Japonica rice]
gb|KDO61997.1|  hypothetical protein CISIN_1g0456322mg                  238   2e-68    
ref|XP_004513110.1|  PREDICTED: sodium transporter HKT1-like isof...    236   7e-67    
ref|NP_001043248.1|  Os01g0532600                                       236   2e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004967240.1|  PREDICTED: probable cation transporter HKT9-...    229   2e-63    
gb|KHN32920.1|  Sodium transporter HKT1                                 221   2e-62    
ref|XP_004968910.1|  PREDICTED: cation transporter HKT8-like isof...    223   7e-62    
gb|KDP35913.1|  hypothetical protein JCGZ_09885                         213   2e-61    
ref|XP_007152991.1|  hypothetical protein PHAVU_004G177200g             218   5e-61    
gb|EMS63266.1|  putative cation transporter HKT7                        213   5e-61    
gb|EMT30072.1|  Putative cation transporter HKT9                        223   1e-60    
ref|XP_009630778.1|  PREDICTED: sodium transporter HKT1-like            218   2e-60    
ref|XP_002524105.1|  hypothetical protein RCOM_0422820                  215   3e-60    Ricinus communis
ref|XP_009346679.1|  PREDICTED: sodium transporter HKT1-like            214   1e-59    
gb|EAZ12198.1|  hypothetical protein OsJ_02083                          210   1e-57    Oryza sativa Japonica Group [Japonica rice]
emb|CBI40140.3|  unnamed protein product                                201   1e-56    
gb|EEC72593.1|  hypothetical protein OsI_06054                          208   1e-56    Oryza sativa Indica Group [Indian rice]
gb|AFK39136.1|  unknown                                                 197   2e-55    
gb|EMT09389.1|  Putative cation transporter HKT7                        200   3e-54    
ref|XP_010227256.1|  PREDICTED: probable cation transporter HKT7        200   3e-53    
ref|XP_006453200.1|  hypothetical protein CICLE_v100106252mg            189   3e-53    
gb|KDO61998.1|  hypothetical protein CISIN_1g0456321mg                  188   8e-53    
emb|CAN64110.1|  hypothetical protein VITISV_037966                     206   1e-52    Vitis vinifera
gb|ACS26261.1|  HKT-type transporter                                    190   3e-52    Puccinellia tenuiflora
ref|XP_010455430.1|  PREDICTED: sodium transporter HKT1-like            193   6e-52    
gb|EEC77956.1|  hypothetical protein OsI_17311                          195   6e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_010107040.1|  Sodium transporter HKT1                            190   2e-51    
gb|KDO61957.1|  hypothetical protein CISIN_1g0458091mg                  183   3e-51    
gb|KEH27272.1|  high-affinity potassium transporter                     190   5e-51    
gb|AGT16404.1|  high-affinity potassium transporter                     195   5e-51    
ref|XP_004162806.1|  PREDICTED: sodium transporter HKT1-like            188   2e-50    
ref|XP_004172340.1|  PREDICTED: sodium transporter HKT1-like            186   2e-50    
gb|EEC81265.1|  hypothetical protein OsI_24359                          187   2e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_006397078.1|  hypothetical protein EUTSA_v10028767mg             185   5e-49    
ref|XP_008645031.1|  PREDICTED: probable cation transporter HKT9        189   5e-49    
gb|EEC81264.1|  hypothetical protein OsI_24358                          185   5e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_007028762.1|  High-affinity K+ transporter 1, putative           178   2e-47    
emb|CAE03639.1|  OSJNBa0060N03.4                                        187   5e-47    Oryza sativa Japonica Group [Japonica rice]
gb|ACU19475.1|  unknown                                                 180   6e-47    Glycine max [soybeans]
ref|XP_010913850.1|  PREDICTED: probable cation transporter HKT6        180   7e-47    
gb|KHN40321.1|  Sodium transporter HKT1                                 178   2e-46    
ref|XP_002522042.1|  hypothetical protein RCOM_1381500                  168   4e-45    Ricinus communis
ref|XP_002438960.1|  hypothetical protein SORBIDRAFT_10g029000          178   4e-45    Sorghum bicolor [broomcorn]
dbj|BAE44384.1|  high-affinity potassium transporter                    174   5e-45    Phragmites australis
dbj|BAK02371.1|  predicted protein                                      169   6e-45    
ref|XP_010095382.1|  putative cation transporter HKT7                   165   7e-45    
emb|CDP17691.1|  unnamed protein product                                169   9e-44    
gb|EMS50103.1|  putative cation transporter HKT6                        169   3e-43    
ref|XP_010558900.1|  PREDICTED: probable cation transporter HKT7        160   5e-43    
ref|XP_007028763.1|  High-affinity K+ transporter 1, putative           161   6e-43    
ref|XP_009609763.1|  PREDICTED: sodium transporter HKT1-like            162   2e-41    
ref|XP_010095383.1|  Sodium transporter HKT1                            162   3e-41    
gb|AFI81997.1|  high-affinity K+ transporter 1                          158   4e-41    
gb|KCW80813.1|  hypothetical protein EUGRSUZ_C02181                     158   6e-39    
ref|XP_004968908.1|  PREDICTED: cation transporter HKT8-like isof...    158   1e-38    
ref|XP_004968909.1|  PREDICTED: cation transporter HKT8-like isof...    158   1e-38    
gb|EEE61645.1|  hypothetical protein OsJ_16090                          162   1e-38    
ref|XP_006850936.1|  hypothetical protein AMTR_s00025p00189380          151   1e-37    
gb|AFI81996.1|  high-affinity K+ transporter 1                          147   4e-37    
ref|XP_010273375.1|  PREDICTED: sodium transporter HKT1-like            147   6e-37    
ref|XP_002976863.1|  sodium transporter                                 154   2e-36    
ref|XP_010107041.1|  putative cation transporter HKT7                   140   3e-36    
ref|XP_002980326.1|  hypothetical protein SELMODRAFT_32516              150   5e-36    
dbj|BAK01227.1|  predicted protein                                      145   4e-35    
gb|EEE66307.1|  hypothetical protein OsJ_22538                          140   4e-35    
gb|KGN65515.1|  hypothetical protein Csa_1G433630                       139   6e-35    
ref|XP_002980585.1|  hypothetical protein SELMODRAFT_54024              146   6e-35    
gb|AFI81998.1|  high-affinity K+ transporter 1                          140   9e-35    
ref|XP_002963006.1|  hypothetical protein SELMODRAFT_79151              147   1e-34    
gb|AFI82000.1|  high-affinity K+ transporter 1                          139   1e-34    
gb|AFI81999.1|  high-affinity K+ transporter 1                          138   2e-34    
gb|EMT13550.1|  Putative cation transporter HKT7                        138   4e-33    
ref|XP_002963005.1|  hypothetical protein SELMODRAFT_22409              136   2e-31    
emb|CBI40137.3|  unnamed protein product                                125   1e-30    
ref|XP_002992546.1|  hypothetical protein SELMODRAFT_1751               133   2e-30    
ref|XP_002980327.1|  sodium transporter                                 132   9e-30    
ref|XP_002972315.1|  hypothetical protein SELMODRAFT_97685              131   2e-29    
gb|AFK40714.1|  unknown                                                 122   3e-29    
emb|CAZ65436.1|  sodium transporter                                     130   1e-28    
ref|XP_001763760.1|  Na+ transporter                                    129   4e-28    
gb|AEH68832.1|  sodium transporter HKT1;4 variant 1                     120   4e-28    
gb|AAY33540.1|  HKT1                                                    123   5e-28    
gb|ABD15858.1|  HKT1 protein                                            122   7e-28    
gb|ABD15860.1|  HKT1 protein                                            122   7e-28    
gb|ABD15877.1|  HKT1 protein                                            122   8e-28    
gb|AAY33529.1|  HKT1                                                    122   1e-27    
gb|AAY33513.1|  HKT1                                                    122   1e-27    
gb|ABD15851.1|  HKT1 protein                                            122   1e-27    
emb|CDP16112.1|  unnamed protein product                              92.0    2e-27    
gb|AAY33514.1|  HKT1                                                    121   2e-27    
gb|ABD15852.1|  HKT1 protein                                            118   3e-26    
gb|AAL48250.1|AF450299_1  potassium transporter-like protein HKT1     92.0    2e-18    
emb|CAH66786.1|  OSIGBa0113I13.12                                     89.7    2e-16    
gb|ABG33942.1|  truncated HKT8                                        89.4    3e-16    
ref|XP_002522041.1|  conserved hypothetical protein                   89.0    4e-16    
ref|XP_003169324.1|  high-affinity potassium transporter              90.5    1e-15    
ref|XP_010240386.1|  PREDICTED: probable cation transporter HKT7      82.4    1e-15    
gb|AGT95999.1|  putative potassium ion transporter isoform 3A         89.4    3e-15    
gb|EEE61644.1|  hypothetical protein OsJ_16089                        84.7    7e-15    
ref|XP_007684988.1|  hypothetical protein COCMIDRAFT_87125            86.3    3e-14    
gb|EMD88757.1|  hypothetical protein COCHEDRAFT_1205887               85.1    5e-14    
gb|ENI05528.1|  hypothetical protein COCC4DRAFT_195409                85.1    5e-14    
gb|AGT96000.1|  putative potassium ion transporter isoform 3B         85.1    5e-14    
gb|EMS57752.1|  hypothetical protein TRIUR3_20847                     79.3    6e-14    
gb|EWZ33200.1|  hypothetical protein FOZG_12961                       84.3    8e-14    
gb|EWZ33198.1|  hypothetical protein FOZG_12961                       84.3    1e-13    
gb|EXM21554.1|  hypothetical protein FOTG_10489                       84.0    1e-13    
gb|EWZ33199.1|  hypothetical protein FOZG_12961                       84.0    1e-13    
gb|EXM21552.1|  hypothetical protein FOTG_10489                       83.6    2e-13    
ref|XP_008024280.1|  hypothetical protein SETTUDRAFT_108086           83.6    2e-13    
ref|XP_007700164.1|  hypothetical protein COCSADRAFT_142759           83.6    2e-13    
gb|EXM21553.1|  hypothetical protein FOTG_10489                       83.2    2e-13    
emb|CBI40141.3|  unnamed protein product                              78.2    2e-13    
gb|EMT69484.1|  Low-affinity potassium transport protein              83.2    3e-13    
gb|EXL92833.1|  hypothetical protein FOIG_14008                       82.0    4e-13    
gb|EXL92831.1|  hypothetical protein FOIG_14008                       82.4    4e-13    
gb|KFY66386.1|  hypothetical protein V496_02079                       82.4    5e-13    
ref|XP_384010.1|  hypothetical protein FG03834.1                      82.0    6e-13    
gb|KFY25124.1|  hypothetical protein V491_01889                       82.0    7e-13    
ref|XP_009652746.1|  low-affinity potassium transport protein         81.6    7e-13    
gb|EXL92832.1|  hypothetical protein FOIG_14008                       81.6    7e-13    
gb|EYB21683.1|  hypothetical protein FG05_03834                       81.6    8e-13    
gb|EPS25165.1|  hypothetical protein PDE_00096                        81.3    9e-13    
ref|XP_001272203.1|  cation transporter, putative                     81.3    1e-12    
gb|EWY81145.1|  hypothetical protein FOYG_15423                       80.9    1e-12    
gb|EWY81146.1|  hypothetical protein FOYG_15423                       80.9    1e-12    
gb|EWG54706.1|  hypothetical protein FVEG_12850                       80.9    1e-12    
gb|EWG54707.1|  hypothetical protein FVEG_12850                       80.5    2e-12    
ref|XP_007585645.1|  putative potassium transporter protein           80.9    2e-12    
emb|CCT75456.1|  probable potassium transporter TRK-1                 80.1    2e-12    
dbj|GAM21900.1|  hypothetical protein SAMD00019534_050750             80.1    2e-12    
gb|EWG54710.1|  hypothetical protein FVEG_12850                       79.7    2e-12    
ref|XP_003040985.1|  hypothetical protein NECHADRAFT_54501            80.1    2e-12    
gb|EGC40896.1|  potassium transporter                                 79.7    3e-12    
ref|XP_009258042.1|  hypothetical protein FPSE_06649                  79.7    3e-12    
ref|XP_004336855.1|  cation transport domain containing protein       79.7    3e-12    
gb|KFA69880.1|  hypothetical protein S40285_08952                     79.0    6e-12    
gb|EXK26841.1|  hypothetical protein FOMG_16648                       78.2    7e-12    
emb|CAE03638.1|  OSJNBa0060N03.3                                      75.9    7e-12    
ref|XP_751477.1|  potassium uptake transporter                        77.8    8e-12    
ref|XP_004356724.1|  cation transport domain containing protein       78.2    1e-11    
gb|KFY24307.1|  hypothetical protein V493_05328                       78.2    1e-11    
emb|CEJ94434.1|  hypothetical protein VHEMI09968                      77.8    1e-11    
gb|EWZ80112.1|  hypothetical protein FOWG_15751                       77.0    2e-11    
gb|EWZ80110.1|  hypothetical protein FOWG_15751                       77.0    2e-11    
gb|EXL42192.1|  hypothetical protein FOCG_15540                       76.6    2e-11    
gb|EWZ80111.1|  hypothetical protein FOWG_15751                       77.0    2e-11    
gb|EEH04864.1|  potassium transporter                                 76.6    2e-11    
gb|EWY79355.1|  hypothetical protein FOYG_17489                       77.0    3e-11    
ref|XP_007826888.1|  hypothetical protein PFICI_00116                 76.6    3e-11    
gb|KFA55205.1|  hypothetical protein S40293_09695                     76.6    3e-11    
gb|KEY71269.1|  hypothetical protein S7711_02375                      76.6    3e-11    
gb|KFA72600.1|  hypothetical protein S40288_09753                     76.6    3e-11    
gb|EXL42190.1|  hypothetical protein FOCG_15540                       76.6    3e-11    
emb|CDM32432.1|  Cation transporter                                   76.3    4e-11    
gb|EXL42191.1|  hypothetical protein FOCG_15540                       76.3    4e-11    
gb|EWY79356.1|  hypothetical protein FOYG_17489                       76.3    4e-11    
gb|EME42197.1|  hypothetical protein DOTSEDRAFT_175094                75.9    4e-11    
ref|XP_001212412.1|  hypothetical protein ATEG_03234                  75.9    4e-11    
gb|KFY57236.1|  hypothetical protein V496_06510                       75.9    5e-11    
gb|KDR75691.1|  hypothetical protein GALMADRAFT_248309                75.9    6e-11    
ref|XP_001937091.1|  potassium transport protein 1                    74.7    1e-10    
gb|EGU73726.1|  hypothetical protein FOXB_15764                       74.7    1e-10    
gb|EXL66999.1|  hypothetical protein FOPG_16855                       74.7    1e-10    
gb|EWZ78216.1|  hypothetical protein FOWG_17483                       74.7    1e-10    
ref|XP_004356062.1|  transmembrane protein                            74.7    1e-10    
gb|EPS28504.1|  hypothetical protein PDE_03450                        74.3    1e-10    
emb|CDN24623.1|  HKT protein                                          69.3    2e-10    
ref|XP_001266694.1|  cation transporter, putative                     73.6    2e-10    
gb|ELQ32851.1|  potassium transport protein                           73.9    2e-10    
ref|XP_003711229.1|  potassium transporter                            73.6    2e-10    
ref|XP_009224632.1|  hypothetical protein GGTG_08526                  73.6    3e-10    
gb|KEZ40153.1|  Low-affinity potassium transport protein              73.2    3e-10    
gb|KEQ67360.1|  TrkH-domain-containing protein                        73.2    3e-10    
gb|KEZ40099.1|  hypothetical protein SAPIO_CDS9118                    72.8    4e-10    
ref|XP_001261209.1|  cation transporter, putative                     72.8    4e-10    
gb|EHA26772.1|  hypothetical protein ASPNIDRAFT_130818                72.0    8e-10    
ref|XP_003301436.1|  hypothetical protein PTT_12924                   71.6    1e-09    
ref|XP_001816709.2|  hypothetical protein AOR_1_1304184               70.1    1e-09    
gb|EUN28407.1|  hypothetical protein COCVIDRAFT_95759                 71.6    1e-09    
ref|XP_008079101.1|  hypothetical protein GLAREA_06962                71.6    1e-09    
ref|XP_007808304.1|  cation transporter, putative                     70.9    1e-09    
emb|CAK43980.1|  unnamed protein product                              71.2    1e-09    
ref|XP_002383368.1|  potassium uptake transporter, putative           70.9    2e-09    
gb|EGE79438.1|  potassium transporter                                 70.9    2e-09    
dbj|GAA82006.1|  cation transporter                                   70.9    2e-09    
gb|EQL36316.1|  hypothetical protein BDFG_02277                       70.5    2e-09    
gb|KFG87317.1|  putative cation transporter                           70.5    2e-09    
gb|KGO74984.1|  Potassium transport protein, high-affinity            70.5    2e-09    
ref|XP_001486311.1|  hypothetical protein PGUG_01982                  70.5    3e-09    
gb|EEQ83921.1|  potassium transporter                                 70.5    3e-09    
ref|XP_001389350.2|  cation transporter                               70.5    3e-09    
gb|KID60873.1|  Potassium transport protein, high-affinity            70.5    3e-09    
gb|KEQ77523.1|  TrkH-domain-containing protein                        70.5    3e-09    
ref|XP_663240.1|  hypothetical protein AN5636.2                       70.1    3e-09    
tpe|CBF81506.1|  TPA: potassium ion transporter (Eurofung)            70.1    3e-09    
ref|XP_006689913.1|  potassium transport protein TRK1/TRK2            70.1    3e-09    
ref|XP_008713786.1|  hypothetical protein HMPREF1541_10895            70.1    4e-09    
gb|EXA34906.1|  hypothetical protein FOVG_14309                       68.2    4e-09    
gb|KHN97531.1|  Potassium transport protein, high-affinity            69.7    4e-09    
ref|XP_004344984.1|  hypothetical protein CAOG_06235                  70.1    4e-09    
gb|EDK37884.2|  hypothetical protein PGUG_01982                       70.1    4e-09    
gb|EPS29446.1|  hypothetical protein PDE_04395                        69.7    4e-09    
gb|KID88292.1|  Potassium transport protein, high-affinity            69.7    4e-09    
gb|KID82954.1|  Potassium transport protein, high-affinity            69.3    5e-09    
gb|KID65078.1|  Potassium transport protein, high-affinity            69.3    5e-09    
ref|XP_007815318.1|  cation transporter, putative                     69.3    6e-09    
ref|XP_007715845.1|  hypothetical protein COCCADRAFT_105415           69.3    6e-09    
gb|EYE95608.1|  hypothetical protein EURHEDRAFT_454926                68.9    6e-09    
ref|XP_002564680.1|  Pc22g06520                                       68.9    6e-09    
ref|XP_003174651.1|  potassium transporter 1                          68.9    7e-09    
ref|XP_004334316.1|  cation transport domain containing protein       68.9    7e-09    
gb|EXK77899.1|  hypothetical protein FOQG_17412                       68.6    9e-09    
gb|EXU95931.1|  cation transporter                                    68.6    9e-09    
ref|XP_454641.1|  hypothetical protein                                68.9    1e-08    
dbj|GAD99196.1|  potassium transporter, putative                      68.6    1e-08    
emb|CEJ03947.1|  hypothetical protein RMCBS344292_17920               68.6    1e-08    
gb|AAD30128.1|AF136181_1  potassium transporter                       68.6    1e-08    
ref|XP_002623490.1|  potassium uptake transporter                     68.2    1e-08    
gb|KEQ93948.1|  hypothetical protein AUEXF2481DRAFT_6515              68.2    1e-08    
gb|KID94353.1|  Potassium transport protein, high-affinity            67.8    1e-08    
gb|EYE98881.1|  putative cation transporter                           67.8    1e-08    
gb|KID75485.1|  Potassium transport protein, high-affinity            67.8    2e-08    
gb|EXL75584.1|  hypothetical protein FOPG_09432                       67.8    2e-08    
gb|EXK82424.1|  hypothetical protein FOQG_13293                       67.8    2e-08    
gb|KEQ82898.1|  TrkH-domain-containing protein                        67.8    2e-08    
gb|EGU87904.1|  hypothetical protein FOXB_01590                       67.4    2e-08    
gb|KID68907.1|  Potassium transport protein, high-affinity            67.0    3e-08    
gb|EZF16275.1|  hypothetical protein H100_05737                       65.9    3e-08    
ref|XP_001268643.1|  cation transporter, putative                     66.2    5e-08    
gb|EPS29239.1|  hypothetical protein PDE_04188                        66.2    6e-08    
emb|CAZ65445.1|  HKT1 protein                                         62.8    6e-08    
gb|KGO40604.1|  Potassium transport protein, high-affinity            65.9    6e-08    
gb|KHC43824.1|  trk family potassium uptake protein                   66.2    7e-08    
ref|XP_003236392.1|  potassium transporter                            65.5    8e-08    
gb|KFZ24359.1|  hypothetical protein V502_01153                       65.5    8e-08    
ref|XP_002545572.1|  hypothetical protein CTRG_00353                  65.9    8e-08    
gb|EKG18257.1|  Cation transporter                                    65.5    9e-08    
ref|XP_001275106.1|  cation transporter, putative                     65.1    1e-07    
ref|XP_007373604.1|  hypothetical protein SPAPADRAFT_59429            64.3    1e-07    
ref|XP_007601161.1|  low-affinity potassium transport protein         64.7    1e-07    
emb|CAZ65439.1|  HKT1 protein                                         61.6    1e-07    
dbj|BAO41327.1|  low-affinity potassium transport protein             65.1    2e-07    
ref|XP_007881415.1|  hypothetical protein PFL1_05689                  65.1    2e-07    
gb|KID97792.1|  Cation transporter                                    63.2    2e-07    
gb|AGT95997.1|  putative potassium ion transporter isoform 2A         64.3    2e-07    
ref|XP_004356725.1|  cation transport domain containing protein       64.3    2e-07    
gb|KID81704.1|  Cation transporter                                    64.3    2e-07    
emb|CEJ01570.1|  hypothetical protein RMCBS344292_15593               64.7    2e-07    
emb|CEG68999.1|  hypothetical protein RMATCC62417_05151               64.3    2e-07    
gb|KGU01515.1|  trk family potassium uptake protein                   64.7    2e-07    
gb|KGR05685.1|  trk family potassium uptake protein                   64.7    2e-07    
dbj|BAE61404.1|  unnamed protein product                              64.3    2e-07    
gb|EGD93592.1|  potassium transporter                                 64.3    2e-07    
gb|KGU18230.1|  trk family potassium uptake protein                   64.3    2e-07    
gb|KEI37607.1|  hypothetical protein L969DRAFT_96134                  64.7    2e-07    
gb|KHC44500.1|  trk family potassium uptake protein                   64.3    2e-07    
gb|KGU01785.1|  trk family potassium uptake protein                   64.3    2e-07    
gb|KGU01026.1|  trk family potassium uptake protein                   64.3    2e-07    
gb|KGQ81193.1|  trk family potassium uptake protein                   64.3    2e-07    
gb|KGQ80972.1|  trk family potassium uptake protein                   64.3    2e-07    
emb|CAZ65437.1|  HKT1 protein                                         61.2    2e-07    
gb|KHC70651.1|  trk family potassium uptake protein                   64.3    2e-07    
gb|EEQ43839.1|  conserved hypothetical protein                        64.3    2e-07    
dbj|GAA99709.1|  hypothetical protein E5Q_06412                       64.7    2e-07    
gb|KHC64350.1|  trk family potassium uptake protein                   64.3    2e-07    
gb|AAF72203.1|AF267125_1  potassium transporter Trk1p                 64.3    2e-07    



>ref|XP_007014476.1| Sodium transporter hkt1-like protein, putative [Theobroma cacao]
 gb|EOY32095.1| Sodium transporter hkt1-like protein, putative [Theobroma cacao]
Length=546

 Score =   462 bits (1188),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 288/521 (55%), Positives = 375/521 (72%), Gaps = 13/521 (2%)
 Frame = -1

Query  1710  RNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvffta  1531
             ++ H ++ S+ R L  ++NPF ++L+YFIVLSLIG+ AL ++KP+  SF+ K++DVFFT+
Sbjct  27    QSYHGVISSSSRFLLLKLNPFWVQLAYFIVLSLIGYGALNIAKPKTDSFRPKNIDVFFTS  86

Query  1530  vssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTER------  1369
             VS+ATVSSMSTVEMEVFSN QL+ MT LM +GGE F S LGL   +S+    +       
Sbjct  87    VSAATVSSMSTVEMEVFSNTQLIIMTTLMLIGGEVFVSMLGLLLARSRFPKKQHPENNIT  146

Query  1368  --VLEKNKVI---VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLA  1204
                +  N +    +   +E G  + +   ND  P+   +S++++  + D       R L 
Sbjct  147   FFSIPNNSLTSKSITHQIEFGTDSCSTVEND-KPDSDLESDIKLSSMTDSLQYSASRYLC  205

Query  1203  RvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTN  1024
              VVL Y++V+H+ G +LV+MY+  VP+A+ +LK K + + TF++FT VSTF+NCGFVPTN
Sbjct  206   YVVLGYLLVVHIGGSSLVSMYVSLVPSARNILKTKAIQIQTFSIFTVVSTFANCGFVPTN  265

Query  1023  ENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYG  844
             ENMI+FK+N GLLL+LIPQILLGNTLYPACLR+ IW L K T+R+E   IL +   +GY 
Sbjct  266   ENMIIFKKNSGLLLLLIPQILLGNTLYPACLRVLIWLLEKITKRVELGCILKNYKEMGYS  325

Query  843   HLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGE  664
             HL SG     LAATVFG I +QL +F ++EW S+A+ GL+ Y+K VGSLF VVNSRHTGE
Sbjct  326   HLLSGVHCSLLAATVFGFILVQLILFCSMEWNSEAMDGLSSYQKFVGSLFEVVNSRHTGE  385

Query  663   SIldlsllapavlalivVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFNIIEKILLSPL  487
             SI+DLS ++ A+L L VVMMYLPP T+  P    E N+ K +       +I+E +L S L
Sbjct  386   SIVDLSTISSAILVLFVVMMYLPPYTSLLPTAYQEKNSGKGQASENHGRSILECLLFSQL  445

Query  486   GNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCK  307
               L+IFIILICITEREK+K+DPLNFNVL+I +EVISAYGNVGFSTGYSC RQ+KPE  C 
Sbjct  446   SYLAIFIILICITEREKIKKDPLNFNVLSIAIEVISAYGNVGFSTGYSCKRQVKPESSCI  505

Query  306   DKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             D   GFVGRWSNMGK IL++VMFFGRLKK+HMKGGKAWKLS
Sbjct  506   DTWAGFVGRWSNMGKLILVVVMFFGRLKKFHMKGGKAWKLS  546



>ref|XP_002325229.1| sodium transporter family protein [Populus trichocarpa]
 gb|EEF03794.1| sodium transporter family protein [Populus trichocarpa]
Length=506

 Score =   450 bits (1158),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 291/513 (57%), Positives = 374/513 (73%), Gaps = 24/513 (5%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvss  1507
             S +R L F+++PF ++L+YF++LSL+G  ALKVSKPRP S +   LD+FFT+VSSATVSS
Sbjct  6     SFLRVLVFQIHPFWVQLAYFVILSLVGHMALKVSKPRPGSLRPASLDIFFTSVSSATVSS  65

Query  1506  mstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH--  1333
             MSTVEMEVFSN QL+ MT LM LGGE FTS LGL+  + K S  E   ++++V  + H  
Sbjct  66    MSTVEMEVFSNTQLIIMTILMLLGGEVFTSILGLYLSRFKFSKHET--KESRVSSVYHNP  123

Query  1332  --------VELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivv  1177
                     +E+   TN +   +LN  D+  S      +  +K L CV +       Y  V
Sbjct  124   PKRTNFPGLEIEKPTNVDLECNLNSLDNDHS----LKLNSLKSLACVAL------GYFSV  173

Query  1176  ihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRN  997
             +H+ G +LVAMY   VP+A+QVL  KG+ + TF+VFTTVSTFSNCGFVPTNENM+ FK+N
Sbjct  174   VHITGSSLVAMYTSLVPSARQVLGSKGIKIQTFSVFTTVSTFSNCGFVPTNENMVAFKKN  233

Query  996   PGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSG  817
              GLLLILIPQILLGNTLYP+CLR  IW L K TR++EFR IL +   +GYGHL S   S 
Sbjct  234   SGLLLILIPQILLGNTLYPSCLRFLIWILEKITRKVEFRYILMNTREMGYGHLLSFSHSC  293

Query  816   FLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlslla  637
              LA TV G I +Q  +F ++EW S A  GL  Y+K++G+LF VVNSRHTGESI+DLS+++
Sbjct  294   LLAITVSGFILVQFILFCSMEWNSGAKDGLNPYQKLMGALFQVVNSRHTGESIVDLSIIS  353

Query  636   pavlalivVMMYLPPDTTFFP--IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFII  463
             PA+L L VVMMYLPP T+F P    +E ++   + C  ++ ++++ +L SPL  L+IF+I
Sbjct  354   PAILVLFVVMMYLPPYTSFMPKKQQEEVDSETGQKCKNQRKSLVQCLLFSPLSTLAIFVI  413

Query  462   LICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVG  283
             LIC++EREK+K+DPLNFNVLNI +EV+SAYGNVGFSTGYSC RQ++P+  CKD  FGFVG
Sbjct  414   LICVSEREKLKKDPLNFNVLNITIEVVSAYGNVGFSTGYSCKRQLEPDSSCKDAWFGFVG  473

Query  282   RWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             RWSNMGKFILI+VMFFGRLKK+ + GGKAWKLS
Sbjct  474   RWSNMGKFILILVMFFGRLKKFSINGGKAWKLS  506



>ref|XP_011017751.1| PREDICTED: sodium transporter HKT1-like [Populus euphratica]
Length=535

 Score =   447 bits (1150),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 286/515 (56%), Positives = 375/515 (73%), Gaps = 24/515 (5%)
 Frame = -1

Query  1692  MMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatv  1513
             + S +R LAF+++PF ++L+YF++LSL+G  ALKVS+PRP S +   LD+FFT+VSSATV
Sbjct  33    IQSFLRVLAFQIHPFWVQLTYFVILSLVGHMALKVSEPRPGSLRPASLDIFFTSVSSATV  92

Query  1512  ssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH  1333
             SSMSTVEMEVFSN QL+ MT LM LGGE FTS LGL+  + K S  E   ++++V+ + H
Sbjct  93    SSMSTVEMEVFSNTQLIIMTILMLLGGEVFTSILGLYLSRVKFSKLET--KESRVLSVYH  150

Query  1332  ----------VELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyi  1183
                       +E+    N +   +LN  D    N     +  +K L CV +       Y 
Sbjct  151   NPPKRTNFPGLEIEKPANVDLEYNLNSLD----NDHSLKLSSLKSLACVAL------GYF  200

Query  1182  vvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFK  1003
              V+H+ G +LVAMY   VP+A+QVL  KG+ + TF+VFTTVSTFS+CGFVPTNENM+ FK
Sbjct  201   SVVHITGSSLVAMYTSLVPSARQVLGSKGIKIQTFSVFTTVSTFSSCGFVPTNENMVAFK  260

Query  1002  RNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRR  823
             +NPGLLLILIPQ+LLGNTLYP+CLR  IW L K TR++EFR IL +   +GYGHL S   
Sbjct  261   KNPGLLLILIPQVLLGNTLYPSCLRFLIWILEKITRKVEFRYILMNTREMGYGHLLSFSH  320

Query  822   SGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsl  643
             S  LA TV G I +Q  +F ++EW S A+ GL  Y+K +G+LF VVNSRHTGESI+DLS+
Sbjct  321   SCLLAITVSGFILVQFILFCSMEWNSGAMDGLNPYQKFMGALFQVVNSRHTGESIVDLSI  380

Query  642   lapavlalivVMMYLPPDTTFFPI--MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIF  469
             ++PA+L L V+MMYLPP T+  PI   +E ++   + C  ++ +++  +L SPL  L+IF
Sbjct  381   ISPAILVLFVIMMYLPPCTSLMPIKQQEEVDSETGQKCKNQRKSLVHCLLFSPLSTLAIF  440

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             +IL+C++EREK+K+DPLNFNVLNI +EV+SAYGNVGFSTGYSC RQ++P+  C+D  FGF
Sbjct  441   VILVCVSEREKLKKDPLNFNVLNITIEVVSAYGNVGFSTGYSCKRQLEPDSSCRDAWFGF  500

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             VGRWSNMGKFILI+VMFFGRLKK+ + GGKAWKLS
Sbjct  501   VGRWSNMGKFILILVMFFGRLKKFSINGGKAWKLS  535



>ref|XP_006474646.1| PREDICTED: probable cation transporter HKT6-like [Citrus sinensis]
Length=542

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 296/530 (56%), Positives = 364/530 (69%), Gaps = 39/530 (7%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISF-KLKDLDvfftavssa  1519
             + +S++R L  +VNP  ++LSYFI +S +G+  L+VSKPR  SF   K++DVFFT+VS+ 
Sbjct  26    LFLSSIRFLVLKVNPLWIQLSYFISISSVGYLILRVSKPRDSSFINPKNIDVFFTSVSAM  85

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLE-------  1360
             T SSMSTVEMEVFSN QL+ MT LMF+GGE F S  GLH  +SK  +  ++ E       
Sbjct  86    TGSSMSTVEMEVFSNFQLIIMTILMFVGGEVFISMFGLHA-RSKFYSLNQLFENRINPNL  144

Query  1359  -------------KNKVIVIDHVELGLV-----TNNEYHNDLNPEDSAKSNVQIEVVEDI  1234
                          +N     D +ELG+V     TN E +N L  E    SN      +D 
Sbjct  145   TPSSSSSSSSSSSENSTEFTDQIELGIVSHSYITNEEPNNGLENEHRMSSN------DDN  198

Query  1233  KLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvst  1054
                  VRVL  VVL YI+V HVVG +LVA+Y    P+AKQ+LKQKGL + TF+VFTT ST
Sbjct  199   LKYNSVRVLVYVVLGYILVTHVVGSSLVALYTSLAPSAKQILKQKGLQIFTFSVFTTAST  258

Query  1053  fSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQI  874
             FSNCGFVPTNENM+VFK+N  LLLIL PQ LLGNTLYP+CLR  IW L K T R EF  I
Sbjct  259   FSNCGFVPTNENMMVFKKNALLLLILFPQGLLGNTLYPSCLRFVIWVLKKITNREEFDYI  318

Query  873   LGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLF  694
             L +   + Y HL S   S FLA TVFG IF+QL +F ALEW S+A  GL  +EK+V SLF
Sbjct  319   LRNSKEMIYRHLLSKAYSYFLAITVFGFIFVQLVLFCALEWDSEATDGLNFFEKLVASLF  378

Query  693   VVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNI  514
              VVNSRHTGES+ D+S+++PA+L L VVMMYLPP T F P    + N K K    K F  
Sbjct  379   QVVNSRHTGESVFDISIVSPAILVLFVVMMYLPPYTAFLP----SRNCKEKKNKKKTF--  432

Query  513   IEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR  334
             ++  + S L  L IFIIL+C TER+KMK+DPLNFNVLN+ +EVISAYGNVGFSTGYSC R
Sbjct  433   VQNFIFSQLSYLVIFIILVCTTERDKMKKDPLNFNVLNVTIEVISAYGNVGFSTGYSCKR  492

Query  333   QIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             Q++P+  CKD  +GFVGRWSN GK ILI+VMFFGR+KK++MKGGKAW++S
Sbjct  493   QLRPDSSCKDAWYGFVGRWSNQGKVILILVMFFGRIKKFNMKGGKAWQIS  542



>ref|XP_009789271.1| PREDICTED: sodium transporter HKT1-like [Nicotiana sylvestris]
Length=519

 Score =   429 bits (1103),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 290/501 (58%), Positives = 361/501 (72%), Gaps = 18/501 (4%)
 Frame = -1

Query  1659  VNPFLLELSYFIVLSLIGFFALKVSKPRPI-SFKLKDLDvfftavssatvssmstVEMEV  1483
             V PF +ELSYF++LSL+GF AL VSKPR + SF+ ++LDVFFT+VS+ATVSSMSTVEMEV
Sbjct  26    VKPFWIELSYFMILSLLGFLALTVSKPRTLPSFRPQNLDVFFTSVSAATVSSMSTVEMEV  85

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNE  1303
             FSN QLVF+T LMFLGGE FTS+L L   +SK+ST + VL+       + +E    T N 
Sbjct  86    FSNAQLVFITILMFLGGEAFTSFLRLQLMKSKISTEKAVLQ-------NKIESSNSTRNS  138

Query  1302  YHN---DLNPEDSAKSNVQIEVVED---IKLLGCVRVLARvvlsyivvihvVGFTLVAMY  1141
              H+       ED+   +  I  +ED   I  L  +R L+ VV  YI+ + VVG +LV++Y
Sbjct  139   IHHLEQGHGKEDNNLEHAIINSMEDSEAIVKLKSLRFLSYVVFGYILCVVVVGSSLVSIY  198

Query  1140  IGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqil  961
             I  +P+AKQVL +KGL+L TF++FTTVSTF+NCG VPTNENM+VFK+N GLLLILIPQIL
Sbjct  199   ISIIPSAKQVLIEKGLNLHTFSLFTTVSTFANCGLVPTNENMMVFKKNSGLLLILIPQIL  258

Query  960   LGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFL  781
             LGNTLY  CLRLAIWFL K T+R EF  I+ +   +GY H+F    +  +  TV G I +
Sbjct  259   LGNTLYAPCLRLAIWFLWKITKRGEFEYIMKNSKRVGYSHIFPNLETMAILTTVLGFISI  318

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
             Q  VF +LEW S+AIAG++ YEK+VG+LF VVN+RHTGES+ DLS L PAVL L  +MMY
Sbjct  319   QFVVFCSLEWNSEAIAGMSSYEKLVGALFEVVNTRHTGESVFDLSTLTPAVLVLFALMMY  378

Query  600   LPPDTTFFPIMDENN---NSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMK  430
             L   T+F P+ D N     +  +    K  +++E I  S L  L IF ILICITER+KMK
Sbjct  379   LSSYTSFLPV-DSNEECLETTERMNRRKGSSLVEYISFSQLNYLVIFTILICITERDKMK  437

Query  429   EDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILI  250
              DPLNFNVL+IV EVISAYG VG S GYSCARQ+KP+  CKD  +GF G+WSNMGKFILI
Sbjct  438   NDPLNFNVLSIVFEVISAYGTVGMSMGYSCARQLKPDHHCKDAAYGFAGKWSNMGKFILI  497

Query  249   IVMFFGRLKKYHMKGGKAWKL  187
             IVMFFGRLK+Y  +GGK WK+
Sbjct  498   IVMFFGRLKQYSKRGGKGWKV  518



>ref|XP_006474312.1| PREDICTED: probable cation transporter HKT6-like [Citrus sinensis]
Length=523

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 287/516 (56%), Positives = 357/516 (69%), Gaps = 12/516 (2%)
 Frame = -1

Query  1707  NKHTMMMSTVRRLAFR--VNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfft  1534
              K +  MST   LA +  +NP +L L YF  LSL+G+F L V+KPR  S   K  DVFFT
Sbjct  12    TKISCFMSTFIFLAVKYIMNPLMLHLCYFTALSLLGYFLLSVTKPRTHSTTPKTFDVFFT  71

Query  1533  avssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL---  1363
             +VS+AT SSM TVEMEVFSN QL+ MT LM  GGE F S L L F +SK+      L   
Sbjct  72    SVSAATDSSMGTVEMEVFSNCQLIIMTILMLAGGEVFMSMLELFFIKSKLPKHNDHLLIT  131

Query  1362  -EKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsy  1186
                     ++ +EL  +  +E  + ++ ++    N    +++       +R L  VVL Y
Sbjct  132   PSSKPTKSVEQIELNSICCSEKTDHISFDNKNNKNNNNTILKH----NSIRYLCYVVLGY  187

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
              +++HV G  LV  YI  +P+AK VL+QKGL   TF++FT VSTFSNCGFVPTNENMIVF
Sbjct  188   FLIVHVGGSCLVLWYISLIPSAKHVLEQKGLQAETFSLFTIVSTFSNCGFVPTNENMIVF  247

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
             K N GLLL+LIPQ+LLGNTLYPACLR AIW L K T+R E   +L +   +GY HL S  
Sbjct  248   KENSGLLLLLIPQVLLGNTLYPACLRFAIWVLKKITKREECDYLLKNYREIGYDHLLSRS  307

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
             RS FLA TVFG I +QL +F +LEW S+A+  L  Y+K+V SLF VVNSRHTGES+LDLS
Sbjct  308   RSCFLAITVFGFIIVQLVIFCSLEWNSEAMDDLNFYQKLVASLFEVVNSRHTGESVLDLS  367

Query  645   llapavlalivVMMYLPPDTTFFPI--MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSI  472
             +++PA+L L VVMMYLPP T+F P    DE ++   K    +  +++E +  S L  L+I
Sbjct  368   IISPAILVLFVVMMYLPPYTSFLPTRNCDEGDSKNCKEKEKETKSLLECLAFSQLSYLAI  427

Query  471   FIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFG  292
             FIILICITER KMK+DPLNFNVL+I +EVISAYGNVGFSTGYSC RQ+KPE  CKDK FG
Sbjct  428   FIILICITERHKMKQDPLNFNVLSITIEVISAYGNVGFSTGYSCERQLKPEISCKDKWFG  487

Query  291   FVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              VG+WSN GK ILI+VMFFGR+KK++MKGGKAWKLS
Sbjct  488   LVGKWSNGGKLILILVMFFGRIKKFNMKGGKAWKLS  523



>ref|XP_011094146.1| PREDICTED: sodium transporter HKT1-like [Sesamum indicum]
Length=541

 Score =   427 bits (1097),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 279/519 (54%), Positives = 360/519 (69%), Gaps = 27/519 (5%)
 Frame = -1

Query  1701  HTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPIS-FKLKDLDvfftavs  1525
             H  + + ++ L F+VN F +EL YF+ LS +GF AL  S PR  + FK K +D+FFT+VS
Sbjct  31    HGSLRTLLQILFFQVNSFWIELGYFLTLSSLGFLALNASNPRTTTTFKPKYIDLFFTSVS  90

Query  1524  satvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVI  1345
             ++TVSSMSTVEMEVFSN QLV +T LM +GGE FTS LGLH  ++K+   +  L  ++ +
Sbjct  91    ASTVSSMSTVEMEVFSNTQLVLLTILMLVGGEVFTSMLGLHLIRAKIYLQKNGLITHRTV  150

Query  1344  V-------------IDHVELGLVTN-NEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVL  1207
                            DH+EL + T   +  +D  P ++   N+  +          +++L
Sbjct  151   SDSSISSDPIPDSPTDHIELQMATRFRDKKSDTKPGETG-GNLNHK---------SIKIL  200

Query  1206  ARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPT  1027
             A  V  Y++V+HV G TL+++Y   +P+A++VLK KGL++ TF++FTTVSTF+NCGFVPT
Sbjct  201   AYFVACYLLVVHVAGSTLISIYFSLIPSARKVLKIKGLNMQTFSIFTTVSTFANCGFVPT  260

Query  1026  NENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGY  847
             NENM+ FK+N GLLLILIPQIL+GNTLYP CLR AIW   K +RR EFR +L +   LGY
Sbjct  261   NENMMAFKKNSGLLLILIPQILMGNTLYPVCLRSAIWAAEKMSRRAEFRYMLKNSRELGY  320

Query  846   GHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTG  667
             GHL SGR   +L  T  G + +QL  F  LEW+S+A  GL+ Y+K+VGSLF VVNSRHTG
Sbjct  321   GHLISGRHCVYLGITGVGFVIVQLVAFCLLEWKSEATGGLSAYQKLVGSLFQVVNSRHTG  380

Query  666   ESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS-PKKFNIIEKILLSP  490
             ES+ DLS ++PA+L L V MMYLPP T+F PI DE    K +G    KK  + E I+ S 
Sbjct  381   ESVFDLSAISPAILVLFVAMMYLPPYTSFLPI-DEAEEMKGEGEKWRKKKGLGEHIMFSQ  439

Query  489   LGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQC  310
             L  L IF+ILICITER KMK DPLNFNVL+IVVEV+SAYGNVGFS GYSC RQI P+G C
Sbjct  440   LTYLLIFVILICITERRKMKTDPLNFNVLSIVVEVVSAYGNVGFSVGYSCERQINPDGGC  499

Query  309   KDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAW  193
             KD  +G  GRWSN GK +LI+VM FGRLKK+ M+GG+AW
Sbjct  500   KDAWYGLAGRWSNQGKLVLILVMLFGRLKKFSMRGGRAW  538



>ref|XP_009599985.1| PREDICTED: sodium transporter HKT1 isoform X1 [Nicotiana tomentosiformis]
Length=531

 Score =   426 bits (1094),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 289/505 (57%), Positives = 362/505 (72%), Gaps = 14/505 (3%)
 Frame = -1

Query  1659  VNPFLLELSYFIVLSLIGFFALKVSKPRPI-SFKLKDLDvfftavssatvssmstVEMEV  1483
             V PF +E+SYF++LSL+G  AL +SKPR + SF+ ++LDVFFT+VS+ATVSSMSTVEMEV
Sbjct  26    VKPFWIEVSYFMILSLLGLLALTISKPRTLPSFRPQNLDVFFTSVSAATVSSMSTVEMEV  85

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID------HVELG  1321
             FSN QLVF+T LMFLGGE FTS+L L   +SK+S  + VL+              H    
Sbjct  86    FSNAQLVFITMLMFLGGEAFTSFLRLQLMKSKLSMEKTVLQNKIESSNSIISIDSHDSSN  145

Query  1320  LVTNNEYHNDL--NPEDSAKSNVQIEVVED---IKLLGCVRVLARvvlsyivvihvVGFT  1156
                N+ +H +L    EDS   +  I  +ED   I  L  +R L+ VV  YI+ + V+G +
Sbjct  146   SPRNSIHHLELGHEQEDSNLEHAIINSMEDSEAIVKLKSLRFLSYVVFGYILGVVVLGSS  205

Query  1155  LVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllil  976
             LV++Y+ F+P+AKQVLK+KGL+L TF++FTTVSTF+NCGFVPTNENM+VF++N GLLLIL
Sbjct  206   LVSIYVSFIPSAKQVLKEKGLNLHTFSLFTTVSTFANCGFVPTNENMMVFRKNSGLLLIL  265

Query  975   ipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVF  796
             IPQ+LLGNTLY  CLRL IWFL K T+R EF  I+ +   +GY H+F    +  LA TV 
Sbjct  266   IPQVLLGNTLYAPCLRLTIWFLWKITKRGEFEYIMKNSKRVGYSHIFPNLETMALATTVL  325

Query  795   GLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlali  616
             G I +Q  VF +LEW S+A AGL+ YEK+VGSLF VVN+RHTGES+ DLS L PA+L L 
Sbjct  326   GFISIQFVVFCSLEWNSEATAGLSSYEKLVGSLFEVVNTRHTGESVFDLSTLTPAILVLF  385

Query  615   vVMMYLPPDTTFFPI--MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITER  442
              VMMYL P T+F PI   +E   +  +    K  +++E +  S L  L IF ILICITER
Sbjct  386   AVMMYLSPYTSFLPIDSNEERLETTERMNRRKGSSLVEYVSFSHLSYLVIFTILICITER  445

Query  441   EKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGK  262
             +KMK DPLNFNVLNIV EVISAYG VG S GYSCARQ+KP+  CKD  +GF G+WSNMGK
Sbjct  446   DKMKNDPLNFNVLNIVFEVISAYGTVGMSMGYSCARQLKPDVHCKDAAYGFAGKWSNMGK  505

Query  261   FILIIVMFFGRLKKYHMKGGKAWKL  187
             FILIIVMFFGRLK+Y  +GGK WK+
Sbjct  506   FILIIVMFFGRLKQYCKRGGKGWKV  530



>ref|XP_002270986.1| PREDICTED: sodium transporter HKT1 [Vitis vinifera]
Length=544

 Score =   424 bits (1091),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 282/542 (52%), Positives = 365/542 (67%), Gaps = 25/542 (5%)
 Frame = -1

Query  1740  PSAFTPPISLRNKHTMMMSTVRR------------LAFRVNPFLLELSYFIVLSLIGFFA  1597
             P     P+ + N+ +  +S +++            LAF+V+PF  +L YFI +SL+G+ A
Sbjct  5     PCFARKPVDVFNRSSTKLSCLQQSFRGLFSSLFYFLAFQVSPFWNQLGYFITVSLLGYMA  64

Query  1596  LKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTS  1417
             LKVSKP+  SF   D+DVFFT+VS++TVSSMS VEMEVFS+ QLV MT LM +GGE FTS
Sbjct  65    LKVSKPKTTSFMPSDVDVFFTSVSASTVSSMSAVEMEVFSDTQLVIMTVLMLVGGEIFTS  124

Query  1416  WLGLHFFQSKVSTTERVLEK-----------NKVIVIDHVELGLVTNNEYHNDLNPEDSA  1270
              LGL F +SK +       K           N  I  D +ELGLVT  +  N+  P  + 
Sbjct  125   MLGLQFVRSKYTRKANRENKAHLASIDYKSPNSKISFDQIELGLVTLPQAQNE-QPCSNL  183

Query  1269  KSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLD  1090
             +  ++    ED+K    ++ L  VVL Y++V+HVVG  L+ +Y+  VP+A++VLK KGL 
Sbjct  184   EKGIEASCDEDLKY-HSIKCLGYVVLFYLLVVHVVGSALIVLYLNLVPSAREVLKNKGLR  242

Query  1089  LttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFL  910
             + TF+VFT VSTFSNCGF+PTNENM+VFK+N GLLLILIPQILLGNTL+  CLR  IW L
Sbjct  243   ILTFSVFTVVSTFSNCGFIPTNENMVVFKKNSGLLLILIPQILLGNTLFAPCLRFVIWVL  302

Query  909   GKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAG  730
              K TRR+EF  +L +   + Y HL  G  S  LA TVFG I +Q  +   +EW S+ +AG
Sbjct  303   VKITRRVEFNYMLKNSREISYDHLLPGLYSCLLAITVFGFILVQFLLLCFMEWNSEDLAG  362

Query  729   LTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNS  550
             L  Y+K+VG LF   NSRH+GESI DLS+++PAVL L V+MMYLPP T+F PI       
Sbjct  363   LNAYQKIVGMLFQTANSRHSGESIFDLSVISPAVLVLFVLMMYLPPHTSFLPIDGGEKAL  422

Query  549   KTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYG  370
             + +    +K   +E +LLS L  L IF+IL+CI EREKMK+DPLNF+VLNI +E++SAYG
Sbjct  423   QKEERRTEKRKYVEHLLLSQLSYLVIFVILVCIIEREKMKKDPLNFSVLNITIEIVSAYG  482

Query  369   NVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWK  190
             NVGFS GY C  Q+K E  CKD  +GFVGRWSN GKF+L+ VMFFGRLKK+ M GG+AWK
Sbjct  483   NVGFSAGYQCNLQLKHEPHCKDLCYGFVGRWSNSGKFVLMFVMFFGRLKKFSMHGGRAWK  542

Query  189   LS  184
             L 
Sbjct  543   LD  544



>ref|XP_006592483.1| PREDICTED: cation transporter HKT8-like [Glycine max]
Length=561

 Score =   419 bits (1076),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 273/540 (51%), Positives = 356/540 (66%), Gaps = 48/540 (9%)
 Frame = -1

Query  1680  VRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssms  1501
             VR LAF V+PF ++L YF++LSL+G+  LK SKPR    +  DLD+F+T+VS++TVSSM 
Sbjct  29    VRFLAFHVHPFFIQLCYFVILSLLGYLGLKASKPR-TPLRPNDLDLFYTSVSASTVSSMV  87

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHF--------FQSKVSTTERVLEKNKVI  1345
              VEMEVFSN QL+ +T LMF+GGE FTS L L F         Q+KVST    L + ++ 
Sbjct  88    AVEMEVFSNSQLILLTLLMFVGGEVFTSMLDLVFARYKFTRSVQNKVSTNHSYLTRTRLP  147

Query  1344  VID--------------------------HVELGLVT--NNEYHNDLNPEDSAKSNVQIE  1249
              +D                           +ELGLV+  ++E  N   P DS  +NV   
Sbjct  148   PVDDTSGLDQIFFSSNPFLSTKKPSINANQIELGLVSIHHSESENH-KPSDSNNTNVPKG  206

Query  1248  VV-----EDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLt  1084
              V      D     C+  L  +VL Y+VV+  VGF+ V++YI  VP+A+QVLK KG+ + 
Sbjct  207   TVVSFNDSDRLKYNCLSYLTYLVLGYLVVVQFVGFSSVSLYITLVPSARQVLKNKGIKIA  266

Query  1083  tfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGK  904
             TF++FT VSTF++CGF+PTNENM+VFK+N GLLL+++P ILLGNTLYP CLRL I  L +
Sbjct  267   TFSLFTIVSTFASCGFIPTNENMMVFKKNSGLLLLVLPHILLGNTLYPPCLRLVIMVLER  326

Query  903   TTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLT  724
              T+R E+  +L +   +GY H+ S      L ATV G   +Q  +  ++EW +  + GL 
Sbjct  327   ITKREEYSHLLKNFKDVGYDHMLSALHCCLLVATVLGFNLIQFVMLCSMEWNTKIMEGLN  386

Query  723   GYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKT  544
              YEKVV SLF V N+RH GES+ DLS ++  +L L VVMMYLPP TTF P+ +  N++K 
Sbjct  387   VYEKVVASLFQVTNARHAGESVFDLSSISSVILVLFVVMMYLPPYTTFLPVREHENDAKR  446

Query  543   KGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNV  364
                S     ++E ++ S L  L IFIILICITE + ++EDPLNFNVLNI +EVISAYGNV
Sbjct  447   SEKS-----VLECLVFSQLSYLVIFIILICITESKSLREDPLNFNVLNITLEVISAYGNV  501

Query  363   GFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             GFSTGYSCARQ+KP+  CKD   GF GRWS+ GKFILI+VMFFGRLKK++MKGGKAW LS
Sbjct  502   GFSTGYSCARQLKPDATCKDSWVGFSGRWSSKGKFILILVMFFGRLKKFNMKGGKAWDLS  561



>ref|XP_007226668.1| hypothetical protein PRUPE_ppa021550mg [Prunus persica]
 gb|EMJ27867.1| hypothetical protein PRUPE_ppa021550mg [Prunus persica]
Length=513

 Score =   416 bits (1070),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 286/515 (56%), Positives = 363/515 (70%), Gaps = 21/515 (4%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvss  1507
             S  R L F  NPF ++L YF++LSL+G+ AL  +KPR  + + KD DVFFT+VS+ TVSS
Sbjct  6     SIFRVLLFHANPFYVQLVYFVMLSLLGYLALIFTKPR--TTRPKDADVFFTSVSATTVSS  63

Query  1506  mstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV----------STTERVLEK  1357
             MS VEMEVFSN  L+ +T LM LGGE FTS LGL F +SK+          S  + V  K
Sbjct  64    MSVVEMEVFSNTHLIILTILMLLGGEVFTSMLGLLFTKSKIIPKFHDHQTDSRIDVVNTK  123

Query  1356  NKV--IVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIK-LLGCVRVLARvvlsy  1186
             N       D +ELGL T    H+ L  E     N  I+ + +I      +R L  VVL Y
Sbjct  124   NHFPDSNADQIELGLAT----HSHLENEKPQIIN-HIDGMNNINNKYNSIRFLGYVVLGY  178

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
             ++V+H+ G  LV++Y   VP+A+ VL++KG+++ TFAVFTTVSTFSNCGFVPTNENMIVF
Sbjct  179   LLVVHIGGSILVSLYFTLVPSARHVLEKKGIEIPTFAVFTTVSTFSNCGFVPTNENMIVF  238

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
             K N GLLL+L+PQ+LLGNTLYPACLR  IW L K T+R+EF  +L +   +GY H+ S  
Sbjct  239   KNNSGLLLLLLPQLLLGNTLYPACLRFLIWVLEKITKRVEFSYMLKNYKDMGYSHMLSSL  298

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
             RS  LA TV G I +Q+T+F A+EW+S+A+ GLT Y+K V S+F  +NSRH GES++DLS
Sbjct  299   RSFLLAITVLGFIVVQVTLFCAMEWKSEAMDGLTAYQKFVASIFQTMNSRHAGESVIDLS  358

Query  645   llapavlalivVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFNIIEKILLSPLGNLSIF  469
             +++PA+L L VVMMYLPP TTF P   D  +++  KG    +  ++E ++ S L  L++F
Sbjct  359   VISPAILVLFVVMMYLPPYTTFLPTTSDCEDSASAKGIPNPRKTLVESLIFSQLSYLAMF  418

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             IILICITEREKMKEDPLNF+VLN+++EVISAYGNVGFSTGYSC R++K EG CKD   GF
Sbjct  419   IILICITEREKMKEDPLNFSVLNVIIEVISAYGNVGFSTGYSCKRRLKHEGDCKDAWAGF  478

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GRWS  GKFILI VMFFGRLK +  K GKAWKLS
Sbjct  479   SGRWSTQGKFILITVMFFGRLKSFSTKHGKAWKLS  513



>emb|CDP16110.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   413 bits (1061),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 251/453 (55%), Positives = 316/453 (70%), Gaps = 18/453 (4%)
 Frame = -1

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK----VSTTERVLEKNKVIV-----  1342
             EMEVFSN QL+ +T  MFLGGE FTS LGL   + K    +  TE  +++          
Sbjct  5     EMEVFSNAQLILLTIFMFLGGEVFTSLLGLQLMKFKRSHQIQKTENKIDRFSTDADCSTS  64

Query  1341  -----IDHVELGLVTNNE-YHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyiv  1180
                   D +ELG+ + ++   ND  P+   +S +  +  E I       +LA  +L Y++
Sbjct  65    IPTNAFDQIELGVTSQDQQLGNDQKPDSIPESRISFQAQESIN--RASDLLAFSILCYLL  122

Query  1179  vihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKR  1000
             V+H++G   +++Y   +P+A +VL++KGL+L TF+VFTTVSTF+NCGFVPTNENM+VFK+
Sbjct  123   VVHLLGSVSISIYNNTIPSANEVLRKKGLNLITFSVFTTVSTFANCGFVPTNENMMVFKK  182

Query  999   NPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRS  820
             N GLLLI+ PQ+LLGNTLYPACLR  IWFL K T+R EF  +L +P  LGY HLFS   S
Sbjct  183   NSGLLLIIFPQLLLGNTLYPACLRYFIWFLSKITKRSEFADLLKNPRALGYDHLFSDLHS  242

Query  819   GFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsll  640
              FLA TVFG I  Q  +F  LEW S A AGLT YEK+VGSLF VVNSRH GES+ DLSL+
Sbjct  243   IFLAITVFGFILAQFVLFCLLEWHSGATAGLTAYEKLVGSLFQVVNSRHAGESVFDLSLI  302

Query  639   apavlalivVMMYLPPDTTFFPIMDENNNSKT-KGCSPKKFNIIEKILLSPLGNLSIFII  463
              PA++ L V+MMYLPP T+F PI D      T K    K+ NI++ +L S L  + +F+I
Sbjct  303   TPAIIVLFVLMMYLPPYTSFLPIKDGKCFPATEKKTRAKRKNILDYLLFSQLTYIVLFVI  362

Query  462   LICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVG  283
             LICITEREK+KEDPLNFN+L+IVVEVIS YGNVGFS GYSC RQ+KP   CKD  +GF G
Sbjct  363   LICITEREKLKEDPLNFNLLSIVVEVISGYGNVGFSMGYSCGRQLKPSNNCKDASYGFAG  422

Query  282   RWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             +WS  GKFILIIVMFFGRLKK++ KGGKAW+LS
Sbjct  423   KWSTQGKFILIIVMFFGRLKKFNTKGGKAWRLS  455



>gb|KHN15418.1| Sodium transporter HKT1 [Glycine soja]
Length=561

 Score =   416 bits (1069),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 272/540 (50%), Positives = 355/540 (66%), Gaps = 48/540 (9%)
 Frame = -1

Query  1680  VRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssms  1501
             VR LAF V+PF ++L YF++LSL+G+  LK SKPR    +  DLD+F+T+VS++TVSSM 
Sbjct  29    VRFLAFHVHPFFIQLCYFVILSLLGYLGLKASKPR-TPLRPNDLDLFYTSVSASTVSSMV  87

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHF--------FQSKVSTTERVLEKNKVI  1345
              VEMEV SN QL+ +T LMF+GGE FTS L L F         Q+KVST    L + ++ 
Sbjct  88    AVEMEVVSNSQLILLTLLMFVGGEVFTSMLDLVFARYKFTRSVQNKVSTNHSYLTRTRLP  147

Query  1344  VID--------------------------HVELGLVT--NNEYHNDLNPEDSAKSNVQIE  1249
              +D                           +ELGLV+  ++E  N   P DS  +NV   
Sbjct  148   PVDDTSGLDQIFFSSNPFLSTKKPSINANQIELGLVSIHHSESENH-KPSDSNNTNVPKG  206

Query  1248  VV-----EDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLt  1084
              V      D     C+  L  +VL Y+VV+  VGF+ V++YI  VP+A+QVLK KG+ + 
Sbjct  207   TVVSFNDSDRLKYNCLSYLTYLVLGYLVVVQFVGFSSVSLYITLVPSARQVLKNKGIKIA  266

Query  1083  tfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGK  904
             TF++FT VSTF++CGF+PTNENM+VFK+N GLLL+++P ILLGNTLYP CLRL I  L +
Sbjct  267   TFSLFTIVSTFASCGFIPTNENMMVFKKNSGLLLLVLPHILLGNTLYPPCLRLVIMVLER  326

Query  903   TTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLT  724
              T+R E+  +L +   +GY H+ S      L ATV G   +Q  +  ++EW +  + GL 
Sbjct  327   ITKREEYSHLLKNFKDVGYDHMLSALHCCLLVATVLGFNLIQFVMLCSMEWNTKIMEGLN  386

Query  723   GYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKT  544
              YEKVV SLF V N+RH GES+ DLS ++  +L L VVMMYLPP TTF P+ +  N++K 
Sbjct  387   VYEKVVASLFQVTNARHAGESVFDLSSISSVILVLFVVMMYLPPYTTFLPVREHENDAKR  446

Query  543   KGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNV  364
                S     ++E ++ S L  L IFIILICITE + ++EDPLNFNVLNI +EVISAYGNV
Sbjct  447   SEKS-----VLECLVFSQLSYLVIFIILICITESKSLREDPLNFNVLNITLEVISAYGNV  501

Query  363   GFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             GFSTGYSCARQ+KP+  CKD   GF GRWS+ GKFILI+VMFFGRLKK++MKGGKAW LS
Sbjct  502   GFSTGYSCARQLKPDATCKDSWVGFSGRWSSKGKFILILVMFFGRLKKFNMKGGKAWDLS  561



>ref|XP_008223810.1| PREDICTED: sodium transporter HKT1-like [Prunus mume]
Length=543

 Score =   412 bits (1060),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 278/518 (54%), Positives = 360/518 (69%), Gaps = 26/518 (5%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvss  1507
             S  R L F+ NPF ++L YF++LSL+G+ AL  +KPR  + + KD+DVFFT+VS+ TVSS
Sbjct  35    SIFRVLLFQANPFYVQLVYFVMLSLLGYLALMFTKPR--TTRPKDVDVFFTSVSATTVSS  92

Query  1506  mstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK----------------VSTT  1375
             MS VEMEVFSN  L+ +T LM LGGE FTS LGL F +SK                V+T 
Sbjct  93    MSVVEMEVFSNTHLIILTILMLLGGEVFTSMLGLQFTRSKIIPKFHDHHTDGRIDVVNTK  152

Query  1374  ERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvv  1195
                 + N     D +ELGL T++   N+   +     ++      +      +R L  VV
Sbjct  153   NHFPDSNA----DQIELGLATHSHLENE---KPQIIDHIDGMNNNNNNKYNSIRFLGYVV  205

Query  1194  lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENM  1015
             L Y++V+H+ G  LV++Y   VP+A+ VL++KG+++ TFAVFTTVSTFSNCGFVPTNENM
Sbjct  206   LGYLLVVHIGGSILVSLYFTLVPSARHVLEKKGIEIPTFAVFTTVSTFSNCGFVPTNENM  265

Query  1014  IVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLF  835
             IVFK N GLLL+L+PQ+LLGNTLYP CLR  IW L K T+R+EF  +L +   +GY H+ 
Sbjct  266   IVFKNNSGLLLLLLPQLLLGNTLYPVCLRFLIWVLEKITKRVEFSYMLKNYKDMGYSHML  325

Query  834   SGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIl  655
             S  RS  LA TV G I +Q+ +F A+EW+S+A+ GLT Y+K V S+F  +NSRH GES++
Sbjct  326   SSLRSFLLALTVLGFIVVQVILFCAMEWKSEAMDGLTAYQKFVASIFQTMNSRHAGESVI  385

Query  654   dlsllapavlalivVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFNIIEKILLSPLGNL  478
             DLS+++PA+L L VVMMYLPP TTF P   D  +++  KG    +  ++E ++ S L  L
Sbjct  386   DLSVISPAILVLFVVMMYLPPYTTFLPTTSDCEDSASAKGIPNPRKTLVESLVFSQLSYL  445

Query  477   SIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQ  298
             ++FIILICITEREKMKEDPLNF+VLN+++EVISAYGNVGFSTGYSC R++K EG CKD  
Sbjct  446   AMFIILICITEREKMKEDPLNFSVLNVIIEVISAYGNVGFSTGYSCKRRLKHEGDCKDAW  505

Query  297   FGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GF GRWS  GKFILI VMFFGRLK +  K GKAWKLS
Sbjct  506   SGFSGRWSTQGKFILITVMFFGRLKNFSTKHGKAWKLS  543



>ref|XP_003517618.1| PREDICTED: sodium transporter HKT1-like [Glycine max]
Length=511

 Score =   409 bits (1051),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 262/501 (52%), Positives = 344/501 (69%), Gaps = 16/501 (3%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPR-PISFKLKDLDvfftavssatvssmstV  1495
             +AF  + F ++L Y ++LSL+G+  LKVSKPR P+  +L DLD+F+T+VS++T SSM  V
Sbjct  19    IAFHFHSFFIQLCYLMILSLVGYLGLKVSKPRNPV--RLNDLDLFYTSVSASTASSMVAV  76

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHF----FQSKVSTTERVLEKNKVIVIDHVE  1327
             EMEVFSN QL+  T LMFLGGE FTS L L F     Q+KVS        +     + +E
Sbjct  77    EMEVFSNSQLILFTLLMFLGGEVFTSMLDLLFAGYKLQNKVSINPFPPTNHA----NQIE  132

Query  1326  LGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVA  1147
             LGLV +   H+D    +   SN+      D     C+  L   VL Y+V++  VGF+ V+
Sbjct  133   LGLVLSIP-HSDSENNNPCDSNIINVASCDRLKYNCLSYLTYAVLGYLVMVQFVGFSFVS  191

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +Y+  VP+A+QVLK KG+ + TF++FT VSTF++CGFVPTNENM+VFK+N GLLL+++P 
Sbjct  192   LYMTLVPSARQVLKNKGIKIVTFSLFTVVSTFASCGFVPTNENMLVFKKNSGLLLLILPH  251

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             + LGN LYP CLRL I  L K T++ EF  +L +   +GY HL S  R  FL ATV G  
Sbjct  252   VFLGNALYPPCLRLLIMVLKKVTKKEEFSYLLKNSIDVGYEHLLSDLRCCFLVATVLGFN  311

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              +Q  +  +LEW++  + GL  YEKVV SLF V N+RH GES+ DLS ++ A+L L VVM
Sbjct  312   LIQFVMLCSLEWKTKIMEGLNVYEKVVASLFQVTNARHAGESVFDLSSISSAILVLFVVM  371

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLPP TTF P+ +   +   +     + ++++ ++LS L  L IFIILICITE + +KE
Sbjct  372   MYLPPYTTFLPVREHEKDVNKRN----EKSVVDCLVLSQLSYLVIFIILICITESKSLKE  427

Query  426   DPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILII  247
             DPLNFNVL I +EVISAYGNVGFSTGYSCARQ+K +  CKD   GF GRWS+ GKFILI+
Sbjct  428   DPLNFNVLYITLEVISAYGNVGFSTGYSCARQLKTDATCKDSWVGFSGRWSSKGKFILIL  487

Query  246   VMFFGRLKKYHMKGGKAWKLS  184
             VMFFGRLKK++MKGGKAWKLS
Sbjct  488   VMFFGRLKKFNMKGGKAWKLS  508



>ref|XP_011017602.1| PREDICTED: probable cation transporter HKT6 [Populus euphratica]
Length=521

 Score =   409 bits (1050),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 270/508 (53%), Positives = 352/508 (69%), Gaps = 14/508 (3%)
 Frame = -1

Query  1692  MMSTVRRLAF-RVNPFLLELSYFIVLSLIGFFALKVSKPRP-ISFKLKDLDvfftavssa  1519
             +MS   RL   RVN F ++L YF+ +S  GF  LKV KPR   SFK ++LD+FFT+VS+ 
Sbjct  21    LMSCFYRLILVRVNSFCIQLCYFLSVSFFGFVVLKVLKPRTHDSFKPRNLDLFFTSVSAT  80

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVI  1339
             TVSSMSTVEMEVFSN QL+ +T LM +GGE FTS +GLHF +S++   E  +        
Sbjct  81    TVSSMSTVEMEVFSNSQLLVLTILMLIGGEIFTSMVGLHFKKSQLQKMENRISSLANNDP  140

Query  1338  DHVELGLV-TNNEYHNDL---NPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvih  1171
                + GLV T  +   +L   N E S  S+V     + IK L C  VL      Y +VI 
Sbjct  141   STYQSGLVMTEKQDFENLESGNHETSLDSSVDFLKYKSIKFL-CFVVLG-----YFIVIQ  194

Query  1170  vVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPG  991
             V+G +LV+ Y+  V +A++VLK KGL+L TF++F+ VSTF+NCGF+PTNENM+VFK N G
Sbjct  195   VLGVSLVSTYLALVSSAREVLKNKGLNLLTFSIFSVVSTFANCGFLPTNENMVVFKNNSG  254

Query  990   lllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFL  811
             LLLILIPQILLGNTL+P+CLR  +WFLGK  +R+E   +L   + +GY HL   + S +L
Sbjct  255   LLLILIPQILLGNTLFPSCLRFCVWFLGKFFKRVESNYLLKKTSEIGYFHLLPSQHSSYL  314

Query  810   AATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapa  631
               TVFG I  Q  +F ++EW S  ++GL  Y+K +G LF  +N+R+ GESI+DLS ++ A
Sbjct  315   VVTVFGFIITQFILFCSMEWNSAGLSGLNSYQKTIGVLFQTMNARYAGESIVDLSTISSA  374

Query  630   vlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             VL L V+MMYLPP T+F PI D+    K K    +K +  E IL S L  L+IFIIL+CI
Sbjct  375   VLVLFVIMMYLPPYTSFLPIKDDEEIYKKKRNRREKLS--ENILFSQLSYLAIFIILVCI  432

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSN  271
             TER+K+KEDPLNFNVLNIVVEV+SAYG+VGF+TGYSC RQ +P   C +K +GF G+WS+
Sbjct  433   TERQKLKEDPLNFNVLNIVVEVVSAYGSVGFTTGYSCDRQTQPNSNCVNKSYGFSGKWSD  492

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              GK ILI+VM FGRLKK++M GG+AWKL
Sbjct  493   EGKIILIVVMVFGRLKKFNMDGGRAWKL  520



>ref|XP_011017605.1| PREDICTED: probable cation transporter HKT6 [Populus euphratica]
Length=521

 Score =   408 bits (1049),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 267/502 (53%), Positives = 349/502 (70%), Gaps = 13/502 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRP-ISFKLKDLDvfftavssatvssms  1501
             R +  RVN F ++L YF+ +SL GF  LKV KPR   SFK ++LD+FFT+VS+ TVSSMS
Sbjct  27    RLILVRVNSFFIQLCYFLSVSLFGFVVLKVLKPRTHDSFKPRNLDLFFTSVSATTVSSMS  86

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELG  1321
             TVEMEVFSN QL+ +T LM +GGE FTS +GLHF +S++   E  +           + G
Sbjct  87    TVEMEVFSNSQLLVLTILMLIGGEIFTSMVGLHFKKSQLQKMENRISSLANNDPSTYQSG  146

Query  1320  LV-TNNEYHNDL---NPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTL  1153
             LV T  +   +L   N E S  S+V     + IK L C  VL      Y +VI V+G +L
Sbjct  147   LVMTEKQDFENLESGNHETSLDSSVDFLKYKSIKFL-CFVVLG-----YFIVIQVLGVSL  200

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V+ Y+  V +A++VLK KGL+L TF++F+ VSTF+NCGF+PTNENM+VF+ N GLLLILI
Sbjct  201   VSTYLALVSSAREVLKNKGLNLLTFSIFSVVSTFANCGFLPTNENMVVFRNNSGLLLILI  260

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
             PQILLGNTL+P+CLR  +WFLGK  +R+E   +L   + +GY HL   + S +L  TVFG
Sbjct  261   PQILLGNTLFPSCLRFCVWFLGKFFKRVESNYLLKKTSEIGYFHLLPSQHSSYLVVTVFG  320

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
              I  Q  +F ++EW S  ++GL  Y+K +G LF  +N+R+ GESI+DLS ++ AVL L V
Sbjct  321   FIITQFILFCSMEWNSAGLSGLNSYQKTIGVLFQTMNARYAGESIVDLSTISSAVLVLFV  380

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKM  433
             +MMYLPP T+F PI D+    K K    +K +  E IL S L  L+IFIIL+CITER+K+
Sbjct  381   IMMYLPPYTSFLPIKDDEEIYKKKRNRREKLS--ENILFSQLSYLAIFIILVCITERQKL  438

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFIL  253
             KEDPLNFNVLNIVVEV+SAYG VGF+TGYSC RQ +P   C +K +GF G+WS+ GK IL
Sbjct  439   KEDPLNFNVLNIVVEVVSAYGRVGFTTGYSCDRQTQPNSNCVNKSYGFSGKWSDEGKIIL  498

Query  252   IIVMFFGRLKKYHMKGGKAWKL  187
             I+VM FGRLKK++M GG+AWKL
Sbjct  499   IVVMVFGRLKKFNMDGGRAWKL  520



>ref|XP_007152990.1| hypothetical protein PHAVU_004G177200g [Phaseolus vulgaris]
 gb|ESW24984.1| hypothetical protein PHAVU_004G177200g [Phaseolus vulgaris]
Length=519

 Score =   407 bits (1047),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 278/509 (55%), Positives = 358/509 (70%), Gaps = 23/509 (5%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             LAF  +PF ++LSYF +LSL+G+ ALK+S PR  + K KD D+F+T+VS++TVSSM  VE
Sbjct  21    LAFNAHPFFIQLSYFWILSLLGYLALKLSNPR-TTLKPKDFDLFYTSVSASTVSSMVAVE  79

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK--------VSTTERVLEKNKVIVID  1336
             MEVFSN QL+ +T LMFLGGE FTS L L F + K        V +T     +   I   
Sbjct  80    MEVFSNSQLLLLTLLMFLGGEVFTSMLDLLFARYKFTQSVPNRVRSTPFSSTEKPQIHAK  139

Query  1335  HVELGLVT-----NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvih  1171
             HVELGL++      +E HN   P+ +    V  +  E +K   C+  L  VVL Y+VV+ 
Sbjct  140   HVELGLISIIPHSESENHNLNLPKGTM---VPFKDSERLKY-NCLTYLIFVVLGYLVVVQ  195

Query  1170  vVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPG  991
             +VGF+LV++Y+  VP+A QVLK K + + TF++FT VSTF++CGFVPTNENM+VFK+N G
Sbjct  196   LVGFSLVSLYMSLVPSATQVLKNKDIKVATFSLFTIVSTFASCGFVPTNENMMVFKKNSG  255

Query  990   lllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFL  811
             LLL+++P ILLGNTLYP CLRL I  L K +RR EF  +L +   +GY H+ S      L
Sbjct  256   LLLLVLPHILLGNTLYPPCLRLVIMGLRKVSRREEFSYLLKNFKDVGYDHMLSAVHCWLL  315

Query  810   AATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapa  631
              ATV  L  +Q  +F A+EW++ ++ GL  YEKVVGSLF V N+RH+GES+ DLS L+ A
Sbjct  316   VATVLCLNVIQFVMFWAMEWKNKSMEGLNVYEKVVGSLFQVTNARHSGESVFDLSSLSSA  375

Query  630   vlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             +L L ++MMYLPP TTF P+ +E N+ K    SP     +E ++LS L  L+IFIIL+CI
Sbjct  376   MLVLFILMMYLPPYTTFLPVREEENDVKRNRKSP-----VECVVLSQLSYLAIFIILVCI  430

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSN  271
             TER+ +KEDPLNFNVLNI +EVISAYGNVGFS GYSC RQ+K +G CKD   GF GRWSN
Sbjct  431   TERKSLKEDPLNFNVLNITLEVISAYGNVGFSMGYSCERQLKDDGMCKDSWVGFSGRWSN  490

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GKFILI+VMFFGRLKK++MKGGKAW LS
Sbjct  491   GGKFILILVMFFGRLKKFNMKGGKAWHLS  519



>emb|CCJ09642.1| Na+ transporter [Solanum lycopersicum var. cerasiforme]
 emb|CCJ09644.1| Na+ transporter [Solanum cheesmaniae]
Length=503

 Score =   406 bits (1044),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 271/502 (54%), Positives = 356/502 (71%), Gaps = 20/502 (4%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALK-VSKPRPI-SFKLKDLDvfftavssatvssmst  1498
             ++ RV PF +EL YF  LSL+GF AL  VSKPR + SF+ ++LDV FT+VSS TVSSMST
Sbjct  14    MSLRVKPFWIELGYFTTLSLLGFLALNYVSKPRTLPSFRPQNLDVLFTSVSSTTVSSMST  73

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             +EMEVFSN+QLVFMT LMFLGGE FTS+L L   ++K S       K+K       ELG 
Sbjct  74    IEMEVFSNVQLVFMTILMFLGGEAFTSFLSLKLIKNKES-------KDKSFSNKDYELGN  126

Query  1317  VTNNEYHND----LNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
             V N +   +    +NP +    +   E+++    +  +++L+ VV  YI+V+ ++G +LV
Sbjct  127   VINVDNKLEDVIIINPIEDHIHDHHDEIIK----IKSIKLLSNVVFGYILVVILLGSSLV  182

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
             ++YI  +P+AKQ+L QKGL+L TF++FTTVSTF+NCGF+PTNENM++FK+N GLLLILIP
Sbjct  183   SLYIIIIPSAKQILDQKGLNLHTFSLFTTVSTFANCGFLPTNENMMIFKKNSGLLLILIP  242

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             Q+LLGNTL+  CLR+ I FL K T+R E+  IL +   +GY H+F    +  +A TV GL
Sbjct  243   QVLLGNTLFAPCLRIVIMFLWKITKRHEYEYILKNSKCVGYSHIFPSYETIGIAITVVGL  302

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             I  Q  +F +LEW S+  +GL+ YEK+VGSLF VVN+RH G S+ DLS   P++L L  +
Sbjct  303   IVFQFVMFCSLEWNSEGTSGLSTYEKIVGSLFEVVNTRHAGLSVFDLSTFTPSILVLFAL  362

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKK-FNIIEKILLSPLGNLSIFIILICITEREKM  433
             MMYL   TTF P+  +N   K++    +K  +++E I LS    L IF ILIC+ E++KM
Sbjct  363   MMYLSSYTTFLPV--DNYEEKSEKMKKRKGRSLMEYISLSQPCCLVIFTILICVVEKDKM  420

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFIL  253
             K DPLNFNVLNI+ EVISAYG VG S GYSCARQI P+G CKD  +GF G+WSN GKFIL
Sbjct  421   KNDPLNFNVLNILFEVISAYGTVGLSIGYSCARQINPDGHCKDVTYGFAGKWSNTGKFIL  480

Query  252   IIVMFFGRLKKYHMKGGKAWKL  187
             IIVMFFGRLKKY+ +GGKAWK+
Sbjct  481   IIVMFFGRLKKYNQRGGKAWKV  502



>ref|XP_011017603.1| PREDICTED: probable cation transporter HKT6 isoform X1 [Populus 
euphratica]
Length=547

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 265/497 (53%), Positives = 346/497 (70%), Gaps = 13/497 (3%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRP-ISFKLKDLDvfftavssatvssmstVEME  1486
             RVN F ++L YF+ +SL GF  LKV KPR   SFK ++LD+FFT+VS+ TVSSMSTVEME
Sbjct  58    RVNSFFIQLCYFLSVSLFGFVVLKVLKPRTHDSFKPRNLDLFFTSVSATTVSSMSTVEME  117

Query  1485  VFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV-TN  1309
             VFSN QL+ +T LM +GGE FTS +GLHF +S++   E  +           + GLV T 
Sbjct  118   VFSNSQLLVLTILMLIGGEIFTSMVGLHFKKSQLQKMENRISSLANNDPSTYQSGLVMTE  177

Query  1308  NEYHNDL---NPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
              +   +L   N E S  S+V     + IK L C  VL      Y +VI V+G +LV+ Y+
Sbjct  178   KQDFENLESGNHETSLDSSVDFLKYKSIKFL-CFVVLG-----YFIVIQVLGVSLVSTYL  231

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               V +A++VLK KGL+L TF++F+ VSTF+NCGF+PTNENM+VF+ N GLLLIL+PQILL
Sbjct  232   ALVSSAREVLKNKGLNLLTFSIFSVVSTFANCGFLPTNENMVVFRNNSGLLLILVPQILL  291

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GNTL+P+CLR  +WFLGK  +R+E   +L   + +GY HL   + S +L  TVFG I  Q
Sbjct  292   GNTLFPSCLRFCVWFLGKFFKRVESNYLLKKTSEIGYFHLLPSQHSSYLVVTVFGFIITQ  351

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
               +F ++EW S  ++GL  Y+K +G LF  +N+R+ GESI+DLS ++ AVL L VVMMYL
Sbjct  352   FILFCSMEWNSAGLSGLNSYQKTIGVLFQTMNARYAGESIVDLSTISSAVLVLFVVMMYL  411

Query  597   PPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPL  418
             PP T+F PI D+    K K    ++  + E IL S L  L+IFIIL+CITER K+KEDPL
Sbjct  412   PPYTSFLPIKDDEEIYKKK--RNRRGKLSESILFSQLSYLAIFIILVCITERRKLKEDPL  469

Query  417   NFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMF  238
             NFNVLNIVVEV+SAYG VGF+TGYSC RQ +P   C +K +GF G+WS+ GK ILI+VM 
Sbjct  470   NFNVLNIVVEVVSAYGRVGFTTGYSCDRQTQPNSNCVNKSYGFSGKWSDEGKIILIVVMV  529

Query  237   FGRLKKYHMKGGKAWKL  187
             FGRLKK++M GG+AWKL
Sbjct  530   FGRLKKFNMDGGRAWKL  546



>ref|XP_011017604.1| PREDICTED: probable cation transporter HKT6 isoform X2 [Populus 
euphratica]
Length=521

 Score =   405 bits (1041),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 265/502 (53%), Positives = 347/502 (69%), Gaps = 13/502 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRP-ISFKLKDLDvfftavssatvssms  1501
             R +  RVN F ++L YF+ +S  GF  LKV KPR   SFK ++LD+FFT+VS+ TVSSMS
Sbjct  27    RLILVRVNSFCIQLCYFLSVSFFGFVVLKVLKPRTHDSFKPRNLDLFFTSVSATTVSSMS  86

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELG  1321
             TVEMEVFSN QL+ +T LM +GGE FTS +GLHF +S++   E  +           + G
Sbjct  87    TVEMEVFSNSQLLVLTILMLIGGEIFTSMVGLHFKKSQLQKMENRISSLANNDPSTYQSG  146

Query  1320  LV-TNNEYHNDL---NPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTL  1153
             LV T  +   +L   N E S  S+V     + IK L C  VL      Y +VI V+G +L
Sbjct  147   LVMTEKQDFENLESGNHETSLDSSVDFLKYKSIKFL-CFVVLG-----YFIVIQVLGVSL  200

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V+ Y+  V +A++VLK KGL+L TF++F+ VSTF+NCGF+PTNENM+VF+ N GLLLIL+
Sbjct  201   VSTYLALVSSAREVLKNKGLNLLTFSIFSVVSTFANCGFLPTNENMVVFRNNSGLLLILV  260

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
             PQILLGNTL+P+CLR  +WFLGK  +R+E   +L   + +GY HL   + S +L  TVFG
Sbjct  261   PQILLGNTLFPSCLRFCVWFLGKFFKRVESNYLLKKTSEIGYFHLLPSQHSSYLVVTVFG  320

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
              I  Q  +F ++EW S  ++GL  Y+K +G LF  +N+R+ GESI+DLS ++ AVL L V
Sbjct  321   FIITQFILFCSMEWNSAGLSGLNSYQKTIGVLFQTMNARYAGESIVDLSTISSAVLVLFV  380

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKM  433
             VMMYLPP T+F PI D+    K K    ++  + E IL S L  L+IFIIL+CITER K+
Sbjct  381   VMMYLPPYTSFLPIKDDEEIYKKK--RNRRGKLSESILFSQLSYLAIFIILVCITERRKL  438

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFIL  253
             KEDPLNFNVLNIVVEV+SAYG VGF+TGYSC RQ +P   C +K +GF G+WS+ GK IL
Sbjct  439   KEDPLNFNVLNIVVEVVSAYGRVGFTTGYSCDRQTQPNSNCVNKSYGFSGKWSDEGKIIL  498

Query  252   IIVMFFGRLKKYHMKGGKAWKL  187
             I+VM FGRLKK++M GG+AWKL
Sbjct  499   IVVMVFGRLKKFNMDGGRAWKL  520



>ref|XP_010263271.1| PREDICTED: sodium transporter HKT1-like [Nelumbo nucifera]
Length=544

 Score =   406 bits (1043),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 270/533 (51%), Positives = 356/533 (67%), Gaps = 41/533 (8%)
 Frame = -1

Query  1710  RNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvffta  1531
             R+   +++   R + FRVNPF + + YF+ +S +GF  LK+  P+P SF   DLD+FFT+
Sbjct  27    RSIWGLLVRWFRFILFRVNPFFVLVFYFVSVSFVGFLILKLLNPKPSSFTPNDLDMFFTS  86

Query  1530  vssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNK  1351
             VS+ T+SSMSTVEMEVFSN QLV +T LM +GGE F S LGLHF   K       +EKN 
Sbjct  87    VSATTISSMSTVEMEVFSNTQLVVLTILMLVGGEVFASMLGLHFATFK-------MEKNA  139

Query  1350  VIV--------------------IDHVELGLV-TNNEYHNDLNPEDSAKSNVQIEVVEDI  1234
              ++                    +D +ELGLV T      DL  E      V+    ED+
Sbjct  140   AMIDNRVDSLSSNESADLSPTNPVDQIELGLVQTRKPSKADLVSE------VESLFSEDL  193

Query  1233  KLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvst  1054
             +     R L  V+  Y++V+HV G  LVA+Y+  V +A+ VLK KGL   TF VFTTVST
Sbjct  194   RY-NSTRCLISVIQCYLLVVHVAGSALVAVYVSLVSSARDVLKNKGLQFVTFCVFTTVST  252

Query  1053  fSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQI  874
             F+NCGF+PTNENM++F++N GLLL+LIPQ LLGN L+P+CLR  IW LG+ ++R EF  +
Sbjct  253   FANCGFIPTNENMLIFRKNYGLLLLLIPQALLGNALFPSCLRFLIWVLGRISKRDEFNYM  312

Query  873   LGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLF  694
             L +   + Y HL     +  L  TVF  + LQ  VF ++EW S+++ GL  ++KVV SLF
Sbjct  313   LKNSEEMKYFHLLPSLHARCLVVTVFWFLLLQFVVFSSMEWNSESLDGLNPFQKVVASLF  372

Query  693   VVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNI  514
               VNSRHTGESI+DLS ++PA+L L VVMMYLP  T+F PI D+  +S++  C  +K   
Sbjct  373   QAVNSRHTGESIVDLSSISPAILVLFVVMMYLPAYTSFLPIKDDQQSSRS--CKKRKIRW  430

Query  513   ----IEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGY  346
                 +E ++ S L  L+I IILIC TER++++EDPLNF+V NIV+EVISAYGNVGF+TGY
Sbjct  431   GRINVENLIFSQLSYLAISIILICFTERKRIEEDPLNFSVFNIVIEVISAYGNVGFTTGY  490

Query  345   SCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             SC RQ+KP+  CKD  +GFVGRWSN GK ILI+VMFFGRLKK +M+GG+AWKL
Sbjct  491   SCKRQLKPDSLCKDSWYGFVGRWSNKGKAILILVMFFGRLKKLNMEGGRAWKL  543



>ref|XP_010263268.1| PREDICTED: sodium transporter HKT1-like isoform X1 [Nelumbo nucifera]
Length=548

 Score =   406 bits (1043),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 274/505 (54%), Positives = 353/505 (70%), Gaps = 17/505 (3%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFS  1477
             NPF + + YF+ +S +GF  LK+  PR  SFK KDLD+FFT+VS+ TVSSMSTVEMEVFS
Sbjct  45    NPFYILVCYFVSVSFLGFLILKLLNPRTDSFKPKDLDIFFTSVSATTVSSMSTVEMEVFS  104

Query  1476  NLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIV----------IDHVE  1327
             N QLVF+T LMF+GGE F S  GL F + K+    R+       V          +D +E
Sbjct  105   NTQLVFITILMFVGGEVFVSMFGLLFTKYKLRNRARIHGSRVGSVSRESLSPTNPVDQIE  164

Query  1326  LGLVTNNEYHNDLNPED----SAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGF  1159
             LG+V  +E  +   P      SA  ++     ED++    +R L  V+L Y++V+H+ G 
Sbjct  165   LGMVILSETESR-KPSSVDLVSAVESILSSNEEDLRY-NSIRYLVFVILVYLLVVHIGGS  222

Query  1158  TLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGllli  979
              LVA+Y+  VP+A+ VL+ KGL + TF++FTTVSTF++CGFVPTNENMIVF +N GLLL+
Sbjct  223   ALVALYVSLVPSARNVLRNKGLQIPTFSIFTTVSTFASCGFVPTNENMIVFSKNSGLLLL  282

Query  978   lipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATV  799
             LIPQ+LLGNTLYP+CLR  IW LGK T+R EF  +L +   + Y HL     S  L  TV
Sbjct  283   LIPQVLLGNTLYPSCLRFLIWVLGKFTKRQEFNYMLMNTREMKYFHLLPSLHSSLLVVTV  342

Query  798   FGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
             FG I +Q  +F +LEW S+ + GL  ++K+V SLF  VNSRHTGESI+DLS+L+PA+L L
Sbjct  343   FGFIVVQFILFCSLEWNSEGLDGLNPFQKLVASLFQTVNSRHTGESIIDLSILSPAILVL  402

Query  618   ivVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITER  442
              V+MMYLPP T+F PI  D   +S++   S  +  + E ++ S L  L IFIILICITER
Sbjct  403   FVLMMYLPPYTSFLPITKDVGKSSRSGKKSTSRGRLAENLIFSQLSYLVIFIILICITER  462

Query  441   EKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGK  262
             EKMKEDPLNF+ LNI++EVISAYGNVGF+ GYSC RQ+ P+G CKD  +GFVGRWSN GK
Sbjct  463   EKMKEDPLNFSTLNIIIEVISAYGNVGFTAGYSCKRQLNPQGLCKDSWYGFVGRWSNKGK  522

Query  261   FILIIVMFFGRLKKYHMKGGKAWKL  187
              ILI+VMFFGRLKK++M GG+ WKL
Sbjct  523   VILILVMFFGRLKKFNMDGGRGWKL  547



>ref|XP_006582258.1| PREDICTED: cation transporter HKT8-like [Glycine max]
Length=574

 Score =   407 bits (1045),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 278/556 (50%), Positives = 359/556 (65%), Gaps = 64/556 (12%)
 Frame = -1

Query  1680  VRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPR-PISFKLKDLDvfftavssatvssm  1504
             V  LAF V+PF ++L YF++LSL+G+  LKVSKPR P+  +  DLD+F+T+VS++TVSSM
Sbjct  26    VHFLAFHVHPFFVQLCYFVILSLLGYLGLKVSKPRTPV--RPNDLDLFYTSVSASTVSSM  83

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFF--------------------QSKV  1384
               VEMEVFSN QL+ +T LMF+GGE FTS L L F                     QS+ 
Sbjct  84    VAVEMEVFSNSQLILLTLLMFVGGEVFTSVLDLIFARYKFTQSVQNKVPTHHSYQTQSEF  143

Query  1383  STTERV--LEKNK------------VIVIDHVELGLVT-NNEYHNDLNPEDS--------  1273
             S  E +  L+KN              I  + +ELGLV+ ++    +  P DS        
Sbjct  144   SPVEHICGLDKNNDNTNPFSPTKKPPINANQIELGLVSIDHSESENHKPSDSKLPDTYLQ  203

Query  1272  ------AKSNVQI-----EVVEDIKLL--GCVRVLARvvlsyivvihvVGFTLVAMYIGF  1132
                    KSN+ +     E   D   L   C+  L  VVL Y+VV+  VGF+ V++YI  
Sbjct  204   FLQIKKTKSNINVPKGTVESFNDSDRLKYNCLSFLTFVVLGYLVVVQFVGFSFVSLYITL  263

Query  1131  VPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGN  952
             VP+A+QVLK KG+ + TF++FT VSTF++CGF+PTNENM+VFK+N GLLL+++P ILLGN
Sbjct  264   VPSARQVLKNKGIKIATFSLFTIVSTFASCGFIPTNENMMVFKKNSGLLLLVLPHILLGN  323

Query  951   TLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLT  772
             TLYP CLRL I  L + TRR E+  +L +   +GY H+ S      L ATV G   +Q  
Sbjct  324   TLYPPCLRLVIMALKRVTRREEYSHLLKNFKDVGYDHMLSALHCCLLVATVLGFNLVQFV  383

Query  771   VFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPP  592
             +F ++EW +  + GL  YEKVV SLF V N+RH+GES+ DLS ++ A+L L VVMMYLPP
Sbjct  384   MFCSVEWNTKIMEGLNVYEKVVASLFQVTNARHSGESVFDLSSISSAILVLFVVMMYLPP  443

Query  591   DTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNF  412
              TTF P+ +  N+ K    S     ++E ++ S L  L IFIILICITE   +KEDPLNF
Sbjct  444   YTTFLPVREHENDVKRNEKS-----VVECLVFSQLSYLVIFIILICITESNSLKEDPLNF  498

Query  411   NVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFG  232
             NVLNI +EVISAYGNVG S GYSCARQ+KP+  CKD   GF GRWS+ GKFILI+VMFFG
Sbjct  499   NVLNITLEVISAYGNVGLSMGYSCARQLKPDATCKDSWVGFSGRWSSKGKFILILVMFFG  558

Query  231   RLKKYHMKGGKAWKLS  184
             RLKK++MKGGKAW LS
Sbjct  559   RLKKFNMKGGKAWNLS  574



>gb|KHN28104.1| Putative cation transporter HKT6-like protein [Glycine soja]
Length=574

 Score =   406 bits (1044),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 278/556 (50%), Positives = 359/556 (65%), Gaps = 64/556 (12%)
 Frame = -1

Query  1680  VRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPR-PISFKLKDLDvfftavssatvssm  1504
             V  LAF V+PF ++L YF++LSL+G+  LKVSKPR P+  +  DLD+F+T+VS++TVSSM
Sbjct  26    VHFLAFHVHPFFVQLCYFVILSLLGYLGLKVSKPRTPV--RPNDLDLFYTSVSASTVSSM  83

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFF--------------------QSKV  1384
               VEMEVFSN QL+ +T LMF+GGE FTS L L F                     QS+ 
Sbjct  84    VAVEMEVFSNSQLILLTLLMFVGGEVFTSVLDLIFARYKFTQSVQNKVPTHHSYQTQSEF  143

Query  1383  STTERV--LEKNK------------VIVIDHVELGLVT-NNEYHNDLNPEDS--------  1273
             S  E +  L+KN              I  + +ELGLV+ ++    +  P DS        
Sbjct  144   SPVEHICGLDKNNDNTNPFSPTKKPPINANQIELGLVSIHHSESENHKPSDSKLPDTYLQ  203

Query  1272  ------AKSNVQI-----EVVEDIKLL--GCVRVLARvvlsyivvihvVGFTLVAMYIGF  1132
                    KSN+ +     E   D   L   C+  L  VVL Y+VV+  VGF+ V++YI  
Sbjct  204   FLQIKKTKSNINVPKGTVESFNDSDRLKYNCLSFLTFVVLGYLVVVQFVGFSFVSLYITL  263

Query  1131  VPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGN  952
             VP+A+QVLK KG+ + TF++FT VSTF++CGF+PTNENM+VFK+N GLLL+++P ILLGN
Sbjct  264   VPSARQVLKNKGIKIATFSLFTIVSTFASCGFIPTNENMMVFKKNSGLLLLVLPHILLGN  323

Query  951   TLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLT  772
             TLYP CLRL I  L + TRR E+  +L +   +GY H+ S      L ATV G   +Q  
Sbjct  324   TLYPPCLRLVIMALKRVTRREEYSHLLKNFKDVGYDHMLSALHCCLLVATVLGFNLVQFV  383

Query  771   VFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPP  592
             +F ++EW +  + GL  YEKVV SLF V N+RH+GES+ DLS ++ A+L L VVMMYLPP
Sbjct  384   MFCSVEWNTKIMEGLNVYEKVVASLFQVTNARHSGESVFDLSSISSAILVLFVVMMYLPP  443

Query  591   DTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNF  412
              TTF P+ +  N+ K    S     ++E ++ S L  L IFIILICITE   +KEDPLNF
Sbjct  444   YTTFLPVREHENDVKRNEKS-----VVECLVFSQLSYLVIFIILICITESNSLKEDPLNF  498

Query  411   NVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFG  232
             NVLNI +EVISAYGNVG S GYSCARQ+KP+  CKD   GF GRWS+ GKFILI+VMFFG
Sbjct  499   NVLNITLEVISAYGNVGLSMGYSCARQLKPDATCKDSWVGFSGRWSSKGKFILILVMFFG  558

Query  231   RLKKYHMKGGKAWKLS  184
             RLKK++MKGGKAW LS
Sbjct  559   RLKKFNMKGGKAWNLS  574



>emb|CDI45388.1| membrane Na+ transporter [Solanum pennellii]
Length=503

 Score =   403 bits (1036),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 267/502 (53%), Positives = 354/502 (71%), Gaps = 20/502 (4%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALK-VSKPRPI-SFKLKDLDvfftavssatvssmst  1498
             ++  V PF +EL YF  LSL+GF AL  VSKPR + SF+ ++LDV FT+VSS TVSSMST
Sbjct  14    MSLGVKPFWIELGYFTTLSLLGFLALNYVSKPRTLPSFRPQNLDVLFTSVSSTTVSSMST  73

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             +EMEV SN+QLVFMT LMFLGGE FTS+L L   ++K +       K+K       ELG 
Sbjct  74    IEMEVLSNVQLVFMTILMFLGGEAFTSFLSLKLIKNKEN-------KDKSFSNKDYELGN  126

Query  1317  VTNNEYHND----LNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
             + N +   +    +NP +    +   E+++    +  +++L+ VV  YI+V+ ++G +LV
Sbjct  127   IINVDNKLEDVIIINPIEDHSHDHHDEIIK----IKSIKLLSNVVFGYILVVILLGSSLV  182

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
             ++YI  +P+AKQ+L QKGL+L TF++FTTVSTF+NCGF PTNENM++FK+N GLLLILIP
Sbjct  183   SLYIILIPSAKQILNQKGLNLHTFSLFTTVSTFANCGFAPTNENMMIFKKNSGLLLILIP  242

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             Q+LLGNTL+  CLR+ I FL K T+R E+  IL +   +GY H+F    +  +A TV GL
Sbjct  243   QVLLGNTLFAPCLRIVIMFLWKITKRHEYEYILKNSKCVGYSHIFPSYETIGIAITVVGL  302

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             I  Q  +F +LEW S+  +GL+ YEK+VGSL  VVN+RH G+S+ DLS   P++L L  +
Sbjct  303   IVFQFVMFCSLEWNSEGTSGLSTYEKIVGSLLEVVNTRHAGQSVFDLSTFTPSILVLFAL  362

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKK-FNIIEKILLSPLGNLSIFIILICITEREKM  433
             MMYL P TTF P+  +N   K++    +K  +++E I LS    L IF ILIC+ E++KM
Sbjct  363   MMYLSPYTTFLPV--DNYEEKSEKMKKRKGRSLMEYISLSQPCCLVIFTILICVVEKDKM  420

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFIL  253
             K DPLNFNVLNI+ EVISAYG VG S GYSCARQI P+G CKD  +GF G+WSN GKFIL
Sbjct  421   KNDPLNFNVLNILFEVISAYGTVGLSIGYSCARQINPDGHCKDVTYGFAGKWSNTGKFIL  480

Query  252   IIVMFFGRLKKYHMKGGKAWKL  187
             IIVMFFGRLKKY+ +GGKAWK+
Sbjct  481   IIVMFFGRLKKYNQRGGKAWKV  502



>emb|CBI40144.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   402 bits (1034),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 270/531 (51%), Positives = 350/531 (66%), Gaps = 46/531 (9%)
 Frame = -1

Query  1740  PSAFTPPISLRNKHTMMMSTVRR------------LAFRVNPFLLELSYFIVLSLIGFFA  1597
             P     P+ + N+ +  +S +++            LAF+V+PF  +L YFI +SL+G+ A
Sbjct  5     PCFARKPVDVFNRSSTKLSCLQQSFRGLFSSLFYFLAFQVSPFWNQLGYFITVSLLGYMA  64

Query  1596  LKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTS  1417
             LKVSKP+  SF   D+DVFFT+VS++TVSSMS VEMEVFS+ QLV MT LM +GGE FTS
Sbjct  65    LKVSKPKTTSFMPSDVDVFFTSVSASTVSSMSAVEMEVFSDTQLVIMTVLMLVGGEIFTS  124

Query  1416  WLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVED  1237
              LGL F Q++                                  P  + +  ++    ED
Sbjct  125   MLGLQFAQNE---------------------------------QPCSNLEKGIEASCDED  151

Query  1236  IKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvs  1057
             +K    ++ L  VVL Y++V+HVVG  L+ +Y+  VP+A++VLK KGL + TF+VFT VS
Sbjct  152   LKY-HSIKCLGYVVLFYLLVVHVVGSALIVLYLNLVPSAREVLKNKGLRILTFSVFTVVS  210

Query  1056  tfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQ  877
             TFSNCGF+PTNENM+VFK+N GLLLILIPQILLGNTL+  CLR  IW L K TRR+EF  
Sbjct  211   TFSNCGFIPTNENMVVFKKNSGLLLILIPQILLGNTLFAPCLRFVIWVLVKITRRVEFNY  270

Query  876   ILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSL  697
             +L +   + Y HL  G  S  LA TVFG I +Q  +   +EW S+ +AGL  Y+K+VG L
Sbjct  271   MLKNSREISYDHLLPGLYSCLLAITVFGFILVQFLLLCFMEWNSEDLAGLNAYQKIVGML  330

Query  696   FVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN  517
             F   NSRH+GESI DLS+++PAVL L V+MMYLPP T+F PI       + +    +K  
Sbjct  331   FQTANSRHSGESIFDLSVISPAVLVLFVLMMYLPPHTSFLPIDGGEKALQKEERRTEKRK  390

Query  516   IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCA  337
              +E +LLS L  L IF+IL+CI EREKMK+DPLNF+VLNI +E++SAYGNVGFS GY C 
Sbjct  391   YVEHLLLSQLSYLVIFVILVCIIEREKMKKDPLNFSVLNITIEIVSAYGNVGFSAGYQCN  450

Query  336   RQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              Q+K E  CKD  +GFVGRWSN GKF+L+ VMFFGRLKK+ M GG+AWKL 
Sbjct  451   LQLKHEPHCKDLCYGFVGRWSNSGKFVLMFVMFFGRLKKFSMHGGRAWKLD  501



>ref|XP_006359731.1| PREDICTED: sodium transporter HKT1-like [Solanum tuberosum]
Length=501

 Score =   401 bits (1031),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 273/503 (54%), Positives = 353/503 (70%), Gaps = 12/503 (2%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKV-SKPRPI-SFKLKDLDvfftavssatv  1513
             S  + ++ RV PF +EL YF  LS +GF AL   SKPR + SF+ ++LDVFFT+VSS TV
Sbjct  7     SFFKIMSLRVKPFWIELGYFTTLSFLGFLALNYFSKPRTLPSFRPQNLDVFFTSVSSTTV  66

Query  1512  ssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH  1333
             SSMST+EMEVFSN+QLVFMT LMFLGGE FTS+L L   + +         K++      
Sbjct  67    SSMSTIEMEVFSNVQLVFMTILMFLGGEAFTSFLRLKLIKKE--------NKDESFSCKD  118

Query  1332  VELGLVTN-NEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFT  1156
              ELG V N ++   D+   +  + +   +  ++I  +  +R+L+ VV  YI+VI ++G +
Sbjct  119   YELGNVINVDDKLEDVIITNPIEDHSHHDHHDEIIKIKSIRLLSNVVFGYILVIILLGSS  178

Query  1155  LVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllil  976
             LV++YI  +P+AKQ+L +KGL+L TF++FTTVSTF+NCGFVPTNENM++FK+N GLLLIL
Sbjct  179   LVSLYIIIIPSAKQILNKKGLNLHTFSLFTTVSTFANCGFVPTNENMMIFKQNSGLLLIL  238

Query  975   ipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVF  796
             IPQILLGNTL+  CLRL I FL K T+R EF  IL +   +G+ H+F    +  +A TV 
Sbjct  239   IPQILLGNTLFAPCLRLVIMFLWKITKRHEFEYILKNSKRIGFSHIFPCYETISIAITVV  298

Query  795   GLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlali  616
             GLI  Q  VF +LEW S   +GL+ YEK+VGSLF VVN+RHTG+S+ DLS   PA+L L 
Sbjct  299   GLIVFQFVVFCSLEWNSKGTSGLSTYEKIVGSLFEVVNTRHTGQSVFDLSTFTPAILVLF  358

Query  615   vVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREK  436
               MMYL   TTF P+ +    S+ K    K  ++++ I LS    L IF ILIC+ E++K
Sbjct  359   ASMMYLSSYTTFLPVYNYEEKSE-KMKKRKGRSLMDYISLSQPSCLVIFTILICVVEKDK  417

Query  435   MKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFI  256
             MK DPLNFNVLNI+ EVISAYG VG S GYSCARQI P+G CKD  +GF G+WSN GKFI
Sbjct  418   MKNDPLNFNVLNILFEVISAYGTVGMSIGYSCARQINPDGHCKDATYGFAGKWSNTGKFI  477

Query  255   LIIVMFFGRLKKYHMKGGKAWKL  187
             LIIVMFFGRLKKY+ +GGKAWK+
Sbjct  478   LIIVMFFGRLKKYNQRGGKAWKV  500



>ref|NP_001289833.1| sodium transporter HKT1 [Solanum lycopersicum]
 emb|CDI45387.1| membrane Na+ transporter [Solanum lycopersicum]
Length=503

 Score =   401 bits (1030),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 269/502 (54%), Positives = 354/502 (71%), Gaps = 20/502 (4%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALK-VSKPRPI-SFKLKDLDvfftavssatvssmst  1498
             ++ RV PF +EL YF  LSL+GF AL  VSKPR + SF+ ++LDV FT+VSS TVSSMST
Sbjct  14    MSLRVKPFWIELGYFTTLSLLGFLALNYVSKPRTLPSFRPQNLDVLFTSVSSTTVSSMST  73

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             +EMEVFSN+QLVFMT LMFLGGE FTS+L     ++K S       K+K       ELG 
Sbjct  74    IEMEVFSNVQLVFMTILMFLGGEAFTSFLSPKLIKNKES-------KDKSFSNKDYELGN  126

Query  1317  VTNNEYHND----LNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
             V N +   +    +NP +    +   E+++    +  +++L+ VV  YI+V+ ++G +LV
Sbjct  127   VINVDNKLEDVIIINPIEDHIHDHHDEIIK----IKSIKLLSNVVFGYILVVILLGSSLV  182

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
             ++YI  +P+AKQ+L QKGL+L TF++FTTVSTF+NCGF+PTNENM++FK+N GLLLILIP
Sbjct  183   SLYIIIIPSAKQILDQKGLNLHTFSLFTTVSTFANCGFLPTNENMMIFKKNSGLLLILIP  242

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             Q+LLGNTL+  CLR+ I FL K T+R E+  IL +   +GY H+F    +  +A TV GL
Sbjct  243   QVLLGNTLFAPCLRIVIMFLWKITKRHEYEYILKNSKCVGYSHIFPSYETIGIAITVVGL  302

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             I  Q  +F +LEW S+  +GL+ YEK+VGSLF VVN+RH G S+ DLS   P++L L  +
Sbjct  303   IVFQFVMFCSLEWNSEGTSGLSTYEKIVGSLFEVVNTRHAGLSVFDLSTFTPSILVLFAL  362

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKK-FNIIEKILLSPLGNLSIFIILICITEREKM  433
             MMYL   TTF P+  +N   K++    +K  +++E I LS    L IF ILIC+ E++KM
Sbjct  363   MMYLSSYTTFLPV--DNYEEKSEKMKKRKGRSLMEYISLSQPCCLVIFTILICVVEKDKM  420

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFIL  253
             K DPLNFNVLNI+ EVISAYG VG S GYSCARQI P+G CKD  +GF G+WSN GKFIL
Sbjct  421   KNDPLNFNVLNILFEVISAYGTVGLSIGYSCARQINPDGHCKDVTYGFAGKWSNTGKFIL  480

Query  252   IIVMFFGRLKKYHMKGGKAWKL  187
             IIVMFFGR KKY+ +GGKAWK+
Sbjct  481   IIVMFFGRSKKYNQRGGKAWKV  502



>ref|XP_007226528.1| hypothetical protein PRUPE_ppa025255mg [Prunus persica]
 gb|EMJ27727.1| hypothetical protein PRUPE_ppa025255mg [Prunus persica]
Length=554

 Score =   402 bits (1034),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 274/528 (52%), Positives = 365/528 (69%), Gaps = 31/528 (6%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPI-SFKLKDLDvfftavssa  1519
             +++   R +  R  PF +EL YF+ LS +GF+ LK  KPR   SF+ ++LD+FFT+VS++
Sbjct  32    LLVCYYRFVLRRAKPFWIELVYFVTLSFLGFWVLKALKPRTDPSFRPRNLDLFFTSVSAS  91

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVS--TTERVLEKNKV-  1348
             TVSSMSTVEMEVFSN QL+ +T LMF+GGE FTS +GL  ++ K+   T E+V   +   
Sbjct  92    TVSSMSTVEMEVFSNAQLIILTILMFIGGEVFTSMVGLQLWKLKLMLLTKEKVASASSDI  151

Query  1347  ---------IVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVED--------IKLLGC  1219
                      IV DHVELG + +     DLN         QI+   D        IK LGC
Sbjct  152   SPSSTPTNNIVFDHVELGSLASKPEFQDLNLGVEVYDQDQIDKPLDGESLKFNSIKFLGC  211

Query  1218  VRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCG  1039
             V V       Y++VIH +G  +V++Y+  + +A+ +LK K L++ TF+ FTTVSTFS+CG
Sbjct  212   VVV------GYLLVIHGLGVLMVSLYLAVISSARNILKNKELNMHTFSFFTTVSTFSSCG  265

Query  1038  FVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF--RQILGS  865
             FVPTNENM+VF +N GLLLILIPQ+LLGNTL P+CLR +IW LGK  ++ E     +L +
Sbjct  266   FVPTNENMMVFSKNTGLLLILIPQVLLGNTLLPSCLRFSIWVLGKIFKKKEHLCNYLLKN  325

Query  864   PNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVV  685
                LG+ HL     S  L  TV G I +QL  FL+LEW SD+++GL  Y+K++G+LF  V
Sbjct  326   TRKLGFLHLLPSLHSSLLVVTVLGFIMVQLVAFLSLEWSSDSLSGLNSYQKIIGALFQSV  385

Query  684   NSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNN--SKTKGCSPKKFNII  511
             NSRHTGE+I+DLS+++PA+L L VVMMYLPP T+F PI D++ N     +    ++  ++
Sbjct  386   NSRHTGETIVDLSIISPAILVLFVVMMYLPPYTSFLPIKDDDQNPLQPQERRKTRRGKVV  445

Query  510   EKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQ  331
             E ++ S L  L+IFI+L+CITER++MKEDPLNFNVLNIV+EVISAYGNVGF+TGYSC RQ
Sbjct  446   ENLIFSQLSYLAIFIVLVCITERKQMKEDPLNFNVLNIVIEVISAYGNVGFTTGYSCKRQ  505

Query  330   IKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             I P G C+DK +GF GRWS+ GK +LI VMFFGRLKK++M GG+AWKL
Sbjct  506   IHPNGDCQDKWYGFSGRWSDQGKLVLIAVMFFGRLKKFNMDGGRAWKL  553



>ref|XP_010690257.1| PREDICTED: sodium transporter HKT1-like [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   402 bits (1033),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 267/531 (50%), Positives = 351/531 (66%), Gaps = 23/531 (4%)
 Frame = -1

Query  1746  PNPSAFTPPISLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPIS  1567
             P    FT   SL+N      S    +     PF L L+YFIV+SL+G+ ALKVSKP   +
Sbjct  20    PKRPTFTTSYSLKN------SMFHYIISHAKPFWLHLTYFIVVSLLGYMALKVSKPNTNA  73

Query  1566  FKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK  1387
               L + D+FFT+VS++TVSSM+ +EMEVFSN QL+ MT LM LGGE FTS LGL   + K
Sbjct  74    NDLSNFDLFFTSVSASTVSSMTALEMEVFSNDQLIVMTILMILGGEVFTSMLGLLLRRCK  133

Query  1386  -VSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDS----AKSNVQIEVVED---IK  1231
              +S   + ++      I+ +ELG +      N + P  S    +  N++  +  D    K
Sbjct  134   SLSNESKKIDNTSQPTINSIELGTI------NQMLPLPSNTRGSSFNIESFISADDWSSK  187

Query  1230  LLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstf  1051
                 ++ L  VVL YI+ +H+VG TLV MYI   P+A  VL++KGL+L TF+ F  VSTF
Sbjct  188   YNNSIKCLGYVVLGYIITMHLVGSTLVTMYISLTPSASNVLERKGLNLHTFSFFIVVSTF  247

Query  1050  SNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQIL  871
             ++CGF PTNENM+VF++NPGLLLIL+PQ+ LGN+LYP  LR  IW L + T+R EF  +L
Sbjct  248   ASCGFAPTNENMMVFRKNPGLLLILMPQVFLGNSLYPPFLRFVIWVLERFTKRKEFDYML  307

Query  870   GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFV  691
              +   L YGHL S ++  +L AT    + LQ  +F A+EW S  + G++ Y+K+VGS F 
Sbjct  308   NNYQELKYGHLLSSKKCWYLTATTLAFVVLQFALFCAMEWSSGVMEGMSSYQKIVGSFFQ  367

Query  690   VVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN--  517
               N RH+GESI+D+SLL+ AVL L  VMMYLP  T+F PI D+   +     + KK N  
Sbjct  368   TANIRHSGESIVDISLLSGAVLVLFTVMMYLPAYTSFLPINDKQEEALKNNATMKKQNKK  427

Query  516   -IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSC  340
              I+E +L S L  L IF+I+ICITER+ +KEDPLNFNVLNIV EVISAYGNVG STGYSC
Sbjct  428   KIVENMLFSQLSYLVIFVIVICITERKSLKEDPLNFNVLNIVFEVISAYGNVGLSTGYSC  487

Query  339   ARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              R++K +G C+DK +GF GRWSN GKF LI+VMFFGRLK ++M GGKAW +
Sbjct  488   KRRLKIDGNCEDKFYGFCGRWSNGGKFTLILVMFFGRLKIFNMHGGKAWTM  538



>ref|XP_009597173.1| PREDICTED: sodium transporter HKT1-like [Nicotiana tomentosiformis]
Length=546

 Score =   402 bits (1032),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 260/514 (51%), Positives = 353/514 (69%), Gaps = 23/514 (4%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             + +  RVN   +++ YFI +SL GF  L++ KPR + F  ++LD+FF +VSS TVSSMST
Sbjct  38    KSILLRVNKIFVQIFYFIFISLFGFCILRILKPRSVDFTPRNLDLFFISVSSVTVSSMST  97

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK----------------VSTTERV  1366
             VEMEVFSN QL+ +TFLMF+GGE FTS +GLH  +SK                 +T+ R 
Sbjct  98    VEMEVFSNSQLILITFLMFIGGEIFTSMVGLHLIRSKFKPWRKDSKIESVISSTTTSPRN  157

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsy  1186
              + N  IV+D V +      +  ND   +D   S+ Q    + IK LG V ++      Y
Sbjct  158   SDFNDDIVLDIVVIPDSPKPKSENDEFQDDFGSSDKQTLKYQSIKFLGFVTLV------Y  211

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
             ++VI+++G + V +Y+  V +A+ VL+ KGL   TFA+FT VST ++CGFVPTNENM+VF
Sbjct  212   LLVINIIGVSSVLVYLACVSSARDVLRNKGLKTFTFAIFTVVSTLASCGFVPTNENMMVF  271

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
              +N GLLLILIPQ+L GNTLYPACLRL I FLGK +++ E + +L     + + HLF  +
Sbjct  272   SKNSGLLLILIPQVLFGNTLYPACLRLCIKFLGKFSKKREAKYLLKHSREIRHLHLFPSQ  331

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              S  L  TVFG I +QL +F +LEW+S ++ GL  Y+K+VGSLF VVN+RHTGE+I+D+S
Sbjct  332   HSRLLVVTVFGFILIQLIMFCSLEWKSSSLIGLNSYQKIVGSLFQVVNARHTGETIVDIS  391

Query  645   llapavlalivVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFNIIEKILLSPLGNLSIF  469
              +APA+L + +VMMYLPP T+F P+   E    +T G    +  + E ++LS L  +  F
Sbjct  392   TVAPAILVVFIVMMYLPPYTSFIPVKGAEETPEETVGEKQGRGKVAENLILSQLSYIIFF  451

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             I+LICITER++ K+DP NFNVLNI +EV+SAYGNVGF+TGYSC R I  +  CK+K +GF
Sbjct  452   IVLICITERKRTKDDPFNFNVLNITLEVVSAYGNVGFTTGYSCDRMINRDTTCKNKTYGF  511

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             VG+WS+ GK ILIIVMFFGRLKK++M+GGKAWKL
Sbjct  512   VGKWSDEGKLILIIVMFFGRLKKFNMQGGKAWKL  545



>ref|XP_010050941.1| PREDICTED: sodium transporter HKT1-like [Eucalyptus grandis]
Length=534

 Score =   400 bits (1028),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 258/532 (48%), Positives = 346/532 (65%), Gaps = 31/532 (6%)
 Frame = -1

Query  1725  PPISLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLD  1546
             P I   + H +  S +R LA R N F  +L+YF+++S +G++ALK+ +P+  S+K  DLD
Sbjct  16    PSIPQHSCHPVASSLLRNLARRANSFWTQLTYFVLVSAVGYWALKLCEPKSSSYKPCDLD  75

Query  1545  vfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERV  1366
             +FFT+VS+ TVSSMSTVEME FSN QLV +T LM  GGE FTS LGL+  +S+ +     
Sbjct  76    IFFTSVSANTVSSMSTVEMEAFSNSQLVIITLLMLFGGEVFTSMLGLYLSRSEFAGR---  132

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDL------------------NPEDSAKSNVQIEVVE  1240
                      DH E   VT++   N++                  +PE            E
Sbjct  133   ---------DHREANSVTSDHSDNNIKLELPPLHPVTEANTFKFDPEMKGMPLKPAPSGE  183

Query  1239  DIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttv  1060
              +      + L+ VVL Y  ++H  G TL++ YI  VP+A++VL+ +GL +  F+VF TV
Sbjct  184   GLLKHRATKYLSYVVLGYHFIVHAGGSTLLSAYISLVPSARKVLRHRGLTVQMFSVFMTV  243

Query  1059  stfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFR  880
             STF+NCGFVPTNENM+ FK NPGLL +L+PQ+LLGNTLYP CLR AIW L + T R EF 
Sbjct  244   STFANCGFVPTNENMLAFKHNPGLLWLLLPQVLLGNTLYPPCLRAAIWLLERVTGRAEFD  303

Query  879   QILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGS  700
              +L +   +GY +L  G     LAATV   + +Q      +EW S A+ GL+ YEK+VG+
Sbjct  304   YMLRNSGAMGYAYLLPGFHCLCLAATVGKFVLVQFVALCCMEWDSPAMEGLSPYEKLVGA  363

Query  699   LFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKF  520
             LF  VN+RH GES+ DLS+++PA+L L V+MMYLPP T+F P+ +     K +   P++ 
Sbjct  364   LFEAVNTRHAGESVFDLSIISPAILVLFVLMMYLPPHTSFLPVRNGETAPKIRRDEPRR-  422

Query  519   NIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSC  340
             +++  ++ S L  L IFIILIC+TERE +K DPLNFNVLNI +E ISAYGNVGFS GYSC
Sbjct  423   HLLTCLMFSQLSYLVIFIILICLTERENLKNDPLNFNVLNITIETISAYGNVGFSVGYSC  482

Query  339   ARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              R++  +  C+D ++GFVGRWSN GKFILIIVM FGRLKK++MKGG AW LS
Sbjct  483   KRRLNRDSPCRDAEYGFVGRWSNKGKFILIIVMLFGRLKKFNMKGGAAWSLS  534



>ref|XP_008361077.1| PREDICTED: sodium transporter HKT1-like [Malus domestica]
Length=538

 Score =   398 bits (1022),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 277/526 (53%), Positives = 359/526 (68%), Gaps = 40/526 (8%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRP---ISFKLKDLDvfftavssat  1516
             S  R L F  NPF  +L YF+ +SL G+ AL+V+KPR     SF+ KD D+FFT+VS+ T
Sbjct  28    SLFRVLLFHSNPFCFQLFYFLTVSLFGYLALRVTKPRTSTNTSFRPKDYDIFFTSVSATT  87

Query  1515  vssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV----------------  1384
             VSSMSTVEMEVFSN QL+ +T LM LGGE FTS LGL   +SK+                
Sbjct  88    VSSMSTVEMEVFSNTQLIILTILMLLGGEVFTSMLGLQIAKSKIFPKFLNHKDDNRVDVV  147

Query  1383  --STTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRV  1210
               +T     + N  I  + VELG V N+  H     E+  K+N++ +          +R+
Sbjct  148   VDNTRHHPPDSNNNISFEQVELGCV-NDRSH----LENDEKNNIKYK---------SIRI  193

Query  1209  LARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVP  1030
             L  VVL Y++V+H+ G TLV+MYI  VP+A+Q+L+ KG+ + TF++FTTVSTF+NCG+VP
Sbjct  194   LGYVVLGYLLVVHIGGSTLVSMYIALVPSARQILQTKGIKIQTFSIFTTVSTFANCGYVP  253

Query  1029  TNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLG  850
             TNENMIVFK+N GLLL+L+PQ+L+GNTLYP+CLR  IW L K T+R EF  IL +   LG
Sbjct  254   TNENMIVFKKNSGLLLLLLPQLLIGNTLYPSCLRFLIWLLQKITKRAEFSYILKNYKELG  313

Query  849   YGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHT  670
             Y HL S   S  LA TV G I  Q  +F  +EW+S+A+ GL+ YEK V S+F V NSRHT
Sbjct  314   YCHLLSSLHSFLLAFTVLGFIVAQFILFCVMEWKSEAMDGLSAYEKFVASIFQVTNSRHT  373

Query  669   GESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS----PKKFNIIEKI  502
             GES++DLS+L+PA+L   VVMMYLPP TTFFP   +   + +   S    P K  ++  +
Sbjct  374   GESVVDLSVLSPAILVFFVVMMYLPPYTTFFPTTSDCQETASANGSRIRNPIK-TLVGSL  432

Query  501   LLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP  322
             + S L  +++F+IL+CITER+KMK+DPLNFNVLNI +EVIS YGNVGFSTGYSC R +K 
Sbjct  433   IFSQLSYIAMFVILVCITERDKMKDDPLNFNVLNITIEVISGYGNVGFSTGYSCKRLLKH  492

Query  321   EGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             +  C+D  +GF GRWS  GKF+LI+VM FGRLKK+ MK GKAWKLS
Sbjct  493   DSACEDAWYGFAGRWSTQGKFVLILVMIFGRLKKFSMKQGKAWKLS  538



>ref|XP_007152992.1| hypothetical protein PHAVU_004G177300g [Phaseolus vulgaris]
 gb|ESW24986.1| hypothetical protein PHAVU_004G177300g [Phaseolus vulgaris]
Length=508

 Score =   397 bits (1019),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 264/500 (53%), Positives = 347/500 (69%), Gaps = 18/500 (4%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             LAF  NPFL +L YF++LS++GF  LK+SKPR  S    +LD+F+T+VS++T SSM  +E
Sbjct  23    LAFHFNPFLFQLCYFLILSVVGFLGLKLSKPRTPSMP-NNLDLFYTSVSASTTSSMVALE  81

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV-STTERVLEKNKVIVID--HVELG  1321
             MEVFSN QL+ +T LMFLGGE FTS L L   ++K+  TT      +     +   +ELG
Sbjct  82    MEVFSNSQLILLTLLMFLGGEVFTSMLDLLLARNKLFHTTINPFSHSHQSPTNATQIELG  141

Query  1320  LVTNNEYHNDLNPEDSAKSNVQIEVVEDIKL-LGCVRVLARvvlsyivvihvVGFTLVAM  1144
             LV+         P   ++++     V  I+L    +R L  VV  Y+V++ +VGF++V+ 
Sbjct  142   LVSI--------PHSKSENHTPSHNVACIRLKYNSLRYLTYVVFGYLVMVQLVGFSMVSF  193

Query  1143  YIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqi  964
             Y+  V +A+QVLK K + + TF++FT VSTF++CGFVPTNENM+VFK N GLLL+++P +
Sbjct  194   YMTVVASARQVLKNKDIKIATFSLFTIVSTFASCGFVPTNENMMVFKNNSGLLLLILPHV  253

Query  963   lLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIF  784
              LGNTLYP CL L +  L K TR+ EF  +L +   LGY HLFS  R   L  TVFGL  
Sbjct  254   FLGNTLYPPCLTLVLMVLEKVTRKEEFSHLLKNSKNLGYRHLFSVSRCCLLVCTVFGLNV  313

Query  783   LQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMM  604
             +Q  +F ++EW S+ + G+  YEKVV SLF V N+RH GES+ DLS ++ A+L L +VMM
Sbjct  314   VQFVMFWSVEWNSEIMEGMNLYEKVVASLFQVTNARHAGESVFDLSSISSAILVLFIVMM  373

Query  603   YLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKED  424
             YLPP TTF P+ +E N+ K  G S      +E ++LS L  L+IFIIL+CITER+ +KED
Sbjct  374   YLPPYTTFLPVREEENDVKRNGKSA-----VECVVLSQLSYLAIFIILVCITERKSLKED  428

Query  423   PLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIV  244
             P+NFNVLNI +EVISAYGNVGFS GYSC RQ+K +G CKD   GF GRWSN GKFILI+V
Sbjct  429   PINFNVLNITLEVISAYGNVGFSMGYSCGRQLKDDGMCKDSWVGFSGRWSNGGKFILILV  488

Query  243   MFFGRLKKYHMKGGKAWKLS  184
             MFFGRLKK++MKGGKAW LS
Sbjct  489   MFFGRLKKFNMKGGKAWHLS  508



>ref|XP_006453233.1| hypothetical protein CICLE_v10010667mg, partial [Citrus clementina]
 gb|ESR66473.1| hypothetical protein CICLE_v10010667mg, partial [Citrus clementina]
Length=531

 Score =   397 bits (1021),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 260/462 (56%), Positives = 313/462 (68%), Gaps = 38/462 (8%)
 Frame = -1

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLE---------------  1360
             EMEVFSN QL+ MT LMF+GGE F S  GLH  +SK  +  ++ E               
Sbjct  83    EMEVFSNFQLIIMTILMFVGGEVFISMFGLHA-RSKFYSLNQLFENRINPNLTPSSSSSS  141

Query  1359  -----KNKVIVIDHVELGLV-----TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRV  1210
                  +N     D +ELG+V     TN E +N L  E    SN      +D      VRV
Sbjct  142   SSSSSENSTEFTDQIELGIVSHSYITNEEPNNGLENEHRMSSN------DDNLKYNSVRV  195

Query  1209  LARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVP  1030
             L  VVL YI+V HVVG +LVA+Y    P+AKQ+LKQKGL + TF+VFTT STFSNCGFVP
Sbjct  196   LVYVVLGYILVTHVVGSSLVALYTSLAPSAKQILKQKGLQIFTFSVFTTASTFSNCGFVP  255

Query  1029  TNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLG  850
             TNENM+VFK+N  LLLIL PQ LLGNTLYP+CLR  IW L K T R EF  IL +   + 
Sbjct  256   TNENMMVFKKNALLLLILFPQGLLGNTLYPSCLRFVIWVLKKITNREEFDYILRNSKEMI  315

Query  849   YGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHT  670
             Y HL S   S FLA TVFG IF+QL +F ALEW S+A  GL  +EK+V SLF VVNSRHT
Sbjct  316   YRHLLSKAYSYFLAITVFGFIFVQLVLFCALEWDSEATDGLNFFEKLVASLFQVVNSRHT  375

Query  669   GESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSP  490
             GES+ D+S+++PA+L L VVMMYLPP T F P    + N K K    K F  ++  + S 
Sbjct  376   GESVFDISIVSPAILVLFVVMMYLPPYTAFLP----SRNCKEKKNKKKTF--VQNFIFSQ  429

Query  489   LGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQC  310
             L  L IFIIL+C TER+KMK+DPLNFNVLN+ +EVISAYGNVGFSTGYSC RQ++P+  C
Sbjct  430   LSYLVIFIILVCTTERDKMKKDPLNFNVLNVTIEVISAYGNVGFSTGYSCKRQLRPDSSC  489

Query  309   KDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             KD  +GFVGRWSN GK ILI+VMFFGR+KK++MKGGKAW++S
Sbjct  490   KDAWYGFVGRWSNQGKVILILVMFFGRIKKFNMKGGKAWQIS  531



>ref|XP_010263423.1| PREDICTED: probable cation transporter HKT7 [Nelumbo nucifera]
Length=562

 Score =   398 bits (1023),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 275/522 (53%), Positives = 356/522 (68%), Gaps = 30/522 (6%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             L F VNP  ++  YF+  SL+GF  LK+ KPRP + + KD DVFFT+VS+ATVSSMSTVE
Sbjct  43    LFFNVNPLWIQFFYFVSNSLMGFLVLKILKPRPDAVRPKDFDVFFTSVSAATVSSMSTVE  102

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVI-----------  1345
             MEVFS  QLV +T LM LGGE F S LGL    SK    +  +E NKV            
Sbjct  103   MEVFSIAQLVVLTVLMLLGGEVFLSMLGLQIESSKFMKKQEKIE-NKVDSLVSSDYLITS  161

Query  1344  -----VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGC--------VRVLA  1204
                  V + +ELGLV    +  +     S ++   I   +D +L+ C        +R L+
Sbjct  162   SIHTNVDNQIELGLVKVPHFERE--KPSSVETCRNIGTDDDDQLMSCSEDLKYDSIRYLS  219

Query  1203  RvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTN  1024
              VVL Y++V+HV GF LV+ Y+  VP+A+ VL+ K + + TF+VF  VSTF+NCGF+PTN
Sbjct  220   YVVLGYLLVVHVSGFALVSSYLSLVPSARNVLENKSISIHTFSVFAIVSTFTNCGFIPTN  279

Query  1023  ENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYG  844
             ENMIVF++N GLLL+LIPQ+LLGNTL+P+CLR  IW LG+ T+++EF+ IL +   +GY 
Sbjct  280   ENMIVFRKNAGLLLLLIPQVLLGNTLFPSCLRFVIWVLGRFTKKVEFKYILKNAGEVGYA  339

Query  843   HLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGE  664
             HL     S  L  TVFG I +Q  +F ++EW S+ + G+  Y+K+VG LF  VNSRH GE
Sbjct  340   HLLPSLHSFLLVVTVFGFILVQFVLFCSMEWNSEGLNGMNPYQKLVGCLFQTVNSRHAGE  399

Query  663   SIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKF---NIIEKILLS  493
             SI+DLSL++PAVL L VVMMYLPP T+F PI DE  +  +      K     ++E +  S
Sbjct  400   SIVDLSLVSPAVLVLFVVMMYLPPYTSFLPIKDEELSPASSSEKKTKSSWGRLMENLKFS  459

Query  492   PLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQ  313
              L  L IF+ILICI+ER+KMKEDPLNF VLNIV+EVISAYGNVGF+TGYSC RQ+ P+GQ
Sbjct  460   QLSYLFIFVILICISERKKMKEDPLNFTVLNIVIEVISAYGNVGFTTGYSCKRQLNPDGQ  519

Query  312   CKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             CKD  +GF GRWSN GK ILI+VMFFGRLKK++M+GG+ W+L
Sbjct  520   CKDTWYGFSGRWSNTGKLILIVVMFFGRLKKFNMEGGRTWRL  561



>ref|XP_004301408.1| PREDICTED: sodium transporter HKT1-like [Fragaria vesca subsp. 
vesca]
Length=497

 Score =   395 bits (1014),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 273/509 (54%), Positives = 342/509 (67%), Gaps = 66/509 (13%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKP-RPISFKLKDLDvfftavssatvssmstVEMEVF  1480
             NPF+ EL YF+++S +G+ AL V+KP    SF+ KD D+FFT+VSSATVSSMSTVEMEVF
Sbjct  37    NPFIFELGYFLMISFLGYLALMVTKPGTRTSFRPKDFDLFFTSVSSATVSSMSTVEMEVF  96

Query  1479  SNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIV---------IDHVE  1327
             SN QL+ MT LM LGGE FTS LGLH  +SK++        NKV V          D +E
Sbjct  97    SNTQLIIMTILMLLGGEIFTSMLGLHIAKSKIAK----FHDNKVDVELNSSNNNFSDRIE  152

Query  1326  LGLVTNNE--------YHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvih  1171
             LG+VT ++         HN L   +   S ++ +         C++ LA VVL Y++V+H
Sbjct  153   LGVVTLSQSESEQKPNIHNGLKTFEKNSSTIKYK---------CIKCLAYVVLGYLLVVH  203

Query  1170  vVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPG  991
             + G TL+++YI  VP+A++VLK KG+++ TFAVFTTVSTF+NCGFVPTNENMIVFK N G
Sbjct  204   IGGSTLISLYIILVPSARRVLKSKGIEIQTFAVFTTVSTFANCGFVPTNENMIVFKNNSG  263

Query  990   lllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFL  811
             LLL+LIP +L+GNTLYP  LR  IW L K TRR+EF  +L   N LGY H+ SG  S  L
Sbjct  264   LLLLLIPLLLIGNTLYPVILRFTIWCLEKITRRMEFSYMLKHYNELGYSHMLSGLHSVLL  323

Query  810   AATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapa  631
               TV G I +QL +F A+EW+S+A+ GL+GY+K V SLF  VNSRH GE ++DLS+++PA
Sbjct  324   LVTVLGFIAVQLILFCAMEWKSEAMDGLSGYQKFVASLFQTVNSRHAGEMVVDLSIISPA  383

Query  630   vlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             +L L V+MMYLPP TTF P +         GC                            
Sbjct  384   ILVLFVLMMYLPPYTTFDPAIG--------GCQE--------------------------  409

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSN  271
              ER+KMKEDPLNFNVLN+V EV+SAYGNVGFSTGYSC R++  EG CKD  +G VGR+S 
Sbjct  410   -ERQKMKEDPLNFNVLNVVTEVVSAYGNVGFSTGYSCKRRLNSEGDCKDAWYGLVGRFST  468

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GKFILI+VMFFGRLKK+ MK GKAWKLS
Sbjct  469   EGKFILILVMFFGRLKKFSMKQGKAWKLS  497



>ref|XP_009789270.1| PREDICTED: sodium transporter HKT1-like [Nicotiana sylvestris]
Length=546

 Score =   395 bits (1014),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 259/514 (50%), Positives = 353/514 (69%), Gaps = 23/514 (4%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             + +  RVN   +++ YFI +SL GF  L++ KPR + F  ++LD+FFT+VSS TVSSMST
Sbjct  38    KSILLRVNKIFVQMFYFIFISLFGFCILRILKPRSVDFTPRNLDLFFTSVSSVTVSSMST  97

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK----------------VSTTERV  1366
             VEMEVFSN QL+ +TFLMF+GGE FTS +GLH  +SK                 +T+ R 
Sbjct  98    VEMEVFSNSQLILITFLMFIGGEIFTSMVGLHLIRSKFKPWRKDSKIESVISSTTTSPRN  157

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsy  1186
              + N  I +D V +      +  +D   +D   S+ Q    + IK LG V ++      Y
Sbjct  158   SDFNDDIELDIVVIPDSPKQKSESDEFQDDFGSSDKQTLKYQSIKFLGFVTLV------Y  211

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
             ++VI+++G + V +Y+  V +AK VL+ KGL   TFA+FT VSTF++CGFVPTNENM+VF
Sbjct  212   LLVINIIGVSSVLVYLACVSSAKDVLRNKGLKTFTFAIFTVVSTFASCGFVPTNENMMVF  271

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
              +N GLLLILIPQ+L GNTLYPACLRL I FLGK +++ E + +L     + + HL   +
Sbjct  272   SKNSGLLLILIPQVLFGNTLYPACLRLCIKFLGKFSKKREAKYLLKHSREIRHLHLLPSQ  331

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              S  L  TVFG I +QL +F +LEW+S ++ GL  Y+K+VGSLF VVN+RHTGE+I+D+S
Sbjct  332   HSRLLVVTVFGFILIQLIMFCSLEWKSSSLNGLNSYQKIVGSLFQVVNARHTGETIVDIS  391

Query  645   llapavlalivVMMYLPPDTTFFPIMDENNN-SKTKGCSPKKFNIIEKILLSPLGNLSIF  469
              ++PA+L + +VMMYLPP T+F P+        +T G    +  + + ++LS L  +  F
Sbjct  392   TVSPAILVVFIVMMYLPPYTSFIPVKGVGETPEETVGEKQGRGKVAKNLILSQLSYIFFF  451

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             I+LICITER++MK+DPLNFNVLNI +EV+SAYGNVGF+TGYSC R I     CK+K +GF
Sbjct  452   IVLICITERKRMKDDPLNFNVLNITLEVVSAYGNVGFTTGYSCDRMINRYTTCKNKTYGF  511

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             VG+WS+ GK ILIIVMFFGRLKK++M+GGKAWKL
Sbjct  512   VGKWSDEGKLILIIVMFFGRLKKFNMQGGKAWKL  545



>ref|XP_008223908.1| PREDICTED: sodium transporter HKT1-like [Prunus mume]
Length=554

 Score =   394 bits (1013),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 272/517 (53%), Positives = 360/517 (70%), Gaps = 31/517 (6%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPI-SFKLKDLDvfftavssatvssmstVEME  1486
             R  PF +EL YF+ LS +GF  LK  K R   SF+ ++LD+FFT+VS++TVSSMSTVEME
Sbjct  43    RAKPFWIELVYFVTLSFLGFGVLKALKSRTDPSFRPRNLDLFFTSVSASTVSSMSTVEME  102

Query  1485  VFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVS--TTERVLEKNKVI----------V  1342
             VFSN QL+ +T LMF+GGE FTS +GL  ++ K+   T E+V   +  I          V
Sbjct  103   VFSNAQLIILTILMFIGGEVFTSMVGLQLWKFKLMLLTKEKVASASSDINPSSTPTNNIV  162

Query  1341  IDHVELGLVTNNEYHNDLN------PEDSAKSNVQIEVVE--DIKLLGCVRVLARvvlsy  1186
               HVELG + +     DLN       +D     +  E ++   IK LGCV V       Y
Sbjct  163   SYHVELGSLASKPEFQDLNLGVVVYDQDQIDKQLDGESLKFNSIKFLGCVVV------GY  216

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
             ++VIH +G  +V++Y+  + +A+ VLK KGL++ TF+ FTTVSTFS+CGFVPTNENM+VF
Sbjct  217   LLVIHGLGVLMVSLYLAVISSARNVLKNKGLNMHTFSFFTTVSTFSSCGFVPTNENMMVF  276

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF--RQILGSPNGLGYGHLFS  832
              +N GLLLILIPQ+LLGNTL P+CLR +I  LGK  ++ E     +L +   LG+ HL  
Sbjct  277   SKNSGLLLILIPQVLLGNTLLPSCLRFSIRVLGKIFKKKEHLCNYLLKNTRKLGFLHLLP  336

Query  831   GRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIld  652
                S  L  TVFG I +QL  FL+LEW SD+++GL  Y+K++G+LF  VNSRHTGE+I+D
Sbjct  337   SLHSSLLVVTVFGFIMVQLVAFLSLEWSSDSLSGLNSYQKIIGALFQSVNSRHTGETIVD  396

Query  651   lsllapavlalivVMMYLPPDTTFFPIMDENNN--SKTKGCSPKKFNIIEKILLSPLGNL  478
             LS+++PA+L L V+MMYLPP T+F PI D++ N     +    ++  ++E ++ S L  L
Sbjct  397   LSIISPAILVLFVLMMYLPPYTSFLPIKDDDQNPLQPHERRKTRRGKVVENLIFSQLSYL  456

Query  477   SIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQ  298
             +IFIIL+CITER++MKEDPLNFNVLNIV+EVISAYGNVGF+TGYSC RQI P G C+DK 
Sbjct  457   AIFIILVCITERKQMKEDPLNFNVLNIVIEVISAYGNVGFTTGYSCKRQIHPNGDCQDKW  516

Query  297   FGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +GF GRWS+ GK +LI VMFFGRLKK++M GG+AWKL
Sbjct  517   YGFSGRWSDQGKLVLIAVMFFGRLKKFNMDGGRAWKL  553



>ref|XP_004513135.1| PREDICTED: LOW QUALITY PROTEIN: probable cation transporter HKT6-like 
[Cicer arietinum]
Length=555

 Score =   394 bits (1012),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 263/526 (50%), Positives = 354/526 (67%), Gaps = 31/526 (6%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +  R NP  ++++YFI LS++GF  LK   P P     K+LD+FFT+VSSATVSSMST
Sbjct  31    RFILLRANPLWIQITYFISLSILGFGFLKALNPNPNLETTKNLDLFFTSVSSATVSSMST  90

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV--------STTERVLEKNKVIV  1342
             VEMEVFSN QL+ +T LMF+GGE FTS +GLHF +S++        S+  R+   N VIV
Sbjct  91    VEMEVFSNSQLIIITILMFIGGEIFTSMVGLHFIRSRLKKELDKIASSHARLASLNSVIV  150

Query  1341  ID---HVELGLVTN------------NEYHNDLNPEDSAKSNVQIEVVEDIKLLG-----  1222
                   VELG+ +N            NE HN  +   S  +NV  +  E +         
Sbjct  151   DQIHFEVELGINSNSHNKSHESLSTINEVHNKSHESLSTTNNVHNKSHESLSTTNENLRY  210

Query  1221  -CVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSN  1045
               ++ L  V+L+Y V+IH++G   V++Y   + +AK+VL++KGL + TF+ FT VSTF++
Sbjct  211   MSIKYLGYVILAYFVIIHIIGVFGVSLYFAIITSAKKVLEKKGLKMLTFSTFTIVSTFAS  270

Query  1044  CGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGS  865
             CGFVPTNENMIVF++N GLL++LIPQ+LLGNTLYP CLR  IW LGK         +L +
Sbjct  271   CGFVPTNENMIVFRKNSGLLIMLIPQVLLGNTLYPPCLRFCIWVLGKLXXXXXCGYLLKN  330

Query  864   PNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVV  685
                +GY HL  G+ S F+  +VFG I +Q+T+F  L+W  + + GL  Y+K++G LF  V
Sbjct  331   AEEVGYKHLLQGKHSVFIVLSVFGFIMVQVTLFCLLDWNLEGLKGLNWYQKMIGVLFQSV  390

Query  684   NSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEK  505
             NSRHTGE+I+DLS ++ A+L L V MMYLPP T+F P+ DE    K++    K+  +++ 
Sbjct  391   NSRHTGETIVDLSTVSQAILVLFVFMMYLPPYTSFLPLKDEG--EKSERMKKKRGKVMDN  448

Query  504   ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIK  325
             ++ S L  L IFIIL+CITER+ +K+DPLNFNV NIV EV+SAYGNVGFSTGYSC RQ+ 
Sbjct  449   LIFSQLSYLLIFIILVCITERKHLKDDPLNFNVFNIVFEVVSAYGNVGFSTGYSCERQLH  508

Query  324   PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              +  C++K  GFVG+WS+ GK ILIIVMFFGRLKK++M GGK WKL
Sbjct  509   RDANCENKWIGFVGKWSDEGKIILIIVMFFGRLKKFNMDGGKPWKL  554



>ref|XP_010263413.1| PREDICTED: probable cation transporter HKT7 [Nelumbo nucifera]
Length=546

 Score =   393 bits (1010),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 268/518 (52%), Positives = 357/518 (69%), Gaps = 20/518 (4%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssat  1516
             M+   +R L F +NP  +++ YF+ +S +GF  LK   PRP S + KDLDVFF +VS++T
Sbjct  33    MVWPFLRFLIFHLNPLWVQICYFVSISFMGFLVLKTLNPRPDSIRPKDLDVFFMSVSAST  92

Query  1515  vssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID  1336
             VSSMST+EMEVFSN QLV +T LM LGGE F   L L   +SK    ER+  +     +D
Sbjct  93    VSSMSTIEMEVFSNAQLVVLTVLMLLGGEVFLFMLELQIARSKSKKQERIENRE----VD  148

Query  1335  HVELGLVTNNEYHNDLNPED--------SAKSNVQIEVVEDIKLLGC-------VRVLAR  1201
              +   L ++    N +N  D        +   N  +E   +IK +G        ++ L  
Sbjct  149   SIGFELSSSCP-RNVVNRIDELGLIRVITVPHNSIMEARNEIKSMGSKDVEYNSIKYLNY  207

Query  1200  vvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNE  1021
              VL Y +VIHVVG  L+ +Y+ FVP+A  VLK K L + TF+VFTTVSTF+NCGF+PTNE
Sbjct  208   SVLGYFLVIHVVGSALILLYLIFVPSAGDVLKNKNLQIQTFSVFTTVSTFANCGFLPTNE  267

Query  1020  NMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGH  841
             N+IVF+++ GLLL+LIPQ+LLGNTL+P CLR  IW L + +RR EF  IL +   +GY H
Sbjct  268   NLIVFRKDAGLLLLLIPQVLLGNTLFPPCLRFMIWVLWRLSRREEFNYILNNTREMGYIH  327

Query  840   LFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGES  661
             LF    S  L  TVFG I +Q  +F ++EW S+++AG+  Y+K+VG+LF  VNSRH GES
Sbjct  328   LFPNLHSFLLVVTVFGFILIQFILFCSMEWNSESLAGMNPYQKLVGALFQTVNSRHAGES  387

Query  660   IldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGN  481
             I+DLS+++PA+L L VVMMYLPP T+F PI DE  + +T     ++ +++E ++ S L  
Sbjct  388   IIDLSIVSPAILVLFVVMMYLPPYTSFLPIKDEEKSQRTTNRMRRRESLLENLIFSQLSY  447

Query  480   LSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDK  301
             L +FIILICITER+KMKEDPLNF VLNI++EVISAYGNVGF++GYSC RQ+K +  CKD 
Sbjct  448   LVMFIILICITERKKMKEDPLNFTVLNIIMEVISAYGNVGFTSGYSCKRQLKLDSHCKDT  507

Query  300   QFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              +GF GRWSN GK ILI+VMFFGRLKK++M+GG+ WKL
Sbjct  508   WYGFSGRWSNKGKLILILVMFFGRLKKFNMEGGRGWKL  545



>gb|EYU25742.1| hypothetical protein MIMGU_mgv1a005209mg [Erythranthe guttata]
Length=493

 Score =   391 bits (1004),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 253/509 (50%), Positives = 332/509 (65%), Gaps = 45/509 (9%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             L FR+NPFL EL YF+ LS +GF ALK +   P     + +D+FFT+ S+ TVSSMST+E
Sbjct  17    LLFRLNPFLFELGYFVTLSSVGFLALKSTSSNPA----RKIDLFFTSASAVTVSSMSTLE  72

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVT  1312
             MEVFS   LV +T LM LGGE FTS LGL   ++K++                       
Sbjct  73    MEVFSTTHLVILTVLMLLGGEVFTSMLGLRLTKAKIN-----------------------  109

Query  1311  NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGF  1132
             NN+  +     +  +SN  + +        C+ +LA +V  Y++ +H VG   + +Y+  
Sbjct  110   NNQIRSRQMIAEFDRSNSDVNMKRK-----CIEILASLVTWYLLAVHAVGSASIVVYLSL  164

Query  1131  VPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGN  952
             VP+A++VL++KG+ +  F+VFT VSTF+NCGFVPTNENMIVFK+N GLLLILI  + +GN
Sbjct  165   VPSARRVLERKGIGMGIFSVFTAVSTFANCGFVPTNENMIVFKKNSGLLLILIQLVFMGN  224

Query  951   TLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLT  772
             TLYP CLRL IWF  K T+R E R +L +   LGYGHL  G  S +L  TV G + +Q+ 
Sbjct  225   TLYPVCLRLLIWFTEKVTKRAELRYVLENSRELGYGHLMPGLESVYLGITVLGFVVVQMV  284

Query  771   VFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPP  592
             VF +LEW ++ +     YE++VG LF VVNSRH GES+ DL +++PAVL L V+MMYLPP
Sbjct  285   VFCSLEWNNNFLGVSNYYERIVGCLFQVVNSRHAGESVFDLGVVSPAVLVLFVIMMYLPP  344

Query  591   DTTFFPI-----MDENNN----SKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
              T++ PI      DEN      + T     K +   E I+ S L  LSIF+ILICITER+
Sbjct  345   YTSYLPINEHQVADENITKHIINTTLTSRNKVYYKWENIVFSQLTYLSIFVILICITERQ  404

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQ----CKDKQFGFVGRWSN  271
              MK DP+NFNVLNIVVEVISAYGNVGFS GYSC +Q+   G     CKD  +GF GRWS+
Sbjct  405   NMKTDPINFNVLNIVVEVISAYGNVGFSVGYSCEKQMHYSGGGAAVCKDAWYGFAGRWSD  464

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GKF+LI+VMF GRLKK++M+GG+AW L+
Sbjct  465   EGKFVLIVVMFIGRLKKFNMRGGRAWILA  493



>ref|XP_008781917.1| PREDICTED: cation transporter HKT8-like [Phoenix dactylifera]
Length=528

 Score =   392 bits (1007),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 257/527 (49%), Positives = 342/527 (65%), Gaps = 23/527 (4%)
 Frame = -1

Query  1743  NPSAFTPPISLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISF  1564
             +P    PP  + +     +S  + L F  NP  ++L YF  +S IGF  LK+   R  + 
Sbjct  16    SPLHMQPPSFISSFRDFAVSVYQFLLFHANPLWIQLCYFFFVSSIGFLLLKILPMRDAAS  75

Query  1563  KLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV  1384
             K +D D+FF AVS+ TVSSM  VEME FSN QLV +T LM +GGE FTS +GL F   K+
Sbjct  76    KPEDFDLFFMAVSANTVSSMVAVEMESFSNSQLVILTLLMLVGGEVFTSIVGLQFTMIKL  135

Query  1383  STTE--------RVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKL  1228
                E         +  K +  V D +ELG V +      ++PE  +           IK 
Sbjct  136   EKKETPYNKASIELSSKVRAEVPDQLELGTVESGA----ISPESGSDLRYN-----SIKH  186

Query  1227  LGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfS  1048
             LG V VL      Y +V HV+G+ L+ +Y+  +P+A+ VL+ KG+   TF++FT VS+F+
Sbjct  187   LGFV-VLG-----YFLVFHVIGYVLILVYLSLIPSARAVLEGKGIHFHTFSIFTMVSSFT  240

Query  1047  NCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILG  868
             NCGF+PTNENM+VFK   GLLL+++ QIL GNT++P+ LRL IW L K T+R EF  ++ 
Sbjct  241   NCGFIPTNENMMVFKNCSGLLLLIVAQILAGNTMFPSFLRLVIWILKKHTKRQEFDYMVR  300

Query  867   SPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVV  688
             +   +G+ HL  G  +  LA TV G + +QL +F  LEWRS+ + GL  Y K+VGSLF  
Sbjct  301   NHGEMGFDHLLPGPHAVLLALTVLGFVLVQLILFCCLEWRSEGLDGLNPYRKIVGSLFQS  360

Query  687   VNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIE  508
             VNSRH GESI+D+S ++PA+L L VVMMYLPP T+F P+ D N  S+ K    K+ N+++
Sbjct  361   VNSRHAGESIVDISTVSPAILVLYVVMMYLPPCTSFIPLGDGNGPSERKEGGSKRKNLVQ  420

Query  507   KILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQI  328
              + LS L  L+IF+I+ICITER+K+ EDPLNF+VLNIV+EVISA+GNVGFSTGYSC RQ+
Sbjct  421   NLTLSQLSILAIFVIIICITERKKLSEDPLNFSVLNIVIEVISAFGNVGFSTGYSCKRQL  480

Query  327   KPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             KP GQC D   GF G+WS  GK  LI VM FGRLKK+ M GG+AWKL
Sbjct  481   KPTGQCVDTWVGFSGKWSTEGKLTLIAVMLFGRLKKFSMGGGRAWKL  527



>gb|KEH27269.1| high-affinity potassium transporter [Medicago truncatula]
Length=550

 Score =   392 bits (1006),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 261/515 (51%), Positives = 361/515 (70%), Gaps = 21/515 (4%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +  R NP  +++ YF  LS +GF  LKV KP  +    K+LD+FFT++S+ TVSSMST
Sbjct  38    RFILLRANPLWVQIVYFTSLSTLGFGFLKVLKP--LGETPKNLDLFFTSISATTVSSMST  95

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQS-------KVSTTERVLEKNKVIVI  1339
             VEM+ FSN QL+ +T LMF+GGE FTS +GL F +S       K++++   L       I
Sbjct  96    VEMQNFSNPQLIIITILMFIGGEVFTSMVGLFFIRSRLKTELDKIASSHARLASINTFNI  155

Query  1338  D--HVELGLVTN---NEYHNDL-NPEDSAKSNVQIEVV----EDIKLLGCVRVLARvvls  1189
             +  H+E+ +VTN   N+ H  L N    +  N+  E +    E+++ L  ++ L  VV +
Sbjct  156   EQIHLEVEMVTNEVHNKSHESLHNKSHQSLHNMSHESLSTTNENLRYLS-MKYLGYVVFA  214

Query  1188  yivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIV  1009
             Y ++IH++G   V++Y+  +P+AKQ+LK KGL + TF+VFT VSTF++CGFVPTNENM+V
Sbjct  215   YFLIIHIIGVIGVSIYLAIIPSAKQILKNKGLKMFTFSVFTIVSTFASCGFVPTNENMVV  274

Query  1008  FKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSG  829
             F++N GLLL+LIPQ+LLGNTLYP CLR  IW LGK  ++ E R +L     +GY HL  G
Sbjct  275   FRKNSGLLLMLIPQVLLGNTLYPPCLRFCIWVLGKFYKKKECRYLLKHSEEVGYKHLLKG  334

Query  828   RRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldl  649
             + S  L ATVFGLI +Q+T+F A++W S+ + GL  Y+K++G LF +VNSRHTGE+++D+
Sbjct  335   KHSICLVATVFGLIMVQVTLFCAMDWDSEGLKGLNFYQKMIGVLFQIVNSRHTGETVVDI  394

Query  648   sllapavlalivVMMYLPPDTTFFPIMDENNNS-KTKGCSPKKFNIIEKILLSPLGNLSI  472
             S L+ A+L L V+MMYLPP T+F P+  +  NS ++K     +  + E ++ S L  L I
Sbjct  395   SNLSQAILVLFVLMMYLPPYTSFLPLKSDGKNSERSKRMKKIRGKVTENLIFSQLSYLVI  454

Query  471   FIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFG  292
             FIIL+CITER+K+KEDPLNFNVLNIVVEV+SAYGNVGF+ GYSC RQ+  E  C++K  G
Sbjct  455   FIILVCITERKKLKEDPLNFNVLNIVVEVVSAYGNVGFTMGYSCERQLHLEINCENKWIG  514

Query  291   FVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             FVG+WS+ GK ILI++M FGRLKK++M GGK WKL
Sbjct  515   FVGKWSDEGKIILILIMLFGRLKKFNMDGGKPWKL  549



>ref|XP_002270300.1| PREDICTED: sodium transporter HKT1-like [Vitis vinifera]
Length=545

 Score =   391 bits (1004),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 265/515 (51%), Positives = 357/515 (69%), Gaps = 27/515 (5%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +  R N FL++L YF+ LS  GF+ LK  KPR    + ++LD+FFT+VS+ATVSSMST
Sbjct  39    RFVILRFNTFLVQLCYFLCLSFQGFWVLKALKPRT-PLRPRNLDLFFTSVSAATVSSMST  97

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID------  1336
             VEMEVFSN QL+ +T LMF+GGE FTS + L  ++SK+   + ++ +N+V  +       
Sbjct  98    VEMEVFSNNQLLILTLLMFVGGEIFTSMVELQLWRSKLK--KPLIAENQVNSVSNNSSAP  155

Query  1335  --------HVELGLVTNNEYHNDLNPEDSAKSNVQIEV----VEDIKLLGCVRVLARvvl  1192
                       EL +VT     N     D  +S ++        E +K    ++ L  VV+
Sbjct  156   PDPRNPFGQFELRVVTVPSMSNSTLETDEVQSQIEGRTKSLSSESLKY-HSIKFLGFVVM  214

Query  1191  syivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMI  1012
              Y+VV+HV+G TLV+ YI  V +A+ VLKQKGL L TF++FTTVST ++CGFVPTNENMI
Sbjct  215   GYLVVVHVLGVTLVSAYIALVSSARDVLKQKGLKLFTFSLFTTVSTLASCGFVPTNENMI  274

Query  1011  VFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFS  832
             VF +N GLLLI+IPQ+LLGNTL+P+CLR +IW LGK  +++E   +L S   +G+ HL  
Sbjct  275   VFSKNSGLLLIIIPQVLLGNTLFPSCLRFSIWTLGKF-KKVESNYLLISTREIGFLHLLP  333

Query  831   GRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIld  652
                S  L  TV G I +Q T+F ++EW S+ + GL  Y+K++G+LF  VNSRHTGE+I+D
Sbjct  334   SLHSTLLVPTVLGFILIQFTLFCSMEWNSEGLNGLNSYQKIIGALFQSVNSRHTGETIVD  393

Query  651   lsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSI  472
             +S L+PA+L L+VVMMYLPP T+F PI +  N  + +    ++  I+E ++ S L  L+I
Sbjct  394   ISTLSPAILVLVVVMMYLPPYTSFLPIKEICNGGRKR----RRGKIVENLIFSQLSYLAI  449

Query  471   FIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFG  292
             FIILICITER+KMK+DPLNF VLNIV+EVISAYGNVGF+ GYSC R +KP+  C+ K FG
Sbjct  450   FIILICITERKKMKDDPLNFTVLNIVIEVISAYGNVGFTAGYSCERLLKPDSSCQSKWFG  509

Query  291   FVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             F G+WS+ GK ILI VMFFGRLKK++M GG+AWKL
Sbjct  510   FSGKWSDEGKIILIFVMFFGRLKKFNMDGGRAWKL  544



>gb|AAO73474.1| high affinity potassium transporter 2 [Mesembryanthemum crystallinum]
Length=543

 Score =   390 bits (1003),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 262/506 (52%), Positives = 354/506 (70%), Gaps = 14/506 (3%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             + +R++ F +E+ YFI +S +GF  L+  KPR    K  +LD+FFT+VS+ATVSSM+TVE
Sbjct  40    ITYRMSHFSIEVCYFIFVSCLGFLILRNIKPRTYPVKPGELDMFFTSVSAATVSSMATVE  99

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEK--NKVIVI-------  1339
             MEVFS+ QL  MT LMF+GGE FTS +GLHF  S++  T   ++   N V  +       
Sbjct  100   MEVFSDAQLHIMTILMFIGGEVFTSMVGLHFKASRLGNTPLGVKSRANSVASLPCPPEDF  159

Query  1338  DHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGF  1159
             DH+ELG++T              K+  +I+ +   +    +RVL  VVL+Y++++HV+G 
Sbjct  160   DHIELGIITTTTTTTTTTTTTLQKTKSEIDFLLKSR---SIRVLGFVVLAYLLIVHVLGT  216

Query  1158  TLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGllli  979
              +V  Y+   P+AK+VL+ KGL   TFA+FT+VSTFS+CGFVPTNENMI+F++N GLLL+
Sbjct  217   IMVYAYLRIEPSAKRVLETKGLKSITFAIFTSVSTFSSCGFVPTNENMIIFRQNSGLLLM  276

Query  978   lipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATV  799
             LIPQ+LLGNTL P+ LRL IW LGK T++ E + ++ +   + Y HL   + S ++  TV
Sbjct  277   LIPQVLLGNTLLPSFLRLTIWVLGKFTKKDESKYLMRNTKEIAYHHLLPTKHSKYVVVTV  336

Query  798   FGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
             FG I   L +F +++W    ++ L  Y+K+VG+LF  VN+RHTGE+I+DLS +A AVL +
Sbjct  337   FGFILASLIMFCSMDWNLKGLSDLNVYQKLVGALFQCVNARHTGETIVDLSTIASAVLVV  396

Query  618   ivVMMYLPPDTTFFPIMD--ENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITE  445
              V+MMYLPP T+F P  D  E      KG   K   I++ ++ S L  L IFIIL+CITE
Sbjct  397   FVIMMYLPPYTSFLPTKDGEEEYPLVYKGEKTKGKLILDNVVFSQLSYLVIFIILVCITE  456

Query  444   REKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMG  265
             R+ MKEDPLNFNVLNIVVEVISAYGNVGFSTGYSC+RQ+KP+  C DK +GFVG+WS+ G
Sbjct  457   RKSMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCSRQLKPDANCVDKWYGFVGKWSDQG  516

Query  264   KFILIIVMFFGRLKKYHMKGGKAWKL  187
             K ILI VMFFGRLKK++MKGG+AWKL
Sbjct  517   KIILIFVMFFGRLKKFNMKGGRAWKL  542



>ref|XP_004513109.1| PREDICTED: sodium transporter HKT1-like isoform X1 [Cicer arietinum]
Length=524

 Score =   390 bits (1001),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 261/530 (49%), Positives = 354/530 (67%), Gaps = 44/530 (8%)
 Frame = -1

Query  1707  NKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftav  1528
             N      S  R L+F++N F ++L YFI+LSL G+  LK SKPR   F+ KD D+F+T+V
Sbjct  17    NNFNFHRSLSRSLSFQLNSFFIQLFYFIILSLFGYLGLKFSKPRT-CFRPKDFDLFYTSV  75

Query  1527  ssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKV  1348
             S++TVSSM+++EMEVFSN QL+ +TFLM  GGE FTS L L  F ++ S T+    KN+ 
Sbjct  76    SASTVSSMTSIEMEVFSNFQLILLTFLMLAGGEVFTSMLQL--FLARFSFTQNQCVKNEY  133

Query  1347  IV-------------IDHVELGLVT-------NNEYHNDLNPEDSAKSNVQIEVVEDIKL  1228
                            I+ +ELGLV+       + + H++ N +D  K N           
Sbjct  134   SSTTLSLKHDPSHNQINQIELGLVSIPHHSENHTQNHHNFNDKDKLKYN-----------  182

Query  1227  LGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfS  1048
                +R L+ VVL Y+++IH  GF+LV  Y+ ++P+AK VLK KG+ + TF++F  VSTF+
Sbjct  183   --SLRYLSYVVLGYLMLIHFFGFSLVTFYLTYIPSAKYVLKNKGIKIETFSLFLIVSTFA  240

Query  1047  NCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILG  868
             +CG+VPTNEN+IVFK+N GLLL+++P +L GNTLYP CLRL +  +   T+R EF  +L 
Sbjct  241   SCGYVPTNENLIVFKKNSGLLLLILPHVLFGNTLYPPCLRLFLKVMKSVTKREEFSYLLK  300

Query  867   SPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVV  688
             +   +GY HL SG    FL  TVFG I +QL +F ++EW S+ + GL  Y+K+V SLF V
Sbjct  301   NSKEIGYDHLLSGIHCWFLLVTVFGFIVIQLVLFCSMEWNSNIMEGLNPYQKLVASLFQV  360

Query  687   VNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDE--NNNSKTKGCSPKKFNI  514
              N+RH+GES+ DLS ++ A+L + +VMMYLPP TT+ P+ D   N+  K + C      +
Sbjct  361   TNARHSGESVFDLSAISSAILVIFIVMMYLPPYTTYLPLRDHEINDAKKDQKC------L  414

Query  513   IEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR  334
             ++ ++ S L  L IFIILICITER+ +KEDPLNFNV NI +EVISAYGNVGFSTGYSC+R
Sbjct  415   VDCLVFSQLSYLLIFIILICITERQSLKEDPLNFNVFNITLEVISAYGNVGFSTGYSCSR  474

Query  333   QIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             Q+     CKD   GF G+WS  GKFILI+VMFFGRLKK++M GGKAW LS
Sbjct  475   QLNHNSMCKDSWIGFSGKWSTKGKFILILVMFFGRLKKFNMNGGKAWHLS  524



>gb|AAF97728.1|AF176035_1 potassium-sodium symporter HKT1 [Eucalyptus camaldulensis]
Length=550

 Score =   390 bits (1003),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 264/523 (50%), Positives = 361/523 (69%), Gaps = 16/523 (3%)
 Frame = -1

Query  1710  RNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvffta  1531
             R+   ++    R L  RVN F +++ YF+ LS +GF+ LK   PR  SF+ +DLD+FFT+
Sbjct  28    RSLCFLLSCCFRFLLLRVNSFCIQVFYFVFLSFLGFWVLKALGPRTDSFRPRDLDLFFTS  87

Query  1530  vssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK----VSTTERVL  1363
             VS+ TVSSMSTVEMEVFSN QLV MT LMF+GGE F S +GLH  +SK    + T ++V 
Sbjct  88    VSATTVSSMSTVEMEVFSNSQLVVMTVLMFIGGEVFISLVGLHLRKSKLRWRIRTEDKVA  147

Query  1362  EKNKVI--------VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVL  1207
               +  +        ++DH+ELG+V   +  N        +   +   ++ +K    VR L
Sbjct  148   SADGNLCPSAPTNDIVDHIELGVVAKTDCLNSQVEPQFYRPQDKSSDLDYLKYCS-VRFL  206

Query  1206  ARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPT  1027
               VVL Y++V+ V+G   V++YI  VP+A+ VLK+KGL + TF+VFTTVSTF++CGFVPT
Sbjct  207   CYVVLGYLLVVQVLGVAAVSLYITLVPSARDVLKKKGLKMVTFSVFTTVSTFASCGFVPT  266

Query  1026  NENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGY  847
             NENMI+F +N GLLLILIPQ LLGN L+P+ LRL +W +G+ + + E   +L   + +GY
Sbjct  267   NENMIIFSKNSGLLLILIPQALLGNMLFPSSLRLTLWLIGRFSEKDEIGYLLSRTSEIGY  326

Query  846   GHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTG  667
              HL     S  L  TV G + +Q  +F +++W S+++ GL+  EK+VG+LF  VNSRHTG
Sbjct  327   KHLLPSLYSSLLGVTVLGFVGIQFIMFCSMQWDSESLNGLSSCEKIVGALFQCVNSRHTG  386

Query  666   ESIldlsllapavlalivVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFN--IIEKILL  496
             E+++DLS +APA+L L VVMMYLPP T+F P+  +E      +   PK+    ++E +  
Sbjct  387   ETVVDLSTVAPAILVLFVVMMYLPPYTSFLPVKGNERFPENGERRKPKQSYRLLLENLKF  446

Query  495   SPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEG  316
             S L  L+IFII+ICITER+KMKEDPLNFNVLNIVVEV+SAYGNVGF+TGYSC RQ++P  
Sbjct  447   SQLSYLAIFIIVICITERKKMKEDPLNFNVLNIVVEVVSAYGNVGFTTGYSCERQLRPVK  506

Query  315   QCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              C+DK +GF G+WS+  K ILI+VMFFGRLKK++MKGG+AW L
Sbjct  507   GCEDKWYGFSGKWSDESKIILIVVMFFGRLKKFNMKGGRAWIL  549



>ref|XP_011077901.1| PREDICTED: sodium transporter HKT1-like [Sesamum indicum]
Length=534

 Score =   388 bits (996),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 267/514 (52%), Positives = 354/514 (69%), Gaps = 28/514 (5%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R L F +NPFL  + YFI LS +GF  LK  KPR  SF  +++D+FFT+VSSATVSSMST
Sbjct  31    RDLLFTINPFLTYILYFISLSSVGFGVLKALKPRT-SFTPRNIDLFFTSVSSATVSSMST  89

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             VEMEVFSN QL+ MT LMF+GGE FTS +GLH  + K+  T +   K     ++ VE   
Sbjct  90    VEMEVFSNAQLIVMTVLMFVGGEVFTSMVGLHLKRFKIIRTWKSQVK-----VESVE---  141

Query  1317  VTNNEYHNDLNPEDSAKSNV---------QIEVVEDI-----KLLGC--VRVLARvvlsy  1186
              ++      ++P D  + NV         + E  +D+       L C  ++ L  +VL Y
Sbjct  142   -SDPRSPPPIDPSDQMELNVVTVPERGLARFESQQDVFSSYNPFLKCDSIKFLGFLVLGY  200

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
             +VVIH++G T + +Y+  V +A  V+K KG+   TFA+FT VSTF++CGFVPTNENMIVF
Sbjct  201   LVVIHILGVTSILVYLALVSSANDVVKNKGIKTFTFAIFTIVSTFASCGFVPTNENMIVF  260

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
              +N GLL ILIPQ+L GNTL+P+CLRL IW +GK  +++E   +L      GY HL    
Sbjct  261   GKNSGLLWILIPQVLFGNTLFPSCLRLLIWVVGKNIKKVEANYLLNHTTEAGYMHLLPRL  320

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              S  LAATV G I L   +F +LEW S A++GL  Y+KVVG LF  VN+RHTGE+I+D+S
Sbjct  321   HSVLLAATVLGFILLGFIIFCSLEWNSAALSGLNTYQKVVGILFQCVNARHTGETIVDIS  380

Query  645   llapavlalivVMMYLPPDTTFFPI-MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIF  469
              +APA+L   VVMMYLPP T+F PI  DE +  +++G   K+    + ++ S L  L+IF
Sbjct  381   TIAPAILVFFVVMMYLPPYTSFLPIKRDEQSQLESEG-KKKRRTFADNLIFSQLSYLAIF  439

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             +ILICITER++MKEDP+NF+VLNI+VEV+SAYGNVGF+TGYSC RQ++P+  C +K +GF
Sbjct  440   VILICITERKRMKEDPINFSVLNIIVEVVSAYGNVGFTTGYSCERQLRPDPNCVNKWYGF  499

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              G+WS+ GK ILIIVMFFGRLKK++M GG+AWKL
Sbjct  500   SGKWSDEGKVILIIVMFFGRLKKFNMNGGRAWKL  533



>ref|XP_010913849.1| PREDICTED: LOW QUALITY PROTEIN: probable cation transporter HKT6 
[Elaeis guineensis]
Length=529

 Score =   387 bits (995),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 245/491 (50%), Positives = 336/491 (68%), Gaps = 2/491 (0%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFS  1477
             +PFL++L YF  +S  GF ALK+ +P+    + K+LD  FT++S++TVSSM TVEMEVFS
Sbjct  39    DPFLIQLFYFTSISSAGFLALKILEPKNELNRFKNLDXVFTSISASTVSSMGTVEMEVFS  98

Query  1476  NLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYH  1297
             + QL  +  LMF+GGE FTS LGL F +++ +      ++ + +  D +E    TN    
Sbjct  99    DPQLWVLILLMFVGGEVFTSMLGLQFMKARFNREGPTQKRAESLSTD-LESPTCTNLGDA  157

Query  1296  NDLNPEDSAKSNVQIEVVEDIKL-LGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTA  1120
             + L       ++ ++ + E   L    ++ L  VVL Y++   + G + +++Y+ FV  A
Sbjct  158   SQLKCTRLVDTSSKMHLTEGEHLKHDVIKYLGYVVLCYLIAATLSGSSFISVYLSFVSGA  217

Query  1119  KQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYP  940
             + VL+ KG+ ++TF++FT VS+F NCGF+P NENM++FK+N  LLL++IPQIL GNTL+P
Sbjct  218   RDVLEGKGIKISTFSIFTAVSSFGNCGFIPANENMMIFKKNSILLLLIIPQILAGNTLFP  277

Query  939   ACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLA  760
               LR  IW L K T+R EF  +L  P    Y HL   + SG+LA TVFG I +Q+ +F +
Sbjct  278   VFLRFMIWVLKKLTKREEFNYMLQHPRATRYKHLLPPKHSGYLAFTVFGFILVQMVLFCS  337

Query  759   LEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTF  580
             LEW S+A+ GLT ++KVVG+LF  VNSRH GESI+DLS L+ A+L L VVMMYLPP T+F
Sbjct  338   LEWNSEALKGLTSFQKVVGALFQSVNSRHAGESIIDLSTLSHAILVLYVVMMYLPPYTSF  397

Query  579   FPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLN  400
              PI D+   S  +    ++ N+++ ++ S L  L IF+ LICITER+ M EDPLNFNV N
Sbjct  398   LPIKDDERPSVDEKEGNERRNLLKSLIFSQLSYLVIFVTLICITERKAMIEDPLNFNVFN  457

Query  399   IVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKK  220
             IV EVISAYGNVGFS GYSC R +KP+  CKD  +GFVGRWSN GK ILI+VM FGRLK 
Sbjct  458   IVFEVISAYGNVGFSIGYSCQRLLKPDRSCKDAWYGFVGRWSNQGKLILILVMLFGRLKN  517

Query  219   YHMKGGKAWKL  187
             ++M+GGKAWKL
Sbjct  518   FNMEGGKAWKL  528



>ref|XP_010048559.1| PREDICTED: sodium transporter HKT1-like [Eucalyptus grandis]
 gb|KCW80838.1| hypothetical protein EUGRSUZ_C02202 [Eucalyptus grandis]
Length=549

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 363/517 (70%), Gaps = 24/517 (5%)
 Frame = -1

Query  1680  VRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssms  1501
             +R L  +VN F +++ YF+ LS +GF+ LK  +PR  S++ +DLD+FFT+VS+ TVSSMS
Sbjct  37    LRFLLLQVNSFCIQVFYFVFLSFLGFWVLKALRPRTNSYRPRDLDLFFTSVSATTVSSMS  96

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK----VSTTERVLEKNKVIV---  1342
             TVEMEVFSN QLV MT LMF+GGE F S +GLH  +SK    + T E+V   N  +    
Sbjct  97    TVEMEVFSNSQLVVMTVLMFIGGEVFVSLVGLHLRKSKLRWHIKTEEQVTCVNSDLCPSN  156

Query  1341  -----IDHVELGLVTNNEYHN-DLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyiv  1180
                  ++H+E+G+V   +  N  + P+  ++    +++  D      VR L  VVL Y++
Sbjct  157   PTNDKVEHIEIGVVEKLDCLNSQVEPQLYSQQGESLDL--DYLQYCSVRFLCFVVLGYLL  214

Query  1179  vihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKR  1000
              +HV+G   V++Y+ F+ +A+ VLK+KGL + TF+VFT VSTF++CGFVPTNENMIVF +
Sbjct  215   GVHVLGVATVSLYMAFISSARDVLKKKGLKMVTFSVFTVVSTFASCGFVPTNENMIVFSK  274

Query  999   NPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRS  820
             N GLLL+LIPQ+LLGNTL+P+ LR  +W +G+ T++ E + +L   + +GY HL     S
Sbjct  275   NSGLLLLLIPQVLLGNTLFPSTLRFMLWLMGRFTKKAEIKYLLSRTSEVGYKHLLPSLHS  334

Query  819   GFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsll  640
               L  TV G + +Q  +F  ++W S+++ GL+ YEK+VG +F+ VN+RHTGE+I+DLS +
Sbjct  335   SLLVVTVLGFVGVQFIMFCLMQWHSESLNGLSSYEKIVGVIFLCVNTRHTGETIVDLSTV  394

Query  639   apavlalivVMMYLPPDTTFFPIMD----ENNNSKTKGCSPKKFN--IIEKILLSPLGNL  478
             APA+L + VVMMYLPP T+F P+        N  + K   PK+    ++E + LS L  L
Sbjct  395   APAILVVFVVMMYLPPYTSFLPVKGGERLPGNGDRRK---PKRSYKLLLENLKLSQLSYL  451

Query  477   SIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQ  298
             +IFI++IC+TER+KMKEDPLNFNVLNIVVEVISAYGNVGF+ GYSC RQ+KP   C+DK 
Sbjct  452   AIFIVMICVTERKKMKEDPLNFNVLNIVVEVISAYGNVGFTMGYSCQRQLKPVEGCEDKW  511

Query  297   FGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +GF G+WS+ GK ILIIVM FGRLKK++MKGG+AW L
Sbjct  512   YGFSGKWSDQGKIILIIVMIFGRLKKFNMKGGQAWVL  548



>ref|XP_010263267.1| PREDICTED: probable cation transporter HKT7 [Nelumbo nucifera]
Length=550

 Score =   387 bits (994),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 268/523 (51%), Positives = 351/523 (67%), Gaps = 15/523 (3%)
 Frame = -1

Query  1710  RNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvffta  1531
             R+   +M+   R + F +NPF++ L YF+ +S +GF  LK+  PR  SFK KDLD+FFT+
Sbjct  27    RSVWGLMVLLFRFILFHINPFVVLLCYFVSVSFLGFLILKLLNPRTDSFKPKDLDIFFTS  86

Query  1530  vssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERV-----  1366
             VS+ TVSSMSTVEMEVFSN QLVF+T LMF+GGE F S  GL F + K+    R+     
Sbjct  87    VSATTVSSMSTVEMEVFSNTQLVFITILMFVGGEVFVSMFGLLFTKYKLRNRARIHGSRV  146

Query  1365  -------LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQ--IEVVEDIKLLGCVR  1213
                    +     +    +ELG+VT +E  +         S V+  +   E+      +R
Sbjct  147   GSVSSESMSPTNPVDQLEIELGMVTLSETESRKPSSVDLVSTVESIMSTNEEELRYNSIR  206

Query  1212  VLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFV  1033
              L  V++ Y++V+H+ G  LVA+Y+  V +A+ VL+ KGL + TF++F TVSTF++CGFV
Sbjct  207   YLVFVIMGYLLVVHIGGSALVALYVSLVTSARDVLRNKGLQIPTFSIFITVSTFASCGFV  266

Query  1032  PTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGL  853
             PTNENMIVF +N GLLL+LIPQ+LLGNTLYP+CLR  IW LG  T++ EF  +L +   +
Sbjct  267   PTNENMIVFSKNSGLLLLLIPQVLLGNTLYPSCLRFLIWVLGWFTKKPEFNYMLTNTREM  326

Query  852   GYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRH  673
              Y HL     S  L  TVFG I +Q  +F +LEW S  + G+  ++K+V +LF  VNSRH
Sbjct  327   KYFHLLPSLHSSLLVVTVFGFIVVQFILFCSLEWNSQGLDGMDPFQKLVAALFQTVNSRH  386

Query  672   TGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKF-NIIEKILL  496
             TGES++DLS+L+PA+L L VVMMYLPP T+F PI D +  S+      K    + E +  
Sbjct  387   TGESVIDLSILSPAILVLFVVMMYLPPYTSFLPIKDVDWCSRRSEKKNKTGGRLAENLKF  446

Query  495   SPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEG  316
             S L  L IFII ICITEREKMKEDPLNF+ +NIV+EVISAYGNVGF+ GYSC RQ+ P+ 
Sbjct  447   SQLSYLVIFIIAICITEREKMKEDPLNFSTVNIVIEVISAYGNVGFTAGYSCKRQLNPQE  506

Query  315   QCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              CKD  +GFVGRWSN GK ILI+VMFFGRLKK++M GGK WKL
Sbjct  507   FCKDTWYGFVGRWSNKGKVILILVMFFGRLKKFNMGGGKGWKL  549



>emb|CBI40134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   385 bits (990),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 263/499 (53%), Positives = 348/499 (70%), Gaps = 15/499 (3%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             +  RVNPF ++L YF  LS  GF  LK  KPR  SF+ ++LD+FFT+VS+ATVSSMSTVE
Sbjct  41    VVLRVNPFWIQLCYFPCLSFQGFLVLKALKPRTYSFRPRNLDLFFTSVSAATVSSMSTVE  100

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVT  1312
             MEVFSN QL+ +T LMF+GGE FTS + LH  +SK+   +  + +NK+  +  +  G   
Sbjct  101   MEVFSNNQLLILTLLMFVGGEVFTSMVELHLRRSKLE--KPWIAENKIDSVTSIN-GSAP  157

Query  1311  NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGF  1132
               + H  +  +  + S  +      IK LG V      V+ Y+VV+HVVG  LV+ Y+  
Sbjct  158   LKQVHRQIEGQTESLSTSESLKYRSIKFLGFV------VMGYLVVVHVVGVALVSAYVAL  211

Query  1131  VPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGN  952
             V +A+ VLKQKGL L TF++FTTVSTF++CGFVPTNENMIVF  N GLLLI+IPQ+LLGN
Sbjct  212   VSSARDVLKQKGLKLFTFSLFTTVSTFASCGFVPTNENMIVFSSNSGLLLIIIPQVLLGN  271

Query  951   TLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLT  772
             TL+P+CLR +IW LGK   + E   +L +   +G+ +L     S  L  TV G I +Q T
Sbjct  272   TLFPSCLRFSIWTLGKFFNKAESNYLLMNAREIGFLYLLPSLHSTLLVPTVLGFILIQFT  331

Query  771   VFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPP  592
             +  +++W S+ + GL  Y+K++G+LF  VNSRHTGE+I+D+S+L+PA+L L VVMMYLPP
Sbjct  332   LLCSMDWNSEGLNGLNSYQKIIGALFQSVNSRHTGETIVDISILSPAILVLFVVMMYLPP  391

Query  591   DTTFFPIMDENNNSKTKGCSPKKFN----IIEKILLSPLGNLSIFIILICITEREKMKED  424
              T+F PI D   +S T  CS ++      I+E ++ S L  L IFIILICITER+ MK+D
Sbjct  392   YTSFLPIEDYEQSSPT--CSGRRRRKRGKIVENLIFSQLSYLVIFIILICITERKNMKDD  449

Query  423   PLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIV  244
             PLNF VLNIV+EVISAYGNVGF+ GYSC R +KP+  C+ K FGF G+WS+ GK ILI+ 
Sbjct  450   PLNFTVLNIVIEVISAYGNVGFTAGYSCERLMKPDSSCQSKWFGFSGKWSDEGKIILILA  509

Query  243   MFFGRLKKYHMKGGKAWKL  187
             MFFGRLKK++M GG+AWKL
Sbjct  510   MFFGRLKKFNMDGGRAWKL  528



>ref|XP_010048550.1| PREDICTED: sodium transporter HKT1-like [Eucalyptus grandis]
 gb|KCW80826.1| hypothetical protein EUGRSUZ_C02190 [Eucalyptus grandis]
Length=548

 Score =   386 bits (991),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 264/512 (52%), Positives = 357/512 (70%), Gaps = 16/512 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R L  R+N F +++ YF+ LS +GF+ LK  +PR  SF+ +DLD+FFT+VS+ATVSSMST
Sbjct  37    RFLLLRINSFCIQVFYFVFLSFLGFWVLKDLRPRTNSFRPRDLDLFFTSVSAATVSSMST  96

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK----VSTTERVLEKNKVI-----  1345
             VEMEVFSN QLV MT LMF+GGE FTS +GL+F ++K    + T E+V   N  +     
Sbjct  97    VEMEVFSNSQLVVMTILMFIGGEVFTSLVGLNFTKTKLWWLIKTKEKVASVNSNLYPSNP  156

Query  1344  ---VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvi  1174
                ++DH+ELG +TN +  N        +S  +   ++ +K    VR L  VVL Y++ +
Sbjct  157   TNDIVDHIELGEITNLDRPNSQVDPHLYRSRDESLDLDHLKYCS-VRFLCFVVLGYLIGV  215

Query  1173  hvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNP  994
             HV+G  +V +Y+  V +A+ VLK KGL + TF+VFT VSTF++CGFVPTNENMIVF +N 
Sbjct  216   HVLGVAMVVLYMKRVSSARDVLKTKGLKMMTFSVFTIVSTFASCGFVPTNENMIVFSKNS  275

Query  993   GlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGF  814
             GLLLILIPQ+LLGNTL+P+ LR  IW +GK   + E   +L   + +GY HL     S  
Sbjct  276   GLLLILIPQVLLGNTLFPSTLRFTIWLMGKFWVKAEMMYLLSRTSEVGYKHLLPSLYSSL  335

Query  813   LAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllap  634
             L  TV G I +Q  +F +++W S+ ++GL+ YEK+ G LF  VN+R+TGE+I+DLS +AP
Sbjct  336   LVVTVLGFIGVQFVIFCSMQWDSELLSGLSSYEKITGVLFQCVNTRYTGETIVDLSQVAP  395

Query  633   avlalivVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFN--IIEKILLSPLGNLSIFII  463
             A+L + VVMMYLPP T+F P   DE      +G  PKK    ++E +  S L  ++IFI+
Sbjct  396   AILVVFVVMMYLPPYTSFLPAKEDERLPGNREGKEPKKNYKLLLENLKFSQLSYVAIFIV  455

Query  462   LICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVG  283
             ++CITER+K+KEDPLNFNVLNIVVEVISAYGNVGF+ GYSC  Q++P   C+DK +GF G
Sbjct  456   MVCITERKKVKEDPLNFNVLNIVVEVISAYGNVGFTMGYSCELQLRPVEGCEDKWYGFSG  515

Query  282   RWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +WS+ GK ILI+VM FGRLKK++MKGG+AW L
Sbjct  516   KWSDQGKIILIVVMIFGRLKKFNMKGGRAWIL  547



>ref|XP_002270183.2| PREDICTED: probable cation transporter HKT7 [Vitis vinifera]
Length=551

 Score =   385 bits (990),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 264/523 (50%), Positives = 358/523 (68%), Gaps = 25/523 (5%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssat  1516
             ++ S  R +  R N F ++L YF+ LS  GF+ LK  KPR    + ++LD+FFT+VS+AT
Sbjct  33    LVSSFYRFVILRFNTFSVQLCYFLCLSFQGFWVLKALKPRT-PLRPRNLDLFFTSVSAAT  91

Query  1515  vssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID  1336
             VSSMSTVEMEVFSN QL+ +T LMF+GGE FTS + L  ++SK+   + ++ +N+V  + 
Sbjct  92    VSSMSTVEMEVFSNNQLLILTLLMFVGGEIFTSMVELQLWRSKLK--KPLIAENQVNSVS  149

Query  1335  --------------HVELGLVTNNEYHNDLNPEDSAKSNVQIEV----VEDIKLLGCVRV  1210
                             EL +VT     N     D  +S ++        E +K    ++ 
Sbjct  150   NNSSAPPDPRNPFGQFELRVVTVPSTSNSTLETDEVQSQIEGRTKSLSSESLKY-HSIKF  208

Query  1209  LARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVP  1030
             L  VV+ Y+VV+HV+G TLV+ YI  V +A+ VLKQKGL L TF++FTTVST ++CGFVP
Sbjct  209   LGFVVMGYLVVVHVLGVTLVSAYIALVSSARDVLKQKGLKLFTFSLFTTVSTLASCGFVP  268

Query  1029  TNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLG  850
             TNENMIVF +N GLLLI+IPQ+LLGNTL+P+CLR +IW LGK  +++E   +L +   +G
Sbjct  269   TNENMIVFSKNSGLLLIIIPQVLLGNTLFPSCLRFSIWTLGKF-KKVESNYLLTNTREIG  327

Query  849   YGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHT  670
             + HL     S  L  TV G I +Q T+F ++EW S+ + GL  Y+K++G+LF  VNSRHT
Sbjct  328   FLHLLPSLHSTLLVPTVLGFILIQFTLFCSMEWNSEGLNGLNSYQKIIGALFQSVNSRHT  387

Query  669   GESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSK--TKGCSPKKFNIIEKILL  496
             GE+I+D+S+L+PA+L L VVMMYLPP T+F P   +  +S+    G   ++  I+E ++ 
Sbjct  388   GETIVDISILSPAILVLFVVMMYLPPYTSFLPTKGDEQSSEICNGGRKRRRGKIVENLIF  447

Query  495   SPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEG  316
             S L  L+IFIILICITER KMK+DPLNF VLNIV+EVISAYGNVGF+ GYSC R +KP+ 
Sbjct  448   SQLSYLAIFIILICITERRKMKDDPLNFTVLNIVIEVISAYGNVGFTAGYSCERLLKPDS  507

Query  315   QCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              C+ K FGF G+WS+ GK ILI VMFFGRLKK++M GG+AWKL
Sbjct  508   SCQSKWFGFSGKWSDEGKIILIFVMFFGRLKKFNMDGGRAWKL  550



>ref|XP_010048551.1| PREDICTED: sodium transporter HKT1-like [Eucalyptus grandis]
 gb|KCW80830.1| hypothetical protein EUGRSUZ_C02196 [Eucalyptus grandis]
Length=549

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 263/527 (50%), Positives = 359/527 (68%), Gaps = 24/527 (5%)
 Frame = -1

Query  1710  RNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvffta  1531
             R+   ++    R L  RVN F +++ YF+ LS +GF+ LK   PR  SF+ +DLD+FFT+
Sbjct  27    RSLCFLLSCCFRFLLLRVNSFCIQVFYFVFLSFLGFWVLKALGPRTDSFRPRDLDLFFTS  86

Query  1530  vssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK----VSTTERVL  1363
             VS+ TVSSMSTVEMEVFSN QLV MT LMF+GGE F S +GLH  +SK    + T ++V 
Sbjct  87    VSATTVSSMSTVEMEVFSNSQLVVMTVLMFIGGEVFISLVGLHLRKSKLRWRIRTEDKVA  146

Query  1362  EKNKVI--------VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVL  1207
               +  +        ++DH+ELG V   +  N        +   +   ++ +K    VR L
Sbjct  147   SADGNLCPSAPTNDIVDHIELGGVAKTDCLNSQVEPQFYRPQDKSSDLDYLKYCS-VRFL  205

Query  1206  ARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPT  1027
               VVL Y++V+ V+G   V++YI  VP+ + VLK+KGL + TF+VFTTVSTF++CGFVPT
Sbjct  206   CYVVLGYLLVVQVLGVAAVSLYITLVPSTRDVLKKKGLKMVTFSVFTTVSTFASCGFVPT  265

Query  1026  NENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGY  847
             NENMI+F +N GLLLILIPQ+LLGN L+P+ LRL +W +G+   + E   +L   + +GY
Sbjct  266   NENMIIFSKNSGLLLILIPQVLLGNMLFPSSLRLTLWLIGRFREKDEIGYLLSRTSEIGY  325

Query  846   GHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTG  667
              HL     S  L  TV G + +Q  +F +++W S+++ GL+  EK+VG+LF  VNSRHTG
Sbjct  326   KHLLPSLYSSLLGVTVMGFVGIQFIMFCSMQWDSESLNGLSSCEKIVGALFQCVNSRHTG  385

Query  666   ESIldlsllapavlalivVMMYLPPDTTFFPI-----MDENNNSKTKGCSPKKFN--IIE  508
             E+++DLS +APA+L L VVMMYLPP T+F P+     + EN   +     PK+    ++E
Sbjct  386   ETVVDLSTVAPAILVLFVVMMYLPPYTSFLPVKGNERLPENGERR----KPKQSYRLLLE  441

Query  507   KILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQI  328
              +  S L  L+IFI +ICITER+KMKEDPLNFNVLNIVVEV+SAYGNVGF+TGYSC RQ+
Sbjct  442   NLKFSQLSYLAIFITVICITERKKMKEDPLNFNVLNIVVEVVSAYGNVGFTTGYSCERQL  501

Query  327   KPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +P   C+DK +GF G+WS+  K ILI+VMFFGRLKK++MKGG+AW L
Sbjct  502   RPVEGCEDKWYGFSGKWSDESKIILIVVMFFGRLKKFNMKGGRAWIL  548



>ref|XP_010050921.1| PREDICTED: sodium transporter HKT1-like [Eucalyptus grandis]
Length=539

 Score =   382 bits (981),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 256/520 (49%), Positives = 345/520 (66%), Gaps = 15/520 (3%)
 Frame = -1

Query  1713  LRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfft  1534
             L+++H +  S +R LA R N F  +L+YF ++S IG++ALK+ +P+  S+K +DLD+FFT
Sbjct  25    LQSRHPVASSLLRNLARRANSFWTQLAYFFLVSAIGYWALKLCEPKSPSYKPRDLDIFFT  84

Query  1533  avssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKN  1354
             +VS+ T SSMSTVEME FSN QL+ +  LM  GGE FTS LGL+  +S+ +  +    K 
Sbjct  85    SVSATTASSMSTVEMEAFSNSQLIIIILLMLFGGEVFTSMLGLYLSRSEFAGRDH--RKV  142

Query  1353  KVIVIDH----VELGLV------TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLA  1204
                V DH    +EL L         N +  D  PE            E +      + L+
Sbjct  143   NSAVSDHSDNNIELKLPPLYPVKEANTFKFD--PEMKGIPLKPAPCGEGLVKYRAAKYLS  200

Query  1203  RvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTN  1024
              VVL+Y++++H  G TL+++YI  VP+A++VL+ KGL +  F+VF TVSTF+NCGFVP N
Sbjct  201   YVVLAYLIIVHAGGSTLLSVYISVVPSARKVLRDKGLAVQMFSVFMTVSTFANCGFVPLN  260

Query  1023  ENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYG  844
             ENM+ FK NPGLL +L+PQ+LLGNTLYP CL  AIW L   T R EF  +L +   +GY 
Sbjct  261   ENMLAFKHNPGLLWLLLPQVLLGNTLYPPCLMAAIWLLKWVTGRAEFDYMLRNSGEMGYA  320

Query  843   HLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGE  664
             HL  G     LAATV   + +Q      +EW S A+ GL+ YEK+VG+LF   N+RH GE
Sbjct  321   HLLPGFHCLCLAATVCKFLLVQFVALCCMEWGSPAMEGLSPYEKLVGALFEAANTRHAGE  380

Query  663   SIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLG  484
             S+ DLS+++PA+L L V+MMYLP  T+F P+ +     K +   P++ +++ +++ S L 
Sbjct  381   SVFDLSIISPAILVLFVLMMYLPTHTSFLPVRNVKTAPKIQRDEPRR-HLLTRLMFSQLS  439

Query  483   NLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKD  304
              L IFIILICITERE +K DPLNFNV+NI +E ISAYGNVGFS GYSC R++  +  C+D
Sbjct  440   YLVIFIILICITEREYLKNDPLNFNVMNITIETISAYGNVGFSIGYSCKRRLHTDSPCRD  499

Query  303   KQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
               +G VGRWSN GKFILIIVMFFGRLKK++MKGG AW LS
Sbjct  500   AAYGLVGRWSNKGKFILIIVMFFGRLKKFNMKGGAAWSLS  539



>emb|CAN68938.1| hypothetical protein VITISV_025919 [Vitis vinifera]
Length=641

 Score =   384 bits (987),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 263/517 (51%), Positives = 354/517 (68%), Gaps = 25/517 (5%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +  R N F ++L YF+ LS  GF+ LK  KPR    + ++LD+FFT+VS+ATVSSMST
Sbjct  39    RFVILRFNTFXVQLCYFLCLSFQGFWVLKALKPRT-PLRPRNLDLFFTSVSAATVSSMST  97

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID------  1336
             VEMEVFSN QL+ +T LMF+GGE FTS + L  ++SK+   + ++ +N+V  +       
Sbjct  98    VEMEVFSNNQLLILTLLMFVGGEIFTSMVELQLWRSKLK--KPLIAENQVNSVSNNSSAP  155

Query  1335  --------HVELGLVTNNEYHNDLNPEDSAKSNVQIEV----VEDIKLLGCVRVLARvvl  1192
                       EL +VT     N     D  +S ++        E +K    ++ L  VV+
Sbjct  156   PDPRNPFGQFELRVVTVPSMSNSTLETDEVQSQIEGRTKSLSSESLKY-HSIKFLGFVVM  214

Query  1191  syivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMI  1012
              Y+VV+HV+G TLV+ YI  V +A+ VLKQKGL L TF++FTTVST ++CGFVPTNENMI
Sbjct  215   GYLVVVHVLGVTLVSAYIALVSSARDVLKQKGLKLFTFSLFTTVSTLASCGFVPTNENMI  274

Query  1011  VFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFS  832
             VF +N GLLLI+IPQ+LLGNTL+P+CLR +IW LGK  +++E   +L     +G+ HL  
Sbjct  275   VFSKNSGLLLIIIPQVLLGNTLFPSCLRFSIWTLGKF-KKVESNYLLTXTREIGFLHLLP  333

Query  831   GRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIld  652
                S  L  TV G I +Q T+F ++EW S+ + GL  Y+K++G+LF  VNSRHTGE+I+D
Sbjct  334   SLHSTLLVPTVLGFILIQFTLFCSMEWNSEGLNGLNSYQKIIGALFQSVNSRHTGETIVD  393

Query  651   lsllapavlalivVMMYLPPDTTFFPIMDENNNSK--TKGCSPKKFNIIEKILLSPLGNL  478
             +S L+PA+L L+VVMMYLPP T+F PI  +  +S+    G   ++  I+E ++ S L  L
Sbjct  394   ISTLSPAILVLVVVMMYLPPYTSFLPIKGDEQSSEICNGGRKRRRGKIVENLIFSQLSYL  453

Query  477   SIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQ  298
             +IFIILICITER KMK+DPLNF VLNIV+EVISAYGNVGF+ GYSC   +KP+  C+ K 
Sbjct  454   AIFIILICITERXKMKDDPLNFTVLNIVIEVISAYGNVGFTAGYSCEXLLKPDSSCQSKW  513

Query  297   FGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             FGF G+WS+ GK ILI VMFFGRLKK++M GG+AWKL
Sbjct  514   FGFSGKWSDEGKIILIFVMFFGRLKKFNMDGGRAWKL  550



>ref|XP_010656787.1| PREDICTED: sodium transporter HKT1-like [Vitis vinifera]
Length=555

 Score =   380 bits (976),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 267/525 (51%), Positives = 352/525 (67%), Gaps = 40/525 (8%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             +  RVNPF ++L YF  LS  GF  LK  KPR  SF+ ++LD+FFT+VS+ATVSSMSTVE
Sbjct  40    VVLRVNPFWIQLCYFPCLSFQGFLVLKALKPRTYSFRPRNLDLFFTSVSAATVSSMSTVE  99

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID--------  1336
             MEVFSN QL+ +T LMF+GGE FTS + LH  +SK+   +  + +NK+  +         
Sbjct  100   MEVFSNNQLLILTLLMFVGGEVFTSMVELHLRRSKLE--KPWIAENKIDSVTSINGSAPL  157

Query  1335  -------HVELGLVT-----------NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRV  1210
                     VEL +VT             + H  +  +  + S  +      IK LG V  
Sbjct  158   SPGKPFGQVELRVVTVPSTDKYSKLETEQVHRQIEGQTESLSTSESLKYRSIKFLGFV--  215

Query  1209  LARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVP  1030
                 V+ Y+VV+HVVG  LV+ Y+  V +A+ VLKQKGL L TF++FTTVSTF++CGFVP
Sbjct  216   ----VMGYLVVVHVVGVALVSAYVALVSSARDVLKQKGLKLFTFSLFTTVSTFASCGFVP  271

Query  1029  TNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLG  850
             TNENMIVF  N GLLLI+IPQ+LLGNTL+P+CLR +IW LGK   + E   +L +   +G
Sbjct  272   TNENMIVFSSNSGLLLIIIPQVLLGNTLFPSCLRFSIWTLGKFFNKAESNYLLMNAREIG  331

Query  849   YGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHT  670
             + +L     S  L  TV G I +Q T+  +++W S+ + GL  Y+K++G+LF  VNSRHT
Sbjct  332   FLYLLPSLHSTLLVPTVLGFILIQFTLLCSMDWNSEGLNGLNSYQKIIGALFQSVNSRHT  391

Query  669   GESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN----IIEKI  502
             GE+I+D+S+L+PA+L L VVMMYLPP T+F PI D   +S T  CS ++      I+E +
Sbjct  392   GETIVDISILSPAILVLFVVMMYLPPYTSFLPIEDYEQSSPT--CSGRRRRKRGKIVENL  449

Query  501   LLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP  322
             + S L  L IFIILICITER+ MK+DPLNF VLNIV+EVISAYGNVGF+ GYSC R +KP
Sbjct  450   IFSQLSYLVIFIILICITERKNMKDDPLNFTVLNIVIEVISAYGNVGFTAGYSCERLMKP  509

Query  321   EGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +  C+ K FGF G+WS+ GK ILI+ MFFGRLKK++M GG+AWKL
Sbjct  510   DSSCQSKWFGFSGKWSDEGKIILILAMFFGRLKKFNMDGGRAWKL  554



>emb|CBI40133.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   379 bits (972),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 265/525 (50%), Positives = 355/525 (68%), Gaps = 46/525 (9%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvss  1507
             S  R +  R N FL++L YF+ LS  GF+ LK  KPR    + ++LD+FFT+VS+ATVSS
Sbjct  36    SFYRFVILRFNTFLVQLCYFLCLSFQGFWVLKALKPRT-PLRPRNLDLFFTSVSAATVSS  94

Query  1506  mstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVE  1327
             MSTVEMEVFSN QL+ +T LMF+GGE FTS + L  ++SK+   + ++ +N+V       
Sbjct  95    MSTVEMEVFSNNQLLILTLLMFVGGEIFTSMVELQLWRSKLK--KPLIAENQV-------  145

Query  1326  LGLVTNNEYHNDLNPEDSAKSNVQIEV---------VEDIKLLGCVRVLARvvlsyivvi  1174
                  N+  +N   P D      Q E+          E +K    ++ L  VV+ Y+VV+
Sbjct  146   -----NSVSNNSSAPPDPRNPFGQFELRVGRTKSLSSESLKY-HSIKFLGFVVMGYLVVV  199

Query  1173  hvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNP  994
             HV+G TLV+ YI  V +A+ VLKQKGL L TF++FTTVST ++CGFVPTNENMIVF +N 
Sbjct  200   HVLGVTLVSAYIALVSSARDVLKQKGLKLFTFSLFTTVSTLASCGFVPTNENMIVFSKNS  259

Query  993   GlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGF  814
             GLLLI+IPQ+LLGNTL+P+CLR +IW LGK  +++E   +L S   +G+ HL     S  
Sbjct  260   GLLLIIIPQVLLGNTLFPSCLRFSIWTLGKF-KKVESNYLLISTREIGFLHLLPSLHSTL  318

Query  813   LAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllap  634
             L  TV G I +Q T+F ++EW S+ + GL  Y+K++G+LF  VNSRHTGE+I+D+S L+P
Sbjct  319   LVPTVLGFILIQFTLFCSMEWNSEGLNGLNSYQKIIGALFQSVNSRHTGETIVDISTLSP  378

Query  633   avlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILIC  454
             A+L L+VVMMYLPP T+F PI +  N  + +    ++  I+E ++ S L  L+IFIILIC
Sbjct  379   AILVLVVVMMYLPPYTSFLPIKEICNGGRKR----RRGKIVENLIFSQLSYLAIFIILIC  434

Query  453   ITEREKMKEDPLNFNVLNIVVEVIS----------------AYGNVGFSTGYSCARQIKP  322
             ITER+KMK+DPLNF VLNIV+EVIS                AYGNVGF+ GYSC R +KP
Sbjct  435   ITERKKMKDDPLNFTVLNIVIEVISLQDQYLSSLKRIQFLVAYGNVGFTAGYSCERLLKP  494

Query  321   EGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +  C+ K FGF G+WS+ GK ILI VMFFGRLKK++M GG+AWKL
Sbjct  495   DSSCQSKWFGFSGKWSDEGKIILIFVMFFGRLKKFNMDGGRAWKL  539



>ref|XP_010062271.1| PREDICTED: sodium transporter HKT1-like [Eucalyptus grandis]
 gb|KCW69385.1| hypothetical protein EUGRSUZ_F02866 [Eucalyptus grandis]
Length=549

 Score =   379 bits (972),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 263/514 (51%), Positives = 352/514 (68%), Gaps = 20/514 (4%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R L  RVN F ++L YF+ LSL+GF+ LK S+P   SF+ +DLD+FFT+VS ATVSSMST
Sbjct  38    RFLLLRVNSFCVQLLYFVFLSLLGFWVLKASRPLTHSFRPRDLDLFFTSVSLATVSSMST  97

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHF----FQSKVSTTERVLEKNKVI-----  1345
             VEMEVFSN QLV MT LMF+GGE FTS  GLHF     QS + T E+V   +  +     
Sbjct  98    VEMEVFSNSQLVVMTVLMFVGGEVFTSLAGLHFRKLKLQSLLKTEEKVASVHANLCPSNP  157

Query  1344  ---VIDHVELGLVTNNEYHND-LNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivv  1177
                V+DHVEL +VTN++  N  + P+     +   ++  D        VL  VVL Y++ 
Sbjct  158   TNDVVDHVELAVVTNSDCLNSRVEPQLHGPRDESPDL--DYLKYRSANVLCLVVLGYLLG  215

Query  1176  ihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRN  997
             ++V+G   V++Y+  V +A+ VLK+KGL + TF++FTTVSTF++CGFVPTNENM VF +N
Sbjct  216   VNVLGVAAVSLYMILVSSARDVLKRKGLKMMTFSIFTTVSTFASCGFVPTNENMAVFSKN  275

Query  996   PGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSG  817
              GLLLILIPQ+LLGNTL+P+ LRL +W LGK +++ E   +L     +GY HL     S 
Sbjct  276   SGLLLILIPQVLLGNTLFPSTLRLVLWLLGKFSKKAEIDYLLSRTGEIGYKHLLPSLYSS  335

Query  816   FLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlslla  637
              L  TV G I +Q  +F +++W S+++ GL  YEK+V  LF  VN+R+TGE+I++LS ++
Sbjct  336   LLVVTVLGFIGVQFIMFCSMQWDSESLDGLNSYEKIVAVLFQCVNTRYTGETIVNLSKVS  395

Query  636   pavlalivVMMYLPPDTTFFPIMDEN----NNSKTKGCSPKKFNIIEKILLSPLGNLSIF  469
             PA+L L VVMMYLPP T+F P         N  + K     K  +++ ++ S L  L+IF
Sbjct  396   PAILVLFVVMMYLPPYTSFLPAKGGEELLGNGERKKAKRSHKL-MLKSLIFSQLSYLAIF  454

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             II ICITE+EKMK+DPLNFNV NIVVEVISAYGNVGF+ GY+C RQ++    C+DK +GF
Sbjct  455   IITICITEKEKMKKDPLNFNVFNIVVEVISAYGNVGFTIGYNCDRQLRRIEGCEDKWYGF  514

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              G+WS+ GK ILI+VM FGRLKK++MKGG+ W L
Sbjct  515   SGKWSDEGKIILIVVMIFGRLKKFNMKGGRNWIL  548



>gb|AFK46164.1| unknown [Lotus japonicus]
Length=516

 Score =   377 bits (969),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 262/502 (52%), Positives = 342/502 (68%), Gaps = 22/502 (4%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKPR-PISFKLKDLDvfftavssatvssmstVEMEVF  1480
             + FL++L YFI LSL G+  LKVSKPR P+S    D+D+FFT+VS+ATVSSM+ +EMEVF
Sbjct  26    HAFLIQLCYFITLSLFGYLCLKVSKPRSPVSHN--DIDLFFTSVSAATVSSMTAIEMEVF  83

Query  1479  SNLQLVFMTFLMFLGGECFTSWLGL---HFFQSKVSTTERVLEKNKVIVIDHVELGLVT-  1312
             SN QL+ +TFLM LGGE FTS L L    F  +K  +T   L+++     + +E+GLV+ 
Sbjct  84    SNSQLILLTFLMLLGGEVFTSMLELVLARFNFTKNHSTTVQLKQDPPPKSNQIEIGLVSV  143

Query  1311  -NNEYHNDLN-----PEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
              N+E H   +     P D A+S       E +K    ++ L+ VV  Y+ VIH+VG  LV
Sbjct  144   SNSESHKQNHSILFVPNDMAES---FNYNERLKY-NSLKCLSHVVFGYLTVIHIVGVCLV  199

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
             +MY  F+P+A+QVL+ K + + TF+ F  VSTF+ CGFVPTNENM+VFK+N GLLL+++P
Sbjct  200   SMYTAFIPSARQVLENKDIKIPTFSFFIIVSTFACCGFVPTNENMVVFKKNSGLLLLILP  259

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
              +LLGN LY  CLRL I  + K TRR E   +L +   +G  H+        L  TVFG 
Sbjct  260   HVLLGNALYAPCLRLVIMLMKKVTRREELSYLLKNSKEMGSSHMLPALHCWLLIVTVFGF  319

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
               +QL +F ++EW S  + GL+ Y+K+V SLF V N+RH GES+ DLS ++ A+L L VV
Sbjct  320   NLVQLIMFCSMEWNSKNMEGLSLYQKLVASLFQVTNARHAGESVFDLSTISSAILVLFVV  379

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMK  430
             MMYLPP TTF P+    N+ K +  S     ++E ++ S +  L IFIILICITERE + 
Sbjct  380   MMYLPPYTTFLPVRGHENDVKREEKS-----LVECLVFSQISYLVIFIILICITERESLT  434

Query  429   EDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILI  250
             EDPLNFNVLNI +EVISAYGNVGFSTGYSCARQ+KP+  CKD   GF G+WS  GKFILI
Sbjct  435   EDPLNFNVLNITLEVISAYGNVGFSTGYSCARQLKPDAMCKDLWVGFSGKWSTKGKFILI  494

Query  249   IVMFFGRLKKYHMKGGKAWKLS  184
             +VMFFGRLKK++M GGKAW LS
Sbjct  495   LVMFFGRLKKFNMNGGKAWHLS  516



>ref|XP_008781920.1| PREDICTED: probable cation transporter HKT6 [Phoenix dactylifera]
Length=529

 Score =   377 bits (969),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 248/505 (49%), Positives = 339/505 (67%), Gaps = 10/505 (2%)
 Frame = -1

Query  1683  TVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssm  1504
             + R + F  NPFL++L YFI +S  GF ALK+ +P     +LK+LD+FFT+VS++TVSSM
Sbjct  30    SYRFIIFHSNPFLIQLFYFISISFAGFLALKILEPGNEVNRLKNLDLFFTSVSASTVSSM  89

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
              TVEMEVFS+ QL  +  LM +GGE FTS LGL F +++  +     ++ + +  D +E+
Sbjct  90    GTVEMEVFSDSQLWVLILLMLVGGEVFTSMLGLQFMKARFKSEGPTKKRAESLSTD-LEV  148

Query  1323  GLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKL-LGCVRVLARvvlsyivvihvVGFTLVA  1147
              + TN +  + L     A +  ++ + E   L    ++ L  VVL Y++V  + G + + 
Sbjct  149   PICTNLDDESQLKCTILAGTLSKMHLPEGEHLKHDAIQYLGYVVLCYLIVATLSGSSFIL  208

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +Y+ FV  A+ VL+ KG+ ++TF+ FT VS+  NCGF P NENM++FK+N  LLL+++PQ
Sbjct  209   LYLSFVSNARDVLESKGIRISTFSFFTAVSSLGNCGFTPANENMMIFKKNSILLLLIVPQ  268

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             +L GNTL+P  LR  IW + K T+R E   ++  P    Y HL     SG+LA TV G I
Sbjct  269   VLAGNTLFPVFLRFMIWVVKKLTKREELNYMIQHPRATRYKHLLPPEHSGYLAFTVLGFI  328

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              +Q+ +F +LEW S+A+ GL  ++K+VG+LF  VNSRH GESI+DLS L+PA+L L VVM
Sbjct  329   LVQMVLFCSLEWNSEALQGLNSFQKLVGALFQSVNSRHAGESIIDLSKLSPAILVLYVVM  388

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFN----IIEKILLSPLGNLSIFIILICITERE  439
             MYLPP T+F PI D     + +   PK+ N    +++ ++ S L  L IFI LICITER+
Sbjct  389   MYLPPYTSFLPIKD----VEWRSVDPKEGNEGGKLLKSLIFSQLSYLVIFITLICITERK  444

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKF  259
              M EDPLNFNV NIV EVISAYGNVGFS GYSC R +KP   CKD  +GFVGRWSN GK 
Sbjct  445   AMIEDPLNFNVFNIVFEVISAYGNVGFSIGYSCQRLLKPNNSCKDAWYGFVGRWSNQGKL  504

Query  258   ILIIVMFFGRLKKYHMKGGKAWKLS  184
             IL+ VM FGRLKK++M+GGKAWKLS
Sbjct  505   ILLFVMLFGRLKKFNMEGGKAWKLS  529



>gb|AES77170.2| high-affinity potassium transporter [Medicago truncatula]
Length=522

 Score =   377 bits (968),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 261/508 (51%), Positives = 350/508 (69%), Gaps = 24/508 (5%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +  R NP  +++ YFI +S +GF  LK  KP  +    K+LD+FFT+VSS TVSSM T
Sbjct  27    RFILLRSNPLCVQIVYFISISTLGFGFLKALKP--LGQTQKNLDLFFTSVSSTTVSSMVT  84

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV--------STTERVLEKNKVIV  1342
             VEM +FSN QL+ +T LMF+GGE FTS +GL F +S++        S+  R+  +N  I+
Sbjct  85    VEMGIFSNTQLIIITILMFIGGEVFTSLVGLFFIRSRLKIDLDKIASSHARLASRNPFII  144

Query  1341  ID--HVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihv  1168
             +D  H+E  +VTN E H     E  + +N      E+++ L  ++ L  VV+ YI+ +HV
Sbjct  145   VDRFHLEDEMVTN-EVHKH---ESLSTTN------ENLRYLS-MKYLGYVVIGYILFLHV  193

Query  1167  VGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGl  988
             +G   V++Y+  +P+ KQ+LK KGL + TF+VFT VS+FS+CGFVPTNENMI F++N GL
Sbjct  194   IGVIGVSLYLTIIPSTKQLLKNKGLKMLTFSVFTIVSSFSSCGFVPTNENMIDFRKNSGL  253

Query  987   llilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLA  808
             LL+LIPQ+LLGNT YP CLRL I  LGK  ++ E R +L     +GY HL   + + FL 
Sbjct  254   LLMLIPQLLLGNTFYPPCLRLCICGLGKFYKKRECRYLLKHSEKVGYKHLLQRKHTIFLV  313

Query  807   ATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapav  628
             AT  GLI +Q+T+F  ++W S  + GL  Y+K++G LF  VNSRH G SI+D+S+L+ A+
Sbjct  314   ATNCGLIVVQVTLFCVMDWNSKGLKGLNFYQKLIGVLFQSVNSRHAGTSIVDISILSQAI  373

Query  627   lalivVMMYLPPDTTFFPI-MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             L L VVMMYLPP T+F P+  D   +  +K    ++  + E ++ S L  L IFIIL+CI
Sbjct  374   LVLFVVMMYLPPYTSFLPLKYDGKISENSKKMKKRRGKVTENLIFSQLSYLVIFIILVCI  433

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSN  271
             TER+K+KEDPLNFNVLNIVVEVISAYGNVGFSTGYSC  Q+ PE  C++K  GFVG+WS+
Sbjct  434   TERKKLKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCELQLHPETNCENKWIGFVGKWSD  493

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              GK ILI VM FGRLKK++M GGKAWKL
Sbjct  494   EGKIILIFVMLFGRLKKFNMDGGKAWKL  521



>ref|XP_010048558.1| PREDICTED: sodium transporter HKT1-like [Eucalyptus grandis]
 gb|KCW80836.1| hypothetical protein EUGRSUZ_C02200 [Eucalyptus grandis]
Length=547

 Score =   376 bits (966),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 264/528 (50%), Positives = 362/528 (69%), Gaps = 27/528 (5%)
 Frame = -1

Query  1710  RNKHTMMMSTVRRLAFRVN-PFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfft  1534
             R+  ++     R L  RVN  F +++ YF+ LS +GF+ LK  +PR  SF+ +DLD+FFT
Sbjct  26    RSFCSLFSRICRFLLLRVNNSFCIQVVYFVFLSFLGFWVLKDLRPRTNSFRPRDLDLFFT  85

Query  1533  avssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKN  1354
             +VS+ATVSSMSTVEMEVFSN QLV +T LMF+GGE FTS +GL+F + K+    R L K 
Sbjct  86    SVSAATVSSMSTVEMEVFSNSQLVVITVLMFVGGEVFTSLVGLYFRKLKL----RCLIKT  141

Query  1353  KVI--------------VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLG--  1222
             +V               ++DH+ELG+  N+++   LN +  A+     +   D+  L   
Sbjct  142   EVASVNANPCPSNPTNDIVDHIELGVAANSDF---LNSQGEAQLFRPRDESLDLGYLKYC  198

Query  1221  CVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNC  1042
              VR L  +VL Y++ +HV+G   VA+Y+  V +A+ VLK+KGL + TF+VFT VSTF++C
Sbjct  199   SVRFLCFLVLGYLIGVHVLGVAAVALYMTHVSSARDVLKKKGLKMVTFSVFTIVSTFASC  258

Query  1041  GFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSP  862
             GFVPTNENMIVF +N GLLLILIPQ+LLGNTL+P+ LR  +W + +++++ E + +L   
Sbjct  259   GFVPTNENMIVFSKNSGLLLILIPQVLLGNTLFPSTLRFTLWLIERSSKKAEIKYLLSRT  318

Query  861   NGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVN  682
               +G  HL     S  L  TV G I +Q  +F +++W S+ + GL+ YEK+VG LF  VN
Sbjct  319   GEVGCKHLLPSLHSSLLVVTVLGFIGVQFIMFCSMQWDSELLNGLSSYEKIVGVLFQCVN  378

Query  681   SRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMD-ENNNSKTKGCSPKKF--NII  511
             +RHTGE+I+DLS +APA+L + VVMMYLPP T+F P    E     +K   PKK    ++
Sbjct  379   TRHTGETIVDLSKVAPAILVVFVVMMYLPPYTSFLPAKSGERLQGNSKRIEPKKSYKQLL  438

Query  510   EKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQ  331
             E    S L  L+IFI+++CITER+KMK+DPLNFN LNIVVEVISAYGNVGF+TGYSC RQ
Sbjct  439   ENFKFSQLSYLAIFIVMVCITERKKMKDDPLNFNALNIVVEVISAYGNVGFTTGYSCERQ  498

Query  330   IKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             ++P   C+D+ +GF G+WS+ GK ILI+VM FGRLKK++MKGG+AW L
Sbjct  499   LRPIDGCEDRWYGFSGKWSDQGKIILIVVMIFGRLKKFNMKGGQAWIL  546



>ref|XP_009339408.1| PREDICTED: sodium transporter HKT1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009339410.1| PREDICTED: sodium transporter HKT1-like isoform X1 [Pyrus x bretschneideri]
Length=534

 Score =   374 bits (960),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 266/523 (51%), Positives = 352/523 (67%), Gaps = 35/523 (7%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRP---ISFKLKDLDvfftavssat  1516
             S  R L F  N F  +L YF+ +SL G+ AL+V+KPR     SF+ K+ D+FFT+VS+ T
Sbjct  25    SLFRVLLFHSNTFCFQLFYFLTVSLFGYLALRVTKPRTSTNTSFRPKNYDIFFTSVSATT  84

Query  1515  vssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID  1336
             VSSMSTVEMEVFSN QL+ +T LM LGGE FTS LGL   +SK          N    ++
Sbjct  85    VSSMSTVEMEVFSNTQLIILTILMLLGGEVFTSMLGLQIAKSK----------NFPKSLN  134

Query  1335  HVELGLVTNNEYHNDLNPEDS-------------AKSNVQIEVVEDIKLLGCVRVLARvv  1195
             H +   V     ++  +P DS                   +E  E   +   +R+L  VV
Sbjct  135   HKDDNRVDVVVDNSRHHPPDSNNNTSFEQFELRFVSDRSHLENDEKNNIYKSIRILGYVV  194

Query  1194  lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENM  1015
             L +++V+H+ G  LV+MYI  VP+A+Q+L+ KG+++ TF++FTTVSTF+NCG+VPTNENM
Sbjct  195   LGFLLVVHIGGSILVSMYIALVPSARQILQSKGIEIQTFSIFTTVSTFANCGYVPTNENM  254

Query  1014  IVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLF  835
             IVFK+N GLLL+L+PQ+L+GNTLYP+CLR  IW L K T+R EF  IL +   LGY HL 
Sbjct  255   IVFKKNSGLLLLLLPQLLIGNTLYPSCLRFLIWLLQKITKRAEFSYILKNYKELGYCHLL  314

Query  834   SGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIl  655
             S   S  LA TV G I  Q  +F  +EW+S+A+ GL+ YEK V S+F V NSRH+GES++
Sbjct  315   SSLHSFLLALTVLGFIVAQFILFCVMEWKSEAMDGLSAYEKFVASIFQVTNSRHSGESVV  374

Query  654   dlsllapavlalivVMMYLPPDTTFFPIMDE------NNNSKTKGCSPKKFNIIEKILLS  493
             DLS+L+PA+L L VVMMYLPP TTF P   +       N S+ +  +P K  +++ ++ S
Sbjct  375   DLSVLSPAILVLFVVMMYLPPYTTFLPTTSDCEEIASANGSRIR--NPIK-TLVDSLIFS  431

Query  492   PLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQ  313
              L  +++F+IL+CITER+KMK+DPLNFNVLNI +EVIS Y NVG STGYSC RQ+K +  
Sbjct  432   QLSYIAMFVILVCITERDKMKDDPLNFNVLNITIEVISGYANVGLSTGYSCKRQLKHDSA  491

Query  312   CKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             C D  +GF GRWS  GKF+LI+VM FGRLK++ MK GKAWKLS
Sbjct  492   CVDAWYGFAGRWSTQGKFVLILVMIFGRLKQFSMKQGKAWKLS  534



>ref|XP_010542389.1| PREDICTED: sodium transporter HKT1 [Tarenaya hassleriana]
Length=520

 Score =   373 bits (958),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 250/486 (51%), Positives = 336/486 (69%), Gaps = 16/486 (3%)
 Frame = -1

Query  1611  IGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGG  1432
             +GF ALK+SKPR  S  L DLD+FFT+VS+ TVSSMST  MEV SN QL+ +T LMFLGG
Sbjct  35    VGFLALKISKPRTSS-HLHDLDIFFTSVSAVTVSSMSTFNMEVLSNTQLIIVTLLMFLGG  93

Query  1431  ECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNE--YHNDLNPEDSAKSNV  1258
             E FTS L L+F  S V  ++++    +   +D  +  + ++     + D    D   +  
Sbjct  94    EVFTSMLSLYFSHS-VKMSQKIERFIRSFRLDQHDRKIESSGPVVLYGDRRGNDVESTVG  152

Query  1257  QIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttf  1078
             + +  ++ K     R L  VVL Y++V+H +G  L+ +Y+  V T+++VL+ KG+ L TF
Sbjct  153   EGDDADEFKDRAS-RSLYSVVLGYLLVVHTIGSMLLLVYVTVVRTSREVLRSKGISLFTF  211

Query  1077  avfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTT  898
             +VFTTVSTF+NCGFVPTNENMIVF++N GLLL++IPQ+L+GNTL+P CL L+IW L K+T
Sbjct  212   SVFTTVSTFANCGFVPTNENMIVFRKNSGLLLLMIPQVLMGNTLFPCCLFLSIWALSKST  271

Query  897   RRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGY  718
              R EF  IL +   +GY HL S R    L AT F  I LQL +F ++EW+S ++ G++ Y
Sbjct  272   NRREFGYILKNYKKMGYSHLLSSRHCLLLGATAFVFIILQLVLFCSMEWKSQSLEGMSSY  331

Query  717   EKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIM--------DE  562
             EK VGSLF VVNSRH GESI+DLS ++ A+L + ++MMYLPP T F P+         D+
Sbjct  332   EKFVGSLFEVVNSRHAGESIVDLSTISQAILVVFIIMMYLPPYTVFMPLTGEEEERGDDD  391

Query  561   NNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
             N +   KG   KK +++E+IL+S LG LSIF+ILI ITER  ++ DPLNFNVLNI++EVI
Sbjct  392   NGDQVKKG--GKKESVVERILMSQLGFLSIFVILISITERHMLRRDPLNFNVLNIILEVI  449

Query  381   SAYGNVGFSTGYSCARQIKP-EGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKG  205
             SAYGNVGF+ GYSC R++   +G C+D  +GF GRWS  GKFILIIVMFFGRLK++    
Sbjct  450   SAYGNVGFTAGYSCERRLNAGDGHCEDAWYGFAGRWSPAGKFILIIVMFFGRLKQFTANS  509

Query  204   GKAWKL  187
             GK+W L
Sbjct  510   GKSWIL  515



>emb|CCJ09643.1| Na+ transporter [Solanum cheesmaniae]
Length=555

 Score =   374 bits (959),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 255/530 (48%), Positives = 357/530 (67%), Gaps = 34/530 (6%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPR-PISFKLKDLDvfftavssa  1519
             ++ S  R + F+VN F ++L YFI +S+ GF  L+   PR    F   +LD+FFT+VSSA
Sbjct  32    LISSLYRSILFKVNKFFIQLFYFIFISIFGFLILRNLNPRHSEDFTSTNLDLFFTSVSSA  91

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV------STTERVLE-  1360
             T+SSMST+EMEVFSN QL+ +TFLMF+GGE F S + L+  + K       S  E +L  
Sbjct  92    TISSMSTLEMEVFSNSQLIVITFLMFIGGEVFISMIELYLIRPKFKPWRKNSKIESILSS  151

Query  1359  --------KNKVIVID---HVELGLV----TNNEYHNDLNPEDSAKSNVQIEVVEDIKLL  1225
                     +N     D   ++EL +V    +     +D + +D   S+  ++  + IK L
Sbjct  152   NNSTTSSPRNSNFNNDDDYNIELDIVVLPDSPKSIKSDKDKDDFTSSDNNLKY-QSIKFL  210

Query  1224  GCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSN  1045
             G V ++      Y+++I++VG +LV MY+ FV +AK VL  KGL+   F +FTT+S+F +
Sbjct  211   GVVTLV------YLLLINIVGMSLVLMYLAFVSSAKDVLINKGLNTYIFTIFTTISSFVS  264

Query  1044  CGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGK--TTRRIEFRQIL  871
             CGFVPTNENM+VF +N GLL ILIP +L+GN LYP CLR +I  +GK   +++ E + +L
Sbjct  265   CGFVPTNENMMVFSKNSGLLWILIPLLLVGNALYPMCLRFSIRLMGKLFVSKKREAKYLL  324

Query  870   GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFV  691
              +   +G+ HLFS + S  L  T+FG I +Q  +F ALEW S+ + GL  Y++ VGSLF 
Sbjct  325   KNSREIGHLHLFSRQHSRLLVVTMFGFILVQFILFCALEWNSNGLNGLNSYQRFVGSLFQ  384

Query  690   VVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPI--MDENNNSKTKGCSPKKFN  517
             VVN+RHTGE+I+D+S L+P +L + +VMMYLPP T+F P+  ++EN      G   K+  
Sbjct  385   VVNARHTGETIVDISTLSPPILVMFIVMMYLPPYTSFIPVKGVEENTEEYLFGEKQKRGK  444

Query  516   IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCA  337
             ++E  + S L  LS+FI+LICITER+KMK+DPLNFNVLNI +EVISAYGNVGF+TGYSC 
Sbjct  445   VVENFIFSQLCYLSLFIVLICITERKKMKDDPLNFNVLNITLEVISAYGNVGFTTGYSCD  504

Query  336   RQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             R I  +  CK+K +GFVG+WS+ GK I+II+MFFGRLKK++M+GGKAWKL
Sbjct  505   RMINGDQSCKNKWYGFVGKWSDEGKIIIIIIMFFGRLKKFNMQGGKAWKL  554



>ref|XP_010323376.1| PREDICTED: sodium transporter HKT1-like [Solanum lycopersicum]
 emb|CCJ09641.1| Na+ transporter [Solanum lycopersicum var. cerasiforme]
Length=555

 Score =   374 bits (959),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 256/530 (48%), Positives = 357/530 (67%), Gaps = 34/530 (6%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPR-PISFKLKDLDvfftavssa  1519
             ++ S  R + F+VN F ++L YFI +S+ GF  L+   PR    F   +LD+FFT+VSSA
Sbjct  32    LISSLYRSILFKVNKFFIQLFYFIFISIFGFLILRNLNPRHSEDFTSTNLDLFFTSVSSA  91

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV------STTERVLE-  1360
             T+SSMST+EMEVFSN QL+ +TFLMF+GGE F S + L+  + K       S  E +L  
Sbjct  92    TISSMSTLEMEVFSNSQLIVITFLMFIGGEVFISMIELYLIRPKFKPWRKNSKIESILSS  151

Query  1359  --------KNKVIVID---HVELGLV----TNNEYHNDLNPEDSAKSNVQIEVVEDIKLL  1225
                     +N     D   ++EL +V    +     +D + +D   S+  ++  + IK L
Sbjct  152   NNSTTSSPRNSNFNNDDDYNIELDIVVLPDSPKSIKSDKDKDDFTSSDNNLKY-QSIKFL  210

Query  1224  GCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSN  1045
             G V ++      Y++VI++VG +LV MY+ FV +AK VL  KGL+   F +FTT+S+F +
Sbjct  211   GVVTLV------YLLVINIVGMSLVLMYLAFVSSAKDVLINKGLNTYIFTIFTTISSFVS  264

Query  1044  CGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGK--TTRRIEFRQIL  871
             CGFVPTNENM+VF +N GLL ILIP +L+GN LYP CLR +I  +GK   +++ E + +L
Sbjct  265   CGFVPTNENMMVFSKNSGLLWILIPLLLVGNALYPMCLRFSIRLMGKLFVSKKREAKYLL  324

Query  870   GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFV  691
              +   +G+ HLFS + S  L  T+FG I +Q  +F ALEW S+ + GL  Y++ VGSLF 
Sbjct  325   KNSREIGHLHLFSRQHSRLLVVTMFGFILVQFILFCALEWNSNGLNGLNSYQRFVGSLFQ  384

Query  690   VVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPI--MDENNNSKTKGCSPKKFN  517
             VVN+RHTGE+I+D+S L+P +L + +VMMYLPP T+F P+  ++EN      G   K+  
Sbjct  385   VVNARHTGETIVDISTLSPPILVMFIVMMYLPPYTSFIPVKGVEENTEEYLFGEKQKRGK  444

Query  516   IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCA  337
             ++E  + S L  LS+FI+LICITER+KMK+DPLNFNVLNI +EVISAYGNVGF+TGYSC 
Sbjct  445   VVENFIFSQLCYLSLFIVLICITERKKMKDDPLNFNVLNITLEVISAYGNVGFTTGYSCD  504

Query  336   RQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             R I  +  CK+K +GFVG+WS+ GK I+II+MFFGRLKK++M+GGKAWKL
Sbjct  505   RMINGDQSCKNKWYGFVGKWSDEGKIIIIIIMFFGRLKKFNMQGGKAWKL  554



>emb|CBI40132.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   371 bits (952),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 254/521 (49%), Positives = 340/521 (65%), Gaps = 48/521 (9%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssat  1516
             ++ S  R +  R N F ++L YF+ LS  GF+ LK  KPR    + ++LD+FFT+VS+AT
Sbjct  33    LVSSFYRFVILRFNTFSVQLCYFLCLSFQGFWVLKALKPRT-PLRPRNLDLFFTSVSAAT  91

Query  1515  vssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID  1336
             VSSMSTVEMEVFSN QL+ +T LMF+GGE FTS + L  ++SK+        K  +I  +
Sbjct  92    VSSMSTVEMEVFSNNQLLILTLLMFVGGEIFTSMVELQLWRSKL--------KKPLIAEN  143

Query  1335  HVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFT  1156
              + +G          L+ E     +++      +  L  V VL              G T
Sbjct  144   QLRVG------RTKSLSSESLKYHSIKFLGFVVMGYLVVVHVL--------------GVT  183

Query  1155  LVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllil  976
             LV+ YI  V +A+ VLKQKGL L TF++FTTVST ++CGFVPTNENMIVF +N GLLLI+
Sbjct  184   LVSAYIALVSSARDVLKQKGLKLFTFSLFTTVSTLASCGFVPTNENMIVFSKNSGLLLII  243

Query  975   ipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVF  796
             IPQ+LLGNTL+P+CLR +IW LGK  +++E   +L +   +G+ HL     S  L  TV 
Sbjct  244   IPQVLLGNTLFPSCLRFSIWTLGKF-KKVESNYLLTNTREIGFLHLLPSLHSTLLVPTVL  302

Query  795   GLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlali  616
             G I +Q T+F ++EW S+ + GL  Y+K++G+LF  VNSRHTGE+I+D+S+L+PA+L L 
Sbjct  303   GFILIQFTLFCSMEWNSEGLNGLNSYQKIIGALFQSVNSRHTGETIVDISILSPAILVLF  362

Query  615   vVMMYLPPDTTFFPIMDENNNSK--TKGCSPKKFNIIEKILLSPLGNLSIFIILICITER  442
             VVMMYLPP T+F P   +  +S+    G   ++  I+E ++ S L  L+IFIILICITER
Sbjct  363   VVMMYLPPYTSFLPTKGDEQSSEICNGGRKRRRGKIVENLIFSQLSYLAIFIILICITER  422

Query  441   EKMKEDPLNFNVLNIVVEVIS----------------AYGNVGFSTGYSCARQIKPEGQC  310
              KMK+DPLNF VLNIV+EVIS                AYGNVGF+ GYSC R +KP+  C
Sbjct  423   RKMKDDPLNFTVLNIVIEVISLQDQYLSSLKRIQFLVAYGNVGFTAGYSCERLLKPDSSC  482

Query  309   KDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             + K FGF G+WS+ GK ILI VMFFGRLKK++M GG+AWKL
Sbjct  483   QSKWFGFSGKWSDEGKIILIFVMFFGRLKKFNMDGGRAWKL  523



>ref|XP_010688439.1| PREDICTED: sodium transporter HKT1-like [Beta vulgaris subsp. 
vulgaris]
Length=547

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 257/506 (51%), Positives = 350/506 (69%), Gaps = 24/506 (5%)
 Frame = -1

Query  1650  FLLELSYFIVLSLIGFFALKVSKPRP---ISF---KLKDLDvfftavssatvssmstVEM  1489
             F++E+ YFI++S+ GF +LK   PR     S+    ++D+D+FFT+VS+ TVSSMST+EM
Sbjct  47    FMIEVFYFILVSICGFVSLKNIDPRTGLLSSYPNKNIRDIDMFFTSVSATTVSSMSTIEM  106

Query  1488  EVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTT-----ERVLE-KNKVIVIDHVE  1327
             EVFSN QLV +T LMF+GGE FTS +GLHF  SK++ T      RV    N  + ++ +E
Sbjct  107   EVFSNSQLVIITILMFIGGEVFTSMVGLHFSASKLTYTPLSARSRVNSVANLPLPLESIE  166

Query  1326  LGLV----TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGF  1159
             LG++    +  E  N+   E   K+  +I+ +   K     RVL  +VL Y++++H++G 
Sbjct  167   LGVIIPCSSTQEISNNTTME---KTKSEIDFLIKSK---STRVLGLLVLGYLLIVHILGI  220

Query  1158  TLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGllli  979
             ++V  Y+    +A ++L++KGL   TF++FT VSTF++CGF+PTNENM VF +N GLLLI
Sbjct  221   SMVFAYLNIFSSAHKILEKKGLKTFTFSLFTIVSTFASCGFIPTNENMQVFSKNSGLLLI  280

Query  978   lipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATV  799
             LIPQILLGNTL+P+ LR +IW LGK T++ E + ++ +   +GY HL   + S  L  TV
Sbjct  281   LIPQILLGNTLFPSFLRFSIWVLGKFTKKDETKYLMRNSKEIGYHHLLPSKHSKLLVVTV  340

Query  798   FGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
             FG I +Q  +F A+EW  +   GL  Y+K+VG LF  VNSRHTGESI+DLS +A A+L L
Sbjct  341   FGFILVQFILFCAMEWSFEGFNGLNVYQKLVGVLFQCVNSRHTGESIVDLSSIASAILVL  400

Query  618   ivVMMYLPPDTTFFPIMDENNNSKTKGC-SPKKFNIIEK-ILLSPLGNLSIFIILICITE  445
              +VMMYLPP T+F PI DE        C S KK  I+ K I+ S L  L+IFI++ICITE
Sbjct  401   FIVMMYLPPYTSFVPIKDEEGELPQILCKSEKKSKIMLKNIIFSQLSYLAIFIMIICITE  460

Query  444   REKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMG  265
             R+ +K+DPLNFN+ NI  EVISAYGNVGFSTGYSC RQ+K +  C  K +GF G WS+ G
Sbjct  461   RQNIKDDPLNFNIFNIAFEVISAYGNVGFSTGYSCGRQLKVDSTCVSKWYGFAGYWSDQG  520

Query  264   KFILIIVMFFGRLKKYHMKGGKAWKL  187
             K +LIIVMFFGRLKK+++KGGK+WKL
Sbjct  521   KIVLIIVMFFGRLKKFNLKGGKSWKL  546



>gb|AAD53890.1|AF176036_1 potassium-sodium symporter HKT2 [Eucalyptus camaldulensis]
Length=549

 Score =   370 bits (950),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 260/514 (51%), Positives = 349/514 (68%), Gaps = 20/514 (4%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R L  RVN F ++L YF+ LSL+GF+ LK S+P   SF+ +DLD+FFT+VS ATVSSMST
Sbjct  38    RFLLLRVNSFCVQLLYFVFLSLLGFWVLKASRPLTHSFRPRDLDLFFTSVSLATVSSMST  97

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHF----FQSKVSTTERVLEKNKVI-----  1345
             VEMEV S+ QLV MT LMF+GGE FTS  GLHF     QS + T E V   +  +     
Sbjct  98    VEMEVLSDSQLVVMTVLMFVGGEVFTSLAGLHFRKLKLQSLLKTEETVASVHTNLCPSNP  157

Query  1344  ---VIDHVELGLVTNNEYHND-LNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivv  1177
                V+DHVEL +VTN++  N  + P+     +   ++  D        VL  VVL Y++ 
Sbjct  158   TNGVVDHVELAVVTNSDCLNSRVEPQLHGPRDESPDL--DYLKYRSANVLCLVVLGYLLG  215

Query  1176  ihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRN  997
             ++V+G   V++Y+  V +A+ VLK+KGL + TF++FTTVSTF++CGFVPTNENM VF +N
Sbjct  216   VNVLGVAAVSLYMILVSSARDVLKRKGLKMMTFSIFTTVSTFASCGFVPTNENMAVFNKN  275

Query  996   PGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSG  817
              GLLLILIPQ+LLGNTL+P+ LRL +W LGK +++ E   +L     +GY HL     S 
Sbjct  276   SGLLLILIPQVLLGNTLFPSTLRLVLWLLGKFSKKAEIDYLLSRTGEIGYKHLLPSLYSS  335

Query  816   FLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlslla  637
              L  TV G I +Q  +F +++W S+++ GL  YEK+V  LF  VN+R+TGE+I++LS ++
Sbjct  336   LLVVTVLGFIGVQFIMFCSMQWDSESLDGLNSYEKIVAVLFQCVNTRYTGETIVNLSKVS  395

Query  636   pavlalivVMMYLPPDTTFFPIMDEN----NNSKTKGCSPKKFNIIEKILLSPLGNLSIF  469
             PA+L L VVMMYLPP T+F P +       N  + K     K  +++ ++ S    L+IF
Sbjct  396   PAILVLFVVMMYLPPYTSFLPAIGGEELLGNGERKKAKRSHKL-MLKSLIFSQPSYLAIF  454

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             II ICITE+EKMK+DPLNFNV NIVVEVISAYGNVGF+ GY+C RQ++    C+DK +GF
Sbjct  455   IITICITEKEKMKKDPLNFNVFNIVVEVISAYGNVGFTIGYNCDRQLRRIEGCEDKWYGF  514

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              G+WS+ GK ILI VM FGRLKK++MKGG+ W L
Sbjct  515   SGKWSDEGKIILIAVMIFGRLKKFNMKGGRNWIL  548



>gb|KCW80896.1| hypothetical protein EUGRSUZ_C02265 [Eucalyptus grandis]
Length=508

 Score =   367 bits (943),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 249/532 (47%), Positives = 331/532 (62%), Gaps = 57/532 (11%)
 Frame = -1

Query  1725  PPISLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLD  1546
             P I   + H +  S +R LA R N F  +L+YF+++S +G++ALK+ +P+  S+K  DLD
Sbjct  16    PSIPQHSCHPVASSLLRNLARRANSFWTQLTYFVLVSAVGYWALKLCEPKSSSYKPCDLD  75

Query  1545  vfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERV  1366
             +FFT+VS+ TVSSMSTVEME FSN QLV +T LM  GGE FTS LGL+  +S+ +     
Sbjct  76    IFFTSVSANTVSSMSTVEMEAFSNSQLVIITLLMLFGGEVFTSMLGLYLSRSEFAGR---  132

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDL------------------NPEDSAKSNVQIEVVE  1240
                      DH E   VT++   N++                  +PE            E
Sbjct  133   ---------DHREANSVTSDHSDNNIKLELPPLHPVTEANTFKFDPEMKGMPLKPAPSGE  183

Query  1239  DIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttv  1060
              +      + L+ VVL Y  ++H  G TL++ YI  VP+A++VL+ +GL +  F+VF TV
Sbjct  184   GLLKHRATKYLSYVVLGYHFIVHAGGSTLLSAYISLVPSARKVLRHRGLTVQMFSVFMTV  243

Query  1059  stfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFR  880
             STF+NCGFVPTNENM+ FK NPGLL +L+PQ+LLGNTLYP CLR AIW L + T R EF 
Sbjct  244   STFANCGFVPTNENMLAFKHNPGLLWLLLPQVLLGNTLYPPCLRAAIWLLERVTGRAEFD  303

Query  879   QILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGS  700
              +L +   +GY +L  G     LAATV   + +Q      +EW S A+ GL+ YEK+VG+
Sbjct  304   YMLRNSGAMGYAYLLPGFHCLCLAATVGKFVLVQFVALCCMEWDSPAMEGLSPYEKLVGA  363

Query  699   LFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKF  520
             LF  VN+RH GES+ DLS+++PA+L L V+MM                            
Sbjct  364   LFEAVNTRHAGESVFDLSIISPAILVLFVLMMR---------------------------  396

Query  519   NIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSC  340
             +++  ++ S L  L IFIILIC+TERE +K DPLNFNVLNI +E ISAYGNVGFS GYSC
Sbjct  397   HLLTCLMFSQLSYLVIFIILICLTERENLKNDPLNFNVLNITIETISAYGNVGFSVGYSC  456

Query  339   ARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              R++  +  C+D ++GFVGRWSN GKFILIIVM FGRLKK++MKGG AW LS
Sbjct  457   KRRLNRDSPCRDAEYGFVGRWSNKGKFILIIVMLFGRLKKFNMKGGAAWSLS  508



>ref|NP_001046052.1| Os02g0175000 [Oryza sativa Japonica Group]
 emb|CAD37184.1| putative sodium transporter [Oryza sativa Japonica Group]
 emb|CAD37185.1| putative sodium transporter [Oryza sativa Japonica Group]
 dbj|BAF07966.1| Os02g0175000 [Oryza sativa Japonica Group]
Length=531

 Score =   367 bits (942),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 236/498 (47%), Positives = 331/498 (66%), Gaps = 14/498 (3%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEME  1486
             ++ NP  + ++YF ++S  G+ +LKV KPR  S  LKDLDV FT+VS++TVSSM+TVEME
Sbjct  42    YQNNPLFVHVAYFALISFAGYGSLKVLKPRDKSNTLKDLDVLFTSVSASTVSSMATVEME  101

Query  1485  VFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID-----HVELG  1321
              FS+ QL  +T LM +GGE FTS LG+HF +++  T E V  ++    ID       + G
Sbjct  102   DFSSAQLWVLTILMLIGGEVFTSMLGIHFMRAEFGTKESVSTRDHSPCIDIESITSTKFG  161

Query  1320  LVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMY  1141
               T          E   ++   +E  + IK LG V      V+ Y+++ ++ G  L+ +Y
Sbjct  162   PSTQGTKVTVSFSELRMENGGHVEP-KTIKFLGFV------VMGYLLITNLGGSLLIYLY  214

Query  1140  IGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqil  961
             +  VP+A ++LK+KG+ +  F+VFT +S+  NCGF P NENMI+F++N  LLL+++PQIL
Sbjct  215   LNLVPSAHKILKRKGIGIIVFSVFTAISSVGNCGFTPVNENMIIFQKNSILLLLILPQIL  274

Query  960   LGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFL  781
              GNTL+  CLRL +W L K T + + R IL  P  +GY HL S R S +L  TV  LI L
Sbjct  275   AGNTLFAPCLRLMVWSLEKITGKKDCRYILEYPKAIGYKHLMSTRESVYLTLTVVSLIIL  334

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
             Q  +FL+LEW S A+ G++ Y+K+V +LF  VN+RH GES+ DLS L+ A+L L  +MMY
Sbjct  335   QTVLFLSLEWSSVALDGMSNYQKIVSALFQSVNARHAGESVTDLSNLSSAILVLYTIMMY  394

Query  600   LPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDP  421
             LP  T+F P  D   +SKT+  + +K  ++E  + S +  L+IF++LICITER+ M  DP
Sbjct  395   LPGYTSFLPRHD-GEDSKTEKINKRK-GLLENWIFSHMSYLAIFVMLICITERDSMATDP  452

Query  420   LNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVM  241
             LNFNV +I+ EV+SAYGNVGFS GYSC R +  + +CKD  +GF G+WS+ GK ILIIVM
Sbjct  453   LNFNVFSILFEVVSAYGNVGFSVGYSCKRLLNHDARCKDASYGFAGKWSDNGKAILIIVM  512

Query  240   FFGRLKKYHMKGGKAWKL  187
              FGRLK ++MKGG+AWKL
Sbjct  513   LFGRLKTFNMKGGRAWKL  530



>gb|EYU38770.1| hypothetical protein MIMGU_mgv1a004645mg [Erythranthe guttata]
Length=517

 Score =   364 bits (934),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 246/504 (49%), Positives = 333/504 (66%), Gaps = 31/504 (6%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPR---PISFKLKDLDvfftavssatvssms  1501
             + F +N F  EL YF  LS IGF ALK SKP    P     K++D+FFT++S+AT SSMS
Sbjct  35    VVFPMNQFWSELCYFTTLSFIGFLALKFSKPSVLLPSHHLPKNIDLFFTSLSAATASSMS  94

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVS--TTERVLEKNKVIVIDHVE  1327
             T+EMEVFSN+QL  +T + F+ GE FTS L LHF +S  S  +T +    N     D  +
Sbjct  95    TLEMEVFSNIQLFVLTVITFVTGEVFTSILELHFSKSAKSDSSTFKYYSNNSNRRTD--Q  152

Query  1326  LGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL-GCVRVLARvvlsyivvihvVGFTLV  1150
             LG+V + E        +  +  ++ + ++ + +L GC  +L  V           G TL+
Sbjct  153   LGIVISGE-------AEEEEGLLKFKSIQTLAVLVGCYLLLVHVA----------GATLI  195

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
             ++Y+  VP+A+ VLK+KGL+   F +FT VSTF+NCGF+PTNENM+ F+ N GL LILI 
Sbjct  196   SVYLNLVPSARNVLKKKGLNQQIFTIFTAVSTFANCGFLPTNENMMAFRTNSGLQLILIL  255

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRR--SGFLAATVF  796
              IL+GNTLYP CLR  I  L K T + EFR +L +   LGY HL  G    S +L  T  
Sbjct  256   LILMGNTLYPLCLRFTILALEKITGKEEFRYMLKNSRELGYRHLIPGNTMDSVYLGITAL  315

Query  795   GLIFLQLTVFLALEWRSDAIA-GLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
             G + +QL +F  LEW S+A+  G++GYEK VGSLF VV+SRH GES+ DLS ++PAVL L
Sbjct  316   GFLSVQLILFCTLEWNSEAVVDGMSGYEKAVGSLFQVVSSRHAGESVFDLSAVSPAVLVL  375

Query  618   ivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
              ++MMYLP  T+F PI+   N  + K    ++ +  E+IL + LG ++IF+IL+CITE E
Sbjct  376   FLLMMYLPAYTSFVPIIYVENGIQKK---KRRGDFWEQILFTQLGYITIFVILVCITEAE  432

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKF  259
              MK DPLNF+V  IV EVISAYGNVGFS GYSC R+I  +G+C+D  +G  G+WSN GKF
Sbjct  433   SMKTDPLNFSVFAIVFEVISAYGNVGFSIGYSCERRINSDGKCRDAWYGLAGKWSNGGKF  492

Query  258   ILIIVMFFGRLKKYHMKGGKAWKL  187
             +L++VM FGRLKK++++GG+AWKL
Sbjct  493   VLMVVMLFGRLKKFNVRGGRAWKL  516



>sp|Q6H501.1|HKT6_ORYSJ RecName: Full=Probable cation transporter HKT6; Short=OsHKT6 
[Oryza sativa Japonica Group]
 dbj|BAD26198.1| putative high affinity potassium transporter [Oryza sativa Japonica 
Group]
 dbj|BAD27606.1| putative high affinity potassium transporter [Oryza sativa Japonica 
Group]
Length=530

 Score =   361 bits (926),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 235/498 (47%), Positives = 330/498 (66%), Gaps = 15/498 (3%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEME  1486
             ++ NP  + ++YF ++S  G+ +LKV KPR  S  LKDLDV FT+VS++TVSSM+TVEME
Sbjct  42    YQNNPLFVHVAYFALISFAGYGSLKVLKPRDKSNTLKDLDVLFTSVSASTVSSMATVEME  101

Query  1485  VFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID-----HVELG  1321
              FS+ QL  +T LM +GGE FTS LG+HF +++  T E V  ++    ID       + G
Sbjct  102   DFSSAQLWVLTILMLIGGEVFTSMLGIHFMRAEFGTKESVSTRDHSPCIDIESITSTKFG  161

Query  1320  LVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMY  1141
               T          E   ++   +E  + IK LG V      V+ Y+++ ++ G  L+ +Y
Sbjct  162   PSTQGTKVTVSFSELRMENGGHVEP-KTIKFLGFV------VMGYLLITNLGGSLLIYLY  214

Query  1140  IGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqil  961
             +  VP+A ++LK+KG+ +  F+VFT +S+  NCGF P NENMI+F++N  LLL+++PQIL
Sbjct  215   LNLVPSAHKILKRKGIGIIVFSVFTAISSVGNCGFTPVNENMIIFQKNSILLLLILPQIL  274

Query  960   LGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFL  781
              GNTL+  CLRL +W L K T + + R IL  P  +GY HL S R S +L  TV  LI L
Sbjct  275   AGNTLFAPCLRLMVWSLEKITGKKDCRYILEYPKAIGYKHLMSTRESVYLTLTVVSLIIL  334

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
             Q  +FL+LEW S A+ G++ Y+K+V +LF  VN+RH GES+ DLS L+ A+L L  +MMY
Sbjct  335   QTVLFLSLEWSSVALDGMSNYQKIVSALFQSVNARHAGESVTDLSNLSSAILVLYTIMMY  394

Query  600   LPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDP  421
             LP  T+F P  D   +SKT+  + +K  ++E  + S +  L+IF++LICITER+ M  DP
Sbjct  395   LPGYTSFLPRHD-GEDSKTEKINKRK-GLLENWIFSHMSYLAIFVMLICITERDSMATDP  452

Query  420   LNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVM  241
             LNFNV +I+ EV+ AYGNVGFS GYSC R +  + +CKD  +GF G+WS+ GK ILIIVM
Sbjct  453   LNFNVFSILFEVV-AYGNVGFSVGYSCKRLLNHDARCKDASYGFAGKWSDNGKAILIIVM  511

Query  240   FFGRLKKYHMKGGKAWKL  187
              FGRLK ++MKGG+AWKL
Sbjct  512   LFGRLKTFNMKGGRAWKL  529



>ref|XP_006646953.1| PREDICTED: probable cation transporter HKT6-like [Oryza brachyantha]
Length=531

 Score =   360 bits (925),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 232/497 (47%), Positives = 322/497 (65%), Gaps = 18/497 (4%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFS  1477
             NP  + ++YF ++S  G+ ALKV KPR     L+DLDV FT++S++TVSSM+TVEME FS
Sbjct  45    NPLFVHVTYFALISFAGYAALKVIKPRDKLNTLRDLDVLFTSISASTVSSMATVEMEDFS  104

Query  1476  NLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYH  1297
             + QL  +T LM +GG+ FTS LG+HF ++K    E V  ++    ID   +     N   
Sbjct  105   SAQLWVLTILMLIGGDIFTSMLGIHFMRAKFGRKEPVNTRDHSSYIDIEPITSTKFNPST  164

Query  1296  NDL-------NPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
              D+        P    + +V+   +E     G V      V+ Y+++ ++ G  L+ +Y+
Sbjct  165   QDMKVTVSFSEPHMENEGHVEPSTIE---FFGFV------VMGYLLMTNLGGSLLIYLYL  215

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VP+A+Q+LK+KG+ +  F+VFT +S+  NCGF P NENMI+F++N  LLLI+IPQIL 
Sbjct  216   NLVPSAQQILKRKGIGMVIFSVFTAISSVGNCGFTPVNENMIIFQKNSVLLLIIIPQILA  275

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GNTL+  CLRL +W + K T + + R IL     +GY HL S R   +L  TV   I +Q
Sbjct  276   GNTLFAPCLRLMVWSVEKITGKKDCRYILERSKAIGYKHLMSSREGVYLILTVVSFIIMQ  335

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
               +FL+LEW S A+  +  Y+K+V +LF  VNSRH GESI DLS L+ A+L L  +MMYL
Sbjct  336   TVLFLSLEWNSAALHEMNSYQKIVCALFQSVNSRHAGESITDLSNLSSAILVLYTIMMYL  395

Query  597   PPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPL  418
             P  T+F P  +++ +SKTK    +K  ++E  + S +  L+IF+ILICITERE M  DPL
Sbjct  396   PGYTSFLP-RNDDGDSKTKMIKERK-RLLENWIFSQISYLAIFVILICITERESMATDPL  453

Query  417   NFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMF  238
             NFNV +I+ EV+SAYGNVGFS GYSC R +  +  CKD  +GF G+WS+ GK ILIIVM 
Sbjct  454   NFNVFSILFEVVSAYGNVGFSVGYSCKRLLNHDAHCKDASYGFAGKWSDSGKAILIIVML  513

Query  237   FGRLKKYHMKGGKAWKL  187
             FGRLK ++MKGG+AWKL
Sbjct  514   FGRLKAFNMKGGRAWKL  530



>ref|XP_008781916.1| PREDICTED: cation transporter HKT8-like [Phoenix dactylifera]
Length=459

 Score =   357 bits (917),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 235/464 (51%), Positives = 311/464 (67%), Gaps = 7/464 (2%)
 Frame = -1

Query  1578  RPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHF  1399
             R  + K +DLD+FF AVS+ TVSSM  VEME FSN QLV +T LM +GGE FTS +GL F
Sbjct  2     RDAASKPEDLDLFFMAVSANTVSSMVAVEMESFSNSQLVILTLLMLVGGEVFTSIVGLQF  61

Query  1398  FQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGC  1219
              + K+   E   +K   I +   ELG V +      +     +  +        IK LG 
Sbjct  62    TRIKLEKKETPYDKAS-IELSSKELGKVADQLELGTMESGAISPGSGSDLRYNSIKHLGF  120

Query  1218  VRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCG  1039
             + VL      Y +V HV+G+ L+ +Y+  +P+A+ VL+ KG+   TF++FT VS+F+NCG
Sbjct  121   I-VLG-----YFLVFHVIGYVLILVYLSLIPSARAVLEGKGIHFHTFSIFTMVSSFTNCG  174

Query  1038  FVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPN  859
             F+PTNENM+VFK   GLLL+++ QIL GNT++P+ LRL IW L K T+R EF  ++ +  
Sbjct  175   FIPTNENMMVFKNCSGLLLLIVAQILAGNTMFPSFLRLVIWILKKHTKRQEFDYMVRNHA  234

Query  858   GLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNS  679
              +G+ HL  G  +  LA TV G + +QL +F  LEWRS  + GL  Y K+VGSLF  VNS
Sbjct  235   EMGFDHLLPGPHAALLALTVLGFVLVQLFLFCCLEWRSVGLDGLNPYRKIVGSLFQSVNS  294

Query  678   RHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKIL  499
             RH GESI+DLS ++PA+L L VVMMYLPP T+F P+ D N  S+ K    K+ N+++ + 
Sbjct  295   RHAGESIVDLSAVSPAILVLYVVMMYLPPCTSFIPLGDGNGPSERKEGGSKRKNLVQNLT  354

Query  498   LSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPE  319
             L  L  L+IF+I+ICITER+K+ EDPLNF+VLNIV+EVISA+GNVGFSTGYSC R++ P 
Sbjct  355   LPQLSCLAIFVIIICITERKKLSEDPLNFSVLNIVIEVISAFGNVGFSTGYSCKRRLNPT  414

Query  318   GQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             GQC+D   GF G+WS  GK  LI VM FGRLKK+ M GG AWKL
Sbjct  415   GQCEDTWVGFSGKWSTEGKLTLIAVMLFGRLKKFSMVGGSAWKL  458



>ref|XP_004149678.1| PREDICTED: sodium transporter HKT1-like [Cucumis sativus]
 gb|KGN65516.1| hypothetical protein Csa_1G434130 [Cucumis sativus]
Length=498

 Score =   359 bits (921),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 254/496 (51%), Positives = 335/496 (68%), Gaps = 25/496 (5%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFS  1477
             NPFL  LSYFI +SL GF ALK+++ R  S    DL++FFT+VS+ +VSSMS VEMEVFS
Sbjct  23    NPFLSHLSYFITISLFGFGALKLTQTRTSS-SPNDLNLFFTSVSAVSVSSMSVVEMEVFS  81

Query  1476  NLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL-EKNKVIVIDHVELGLVTNNEY  1300
             N QL+ +T LMFLGGE F S +       ++S   + L E+N V  +  +E+        
Sbjct  82    NFQLLIITTLMFLGGEVFVSAVAF-----QLSRRFKYLNEENHVDSVRSIEM--------  128

Query  1299  HNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTA  1120
                   E+   S+  + + E      C +VL   ++ Y++  +V+G  L+ +YI  VP A
Sbjct  129   -----EENGTSSSTMVTIDELSISRSCSKVLGHTIIGYLLATNVLGSFLIFIYIIVVPHA  183

Query  1119  KQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYP  940
             KQVL+ KG++  TF++F+TVSTF+NCGF+PTNENMI F  N GLLLILIPQ+LLG  LYP
Sbjct  184   KQVLESKGINFFTFSIFSTVSTFTNCGFIPTNENMIAFNNNSGLLLILIPQVLLGGCLYP  243

Query  939   ACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLA  760
               LRL I  + K + + E+R IL + + +GY HL  G   GFLA TV G I  QL +F +
Sbjct  244   VGLRLVIMAVAKVSGKKEWRYILKNESKMGYSHLLPGLHCGFLAVTVAGFIVFQLIIFCS  303

Query  759   LEWR-SDAI-AGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDT  586
             LEW  SD I  GL  Y+K V SLF V NSRHTGESI+D+S+++ A+L + VVMMYLPP T
Sbjct  304   LEWNNSDGIWDGLNPYQKFVASLFQVTNSRHTGESIVDISVISQAILVVFVVMMYLPPYT  363

Query  585   TFFPIMD--ENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNF  412
             TF PI +  E  +  T G + +++ ++E    S L  L+IFIILICITE++K+++DPLNF
Sbjct  364   TFLPIRNNKERASIMTDGKNRRQY-LVELFTFSQLSYLAIFIILICITEKQKLRDDPLNF  422

Query  411   NVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFG  232
              +LNI +EVISAYGNVGFS+GYSC RQIK +  CKD  +GF GRWS+ GKFILI+VM FG
Sbjct  423   TLLNITIEVISAYGNVGFSSGYSCKRQIKVDSSCKDAWYGFAGRWSSKGKFILILVMIFG  482

Query  231   RLKKYHMKGGKAWKLS  184
             R+K + M  GKAWKLS
Sbjct  483   RMKSFTMHTGKAWKLS  498



>gb|KEH27274.1| high-affinity potassium transporter [Medicago truncatula]
Length=545

 Score =   359 bits (922),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 250/518 (48%), Positives = 349/518 (67%), Gaps = 32/518 (6%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +  R NP  +++ YFI +S  GF  LK   P   +   K+LD+FFT+VSS TVSSMST
Sbjct  38    RFILLRANPLCVQILYFISISFFGFGFLKALNPLYQT-SPKNLDLFFTSVSSTTVSSMST  96

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKV-------IVI  1339
             VEME FSN QL+ +T LMF+GGE FTS LGL+F + K+ T    ++ +         I++
Sbjct  97    VEMEFFSNPQLIIITILMFIGGEIFTSMLGLYFIRLKLKTDLGKIDSSHARFAFANPIIV  156

Query  1338  DHV--ELGLVTNNEYHNDLNPEDSAKSNVQIE-------VVEDIKLLGCVRVLARvvlsy  1186
             D +  E+ +VTN+      NP  ++ SN  I+         E+++ L  ++ L  +VL Y
Sbjct  157   DQIQIEVEMVTNS------NPHITSLSNPNIKSHEPLSTTSENLRYLS-MKYLGYIVLGY  209

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
             I+++H++G   V++Y+  +P+AKQVL+ KGL + TF++FT VSTFS+CGF+PTNENM+VF
Sbjct  210   IIILHIIGVFGVSLYLAMIPSAKQVLENKGLKMFTFSLFTIVSTFSSCGFIPTNENMVVF  269

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
             ++N GLLLILIPQ+LLGNTLYP CLR  IW LGK  ++ E R +L +   +GY HL   +
Sbjct  270   RKNSGLLLILIPQLLLGNTLYPPCLRFCIWVLGKFYKKKECRYLLNNVEEVGYKHLLHWK  329

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              + +L ATVFG I +Q+T+F  ++W S+ +  L  Y+K++G LF  +NSRH GE+I+DLS
Sbjct  330   HTLYLMATVFGFIIIQVTLFCLMDWNSEGLKELNYYQKLIGVLFQSINSRHAGETIVDLS  389

Query  645   llapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN-----IIEKILLSPLGN  481
             +++ A+L L V+MMYLPP T+F P  D   N K    S +K N     + E  +LS +  
Sbjct  390   IISQAILVLFVLMMYLPPYTSFLPWED---NGKMSESSERKQNKRREKVTENKILSRISY  446

Query  480   LSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDK  301
             L IFIIL+CITER+++K+DPLNFNV NI VEV+SAY NVGF+ GYSC RQ+  E  C++K
Sbjct  447   LVIFIILVCITERKQLKDDPLNFNVFNIAVEVVSAYQNVGFTMGYSCERQLHREANCENK  506

Query  300   QFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
               GFVG+WS+ GK ILI+VM  GRLKK++   G  WKL
Sbjct  507   WIGFVGKWSDEGKIILILVMLLGRLKKFNTDAGNPWKL  544



>ref|XP_008453532.1| PREDICTED: sodium transporter HKT1-like [Cucumis melo]
Length=496

 Score =   357 bits (917),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 247/494 (50%), Positives = 329/494 (67%), Gaps = 23/494 (5%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFS  1477
             N FL  LSYFI +SL GF ALK++  R  S    DL++FFT+VS+ +VSSMS VEMEVFS
Sbjct  23    NHFLSHLSYFITISLFGFGALKLTNTRTSS-SPSDLNLFFTSVSAVSVSSMSVVEMEVFS  81

Query  1476  NLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL-EKNKVIVIDHVELGLVTNNEY  1300
             N QL+ +T LMFLGGE F S +G      ++S   + L EKN V  +  +E+G  T++  
Sbjct  82    NFQLLIITTLMFLGGEVFVSAVGF-----QLSRRFKYLNEKNHVGSVRSIEMGSGTSSST  136

Query  1299  HNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTA  1120
                ++    +KS              C ++L   ++ Y++  +++G   + +YI  VP A
Sbjct  137   MVTIDELGISKS--------------CSKLLGHTIIGYLLGTNILGSFFIFVYILVVPHA  182

Query  1119  KQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYP  940
             KQVL+ KG++  TF++F+T+STF+NCGF+PTNENMI F  N GLLLILIPQ+LLG  LYP
Sbjct  183   KQVLESKGINYLTFSIFSTISTFTNCGFIPTNENMIAFNNNSGLLLILIPQVLLGGCLYP  242

Query  939   ACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLA  760
               LRL I    K T + E+R IL + + +GY HL SG R GFL  TV G I  QL +F +
Sbjct  243   VGLRLVIMAAAKVTGKKEWRYILKNDSEMGYSHLLSGLRCGFLVVTVAGFIVFQLIIFCS  302

Query  759   LEWRSDA--IAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDT  586
             LEW +      GL  Y+K V SLF V+NSRHTGES++D+S+++ A+L + VVMMYLPP T
Sbjct  303   LEWNNSGGIWDGLNPYQKFVASLFQVINSRHTGESVVDISVISQAILVIFVVMMYLPPYT  362

Query  585   TFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNV  406
             TF PI +    +       ++  ++E    S L  L+IFIIL+CITE++K+++DPLNF V
Sbjct  363   TFLPIRNYKETASMTDGKDRRQQLVELFTFSQLSYLAIFIILLCITEKQKLRDDPLNFTV  422

Query  405   LNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRL  226
             LNI +EVISAYGNVGFS+GYSC RQIK +  CKD  +GF GRWS+ GKFILI+VM FGR+
Sbjct  423   LNITIEVISAYGNVGFSSGYSCKRQIKVDSSCKDAWYGFAGRWSSKGKFILILVMIFGRM  482

Query  225   KKYHMKGGKAWKLS  184
             K + M  GKAWKLS
Sbjct  483   KSFTMHSGKAWKLS  496



>ref|XP_010263272.1| PREDICTED: probable cation transporter HKT6 [Nelumbo nucifera]
Length=545

 Score =   358 bits (920),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 246/536 (46%), Positives = 333/536 (62%), Gaps = 44/536 (8%)
 Frame = -1

Query  1710  RNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvffta  1531
             ++  T+     R LAF+V+PF + L Y + +S +GF  LKV KP   +F   DL++FF +
Sbjct  20    KSLRTLSAKLYRFLAFQVDPFWIHLFYLVSVSFLGFLGLKVFKPGNETFMPSDLNIFFMS  79

Query  1530  vssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNK  1351
             VS+ TVSS +TVEMEVFS  QLV  T LM LGGE FTS LGL     K +      EKN+
Sbjct  80    VSATTVSSNATVEMEVFSGTQLVVFTLLMLLGGEVFTSMLGLQLSLPKYTAES---EKNE  136

Query  1350  VIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKL--------LGC--------  1219
             + +           N  H D   +  + +   IE  +D           LG         
Sbjct  137   IEI-----------NACHKD---QPISATPFDIETQQDSTSISSSEQSKLGTRAGFNFDT  182

Query  1218  ----------VRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavf  1069
                       +R L  ++L Y++ +H+ G++L+ +Y+ +V +A+++LK+K L   TF+VF
Sbjct  183   GNTGELKYNSLRYLCLILLGYLICVHICGYSLIQLYMSYVQSAREILKKKRLQTVTFSVF  242

Query  1068  ttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRI  889
               +S+F+NCGF+P NENM +F++N GLLLI+IPQ+L+GNTL+P CLRL IW L K T R 
Sbjct  243   AAISSFANCGFLPLNENMAIFRKNSGLLLIIIPQVLMGNTLFPVCLRLIIWVLWKFTHRD  302

Query  888   EFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKV  709
             EF  +L + + +GY HLFS   + FL  T    + LQ  +F  LEW S+ + GL  Y+K+
Sbjct  303   EFDYMLKNTSEMGYSHLFSSLPTCFLGLTALAFLLLQFVLFCILEWNSEPLDGLNSYQKL  362

Query  708   VGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNS-KTKGCS  532
             VG+LF  VNSRH GESI DLS+L+P +L L V MMYLP  T+F PI  +   S K K   
Sbjct  363   VGALFQSVNSRHAGESIFDLSVLSPPILVLYVAMMYLPAYTSFLPIEQDGQLSIKNKKGK  422

Query  531   PKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFST  352
              ++  ++E    SP+  L IF+ILICITEREKM+EDPLNF++ NI++EVISAY NVGFST
Sbjct  423   KRRRRLMETFGSSPIAYLVIFVILICITEREKMREDPLNFSIFNIILEVISAYANVGFST  482

Query  351   GYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             GYSC R+IK +  C+D  +GF GRWSN GK ILIIVM  G+LK +  K  K WKLS
Sbjct  483   GYSCERRIKSDNYCRDASYGFCGRWSNKGKVILIIVMILGKLKNFKTKRDKTWKLS  538



>gb|EYU22104.1| hypothetical protein MIMGU_mgv1a005068mg [Erythranthe guttata]
Length=498

 Score =   357 bits (915),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 263/514 (51%), Positives = 340/514 (66%), Gaps = 27/514 (5%)
 Frame = -1

Query  1716  SLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvff  1537
             SL+    ++  +      ++ PFLL   YF  +S +GF  L   KPR  SFK ++LD+ F
Sbjct  7     SLQRTRFLICCSYHDFLAKLKPFLLYTFYFSSISFVGFGILTGLKPRT-SFKPRNLDLLF  65

Query  1536  tavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEK  1357
             T+VSSATVSSMSTVEMEVFS  QL+ +T LMF+GGE FTS + L   +SK+  T    + 
Sbjct  66    TSVSSATVSSMSTVEMEVFSTSQLIVITILMFMGGEVFTSMVELLLKRSKIIGTCN-FDG  124

Query  1356  NKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivv  1177
              K+  I+       T  EY    NP     S         IK LG V VL      Y+VV
Sbjct  125   RKIESIESEP----TRFEYST--NPFLKYDS---------IKFLGHV-VLG-----YLVV  163

Query  1176  ihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRN  997
             IH++G + V +Y+G V +A+ VL+ KGL    FAVFT VSTF+NCGFVPTNENM+VF +N
Sbjct  164   IHILGISSVLLYLGLVSSAEDVLRNKGLKKFMFAVFTVVSTFANCGFVPTNENMVVFIKN  223

Query  996   PGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQIL---GSPNGLGYGHLFSGR  826
              GLL ILIPQILLGNTL+P+CLR  IW LGK  ++ E   +L    +     Y HLF  +
Sbjct  224   SGLLWILIPQILLGNTLFPSCLRFVIWVLGKKIKKAEANYLLENDTTSKSSVYLHLFPSQ  283

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              S  LAATVFG   L   +F +LEW S A++GL  Y+K+VG LF  VN+RH+GE+I+DLS
Sbjct  284   HSVLLAATVFGFTILGFVIFSSLEWNSAALSGLNTYQKIVGILFQCVNARHSGETIVDLS  343

Query  645   llapavlalivVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFNIIEKILLSPLGNLSIF  469
             +++PAV    VVMMYLPP T+F PI  DE    ++     ++    E ++LS L  L IF
Sbjct  344   IISPAVTVFFVVMMYLPPYTSFLPITKDEETPLESVIRKKRRKTAAENLVLSQLSYLVIF  403

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             II+IC+TER+ +KEDP+NF+VLNI VEVISAYGNVGF+TGYSC RQI+P+  C +K +GF
Sbjct  404   IIIICLTERKSLKEDPVNFSVLNITVEVISAYGNVGFTTGYSCERQIRPDPNCVNKWYGF  463

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              G+WS+ GK +LIIVMFFGRLKK++M GG+AWKL
Sbjct  464   SGKWSDKGKIVLIIVMFFGRLKKFNMNGGQAWKL  497



>gb|ABG33945.1| HKT8 [Triticum aestivum]
 gb|ABG33949.1| HKT8 [Triticum aestivum]
Length=516

 Score =   356 bits (914),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 249/525 (47%), Positives = 334/525 (64%), Gaps = 32/525 (6%)
 Frame = -1

Query  1716  SLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLK  1555
             S   +H+ +    + L F V+PF L+L YF+ +S  G   LK       + PRP+     
Sbjct  8     SSATQHSKLERAYQLLVFHVHPFWLQLLYFVSISFFGLVILKALPMKTSTVPRPM-----  62

Query  1554  DLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTT  1375
             DLD+ FT+VS+ TVSSM  VEME FSN QL+ +T LM LGGE FTS LGLHF   K    
Sbjct  63    DLDLIFTSVSATTVSSMVAVEMESFSNPQLLLLTLLMLLGGEVFTSMLGLHFTYVKSKKK  122

Query  1374  ERVL-------EKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCV  1216
             E          +K K      +EL + T       ++  D  +   + +   D   L   
Sbjct  123   EAQAPHDHDDGDKGKPAPSSSLELAVTTG------MDDVDRVEQGFKDQPRYDRAFL--T  174

Query  1215  RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGF  1036
             R+L  +VL Y VV+H+ G++L+ +Y+  V  A+ VL  KG+ L TF+VFT VSTF+NCGF
Sbjct  175   RLLLFIVLGYHVVVHLAGYSLMLVYLSVVSGARAVLTGKGISLHTFSVFTVVSTFANCGF  234

Query  1035  VPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNG  856
             VP NE MI F+  PGLLL+++P +LLGNTL+P  LRLAIW L + TRR E    LG    
Sbjct  235   VPNNEGMIAFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIWALRRVTRRPE----LGELRS  290

Query  855   LGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSR  676
             +GY HL + R + FLA TV   +  QL++F A+EW S+ + GLT  +K+V  LF+ VNSR
Sbjct  291   IGYDHLLTSRHTWFLAFTVAAFVLAQLSLFCAMEWGSNGLRGLTAVQKLVAGLFMSVNSR  350

Query  675   HTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKK--FNIIEKI  502
             HTGE ++DLS ++ A++ L VVMMYLPP TTF P+ D+++         +K   ++  K+
Sbjct  351   HTGEMVVDLSTVSSALVVLYVVMMYLPPYTTFLPVEDDSDQQVGADQRDQKRITSMWRKL  410

Query  501   LLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP  322
             L+SPL  L+IFI ++CITER ++ +DPLNFNVLNI VEVISAYGNVGFSTGYSC RQ+ P
Sbjct  411   LMSPLSCLAIFIAVVCITERRQISDDPLNFNVLNITVEVISAYGNVGFSTGYSCGRQVTP  470

Query  321   EGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +G C+D   GF G+WS  GK  LI VMF+GRLKK+ M GG+AW++
Sbjct  471   DGGCRDTWVGFSGKWSWQGKLALIAVMFYGRLKKFSMHGGEAWRI  515



>ref|XP_003620952.1| Cation transporter HKT8 [Medicago truncatula]
Length=562

 Score =   358 bits (918),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 261/548 (48%), Positives = 350/548 (64%), Gaps = 64/548 (12%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +  R NP  +++ YFI +S +GF  LK  KP  +    K+LD+FFT+VSS TVSSM T
Sbjct  27    RFILLRSNPLCVQIVYFISISTLGFGFLKALKP--LGQTQKNLDLFFTSVSSTTVSSMVT  84

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV--------STTERVLEKNKVIV  1342
             VEM +FSN QL+ +T LMF+GGE FTS +GL F +S++        S+  R+  +N  I+
Sbjct  85    VEMGIFSNTQLIIITILMFIGGEVFTSLVGLFFIRSRLKIDLDKIASSHARLASRNPFII  144

Query  1341  ID--HVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihv  1168
             +D  H+E  +VTN E H     E  + +N      E+++ L  ++ L  VV+ YI+ +HV
Sbjct  145   VDRFHLEDEMVTN-EVHKH---ESLSTTN------ENLRYLS-MKYLGYVVIGYILFLHV  193

Query  1167  VGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGl  988
             +G   V++Y+  +P+ KQ+LK KGL + TF+VFT VS+FS+CGFVPTNENMI F++N GL
Sbjct  194   IGVIGVSLYLTIIPSTKQLLKNKGLKMLTFSVFTIVSSFSSCGFVPTNENMIDFRKNSGL  253

Query  987   llilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLA  808
             LL+LIPQ+LLGNT YP CLRL I  LGK  ++ E R +L     +GY HL   + + FL 
Sbjct  254   LLMLIPQLLLGNTFYPPCLRLCICGLGKFYKKRECRYLLKHSEKVGYKHLLQRKHTIFLV  313

Query  807   ATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapav  628
             AT  GLI +Q+T+F  ++W S  + GL  Y+K++G LF  VNSRH G SI+D+S+L+ A+
Sbjct  314   ATNCGLIVVQVTLFCVMDWNSKGLKGLNFYQKLIGVLFQSVNSRHAGTSIVDISILSQAI  373

Query  627   lalivVMM----------------------------------------YLPPDTTFFPI-  571
             L L VVMM                                        YLPP T+F P+ 
Sbjct  374   LVLFVVMMATHLFGLHGKELLPRTYLGNTRFDSQGEQRLASAHTSTHEYLPPYTSFLPLK  433

Query  570   MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVV  391
              D   +  +K    ++  + E ++ S L  L IFIIL+CITER+K+KEDPLNFNVLNIVV
Sbjct  434   YDGKISENSKKMKKRRGKVTENLIFSQLSYLVIFIILVCITERKKLKEDPLNFNVLNIVV  493

Query  390   EVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHM  211
             EVISAYGNVGFSTGYSC  Q+ PE  C++K  GFVG+WS+ GK ILI VM FGRLKK++M
Sbjct  494   EVISAYGNVGFSTGYSCELQLHPETNCENKWIGFVGKWSDEGKIILIFVMLFGRLKKFNM  553

Query  210   KGGKAWKL  187
              GGKAWKL
Sbjct  554   DGGKAWKL  561



>ref|XP_009600055.1| PREDICTED: sodium transporter HKT1 isoform X2 [Nicotiana tomentosiformis]
Length=488

 Score =   353 bits (907),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 259/503 (51%), Positives = 329/503 (65%), Gaps = 53/503 (11%)
 Frame = -1

Query  1659  VNPFLLELSYFIVLSLIGFFALKVSKPRPI-SFKLKDLDvfftavssatvssmstVEMEV  1483
             V PF +E+SYF++LSL+G  AL +SKPR + SF+ ++LDVFFT+VS+ATVSSMSTVEMEV
Sbjct  26    VKPFWIEVSYFMILSLLGLLALTISKPRTLPSFRPQNLDVFFTSVSAATVSSMSTVEMEV  85

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID------HVELG  1321
             FSN QLVF+T LMFLGGE FTS+L L   +SK+S  + VL+              H    
Sbjct  86    FSNAQLVFITMLMFLGGEAFTSFLRLQLMKSKLSMEKTVLQNKIESSNSIISIDSHDSSN  145

Query  1320  LVTNNEYHNDL--NPEDSAKSNVQIEVVED---IKLLGCVRVLARvvlsyivvihvVGFT  1156
                N+ +H +L    EDS   +  I  +ED   I  L  +R L+ VV  YI+ + V+G +
Sbjct  146   SPRNSIHHLELGHEQEDSNLEHAIINSMEDSEAIVKLKSLRFLSYVVFGYILGVVVLGSS  205

Query  1155  LVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllil  976
             LV++Y+ F+P+AKQVLK+KGL+L TF++FTTVSTF+NCGFVPTNENM+VF++N GLLLIL
Sbjct  206   LVSIYVSFIPSAKQVLKEKGLNLHTFSLFTTVSTFANCGFVPTNENMMVFRKNSGLLLIL  265

Query  975   ipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVF  796
             IPQ+LLGNTLY  CLRL IWFL K T+R EF  I+ +   +GY H+F    +  LA TV 
Sbjct  266   IPQVLLGNTLYAPCLRLTIWFLWKITKRGEFEYIMKNSKRVGYSHIFPNLETMALATTVL  325

Query  795   GLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlali  616
             G I +Q  VF +LEW S+A AGL+ YEK+VGSLF VVN+RHTGES+ DLS L PA+L L 
Sbjct  326   GFISIQFVVFCSLEWNSEATAGLSSYEKLVGSLFEVVNTRHTGESVFDLSTLTPAILVLF  385

Query  615   vVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREK  436
              VMMYL P T+F PI       +T                               TER  
Sbjct  386   AVMMYLSPYTSFLPIDSNEERLET-------------------------------TERMN  414

Query  435   MKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFI  256
              ++             ++ AYG VG S GYSCARQ+KP+  CKD  +GF G+WSNMGKFI
Sbjct  415   RRKGS----------SLVDAYGTVGMSMGYSCARQLKPDVHCKDAAYGFAGKWSNMGKFI  464

Query  255   LIIVMFFGRLKKYHMKGGKAWKL  187
             LIIVMFFGRLK+Y  +GGK WK+
Sbjct  465   LIIVMFFGRLKQYCKRGGKGWKV  487



>gb|KEH27275.1| sodium transporter HKT1 [Medicago truncatula]
Length=413

 Score =   351 bits (900),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 284/453 (63%), Gaps = 57/453 (13%)
 Frame = -1

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIV----------  1342
             MEVFSN QL+ +TFLM +GGE FTS L L  F  + + T++   KN+             
Sbjct  1     MEVFSNSQLILLTFLMLVGGEVFTSMLQL--FLDRFNFTQKDCVKNECSSCVSSTSLSHK  58

Query  1341  IDHVELGLVT--NNEYH-----NDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyi  1183
             I  +ELG V+   +E H     N++N +D  K N                          
Sbjct  59    IHQMELGSVSMPQSENHDQIEKNNINDKDKLKYN--------------------------  92

Query  1182  vvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFK  1003
                     +LV +YI ++P+AK +L+ KG+++ TF++FT VSTF++CG++PTNENM+VFK
Sbjct  93    ------SLSLVTLYITYIPSAKNILQNKGINIETFSLFTIVSTFASCGYIPTNENMMVFK  146

Query  1002  RNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRR  823
             +N GLLL+++P +LLGN LY  CLRL I FL   T+R EF  +L +   +GY HL S   
Sbjct  147   KNSGLLLLVLPHVLLGNALYAPCLRLIITFLKSITKREEFSYLLNNSKEMGYDHLLSTLH  206

Query  822   SGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsl  643
                L  TVFG   +Q  +F  +EW S  + GL  Y+K+V SLF V N RH+GES+ D   
Sbjct  207   CWHLVGTVFGFNVIQFILFCCMEWSSKIMEGLNIYQKLVASLFQVTNVRHSGESVFDTYS  266

Query  642   lapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFII  463
             ++ A+L L +VMMYLPP TTF P+ D+N+  K +       +++++I+ S L  L IFII
Sbjct  267   ISSAILVLFIVMMYLPPYTTFLPVRDQNDVKKDQN------SLVDRIIFSQLSYLVIFII  320

Query  462   LICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVG  283
             LICITER+ +K+DPLNFNVL I +EVISAYGNVG STGYSC+RQ+KP   C+D   GF G
Sbjct  321   LICITERQSLKDDPLNFNVLTITLEVISAYGNVGLSTGYSCSRQLKPNLMCRDSWIGFSG  380

Query  282   RWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             RWS  GK ILI+VMFFGRLKK++M GGKAW LS
Sbjct  381   RWSTEGKLILILVMFFGRLKKFNMNGGKAWHLS  413



>ref|XP_010690256.1| PREDICTED: cation transporter HKT8-like [Beta vulgaris subsp. 
vulgaris]
Length=520

 Score =   352 bits (904),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 331/507 (65%), Gaps = 42/507 (8%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPI--SFKLKDLDvfftavssatvssmst  1498
             L F++NP+   L Y+I++SL+G+ +LK SK      S    DLD+ FT+VS+ T+SSMST
Sbjct  44    LLFQINPYWHHLFYYILVSLLGYISLKGSKQNSSVSSNPHYDLDLIFTSVSATTISSMST  103

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             +EME FS+ QL  +  LMF GGE F S LGL   + K     R          +HV    
Sbjct  104   IEMENFSSTQLGVLVILMFSGGEVFLSLLGLQIRKLKHKRRAR----------NHV----  149

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
                      LNP  +++         D      +R L  VVL Y++V H++G++LV++Y 
Sbjct  150   ---------LNPSPASEG--------DGMKFRSLRALNHVVLGYLLVSHILGYSLVSLYF  192

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VP+A  VL +K ++   F++FTTVSTF+NCGF+PTNENMI FK+N GLLLILIPQIL+
Sbjct  193   SIVPSASNVLARKKIETHFFSLFTTVSTFANCGFIPTNENMIPFKKNSGLLLILIPQILM  252

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GN LYP+CLRL IW L K T++ E+  +L +  GLGYG+L S  ++  L  T  GL+ +Q
Sbjct  253   GNKLYPSCLRLVIWVLEKVTKKEEYSFMLQNHGGLGYGNLTSSYKAFLLGITAIGLVMVQ  312

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
               VF  LEW +  + G  GY+K VGSLF  VNSRH+GESI+D+SL++ A L L VVMMYL
Sbjct  313   FVVFGILEWNALVLEGQNGYQKFVGSLFQTVNSRHSGESIVDISLVSHATLVLFVVMMYL  372

Query  597   PPDTTFFPI-------MDENNNSKTKGCSPKK--FNIIEKILLSPLGNLSIFIILICITE  445
             P  TTF PI       + EN++      S KK   +I+E +  SPL  L+IF+IL+CITE
Sbjct  373   PSTTTFVPISYNKESALIENSSQSQTSRSSKKQGSSILENLKFSPLSYLAIFVILVCITE  432

Query  444   REKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMG  265
              + +KEDP+NF+V NI+VEV+SAYGNVGFS GYSC R+++    CKD  +GF GRWS  G
Sbjct  433   SKSLKEDPINFSVFNIIVEVVSAYGNVGFSMGYSCKRRLENFSNCKDSWYGFAGRWSWEG  492

Query  264   KFILIIVMFFGRLKKYHMKGGKAWKLS  184
             KF+LI+VM FGRLK++H + GKAWKLS
Sbjct  493   KFLLILVMLFGRLKRFHFQSGKAWKLS  519



>ref|XP_010913851.1| PREDICTED: cation transporter HKT8-like [Elaeis guineensis]
Length=529

 Score =   352 bits (904),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 243/521 (47%), Positives = 338/521 (65%), Gaps = 7/521 (1%)
 Frame = -1

Query  1743  NPSAFTPPISLRNKHTMMMSTVRR-LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPIS  1567
             +P    PP +  +      +++ + L F  NP  ++L YF  +S IGF  LK+   R  +
Sbjct  13    SPLHIRPPSNFISSFREFTASIYQFLLFHANPLWIQLCYFFFVSSIGFLLLKILPMRDAA  72

Query  1566  F-KLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQS  1390
               K KDLD+FF AVS+ TVSS+ TVEME FSN QL+ +T LM LGGE F S +GL F + 
Sbjct  73    RNKPKDLDLFFMAVSANTVSSVDTVEMEAFSNSQLMILTLLMLLGGEVFISMVGLQFTRI  132

Query  1389  KVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRV  1210
             K+   E    K  + ++   EL    N+    +L   DS    +  E          ++ 
Sbjct  133   KLEKKETPYNKANIELMSSKELA---NDSDQPELGTVDSGA--ISPESGSGYLRYSSIKQ  187

Query  1209  LARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVP  1030
             L  VVL Y++ + +VG+ L+  Y+  VP+A+ VL  KG+   TF++FTTVS+F+NCGF+P
Sbjct  188   LGFVVLGYLLAVQIVGYVLILAYVSLVPSARAVLDGKGIHFHTFSIFTTVSSFTNCGFIP  247

Query  1029  TNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLG  850
             TNENM+VFK   GLLL++I QIL GNT++P+ LRL I    K ++R EF  +  +   +G
Sbjct  248   TNENMMVFKNGSGLLLLIIVQILAGNTMFPSFLRLVILVFEKHSKRREFDFMAKNQREIG  307

Query  849   YGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHT  670
             + HL  GRR+   A  V G + +QL +F   EWRS+ + GL+ Y K++ SLF  VNSRH 
Sbjct  308   FDHLLPGRRAVLHALNVLGFVMVQLILFCCFEWRSEGLDGLSPYRKILASLFQSVNSRHA  367

Query  669   GESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSP  490
             GE+I+DLS+++PA+L L VVMMYLP  T+F P+ D++  S+ K    K+ N+++ ++L  
Sbjct  368   GETIVDLSIISPAILVLYVVMMYLPFYTSFIPLGDDDGPSERKEGGSKRKNLVQNLILPE  427

Query  489   LGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQC  310
             L  L+IF+I+ICITER+++ EDPLNF+VLNIV+EV+SAYGNVGFSTGY C RQ+KP GQC
Sbjct  428   LACLAIFVIIICITERKRLSEDPLNFSVLNIVIEVVSAYGNVGFSTGYGCERQLKPIGQC  487

Query  309   KDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +D   GF G+WS  GK  L+ VM FGRLKK+ M GGKAWKL
Sbjct  488   EDTWVGFSGKWSAKGKLTLMAVMLFGRLKKFSMVGGKAWKL  528



>gb|ADG45565.1| putative high-affinity potassium transporter [Salicornia bigelovii]
Length=548

 Score =   350 bits (898),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 251/504 (50%), Positives = 336/504 (67%), Gaps = 26/504 (5%)
 Frame = -1

Query  1641  ELSYFIVLSLIGFFALKVSKPRPISFK-------LKDLDvfftavssatvssmstVEMEV  1483
             EL YFI++S  GF  LK   P+ I          +KDLD+FFT+VS+ TVSSMST+EMEV
Sbjct  51    ELCYFILVSSFGFLILKTLNPKSIHNNNNHIINPIKDLDLFFTSVSATTVSSMSTLEMEV  110

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV-----STTERVLEKNKVIV-IDHVELG  1321
             FSN QL+ +T LMF+GGE FTS +GLHF  SK+      +  RV     + +    +ELG
Sbjct  111   FSNSQLIVLTILMFIGGEVFTSMIGLHFSASKLVYKPLKSRSRVNSVASLTLPCKPIELG  170

Query  1320  LVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL---GCVRVLARvvlsyivvihvVGFTLV  1150
             L+        + P+++  S    +   +I        +RVL  +VL Y+  IH++G ++V
Sbjct  171   LIV-------VTPQENNTSTTMQKTKSEIDFFIKSKSIRVLGFLVLLYLFTIHILGISMV  223

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
              +Y+   P A  VL +KG++  TF++FT VSTF++CGF+PTNENM VF +N G LLILIP
Sbjct  224   LLYLNITPNAINVLHKKGIETFTFSIFTIVSTFASCGFIPTNENMQVFSKNSGFLLILIP  283

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             QILLGNTL+P+ LR +IW LGK  ++ E + +L +   +GY HL   + S  L  TV G 
Sbjct  284   QILLGNTLFPSFLRFSIWVLGKFAKKDEAKYLLRNAKEIGYHHLLPSKHSRLLIMTVLGF  343

Query  789   IFLQLTVFLALEWRSDAI-AGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
             I +QL +F A+EW ++ I  G   Y+K+VG LF  VNSRHTGESI+DLS +APA+L + +
Sbjct  344   IMVQLVMFCAMEWGNEGINEGHNVYQKLVGILFQCVNSRHTGESIVDLSSIAPAMLVVFI  403

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGC--SPKKFNIIEKILLSPLGNLSIFIILICITERE  439
             VMMYLPP T+F PI D+        C    K   I++ +L S L  L+IF I+ICI E++
Sbjct  404   VMMYLPPYTSFVPIKDKEKEYTHILCKEEDKSRKILKNVLFSQLSYLAIFTIIICIIEKQ  463

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKF  259
              MK+DPLNFNV NI  EVISAYGNVGFSTGYSC +Q+K + +C DK +GF GRWS+ GK 
Sbjct  464   NMKDDPLNFNVFNIAFEVISAYGNVGFSTGYSCGKQLKGDPKCVDKWYGFAGRWSDQGKL  523

Query  258   ILIIVMFFGRLKKYHMKGGKAWKL  187
             +LI+VMFFGRLKK+++KGGKAWKL
Sbjct  524   VLILVMFFGRLKKFNLKGGKAWKL  547



>gb|AAK52962.1|AF367366_1 putative potassium-sodium transporter [Mesembryanthemum crystallinum]
Length=505

 Score =   348 bits (892),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 247/515 (48%), Positives = 326/515 (63%), Gaps = 53/515 (10%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISF------KLKDLDvfftavs  1525
             S    + F+V+PF   L Y+I++SL+G+F+LK +  +  S       +  DLD+FFT+VS
Sbjct  29    SLYEYIIFQVHPFWHHLFYYIIVSLLGYFSLKATSRKQRSSPVFSDPRHDDLDLFFTSVS  88

Query  1524  satvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVI  1345
             + T+SSMST+EME FS+ QLV +  LM  GGE F S LGL   +SK     R  E+  ++
Sbjct  89    ATTISSMSTIEMEDFSSPQLVVLIILMLSGGEVFLSLLGLQLRKSK----HRKREQKNIL  144

Query  1344  VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvV  1165
             +               N  +     KS V +  V    LL C               H++
Sbjct  145   L---------------NSPSEGMKYKSLVALGHVVLGYLLVC---------------HII  174

Query  1164  GFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGll  985
             G++L ++YI    +A  VL++K +++  F++F TVSTFSNCGF+PTNENM+VFK N GLL
Sbjct  175   GYSLASLYISISRSASNVLERKHIEMHLFSLFVTVSTFSNCGFIPTNENMMVFKGNSGLL  234

Query  984   lilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAA  805
             LILIPQILLGN LYP+CLRL +W L K T + EF  IL   + LGYG  FS   +  LA 
Sbjct  235   LILIPQILLGNKLYPSCLRLVLWVLEKLTGKAEFSYILKKNDELGYGLFFSQVDALLLAV  294

Query  804   TVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavl  625
             T  GL+ +Q  VF  LEW S A+  L  ++K+VGSLF  VNSRH+GESI+DLSL++PA +
Sbjct  295   TAVGLVMVQFVVFCILEWNSVALMDLNWHQKLVGSLFQTVNSRHSGESIIDLSLISPATM  354

Query  624   alivVMMYLPPDTTFFPIMDE--------NNNSKTKGCSPKKFNIIEKILLSPLGNLSIF  469
              L VVMMYLP  TTF P+  +        +  SK +GCS     I E +  S L  L+IF
Sbjct  355   VLFVVMMYLPSYTTFIPVGYDKEISPEMSSKKSKKQGCS-----IAENLKFSQLSYLAIF  409

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             ++++CITER  + EDPLNFNV NI+VEVISAYGNVGFS GYSC R++   G CKD  +GF
Sbjct  410   VMIVCITERRNLVEDPLNFNVFNIIVEVISAYGNVGFSMGYSCKRRLGDIGTCKDAGYGF  469

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             VGRWS  GK ++I+VM FGRLK+++ KGGKAWKLS
Sbjct  470   VGRWSRQGKMVIILVMLFGRLKRFNFKGGKAWKLS  504



>ref|XP_002268082.1| PREDICTED: sodium transporter HKT1 [Vitis vinifera]
Length=531

 Score =   348 bits (894),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 247/494 (50%), Positives = 328/494 (66%), Gaps = 19/494 (4%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEV  1483
             ++N F+ +  Y+I+LS++GF ALK+S  +  + +L DLD+FFTAVS++TVSSMSTVEME+
Sbjct  43    QLNSFVFQFFYYIILSVLGFLALKLSVLKATTIRLADLDLFFTAVSASTVSSMSTVEMEL  102

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHF----FQSKVSTTERVLEKNKVIVID---HVEL  1324
             FSN QLV +T LM +GGE FTS L L+F    F  K+ + E  +  N     +    VE 
Sbjct  103   FSNTQLVIITALMLMGGEIFTSMLRLNFVGSNFTQKIKSIESRVHDNPSTSRNFPAKVES  162

Query  1323  GLVTNNEYHNDLNP----EDSAKSNVQIEVVEDIKLLGC-VRVLARvvlsyivvihvVGF  1159
             GLV + +   D  P    ED  KS      +    L  C +++L  VV+ YI VI ++G 
Sbjct  163   GLVVHPQL-KDEKPNSIVEDGDKS------LSGEHLRNCSIKLLGHVVIRYIFVIQILGA  215

Query  1158  TLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGllli  979
              L+ +Y+  VP+AK+VLK KG+ +  F+VFT VSTFSNCGFVPTNENM +FK+N GLLL 
Sbjct  216   GLIFLYVSLVPSAKEVLKNKGIQMQIFSVFTAVSTFSNCGFVPTNENMKIFKKNSGLLLF  275

Query  978   lipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATV  799
             LIPQ+LLGNTL+   LR  IW LGKTT+R+E+  +L +   +GY +L     S  +A  V
Sbjct  276   LIPQVLLGNTLFAPALRCVIWVLGKTTKRVEYGYMLNNSREIGYNYLLPSVHSFVMAIVV  335

Query  798   FGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
               LI  +   F ++EW S+A+ GL G EK V SLF VVN RHTGES+ DLS++ PAVL +
Sbjct  336   LVLIVFEFLFFCSMEWNSEALYGLDGNEKFVASLFQVVNLRHTGESVFDLSIVTPAVLVV  395

Query  618   ivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
              +VMMYLP  T+FF I     + K      K+  ++     SPL  L  F+I IC+TER+
Sbjct  396   FIVMMYLPARTSFFAIEGHETDVKNGEGKTKQKRLMGHDTFSPLTFLVPFVIFICMTERD  455

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKF  259
             K+KEDPLNFNVL+I +EVISAY NVG STGY CARQ+KP+  CK   +GFVGRWS  GK 
Sbjct  456   KLKEDPLNFNVLSIALEVISAYANVGLSTGYHCARQLKPDPFCKPVWYGFVGRWSAGGKL  515

Query  258   ILIIVMFFGRLKKY  217
             +L+IVMF G+L+K+
Sbjct  516   LLVIVMFLGKLRKF  529



>ref|XP_009134189.1| PREDICTED: sodium transporter HKT1-like [Brassica rapa]
Length=506

 Score =   346 bits (887),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 242/509 (48%), Positives = 323/509 (63%), Gaps = 30/509 (6%)
 Frame = -1

Query  1680  VRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssms  1501
             +R   ++  P  L   YF+  S +GF ALKV KPR  S +L DLD+FFT+VS+ TVSSMS
Sbjct  12    IRSKLYKNRPCFLNFIYFLSFSFLGFLALKVFKPRATS-RLHDLDIFFTSVSAITVSSMS  70

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLH--------FFQSKVSTTERVLEKNKVI  1345
              V+MEVFSN QL+ +T LMF+GG  FTS+  ++        F QSK+       + +  I
Sbjct  71    PVDMEVFSNTQLIIITILMFIGGPIFTSFFNIYLSHFTKFVFPQSKIKHLIGSFKADHTI  130

Query  1344  VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvV  1165
                H++   +  N+ H   +  +   S     VV    L+  +                 
Sbjct  131   EDRHLDQENI--NDRHEIPSQINEKASKCLYLVVIGYNLVTNI----------------A  172

Query  1164  GFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGll  985
             G  L+ +Y+ FV TA+ VL+ K +   TF++FTTVSTF+ CGFVPTNENMI+F++N GLL
Sbjct  173   GSMLLLVYVSFVKTARDVLRSKEISTLTFSIFTTVSTFATCGFVPTNENMIIFRKNSGLL  232

Query  984   lilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAA  805
              +LIP +L+GNTL+P  LRL IW L KTT+R EF  IL +   +GY HL S R   FL  
Sbjct  233   WLLIPLVLMGNTLFPCFLRLLIWGLSKTTKREEFGYILKNRKKMGYSHLLSVRLCVFLGL  292

Query  804   TVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavl  625
             TV G I +QL +F    W S+++AG+  YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L
Sbjct  293   TVLGFILIQLFLFCTFAWSSESLAGMNWYEKLVGSLFQVVNSRHTGETIVDLSTLSPAIL  352

Query  624   alivVMMYLPPDTTFFP--IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
              + ++MMYLPP T F P  I  +N   +      +K      +L+S L  L I I LI I
Sbjct  353   IVFILMMYLPPYTLFMPFTIKKKNKKEEENDSGYEKGGKKSGLLVSQLSFLVICIFLISI  412

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWS  274
             TER+K++ DPLNFNVLNI +EV+SAYGNVGF+TGYSC R++   +G C+D  +GF GRWS
Sbjct  413   TERQKLRRDPLNFNVLNITLEVVSAYGNVGFTTGYSCERRLNVSDGGCEDAGYGFAGRWS  472

Query  273   NMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             + GKFILIIVMF+GRLK++  K G+AW L
Sbjct  473   SSGKFILIIVMFYGRLKQFTAKSGRAWIL  501



>ref|XP_003564102.2| PREDICTED: cation transporter HKT8-like [Brachypodium distachyon]
Length=507

 Score =   345 bits (884),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 242/526 (46%), Positives = 343/526 (65%), Gaps = 34/526 (6%)
 Frame = -1

Query  1719  ISLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKL  1558
             +S   +++ +        F V+PF L+L YF+  SL+GF  LK         PRP     
Sbjct  2     VSCTPQYSKIQRVYHLFVFCVHPFWLQLMYFVSTSLLGFLILKALPMKTSLVPRP-----  56

Query  1557  KDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVST  1378
             +DLD+ FT+VS+ TVSSM  +EME FSN QL+ +T LM LGGE FTS LGLHF  +K   
Sbjct  57    RDLDLIFTSVSATTVSSMVALEMESFSNSQLLLLTLLMLLGGEVFTSILGLHFTYTKSKK  116

Query  1377  TERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLG--CVRVLA  1204
              +   ++            L+++    +D   +  +++    + ++     G    R+L 
Sbjct  117   EQPSSQE------------LISSTTPMDD---DTHSQTEHGFKNLQRYDQFGGSLARILL  161

Query  1203  RvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTN  1024
              +VL Y +++H+ G+TL+ +Y+     A+ VL  KG+   TF++FT +STF+NCGFVPTN
Sbjct  162   FIVLGYHIMVHLAGYTLILVYLSVASGARAVLVGKGISTHTFSIFTVISTFANCGFVPTN  221

Query  1023  ENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILG---SPNGL  853
             E MI F+  PGLLL+++P +LLGNTL+P  LRLAIW L K T+R E  ++L    S  G 
Sbjct  222   EGMISFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIWALHKVTKRSELSELLRIERSSYGY  281

Query  852   GYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRH  673
              Y HL   R + FLA TV   + LQL +F A+EW SD + GLT  +K+V +LF+ VN+RH
Sbjct  282   EYDHLLPSRNTWFLALTVAAFVLLQLVLFCAMEWSSDGLRGLTAPQKLVAALFMSVNTRH  341

Query  672   TGESIldlsllapavlalivVMMYLPPDTTFFPIMDENN---NSKTKGCSPKKFNIIEKI  502
              GE ++DLS L+ AV+ L VVMMYLPP T F PI ++N+      +   S KK +I  K+
Sbjct  342   AGEMVVDLSALSSAVVVLYVVMMYLPPYTMFLPIAEDNHPQTGEHSSRSSQKKSSIWHKL  401

Query  501   LLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP  322
             L+SPL  L++F+++ICITER+++ +DP+NFNVLNIVVEVISAYGNVGFSTGYSC RQ++P
Sbjct  402   LMSPLSCLAVFVVVICITERQRIADDPINFNVLNIVVEVISAYGNVGFSTGYSCGRQVRP  461

Query  321   EGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             +G C+D   GF G+WS+ GK +L+ VMF+GRLKK+ M+GG+AWK++
Sbjct  462   DGSCRDAWVGFSGKWSSEGKLVLMAVMFYGRLKKFSMQGGQAWKIA  507



>gb|EYU22103.1| hypothetical protein MIMGU_mgv1a018321mg [Erythranthe guttata]
Length=525

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 256/517 (50%), Positives = 339/517 (66%), Gaps = 27/517 (5%)
 Frame = -1

Query  1713  LRNKHTMMMSTVRRLAFRV----NPFLLELSYFIVLSLIGFFALKVSKPRPIS-FKLKDL  1549
             LR  ++ ++ T+      +    NPF   + YF  LS  GF  L   KPR  + F  K L
Sbjct  27    LRCSYSYLLFTLNPFLIHIFHFFNPFSTRILYFSSLSFAGFGILNALKPRTAALFAPKTL  86

Query  1548  DvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTER  1369
             D+FFT+VS ATVSSMSTVEMEVFSN QL+ +T LMFLGGE FTS +GLHF  +      R
Sbjct  87    DLFFTSVSVATVSSMSTVEMEVFSNSQLLVITVLMFLGGEVFTSMVGLHFTHTYSKNITR  146

Query  1368  VLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvls  1189
                + +V   + VE G           +P  +  S  QI+       L     L  VVL 
Sbjct  147   WKSEGRV---ESVESG---------PTSPIPAEYSFDQID-------LSIAEFLGYVVLG  187

Query  1188  yivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIV  1009
             Y++VI  +G   V +Y+  V +A  V+++KG+   TFAVFT VSTF++CGF+PTNENMIV
Sbjct  188   YLLVIQFLGLASVLLYLSVVESAGNVIRKKGIKTATFAVFTVVSTFASCGFLPTNENMIV  247

Query  1008  FKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSG  829
             F+ N GL+ ILIPQILLGNTL+P+CLR  IW LG+  ++ E   ++ +   +GY HL  G
Sbjct  248   FRENSGLMWILIPQILLGNTLFPSCLRFTIWVLGRKVKKAEAEFLMKNAAEVGYLHLLPG  307

Query  828   RRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldl  649
               S  +AATV G + +   +F +LEW S A+ GL+GY KVVG LF  VN+RHTGE+I+DL
Sbjct  308   LHSVLVAATVVGFVLVGFLMFCSLEWDSAALGGLSGYRKVVGVLFQCVNARHTGETIVDL  367

Query  648   sllapavlalivVMMYLPPDTTFFPIMDENNNSKTKG---CSPKKFNIIEKILLSPLGNL  478
             S +APAVL   VVMMYLPP T+F PI+  +++ +       + K+    E ++ S L  +
Sbjct  368   STVAPAVLVFFVVMMYLPPYTSFLPIIKRDDDQQQNPEIIRNQKRKTSAENLVFSQLSYI  427

Query  477   SIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQ  298
              IFIILICITER+ +K+DP+NF+VLNI+VEV+SAYGNVGF+TGYSC R++ P+  C DK 
Sbjct  428   VIFIILICITERKSLKDDPINFSVLNIIVEVVSAYGNVGFTTGYSCGRKVSPDPNCVDKW  487

Query  297   FGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +GF G+WS+ GK ILIIVMFFGRLKK++M GG+AWKL
Sbjct  488   YGFSGKWSDEGKVILIIVMFFGRLKKFNMNGGQAWKL  524



>gb|KFK31992.1| hypothetical protein AALP_AA6G186200 [Arabis alpina]
Length=505

 Score =   344 bits (883),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 244/493 (49%), Positives = 327/493 (66%), Gaps = 19/493 (4%)
 Frame = -1

Query  1650  FLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNL  1471
             F L   YF+  S++GF ALK+SKPR  S +  DLD+FFT+VS+ TVSSMSTV+MEVFSN 
Sbjct  22    FFLYFIYFMSFSVLGFLALKISKPRTTS-RPHDLDLFFTSVSAITVSSMSTVDMEVFSNS  80

Query  1470  QLVFMTFLMFLGGECFTSWLGLHF--FQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYH  1297
             QL+F+T LMFLGGE FTS+L L+F  F + V    ++        +DH         +  
Sbjct  81    QLIFLTILMFLGGEIFTSFLNLYFTHFSNFVFPHNKIRHLIGSFKLDH------PMEDPR  134

Query  1296  NDLNP-EDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTA  1120
             +DL    D  ++ +QI            + L  VVL Y +V ++VG  L+ +Y+ FV TA
Sbjct  135   SDLETVTDHREAPIQIHERAS-------KCLYLVVLGYHLVTNLVGSVLLLVYVTFVKTA  187

Query  1119  KQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYP  940
             + +L  K +   TF+VFTT+STF+NCGFVPTNENMI+F++N GLL +LI Q+L+GNTL+P
Sbjct  188   RNILSSKEISPLTFSVFTTISTFANCGFVPTNENMIIFRKNSGLLWLLITQLLMGNTLFP  247

Query  939   ACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLA  760
               LRL IW L K T+R EF  IL +   +GY HL S R    L  TVFG + +QL +F  
Sbjct  248   CFLRLLIWGLDKFTKREEFGYILKNRKKMGYSHLLSVRLCVLLGLTVFGFLMMQLLLFGV  307

Query  759   LEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTF  580
              EW S+++ G++ YEK VGSLF V NSRH GE+ILDLS L+PA+L L ++MMYLP  T F
Sbjct  308   FEWSSESLEGMSRYEKFVGSLFQVANSRHAGETILDLSTLSPAILILFILMMYLPSYTLF  367

Query  579   FPIMDENNNSKTKGCSPK-KFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVL  403
              P+ +E N  +    S   K      + +S L  L+I + LI ITER+K+++DPLNFNVL
Sbjct  368   MPLTEEKNKKEGDDDSENGKTREKSGLFVSQLSFLAICVFLISITERQKLRQDPLNFNVL  427

Query  402   NIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRL  226
             NI +EV+SAYGNVGF+TGYSC R++   +  CKD  +GF GRW+ +GKFILIIVMF+GR 
Sbjct  428   NITLEVVSAYGNVGFTTGYSCKRRLDVSDVSCKDAGYGFAGRWNPIGKFILIIVMFYGRF  487

Query  225   KKYHMKGGKAWKL  187
             K++  + G+AW L
Sbjct  488   KQFSARSGRAWIL  500



>emb|CAN69230.1| hypothetical protein VITISV_008802 [Vitis vinifera]
Length=498

 Score =   344 bits (882),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 255/542 (47%), Positives = 331/542 (61%), Gaps = 71/542 (13%)
 Frame = -1

Query  1740  PSAFTPPISLRNKHTMMMSTVRR------------LAFRVNPFLLELSYFIVLSLIGFFA  1597
             P     P+ + N+ +  +S +++            LAF+V+PF  +L YFI +SL+G+ A
Sbjct  5     PCFARKPVDVFNRSSTKLSCLQQSFRGLFSSLFYFLAFQVSPFWNQLGYFITVSLLGYMA  64

Query  1596  LKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTS  1417
             LKVSKP+  SF   D+DVFFT+VS++TVSSMS VEMEVFS+ QLV MT LM +GGE FTS
Sbjct  65    LKVSKPKTTSFMPSDVDVFFTSVSASTVSSMSAVEMEVFSDTQLVIMTVLMLVGGEIFTS  124

Query  1416  WLGLHFFQSKVSTTERVLEK-----------NKVIVIDHVELGLVTNNEYHNDLNPEDSA  1270
              LGL F +SK +       K           N  I  D +ELGLVT  +  N+  P  + 
Sbjct  125   MLGLQFVRSKYTRKANRENKAHLASIDYKSPNSKISFDQIELGLVTLPQAQNE-QPCSNL  183

Query  1269  KSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLD  1090
             +  ++    ED+K    ++ L  VVL Y++V+HVVG  L+ +Y+  VP+A++VLK KGL 
Sbjct  184   EKGIEASCDEDLKY-HSIKCLGYVVLFYLLVVHVVGSALIVLYLNLVPSAREVLKNKGLR  242

Query  1089  LttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFL  910
             + TF+VFT VSTFSNCGF+PTNENM+VFK+N GLLLILIPQILLGNTL+  CLR  IW L
Sbjct  243   ILTFSVFTVVSTFSNCGFIPTNENMVVFKKNSGLLLILIPQILLGNTLFAPCLRFVIWVL  302

Query  909   GKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAG  730
              K TRR+EF  +L +   + Y HL  G  S  LA TVFG I +Q  +   +EW S+ +AG
Sbjct  303   VKITRRVEFNYMLKNSREISYDHLLPGLYSCLLAITVFGFILVQFLLLCFMEWNSEDLAG  362

Query  729   LTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNS  550
             L  Y+K+VG LF   NSRH+GESI DLS+++PAVL L V+ MYLP  T+F PI   +   
Sbjct  363   LNAYQKIVGXLFQTANSRHSGESIFDLSVISPAVLVLFVLXMYLPSHTSFLPI---DGGE  419

Query  549   KTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYG  370
             KT                                ++E+ + D  N            AYG
Sbjct  420   KT-------------------------------LQKEERRTDKRN------------AYG  436

Query  369   NVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWK  190
             NVGFS GY C  Q+K E  CKD  +GFVGRWSN GKF+L+ VMFFGRLKK+ M GG+AWK
Sbjct  437   NVGFSAGYHCNLQLKHEPHCKDLGYGFVGRWSNSGKFVLMFVMFFGRLKKFSMHGGRAWK  496

Query  189   LS  184
             L 
Sbjct  497   LD  498



>ref|XP_004951743.1| PREDICTED: probable cation transporter HKT6-like isoform X1 [Setaria 
italica]
Length=532

 Score =   344 bits (883),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 222/500 (44%), Positives = 316/500 (63%), Gaps = 19/500 (4%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEV  1483
             R NP  +++ YF  +S  G+ ALK+ KP+     LK LD+ FT++S++TVSSM+TVEME 
Sbjct  43    RSNPLFVQIIYFTSISFGGYAALKILKPQENPHALKYLDLLFTSISASTVSSMATVEMED  102

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNE  1303
             FSN QL  +T LM +GGE FTS LGL+F ++K      V         +        + E
Sbjct  103   FSNSQLWMLTILMLIGGEVFTSMLGLYFMKAKFDAKGSV---------NKTGYSFYADVE  153

Query  1302  YHNDLNPEDSAKSNVQIEV-VEDIKLLGCVRV-------LARvvlsyivvihvVGFTLVA  1147
               +  NP  ++    ++ V + +++L    RV       L   ++ Y++V ++ G   + 
Sbjct  154   SASSENPGPNSTQGTKVMVPISELRLEDKDRVDHETMKSLGYALMVYLLVTNLGGSLAIY  213

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +Y+  VP A++VLK+K +    F++FT +S+  NCGF P NENM++F++N  LLL+LIP+
Sbjct  214   LYLILVPDAQEVLKRKDIGYVIFSIFTAISSIGNCGFTPVNENMVIFQKNTILLLLLIPK  273

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             ILLGNTL+  CLR  +W L K T + E+  IL  P  +GY HL +GR   +L  TV   I
Sbjct  274   ILLGNTLFAPCLRFMMWSLEKITTKKEYHFILQHPKAVGYKHLMNGRECVYLMVTVIVFI  333

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              +Q  +F +LEW S+A+  +  Y+K+VG+LF  VN+RH GE+I+DLS L+ ++L L  +M
Sbjct  334   IMQTILFCSLEWNSNALQEMNSYQKIVGALFQSVNARHAGENIVDLSSLSSSILVLYTIM  393

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLP  T+F P   +N+    +G   K+ +  E  +LS L  L+IF++LICITE+E M  
Sbjct  394   MYLPSYTSFLP--KDNDQDSNEGMKYKRRSRCENWILSQLSYLAIFVLLICITEKEAMAT  451

Query  426   DPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILII  247
             DPLNFN+ +I  EVISAYGNVGFS GYSC R +     CKD  +GFVGRWS+ GK ILII
Sbjct  452   DPLNFNIFSITFEVISAYGNVGFSLGYSCQRLLNHNIHCKDASYGFVGRWSDKGKMILII  511

Query  246   VMFFGRLKKYHMKGGKAWKL  187
             VM FGR+K  +M GG+AWKL
Sbjct  512   VMVFGRIKSLNMHGGRAWKL  531



>ref|XP_009339409.1| PREDICTED: sodium transporter HKT1-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009339412.1| PREDICTED: sodium transporter HKT1-like isoform X2 [Pyrus x bretschneideri]
Length=447

 Score =   341 bits (875),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 231/456 (51%), Positives = 306/456 (67%), Gaps = 32/456 (7%)
 Frame = -1

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV  1315
             EMEVFSN QL+ +T LM LGGE FTS LGL   +SK          N    ++H +   V
Sbjct  5     EMEVFSNTQLIILTILMLLGGEVFTSMLGLQIAKSK----------NFPKSLNHKDDNRV  54

Query  1314  TNNEYHNDLNPEDS-------------AKSNVQIEVVEDIKLLGCVRVLARvvlsyivvi  1174
                  ++  +P DS                   +E  E   +   +R+L  VVL +++V+
Sbjct  55    DVVVDNSRHHPPDSNNNTSFEQFELRFVSDRSHLENDEKNNIYKSIRILGYVVLGFLLVV  114

Query  1173  hvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNP  994
             H+ G  LV+MYI  VP+A+Q+L+ KG+++ TF++FTTVSTF+NCG+VPTNENMIVFK+N 
Sbjct  115   HIGGSILVSMYIALVPSARQILQSKGIEIQTFSIFTTVSTFANCGYVPTNENMIVFKKNS  174

Query  993   GlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGF  814
             GLLL+L+PQ+L+GNTLYP+CLR  IW L K T+R EF  IL +   LGY HL S   S  
Sbjct  175   GLLLLLLPQLLIGNTLYPSCLRFLIWLLQKITKRAEFSYILKNYKELGYCHLLSSLHSFL  234

Query  813   LAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllap  634
             LA TV G I  Q  +F  +EW+S+A+ GL+ YEK V S+F V NSRH+GES++DLS+L+P
Sbjct  235   LALTVLGFIVAQFILFCVMEWKSEAMDGLSAYEKFVASIFQVTNSRHSGESVVDLSVLSP  294

Query  633   avlalivVMMYLPPDTTFFPIMDE------NNNSKTKGCSPKKFNIIEKILLSPLGNLSI  472
             A+L L VVMMYLPP TTF P   +       N S+ +  +P K  +++ ++ S L  +++
Sbjct  295   AILVLFVVMMYLPPYTTFLPTTSDCEEIASANGSRIR--NPIK-TLVDSLIFSQLSYIAM  351

Query  471   FIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFG  292
             F+IL+CITER+KMK+DPLNFNVLNI +EVIS Y NVG STGYSC RQ+K +  C D  +G
Sbjct  352   FVILVCITERDKMKDDPLNFNVLNITIEVISGYANVGLSTGYSCKRQLKHDSACVDAWYG  411

Query  291   FVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             F GRWS  GKF+LI+VM FGRLK++ MK GKAWKLS
Sbjct  412   FAGRWSTQGKFVLILVMIFGRLKQFSMKQGKAWKLS  447



>ref|XP_002451638.1| hypothetical protein SORBIDRAFT_04g005010 [Sorghum bicolor]
 gb|EES04614.1| hypothetical protein SORBIDRAFT_04g005010 [Sorghum bicolor]
Length=532

 Score =   343 bits (880),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 226/501 (45%), Positives = 319/501 (64%), Gaps = 25/501 (5%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFS  1477
             NP  ++++YF ++S  G+ ALK+ KPR     LKD+D+ FT+VS++TVSSM+TVEME FS
Sbjct  45    NPLFIQVTYFTLISFAGYAALKIIKPRDEQDTLKDIDLLFTSVSASTVSSMATVEMEDFS  104

Query  1476  NLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL---VTNN  1306
             + QL  +T LM +GGE FTS L L+F ++   T      K   + +D+  +     V NN
Sbjct  105   SAQLCILTILMLIGGEVFTSMLDLYFMRATSITKGSSNRKGYSVYVDNESITSAMSVPNN  164

Query  1305  EYH-------NDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVA  1147
                       ++L+ E+  K  V+ +++E +     V +L   +          G +LV 
Sbjct  165   TQDTIVTMPLSELHLEE--KKQVEPKIIESLGHALLVYLLVSNL----------GSSLVI  212

Query  1146  -MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
              +Y+  VP A+ VLK+KG+    F+VFT VS+ +NCGF P NENMI+F++   LLL++IP
Sbjct  213   YLYLISVPDAQGVLKRKGIGFVIFSVFTAVSSVANCGFTPVNENMIIFQKRSILLLLIIP  272

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             QIL GNTL+  CLR  +W L K T + ++R IL  P  +GY HL S +   +L +TVF  
Sbjct  273   QILAGNTLFAPCLRFLVWSLKKVTGQEDYRFILQHPETIGYKHLMSSKECVYLMSTVFSF  332

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             I  Q  +F +LEW S+A+  +  YEK++G+LF   N+RH GE I+DLS L+ A+L L  V
Sbjct  333   IITQTILFCSLEWSSEALRAMNSYEKIIGALFQSTNARHAGEYIVDLSSLSSAILVLYTV  392

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMK  430
             MMYLP +T+  P  D   +S+ +    K+  ++E  + S L  L+IF++LICITERE + 
Sbjct  393   MMYLPGETSLLP-RDGEQHSRAE-IKHKRKRLLENWIFSQLSYLAIFVMLICITEREALI  450

Query  429   EDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILI  250
              DPLNFNV NI+ EV+SAYGNVGFS GYSC R +  +  CKD  +GFVG+WS  GK ILI
Sbjct  451   TDPLNFNVFNILFEVVSAYGNVGFSVGYSCKRLLNHDVYCKDASYGFVGKWSGKGKVILI  510

Query  249   IVMFFGRLKKYHMKGGKAWKL  187
             IVM FGRLK ++MKGG+AW+L
Sbjct  511   IVMVFGRLKAFNMKGGRAWRL  531



>dbj|BAO66168.1| sodium transporter HKT1;5 [Phragmites australis]
Length=511

 Score =   342 bits (878),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 243/530 (46%), Positives = 328/530 (62%), Gaps = 55/530 (10%)
 Frame = -1

Query  1704  KHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLDv  1543
             +H+ +      L F V+PF ++L YF+ +SL GF  LK       + PRP      DLDV
Sbjct  12    QHSKLQRVYHLLLFHVHPFWVQLLYFLFISLFGFLMLKTLPMKTGAVPRP-----TDLDV  66

Query  1542  fftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL  1363
              FT+VS+ TVSSM  VEME FSN QL+ MT LM LGGE FTS LGLHF  ++    E + 
Sbjct  67    IFTSVSATTVSSMVAVEMESFSNSQLLLMTLLMLLGGEVFTSMLGLHFTYTRSKKKEALD  126

Query  1362  EKNK--------------VIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL  1225
             +  K               + ++ +ELG +   +Y               I  +  + +L
Sbjct  127   KAGKHPPSSLELTQTQVPAMALEQMELGFMNQRDY-------------TSIVSLLTLIVL  173

Query  1224  GCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSN  1045
             G + V+           H+ G+TL+ +Y+  V  A+ VL  K +   TF++FT VSTF+N
Sbjct  174   GYLMVV-----------HLAGYTLILVYLSVVSEARAVLAGKRISAHTFSIFTVVSTFAN  222

Query  1044  CGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGS  865
             CGFV TNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L +TTRR E  ++L  
Sbjct  223   CGFVTTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIGALERTTRRRELGELL--  280

Query  864   PNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVV  685
                +GY HL  G R+ FLA T    + +QL +F A+EW SD + GLT ++K+V +LF+ V
Sbjct  281   RESIGYDHLLPGARTWFLALTAAAFLVVQLVLFCAMEWGSDGLRGLTAFQKLVAALFMSV  340

Query  684   NSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN----  517
             NSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D +  S  +            
Sbjct  341   NSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVEDHHQQSGEQSDKKSGSGSSKI  400

Query  516   IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCA  337
             I  K+L+SPL  L  FI++ICITER ++ +DPLNF+VLNIVVEVISAYGNVGFSTGYSC 
Sbjct  401   IWRKLLMSPLSCLVAFIVVICITERRQIADDPLNFSVLNIVVEVISAYGNVGFSTGYSCG  460

Query  336   RQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             RQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ M GG+AWKL
Sbjct  461   RQVRPDGSCRDAWIGFSGKWSREGKLALMAVMFYGRLKKFSMHGGQAWKL  510



>ref|XP_009415063.1| PREDICTED: sodium transporter HKT1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=488

 Score =   342 bits (876),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 228/512 (45%), Positives = 326/512 (64%), Gaps = 27/512 (5%)
 Frame = -1

Query  1725  PPISLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLD  1546
             PP S     T   +++  L  +VNPF ++  YF+  S+ GF  LK+   R  + +  ++D
Sbjct  2     PPPSTVMDITFHRNSLIHLLSQVNPFWIQFFYFLSSSITGFLLLKLLPTRDATSRPTNVD  61

Query  1545  vfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERV  1366
             + F +VS+ TVSSM T+EMEVFSN QL  +T LM +GGE F S L +HF  +K+++  R 
Sbjct  62    LLFMSVSANTVSSMDTMEMEVFSNYQLAVLTLLMVIGGEVFISMLSVHF--TKINSQMR-  118

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsy  1186
                +  +     EL  +++    +DL  + S++ ++   VV    L+G V          
Sbjct  119   ---DSALDAAGTELATLSDQRRSSDL--KFSSRKHL-FFVVLGYLLVGHV----------  162

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
                   VGF L+ +Y+  VP A  VL++KG++ + F++F TVSTF+NCGFVPTNENM+VF
Sbjct  163   ------VGFLLILVYLRLVPEAGAVLERKGINASLFSIFITVSTFANCGFVPTNENMVVF  216

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
             +   GLLLIL  Q+L+GNTLY +CL   IW L K T+R E+  +L +   +   HL  G 
Sbjct  217   RTYSGLLLILTVQVLVGNTLYASCLWAVIWLLKKLTKRREYDYLLTNYGEMECNHLLPGS  276

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              S +LA TV GL+ +Q  +F  +EW S+ ++GL+ Y+KVVG +F  VNSR+ GE+I+DL+
Sbjct  277   HSLYLALTVAGLVLVQFGLFCCMEWTSEILSGLSTYQKVVGVVFQCVNSRYAGETIVDLA  336

Query  645   llapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFI  466
              +APA+L L VVMMY+PP T F P   +    K +  S KK  +   ++ SPL  ++IF 
Sbjct  337   AVAPAILVLFVVMMYIPPYTCFLPRKGDKQLLKGRERSRKKQGL--SLIFSPLSYIAIFT  394

Query  465   ILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFV  286
             I+ CITER ++ EDP+NF+VLNIVVEV+SAYG VGF+TGYSC RQ+K +  CKD   GF 
Sbjct  395   IIACITERRQISEDPINFSVLNIVVEVVSAYGTVGFTTGYSCKRQVKADVHCKDVSAGFS  454

Query  285   GRWSNMGKFILIIVMFFGRLKKYHMKGGKAWK  190
              +WS+ GK +LI+VM FGRLK++ M+GGK WK
Sbjct  455   AKWSSKGKLVLIVVMLFGRLKRFSMRGGKHWK  486



>emb|CDX94264.1| BnaC02g29240D [Brassica napus]
Length=507

 Score =   342 bits (876),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 247/513 (48%), Positives = 328/513 (64%), Gaps = 25/513 (5%)
 Frame = -1

Query  1698  TMMMSTVRRLAF--RVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavs  1525
             T +++ +R   F   ++P  L   YF+  S++GF ALK+SKPR I+ +  DLD+FFT+VS
Sbjct  6     TRILAKIRPQVFAKHLSPLCLYFIYFLTFSILGFLALKISKPR-ITSRPHDLDLFFTSVS  64

Query  1524  satvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKV-  1348
             +  +SSMST++MEVFSN QL+F+T LMFLGGE FTS+L L+F       T+ V   NKV 
Sbjct  65    ALAISSMSTIDMEVFSNTQLIFLTILMFLGGEVFTSFLNLYFSH----FTKFVYPHNKVR  120

Query  1347  IVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihv  1168
              + D  +L         +  N  D  + ++Q+  +E        + L  VVL Y V+ H+
Sbjct  121   HLTDSFDLDRRMEEPRIDIENVIDHQEGSIQM--IERAS-----KCLYSVVLGYHVITHL  173

Query  1167  VGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGl  988
             VG  LV +Y+ F+ TA+ VL  K +   TF+VF TVSTF+N GFVPTNENMI+F+RN GL
Sbjct  174   VGSLLVLVYVNFIKTARDVLSSKDISPLTFSVFLTVSTFANGGFVPTNENMIIFRRNSGL  233

Query  987   llilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLA  808
             L +LIPQ L+GNTL+P  L L IW L K T+R EF  IL +   +GY HL S R    L 
Sbjct  234   LWLLIPQGLMGNTLFPCFLVLIIWGLYKITKRNEFGYILKNHKKMGYYHLLSVRVCILLG  293

Query  807   ATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapav  628
              TV G+  LQ  +F   EW S+++ G++ YEK+VGSLF VVNSRHTGE+I+D+S L+PA 
Sbjct  294   LTVLGIFLLQFLLFCTFEWSSESLEGMSWYEKLVGSLFQVVNSRHTGETIVDISTLSPAT  353

Query  627   lalivVMMYLPPDTTFFPIMDENNNSKTK-----GCSPKKFNIIEKILLSPLGNLSIFII  463
             L   + MM+LPP T F P+  ENNN   +     G   K+        +S L  L I I 
Sbjct  354   LIFFITMMFLPPYTLFIPLTKENNNKDEEEDSGNGNKRKR----SGFFVSQLSFLVICIF  409

Query  462   LICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP-EGQCKDKQFGFV  286
             L+ I E E+++ DPLNFNV NI +EVISAYGNVGF+TGYSC R++   +G CKD  +GFV
Sbjct  410   LVSIVEEEQLRRDPLNFNVFNITLEVISAYGNVGFTTGYSCKRRLDASDGVCKDASYGFV  469

Query  285   GRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             GRWS  GK ILI+VM +GR K +  K G+AW L
Sbjct  470   GRWSPTGKIILILVMLYGRFKHFTSKSGRAWIL  502



>gb|AAF68393.1| sodium transporter [Arabidopsis thaliana]
Length=506

 Score =   341 bits (874),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 244/482 (51%), Positives = 326/482 (68%), Gaps = 34/482 (7%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRVLARvv-------lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++  R         LSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  540   GCSPKKFNIIEK---ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYG  370
             G    +     K   +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVISAYG
Sbjct  380   GDDDSENGKKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVISAYG  439

Query  369   NVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAW  193
             NVGF+TGYSC R++   +G CKD  +GF GRWS MGKF+LIIVMF+GR K++ +K G+AW
Sbjct  440   NVGFTTGYSCERRLDISDGGCKDASYGFAGRWSPMGKFVLIIVMFYGRFKQFTVKSGRAW  499

Query  192   KL  187
              L
Sbjct  500   IL  501



>ref|NP_567354.1| sodium transporter HKT1 [Arabidopsis thaliana]
 sp|Q84TI7.1|HKT1_ARATH RecName: Full=Sodium transporter HKT1; Short=AtHKT1 [Arabidopsis 
thaliana]
 gb|AAO64157.1| putative potassium uptake transporter [Arabidopsis thaliana]
 dbj|BAF00483.1| sodium transporter [Arabidopsis thaliana]
 gb|AEE82866.1| sodium transporter HKT1 [Arabidopsis thaliana]
Length=506

 Score =   341 bits (874),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 241/482 (50%), Positives = 320/482 (66%), Gaps = 34/482 (7%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRVLARvvlsyivvihv-------VGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++  R       V+         VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  540   GCSPKKFNIIEK---ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYG  370
             G    +     K   +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVISAYG
Sbjct  380   GDDDSENGKKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVISAYG  439

Query  369   NVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAW  193
             NVGF+TGYSC R++   +G CKD  +GF GRWS MGKF+LIIVMF+GR K++  K G+AW
Sbjct  440   NVGFTTGYSCERRVDISDGGCKDASYGFAGRWSPMGKFVLIIVMFYGRFKQFTAKSGRAW  499

Query  192   KL  187
              L
Sbjct  500   IL  501



>gb|AAT95386.1| sodium transport protein [Arabidopsis thaliana]
Length=506

 Score =   340 bits (873),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 245/484 (51%), Positives = 326/484 (67%), Gaps = 38/484 (8%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRVLARvv-------lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +R+  R         LSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIRIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  540   GCSPKKFNIIEKI-----LLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISA  376
             G    +    EK+     ++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVISA
Sbjct  380   GDDDSENG--EKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVISA  437

Query  375   YGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGK  199
             +GNVGF+TGYSC R++   +G CKD  +GF GRWS MGKF+LIIVMF+GR K++  K G+
Sbjct  438   HGNVGFTTGYSCERRVDISDGGCKDASYGFAGRWSPMGKFVLIIVMFYGRFKQFTAKSGR  497

Query  198   AWKL  187
             AW L
Sbjct  498   AWIL  501



>gb|AAS20529.2| HKT1 [Suaeda salsa]
Length=550

 Score =   341 bits (875),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 251/510 (49%), Positives = 338/510 (66%), Gaps = 31/510 (6%)
 Frame = -1

Query  1647  LLELSYFIVLSLIGFFALKVSKPRPISFKLK-----DLDvfftavssatvssmstVEMEV  1483
             ++EL YFI++S  GF  LK   P+  +         DLD+FFT+VS+ TVSSMST+EMEV
Sbjct  48    IIELCYFILVSSFGFLFLKTLIPKSSNNNNNNNSINDLDLFFTSVSATTVSSMSTLEMEV  107

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTT-----ERVLEKNKVIVI----DHV  1330
             FSN QL+ +T LMF+GGE FTS +GLHF  SK+  T      RV   N V  +    + +
Sbjct  108   FSNSQLIVLTILMFIGGEVFTSMVGLHFSASKLVYTPLQARSRV---NSVASLPLPPESI  164

Query  1329  ELGLV-----TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvV  1165
             ELG++     T  E     +  +  KS +   +         +RVL  VVLSY++++H +
Sbjct  165   ELGVIIPSSTTTQEIRVSSSTIEKTKSEIDFLIKSK-----SIRVLGFVVLSYLIIVHFL  219

Query  1164  GFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGll  985
             G ++V  YI  +P AK VL +KGL   TF++F+ VSTF++CGF+PTNENM VF +N GLL
Sbjct  220   GISMVLTYINTIPNAKNVLDKKGLKTFTFSIFSVVSTFASCGFIPTNENMQVFSKNSGLL  279

Query  984   lilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAA  805
             L+LIPQILLGNTL+P+ LR +IW LGK  ++ E + ++ +   + Y HL S + S FL  
Sbjct  280   LMLIPQILLGNTLFPSFLRFSIWMLGKFVKKDETKYLMRNSKEIEYHHLLSSKHSRFLIV  339

Query  804   TVFGLIFLQLTVFLALEWRSDAIAGLTG-YEKVVGSLFVVVNSRHTGESIldlsllapav  628
             TV G I +Q  +F ++EW  D +      Y+K+VG LF  VNSRHTGESI+DLS +  A+
Sbjct  340   TVLGFILVQFIMFCSMEWNFDGLNNDHNIYQKLVGILFQCVNSRHTGESIVDLSSINSAM  399

Query  627   lalivVMMYLPPDTTFFPIMDENN---NSKTKGCSPKKFNIIEKILLSPLGNLSIFIILI  457
             L + +VMMYLPP T+F PI DE     N        K+  I++  L S LG ++IFII+I
Sbjct  400   LVIFIVMMYLPPYTSFLPIKDEEKEYPNMVLFNREKKRRKILKNFLFSQLGYIAIFIIII  459

Query  456   CITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRW  277
             CITE++K+K+DPLNFNV NI  EVISAYGNVGFSTGYSC +Q+K +  C +K +GF+G W
Sbjct  460   CITEKQKIKDDPLNFNVFNIAFEVISAYGNVGFSTGYSCEKQLKGDPNCVNKLYGFLGSW  519

Query  276   SNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             S+ GK +LIIVM FGRLKK+++KGGKAWKL
Sbjct  520   SDEGKLVLIIVMLFGRLKKFNLKGGKAWKL  549



>gb|ABG33939.1| HKT8 [Triticum monococcum]
 gb|ABG33946.1| HKT8 [Triticum monococcum]
Length=517

 Score =   339 bits (869),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 247/523 (47%), Positives = 330/523 (63%), Gaps = 33/523 (6%)
 Frame = -1

Query  1707  NKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLD  1546
              +H+ +    + L F V+PF L+L YF+ +S  GF  LK       + PRP+     DLD
Sbjct  11    TQHSKLERAYQLLVFHVHPFWLQLLYFVSISFFGFVILKALPMKTSTVPRPM-----DLD  65

Query  1545  vfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERV  1366
             + F +VS+ TVSSM  VEME FSN QL+ +T LM LGGE FTS LGLHF   K    E  
Sbjct  66    LIFMSVSATTVSSMVAVEMESFSNPQLLLLTLLMLLGGEVFTSMLGLHFTYVKSKKKEAQ  125

Query  1365  L-------EKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVL  1207
                     +K K      ++L   T       ++  D  +   + +   D   L   R+L
Sbjct  126   APHDHDDGDKGKPAPSCSLKLAATTC------MDDVDRVEQGFKDQPRYDRAFL--TRLL  177

Query  1206  ARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPT  1027
               +VL Y VV+H+ G++L+ +Y+  V  A  VL  KG+ L TF+VFT VSTF+NCGFVP 
Sbjct  178   LFIVLGYHVVVHLAGYSLMLVYLSVVSGAGAVLTGKGISLHTFSVFTVVSTFANCGFVPN  237

Query  1026  NENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGY  847
             NE M+ F+  PGLLL+++P +LLGNTL+P  LRLAIW L + TRR E    LG     GY
Sbjct  238   NEGMVAFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIWALRRVTRRPE----LGELRSTGY  293

Query  846   GHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTG  667
              HL + R + FLA TV   +  QL++F A+EW SD + GLT  +K+V +LF+ VNSRHTG
Sbjct  294   DHLLTSRHTWFLAFTVAAFMLAQLSLFCAMEWGSDGLNGLTAAQKLVAALFMSVNSRHTG  353

Query  666   ESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKK--FNIIEKILLS  493
             E ++D+S ++ AV+ L VVMMYLPP TTF P+ D+++          K   +I  K+L+S
Sbjct  354   EMVVDISTVSSAVVVLYVVMMYLPPYTTFLPVEDDSDQQVGADQHDHKRITSICHKLLMS  413

Query  492   PLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP-EG  316
             PL  L+IFI ++CITER ++ +DPLNFNVLNI VEVISAYGNVGFSTGYSC RQ+ P +G
Sbjct  414   PLSCLAIFIAVVCITERRQISDDPLNFNVLNITVEVISAYGNVGFSTGYSCGRQVTPDDG  473

Query  315   QCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              C+D   GF G+WS  GK  LI VMF+GRLKK+ + GG+AW++
Sbjct  474   DCRDTWVGFSGKWSWQGKLALIAVMFYGRLKKFSIHGGQAWRI  516



>ref|XP_006289667.1| hypothetical protein CARUB_v10003226mg [Capsella rubella]
 gb|EOA22565.1| hypothetical protein CARUB_v10003226mg [Capsella rubella]
Length=510

 Score =   338 bits (867),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 244/488 (50%), Positives = 324/488 (66%), Gaps = 26/488 (5%)
 Frame = -1

Query  1617  SLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFL  1438
             S++GF ALK+++PR  S +  DLD+FFT+VS+ TVSSMSTV+MEVFSN+QL+F+T LMFL
Sbjct  33    SVLGFLALKITRPRTTS-RPHDLDLFFTSVSAITVSSMSTVDMEVFSNIQLIFLTVLMFL  91

Query  1437  GGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNV  1258
             GGE FTS+L L++       T  V   NK   I H+       N ++ D  P +  +S++
Sbjct  92    GGEIFTSFLSLYYSH----FTNFVFPHNK---IRHLI------NSFNMD-RPIEEGQSDL  137

Query  1257  QIEVVEDIKLLGCV-----RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGL  1093
             +  V      L  +     + L  VVLSY +V  + G  L+ +Y+ FV +A  VL  KG+
Sbjct  138   ETVVDHCEDRLSKIDERASKCLYYVVLSYHLVSTLAGSVLLLVYVNFVKSAGDVLSSKGI  197

Query  1092  DLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWF  913
                TF+VFTTVSTF+NCGF+PTNENM++F++N GLL +LIPQ+L+GNTL+P  L L IW 
Sbjct  198   SPLTFSVFTTVSTFANCGFLPTNENMVIFRKNSGLLWLLIPQVLMGNTLFPCFLVLFIWG  257

Query  912   LGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIA  733
             L K T+R EF  IL +   +GY HLFS R    L  TV G + +QL +F A EW S ++ 
Sbjct  258   LYKITKREEFSYILKNHKKMGYSHLFSVRVCVLLGLTVLGFLMVQLLLFSASEWSSKSLE  317

Query  732   GLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNN  553
             G++ YEK+VGSLF VVNSRH GESI+DLS L+PA+L L +VMMYLP  T   P+  E   
Sbjct  318   GMSSYEKLVGSLFQVVNSRHAGESIVDLSTLSPAILILFIVMMYLPSYTLLMPLATEQKT  377

Query  552   SKTKG-----CSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVE  388
              K +G        +K     ++ +S L  L+I I LI ITER+K++ DPLNFNVLNI +E
Sbjct  378   IKKEGDDEDDSENRKNVTYHRLFVSQLSFLTICIFLISITERQKLQRDPLNFNVLNITLE  437

Query  387   VISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHM  211
             VISA+GNVGFSTGYSC R++   +G C+D  +GF GRWS   KF+LIIVMF+GR K +  
Sbjct  438   VISAFGNVGFSTGYSCERRLNISDGGCEDASYGFAGRWSPNAKFVLIIVMFYGRFKNFTA  497

Query  210   KGGKAWKL  187
             K G+AW L
Sbjct  498   KSGRAWIL  505



>ref|XP_006289290.1| hypothetical protein CARUB_v10002759mg [Capsella rubella]
 gb|EOA22188.1| hypothetical protein CARUB_v10002759mg [Capsella rubella]
Length=507

 Score =   338 bits (866),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 240/485 (49%), Positives = 331/485 (68%), Gaps = 23/485 (5%)
 Frame = -1

Query  1617  SLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFL  1438
             S++GF ALK++KPR  S +  DLD+FFT+VS+ TVSSMST++MEVFSN+QL+F+T LMFL
Sbjct  33    SVLGFLALKITKPRTTS-RPYDLDLFFTSVSAITVSSMSTIDMEVFSNIQLIFLTVLMFL  91

Query  1437  GGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNV  1258
             GGE FTS+L L++       T  V   NK   I H+       N ++ D  P +  +S++
Sbjct  92    GGEIFTSFLSLYYSH----FTNFVFPHNK---IRHLI------NSFNMD-RPIEEGQSDL  137

Query  1257  QIEVVEDIKLLGCV-----RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGL  1093
             +  V      L  +     + L  VVLSY +V ++VG  L+ +Y+ FV +A+ VL  K +
Sbjct  138   ETVVDHCEDRLSKIDERASKCLYSVVLSYHLVSNLVGSLLLLVYVNFVKSARDVLSSKDI  197

Query  1092  DLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWF  913
                TF++F TVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L + IW 
Sbjct  198   SPLTFSIFATVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVMLIWG  257

Query  912   LGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIA  733
             L K T+R EF  IL +   +GY HL S R    L  TV G + +QL +F A EW S+++ 
Sbjct  258   LYKITKREEFSYILKNHKKMGYSHLLSVRLCFLLGLTVLGFLTIQLLLFCAFEWSSESLQ  317

Query  732   GLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENN-  556
             G++ YEK+VGSLF VVNSRH+GE+I+DLS L+PA+L L  +MMYLP  T F P+ ++   
Sbjct  318   GMSSYEKLVGSLFQVVNSRHSGETIVDLSTLSPAILILFTLMMYLPSYTLFVPLTEQKMI  377

Query  555   NSKTKGCSPKKFNIIE-KILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVIS  379
              S+ +  S    N+I+  + +S L  L+I I LI ITER+K++ DPLNFNVLNI +EVIS
Sbjct  378   KSEGEDDSGNGKNVIKGGMFVSQLSFLTICIFLISITERQKLRRDPLNFNVLNITLEVIS  437

Query  378   AYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGG  202
             AYGNVGF+TGYSC R++   +G C+D  +GF GRWS  GKF+LI+VMF+GR K++  K G
Sbjct  438   AYGNVGFTTGYSCERRLHVDDGGCEDAGYGFAGRWSPTGKFVLILVMFYGRFKQFTAKSG  497

Query  201   KAWKL  187
             +AW L
Sbjct  498   RAWIL  502



>gb|ABK58096.1| sodium transporter HKT1;5 [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   337 bits (864),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 234/513 (46%), Positives = 328/513 (64%), Gaps = 15/513 (3%)
 Frame = -1

Query  1716  SLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKL-KDLDvf  1540
             S   +H+ +    + L F V+PF  +L YF+ +S  GF  L+     P+   +  DLD+ 
Sbjct  9     STTTQHSRVQRAYQLLFFHVHPFWPQLLYFVSISFFGFVMLRA---LPMKTNMPTDLDLI  65

Query  1539  ftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHF--FQSKVSTTERV  1366
             FT+VS+ TVSSM  VEME FSN QL+ +T LM LGGE FTS LG++F   +SK    +  
Sbjct  66    FTSVSATTVSSMQAVEMESFSNPQLLLLTLLMLLGGEVFTSMLGMYFTYVKSKKKEAQAP  125

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsy  1186
              +    +      L L   +   +D   +D  +   + +       L   R+L  +V+ Y
Sbjct  126   HDDGAKVKPAPSSLELTAASICMDDGTAQDRMEQGFKDQPRYGRAFL--TRLLLFIVVGY  183

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
               V+H  G++L+ +Y+  V  A+ VL  KG+ + TF+VFT VSTF+NCGF+P NE M  F
Sbjct  184   HAVVHPAGYSLMLVYLSVVSGARTVLAGKGISMHTFSVFTIVSTFANCGFMPNNEGMASF  243

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
             +  PGLLL+++P +LLGNTL+P  LRLAIW L + T+R E    LG    +GY HL + R
Sbjct  244   RSFPGLLLLVMPHVLLGNTLFPVFLRLAIWALQRFTKRPE----LGELRSIGYDHLLTSR  299

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              + FLA TV   +  QL++F A+EW SD + GLT  +K+V +LF+ VNSRH GE ++DLS
Sbjct  300   HTRFLAFTVAVFVLAQLSLFCAMEWGSDGLRGLTAAQKLVAALFMSVNSRHAGEMVVDLS  359

Query  645   llapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFI  466
              ++ AV+ + +VMMYLPP TTF P+ D N      G   K+ +I  K+L+SPL  ++IF+
Sbjct  360   TVSSAVVVVYMVMMYLPPYTTFLPVEDSNQQV---GTDQKRTSIWHKLLMSPLSCIAIFV  416

Query  465   ILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFV  286
             +++CITER ++ +DPLNFNVL+I VEVISAYGNVGFSTGYSC RQ+ P+G C+D   GF 
Sbjct  417   VVVCITERRQISDDPLNFNVLSIAVEVISAYGNVGFSTGYSCGRQVTPDGSCRDAWVGFS  476

Query  285   GRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             G+WS  GK  LI VMF+GRLKK+ M GG+AW++
Sbjct  477   GKWSREGKLALIAVMFYGRLKKFSMHGGQAWRI  509



>dbj|BAO66165.1| sodium transporter HKT1;5 [Phragmites australis]
Length=511

 Score =   337 bits (864),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 241/530 (45%), Positives = 326/530 (62%), Gaps = 55/530 (10%)
 Frame = -1

Query  1704  KHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLDv  1543
             +H+ +      L F V+PF ++L YF+ +SL GF  LK       + PRP      DLDV
Sbjct  12    QHSKLQRVYHLLLFHVHPFWVQLLYFLFISLFGFLMLKTLPMKTGAVPRP-----TDLDV  66

Query  1542  fftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL  1363
              FT+VS+ TVSSM  VEME FSN QL+ MT LM LGGE FTS LGLHF  ++    E + 
Sbjct  67    IFTSVSATTVSSMVAVEMESFSNSQLLLMTLLMLLGGEVFTSMLGLHFTYTRSKKKEALD  126

Query  1362  EKNK--------------VIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL  1225
             +  K               + ++ +ELG +   +Y               I  +  + +L
Sbjct  127   KAGKHPPSSLELTQTQVPAMALEQMELGFMNQRDY-------------TSIVSLLTLIVL  173

Query  1224  GCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSN  1045
             G + V+           H+ G+TL+ +Y+  V  A+ VL  K +   TF++FT VSTF+N
Sbjct  174   GYIMVV-----------HLAGYTLILVYLSVVSEARAVLAGKRISAHTFSIFTVVSTFAN  222

Query  1044  CGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGS  865
             CGFV TNE MI F+  PGLLL+++P +LLGNTL+P  LRL I  L +TTRR E  ++L  
Sbjct  223   CGFVTTNEGMISFRSFPGLLLLVMPHVLLGNTLFPFFLRLTIGALERTTRRRELGELL--  280

Query  864   PNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVV  685
                +GY HL  G R+ FLA T    + +QL +F A+EW SD + GLT ++K+V +LF+ V
Sbjct  281   RESIGYDHLLPGARTWFLALTAAAFLVVQLVLFCAMEWGSDGLRGLTAFQKLVAALFMSV  340

Query  684   NSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN----  517
             NSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D +  S  +            
Sbjct  341   NSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVEDHHQQSGEQSDKKSVSGSSKS  400

Query  516   IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCA  337
             I  K+L+SPL  L  FI++ICITER ++ +DP+NF+VLNIVVEVISAYGNVGFSTGYSC 
Sbjct  401   IWRKLLMSPLSCLVAFIVVICITERRQIADDPVNFSVLNIVVEVISAYGNVGFSTGYSCG  460

Query  336   RQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             RQ++P+G C+D   G  G+WS  GK  L+ VMF+GRLKK+ M GG+AWKL
Sbjct  461   RQVRPDGSCRDAWIGLSGKWSREGKLALMAVMFYGRLKKFSMHGGQAWKL  510



>ref|XP_010437244.1| PREDICTED: sodium transporter HKT1 [Camelina sativa]
Length=506

 Score =   336 bits (861),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 241/478 (50%), Positives = 318/478 (67%), Gaps = 22/478 (5%)
 Frame = -1

Query  1599  ALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFT  1420
             ALK++KPR  S +  DLD+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LM LGGE FT
Sbjct  39    ALKITKPRTTS-RPHDLDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMLLGGEIFT  97

Query  1419  SWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTN---NEYHNDLNPE-DSAKSNVQI  1252
             S+L L+F       T  V   NK   I H+      +    + H+DL    D  +   +I
Sbjct  98    SFLSLYFSH----FTNFVFPHNK---IRHLMGSFNLDRPIEDGHSDLETVVDHCEGRTKI  150

Query  1251  EVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfav  1072
                 D +   C   L  VVLSY +V ++ G  L+ +Y+ FV +A+ VL  K +   TF+V
Sbjct  151   ----DERASKC---LYSVVLSYHLVSNLAGSVLLLVYVNFVKSARDVLSSKEISPLTFSV  203

Query  1071  fttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRR  892
             FTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K T+R
Sbjct  204   FTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKITKR  263

Query  891   IEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEK  712
              EF  IL +   +GY HL S R    L  TV G + +QL +F   EW S+++ G++ YEK
Sbjct  264   DEFSYILKNHKKMGYSHLLSVRLCVLLGLTVLGFLMIQLLLFCTFEWSSESLEGMSSYEK  323

Query  711   VVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS  532
             +VGSLF VVNSRHTGE+I+DLS L+PA+L L  +MMYLPP T F P+ ++    K     
Sbjct  324   LVGSLFQVVNSRHTGETIVDLSTLSPAILILFTLMMYLPPYTLFMPLTEQKTIKKEGDDD  383

Query  531   PKKFNIIEK--ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGF  358
                   + K  + +S L  L+I I LI ITER+K++ DPLNFNVLNI++EVISAYGNVGF
Sbjct  384   SGNRKKVTKSGLFVSQLSFLTICIFLISITERQKLRSDPLNFNVLNIILEVISAYGNVGF  443

Query  357   STGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +TGYSC R++   +G C+D  +GF GRWS  GKF+LIIVMF+GR K++  K G+AW L
Sbjct  444   TTGYSCGRRLNVSDGSCEDAGYGFAGRWSPTGKFVLIIVMFYGRFKQFTAKSGRAWIL  501



>ref|XP_002872505.1| potassium transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48764.1| potassium transporter [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   335 bits (859),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 245/497 (49%), Positives = 322/497 (65%), Gaps = 32/497 (6%)
 Frame = -1

Query  1650  FLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNL  1471
             FLL   YF++ S +GF ALK++KPR  S +  DLD+FFT+VS+ TVSSMSTV+MEVFSN 
Sbjct  22    FLLYFIYFLLFSFLGFLALKITKPRTTS-RPHDLDLFFTSVSAITVSSMSTVDMEVFSNT  80

Query  1470  QLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVI------DHVELGLVTN  1309
             QL+F+T LMFL GE FTS+L L+F       T  V   NK+  +      D  +L  VT 
Sbjct  81    QLIFLTILMFLAGEIFTSFLNLYFQH----FTNFVFPHNKIRHLVGSFNSDRCDLETVT-  135

Query  1308  NEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFV  1129
              ++   L+  +   S     VV    L+  +                VG  L+ +Y+ FV
Sbjct  136   -DHREGLSKIEERASKCLYSVVLSYHLVSNL----------------VGSVLLLVYVNFV  178

Query  1128  PTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNT  949
              TA+ VL  K +   TF+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNT
Sbjct  179   KTARDVLSSKDISPLTFSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNT  238

Query  948   LYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTV  769
             L+P  L L IW L K T+R EF  IL +   +GY HL S R    L  TV G + +QL  
Sbjct  239   LFPCFLALLIWGLYKITKRDEFGYILKNQKKMGYSHLLSVRLCVLLGVTVLGFLIIQLLF  298

Query  768   FLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPD  589
             F A EW S+++ G++ YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLP  
Sbjct  299   FCAFEWTSESLEGMSSYEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPSY  358

Query  588   TTFFPIMDENNNSKTKGCSPKKFNIIEK--ILLSPLGNLSIFIILICITEREKMKEDPLN  415
             T F P+ ++    K           + K  + +S L  L+I I LI ITER+K++ DPLN
Sbjct  359   TLFMPLTEQKTIEKEGDDDSGNGKKVTKSGLFVSQLSFLTICIFLISITERQKLRRDPLN  418

Query  414   FNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMF  238
             FNVLNI +EVISAYGNVGF+TGYSC R++   +G CKD  +GF GRWS +GKF+LIIVMF
Sbjct  419   FNVLNITLEVISAYGNVGFTTGYSCERRLDISDGSCKDAGYGFAGRWSPVGKFVLIIVMF  478

Query  237   FGRLKKYHMKGGKAWKL  187
             +GR K++  K G+AW L
Sbjct  479   YGRFKQFTAKSGRAWIL  495



>gb|ABG33940.1| HKT8 [Triticum turgidum subsp. durum]
 gb|ABG33943.1| HKT8 [Triticum aestivum]
 gb|ABG33947.1| HKT8 [Triticum aestivum]
Length=518

 Score =   335 bits (860),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 247/525 (47%), Positives = 332/525 (63%), Gaps = 36/525 (7%)
 Frame = -1

Query  1707  NKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLD  1546
              +H+ +    + L F V+PF L   YF+ +S +GF  LK          RPI     DLD
Sbjct  11    TQHSKLQRVYQLLFFHVHPFWLHFLYFVTISFLGFVILKALPMKTSMVSRPI-----DLD  65

Query  1545  vfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERV  1366
             + FT+VS+ TVSSM  VEME FSN QL+ +T LM LGGE FTS LGL+F   K       
Sbjct  66    LIFTSVSATTVSSMVAVEMESFSNPQLLLLTILMLLGGEVFTSMLGLYFTYIK-------  118

Query  1365  LEKNKVIVIDHVELG----------LVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCV  1216
               K K    DH + G           +    + +D   ++  +     E     +     
Sbjct  119   -SKKKEAPHDHGDGGGKVEPAPSSLELPATTFMDDSTAQNQMEQGFNKEQPRYGRAF-LT  176

Query  1215  RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGF  1036
             R+L  +VL Y VV+H+ G++L+ +Y+  V  A+ VL  KG+ L TF+VFT VSTF+N GF
Sbjct  177   RLLLFIVLGYHVVVHLAGYSLMLLYLSVVSGARAVLAGKGISLHTFSVFTVVSTFANGGF  236

Query  1035  VPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNG  856
             VP NE M+VF+  PGLLL+++P +LLGNTL+P  LRLAIW L + TRR E    LG    
Sbjct  237   VPNNEGMVVFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIWALRRVTRRPE----LGQLQS  292

Query  855   LGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSR  676
             +GYGHL + R + FLA TV   +  QL++F A+EW S+ + GLT  +K+V +LF+ VNSR
Sbjct  293   IGYGHLLTSRHTCFLAFTVATFVLAQLSLFCAMEWGSNGLHGLTAAQKLVAALFMSVNSR  352

Query  675   HTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKK--FNIIEKI  502
             HTGE ++DLS ++ AV+ L VVMMYLPP TTF P+ D+++         +K   +I  K+
Sbjct  353   HTGEMVVDLSTMSSAVVVLYVVMMYLPPYTTFLPVEDDSDQQVGADQHHQKRVTSIWRKL  412

Query  501   LLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP  322
             L+SPL  L+IFI ++CITER ++ +DPLNFNVLNI VEVISAYGNVGFSTGYSCARQ+  
Sbjct  413   LMSPLSFLAIFIAVVCITERRQISDDPLNFNVLNITVEVISAYGNVGFSTGYSCARQVTA  472

Query  321   EGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             +G C+D   GF G+WS  GK +LI VMF+GRLKK+ M GG+AW++
Sbjct  473   DGGCRDTWVGFSGKWSWQGKLVLIAVMFYGRLKKFGMHGGEAWRI  517



>gb|ABG33941.1| HKT8 [Triticum turgidum subsp. durum]
 gb|ABG33944.1| HKT8 [Triticum aestivum]
 gb|ABG33948.1| HKT8 [Triticum aestivum]
Length=514

 Score =   335 bits (858),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 248/516 (48%), Positives = 332/516 (64%), Gaps = 23/516 (4%)
 Frame = -1

Query  1707  NKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftav  1528
              +H+ +    + L F V+PF L+L YF+ +S  GF  LK + P      + DLD+ FT+V
Sbjct  12    TQHSKLHRAYQLLFFHVHPFWLQLLYFVSISFFGFVILK-ALPMKTGMPM-DLDLIFTSV  69

Query  1527  ssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL-----  1363
             S+ TVSSM  VEME FSN QL+ +T LM LGGE FTS LGLHF   K  T E        
Sbjct  70    SATTVSSMVAVEMESFSNPQLLLLTLLMLLGGEVFTSMLGLHFTYLKSKTKEAQAPHEHD  129

Query  1362  --EKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvls  1189
               +K K      ++L   T     +D+N     +   + +   D   L   R+L  +VL 
Sbjct  130   DADKGKPAPSSSLQL---TATTCMDDVN---RVEQGFKDQPRYDRAFL--TRLLLFIVLG  181

Query  1188  yivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIV  1009
             Y VV+H+ G++L+ +Y+  V  A+ VL  KG+ L TF+VFT VSTF+N GF+P NE M+ 
Sbjct  182   YHVVVHLAGYSLMLVYLSVVSGARAVLAGKGISLHTFSVFTVVSTFANGGFMPNNEEMVA  241

Query  1008  FKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSG  829
             F+  PGLLL+++P +LLGNTL+P  LRLAIW L + TRR E    LG    +GY HL + 
Sbjct  242   FRSFPGLLLLVMPHVLLGNTLFPVFLRLAIWALRRVTRRPE----LGELQSIGYDHLLTS  297

Query  828   RRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldl  649
             R + FLA TV   +  QL++F A+EW SD + GLT  +K+V +LF+ VNSRHTGE ++DL
Sbjct  298   RHTCFLAFTVAMFVLAQLSLFCAMEWGSDGLHGLTAAQKLVTALFMSVNSRHTGEMVVDL  357

Query  648   sllapavlalivVMMYLPPDTTFFPIMDENNNS-KTKGCSPKKFNII-EKILLSPLGNLS  475
             S ++ AV+ L VVMMYLPP TTF P+ D+++          K+  II  K+L+SPL  L+
Sbjct  358   STVSSAVVVLYVVMMYLPPYTTFLPVEDDSDQQVGADQHHQKRVTIIWRKLLMSPLSCLA  417

Query  474   IFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQF  295
             IFI ++CITER ++ +DPLNF VLNI VEVISAYGNVGFSTGYSC RQ+ P+G C+D   
Sbjct  418   IFIAVVCITERRQISDDPLNFKVLNITVEVISAYGNVGFSTGYSCGRQVTPDGGCRDTWV  477

Query  294   GFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             GF G+WS  GK +LI VMF+GRLKK+ M GG+AW +
Sbjct  478   GFSGKWSWQGKLVLIAVMFYGRLKKFSMHGGEAWMI  513



>ref|XP_006397077.1| hypothetical protein EUTSA_v10028595mg [Eutrema salsugineum]
 gb|AFJ23835.1| potassium transporter [Eutrema salsugineum]
 gb|ESQ38530.1| hypothetical protein EUTSA_v10028595mg [Eutrema salsugineum]
Length=505

 Score =   334 bits (856),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 246/501 (49%), Positives = 315/501 (63%), Gaps = 17/501 (3%)
 Frame = -1

Query  1674  RLAFRVNPFLLELS--YFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssms  1501
             RL    NP +L L   YF+  S +GF ALK+SKPR  S +  DLD+FFT+VS+ TVSSMS
Sbjct  12    RLQLAKNPSVLCLYFVYFLSFSFLGFLALKISKPRTTS-RPHDLDLFFTSVSAITVSSMS  70

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVI--VIDHVE  1327
             T++MEVFSN  L+F+T LM LGGE FTS+L L+F       T+ VL  NK I  ++   +
Sbjct  71    TIDMEVFSNTHLIFLTILMLLGGEVFTSFLTLYFSH----FTKFVLPHNKNIRHLMGSFD  126

Query  1326  LGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVA  1147
             L     +   +  N  D      QI            + L  VVL Y +V ++ G  LV 
Sbjct  127   LDSPIEDRRIDLENVTDHRVDPSQINERAS-------KCLYSVVLGYHLVTNIAGSVLVL  179

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +Y+ FV TA  VL  K +   TF+VFT VSTF NCGFVPTNENMI+F++N GLL +LIPQ
Sbjct  180   VYVNFVKTAGDVLSSKEISPLTFSVFTAVSTFGNCGFVPTNENMIIFRKNSGLLWLLIPQ  239

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
              L+GNTL+P  L   +  L K T+  EF  IL +   +GY HL S RR   L  TV G +
Sbjct  240   ALMGNTLFPCFLLFLVSGLDKITKYDEFGYILNNYKKMGYYHLLSVRRCVLLGLTVLGFL  299

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              +QL  F   EW S+++ G+  YEK VGSLF VVNSRHTGE+ILD+S L+P +L L ++M
Sbjct  300   TIQLIFFCVYEWSSESLEGMNWYEKFVGSLFQVVNSRHTGETILDVSTLSPTILILFILM  359

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLPP T F P  +E N          K      + +S L  L + I+LI I+EREK++ 
Sbjct  360   MYLPPYTLFMPFTEETNEKGEDDSENGKKRKKSGLFVSQLSFLVVCIVLISISEREKLRR  419

Query  426   DPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILI  250
             DPLNFNVLNI +EVISAYGNVGF+TGYSC R++   +G C+D  +GFVGRWS  GK ILI
Sbjct  420   DPLNFNVLNITLEVISAYGNVGFTTGYSCKRRLNVSDGGCEDASYGFVGRWSPAGKVILI  479

Query  249   IVMFFGRLKKYHMKGGKAWKL  187
             +VMF+GR K +  K G+AW L
Sbjct  480   LVMFYGRFKHFTPKSGRAWIL  500



>dbj|BAO66166.1| sodium transporter HKT1;5 [Phragmites australis]
Length=511

 Score =   334 bits (856),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 240/530 (45%), Positives = 325/530 (61%), Gaps = 55/530 (10%)
 Frame = -1

Query  1704  KHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLDv  1543
             +H+ +    R L F V+PF ++L YF+ +SL GF  LK       + PRP      DLDV
Sbjct  12    QHSKLQRVYRLLLFHVHPFWIQLLYFLFISLFGFLMLKTLPMKTGAVPRP-----TDLDV  66

Query  1542  fftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL  1363
              FT+VS+ TVSSM  VEME FSN QL+ MT LM LGGE FTS LGLHF  ++    E + 
Sbjct  67    IFTSVSATTVSSMVAVEMEPFSNSQLLLMTLLMLLGGEVFTSMLGLHFTYTRSKKKEALD  126

Query  1362  EKNK--------------VIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL  1225
             +  K               + ++ +ELG +   +Y               I  +  + +L
Sbjct  127   KAGKHPPSSLELTQTQVPAMALEQMELGFMNQRDY-------------TSIVSLLTLIVL  173

Query  1224  GCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSN  1045
             G + V+           H+ G+TL+ +Y+  V  A+ VL  K +   TF++FT VSTF+N
Sbjct  174   GYIMVV-----------HLAGYTLILVYLSVVSEARAVLAGKRISAHTFSIFTVVSTFAN  222

Query  1044  CGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGS  865
             CGFV TNE M+ F+  PGLLL+++P +LLGNTL+P  LRL I  L +TTRR E  ++L  
Sbjct  223   CGFVTTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLTIGALERTTRRRELGELL--  280

Query  864   PNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVV  685
                +GY HL    R+  LA T    + +QL +F A+EW SD + GLT ++K+V +LF+ V
Sbjct  281   RESIGYDHLLPVTRTWCLALTAAAFLVVQLVLFCAMEWGSDGLRGLTAFQKLVAALFMSV  340

Query  684   NSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNS----KTKGCSPKKFN  517
             NSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D +  S      K  S     
Sbjct  341   NSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVEDHHQQSGEQSDKKSVSGSSKG  400

Query  516   IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCA  337
             I  K+L+SPL  L  FI++I ITER ++ +DP+NF+VLNIVVEVISAYGNVGFSTGYSC 
Sbjct  401   IWRKLLMSPLSCLVAFIVVISITERRQIADDPVNFSVLNIVVEVISAYGNVGFSTGYSCG  460

Query  336   RQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             RQ++P+G C+D   G  G+WS  GK  L+ VMF+GRLKK+ M GG+AWKL
Sbjct  461   RQVRPDGSCRDAWIGLSGKWSREGKLALMAVMFYGRLKKFSMHGGQAWKL  510



>emb|CDX90754.1| BnaA03g24340D [Brassica napus]
Length=585

 Score =   335 bits (860),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 237/486 (49%), Positives = 314/486 (65%), Gaps = 30/486 (6%)
 Frame = -1

Query  1611  IGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGG  1432
             +GF ALKVSKPR  S +L DLD+FFT+VS+ TVSSMSTV+MEVFSN QL+ +T LMF+GG
Sbjct  114   LGFLALKVSKPRATS-RLHDLDIFFTSVSAITVSSMSTVDMEVFSNTQLIIITILMFIGG  172

Query  1431  ECFTSWLGLH--------FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPED  1276
               FTS+  ++        F  SK+       + +  I   H++   +  N+ H   +  +
Sbjct  173   PIFTSFFNIYLSHFTKFVFPHSKIKHLIGSFKADHTIEDRHLDQENI--NDRHEIPSQIN  230

Query  1275  SAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKG  1096
                S     VV    L+  +                 G  L+ +Y+ FV TA+ VL+ K 
Sbjct  231   EKASKCLYLVVIGYHLVTNI----------------AGSMLLLVYVSFVKTARDVLRFKE  274

Query  1095  LDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIW  916
             +   TF++FTTVSTF+ CGFVPTNENMI+F++N GLL +LIP +L+GNTL+P  LRL IW
Sbjct  275   ISTLTFSIFTTVSTFATCGFVPTNENMIIFRKNSGLLWLLIPLVLMGNTLFPCFLRLLIW  334

Query  915   FLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAI  736
              L KTT+R EF  IL +   +GY HL S R   FL  TV G I +QL +F    W S+++
Sbjct  335   GLSKTTKREEFGYILKNRKKMGYSHLLSVRLCVFLGLTVLGFILIQLFLFCTFAWSSESL  394

Query  735   AGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFP--IMDE  562
             AG+  YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L + ++MMYLPP T F P  I  +
Sbjct  395   AGMNWYEKLVGSLFQVVNSRHTGETIVDLSTLSPAILIVFILMMYLPPYTLFMPFTIKKK  454

Query  561   NNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
             N   +      +K      +L+S L  L I I LI ITER+K++ DPLNFNVLNI +EV+
Sbjct  455   NKKEEENDSGYEKGGKKSGLLVSQLSFLVICIFLISITERQKLRRDPLNFNVLNITLEVV  514

Query  381   SAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKG  205
             SAYGNVGF+TGYSC R++   +G C+D  +GF GRWS+ GKFILIIVMF+GRLK++  K 
Sbjct  515   SAYGNVGFTTGYSCERRLNVSDGGCEDAGYGFAGRWSSSGKFILIIVMFYGRLKQFTAKS  574

Query  204   GKAWKL  187
             G+AW L
Sbjct  575   GRAWIL  580



>ref|XP_010437235.1| PREDICTED: sodium transporter HKT1-like [Camelina sativa]
Length=482

 Score =   331 bits (849),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 242/497 (49%), Positives = 320/497 (64%), Gaps = 35/497 (7%)
 Frame = -1

Query  1674  RLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstV  1495
             +LA   +PF L   YF+  SL+GF ALK+SKPR  S  + DLD+FFT+VS+ T+SSMSTV
Sbjct  15    QLAKPCSPFFLYFIYFLSFSLLGFLALKISKPRTTS-HVNDLDLFFTSVSAITISSMSTV  73

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV  1315
             ++EVFSN QL+ +T +MFLG E FTS+L L+F       T  V  +NK   I++  + L 
Sbjct  74    DVEVFSNTQLIIITIIMFLGAEIFTSFLVLYFSH----LTNFVFPRNK---IENCRIDLE  126

Query  1314  TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIG  1135
              + +     +  +   S     VV   +L+                 ++VG  +V +Y+ 
Sbjct  127   NDTDLCEGPSQINERASKCLYSVVLGYQLV----------------TNLVGSVVVLVYVS  170

Query  1134  FVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLG  955
             FV TA  VL  KG+    F+VFTTVSTF+NCGFVPTNENM++F++N GLL +LIPQ+L+G
Sbjct  171   FVKTAGDVLSFKGISPLLFSVFTTVSTFANCGFVPTNENMVIFRKNSGLLWLLIPQVLMG  230

Query  954   NTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQL  775
             NTL+P  L L IW L K T+R EF  IL +   +GY HL S R    L  TV G + +QL
Sbjct  231   NTLFPCFLVLFIWGLYKITKRDEFGYILKNHKKMGYYHLLSVRLCILLGLTVLGFVMIQL  290

Query  774   TVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLP  595
               F   EW SD++ G++ YEK+VGSLF VVNSR+TGE+I+D+S L+PA+L L ++MMYLP
Sbjct  291   LFFCTFEWSSDSLGGMSWYEKLVGSLFQVVNSRYTGETIVDISTLSPAILILFILMMYLP  350

Query  594   PDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLN  415
             P T F P+ +E   SK K            + +S L  L + I LI ITEREK++ DPLN
Sbjct  351   PYTLFMPLTEEKERSKKK----------SGLFVSQLSFLVMCIFLISITEREKLQRDPLN  400

Query  414   FNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMF  238
             FNVLNI +EVISAYGNVGF+TGYSC R++   +G C D  +GFVGRWS  GK IL+IVMF
Sbjct  401   FNVLNITLEVISAYGNVGFTTGYSCKRRLDINDGGCIDASYGFVGRWSPTGKVILVIVMF  460

Query  237   FGRLKKYHMKGGKAWKL  187
             +GR K +  K G+AW L
Sbjct  461   YGRFKHFTAKSGRAWIL  477



>ref|XP_010424497.1| PREDICTED: sodium transporter HKT1-like, partial [Camelina sativa]
Length=468

 Score =   331 bits (848),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 244/499 (49%), Positives = 322/499 (65%), Gaps = 42/499 (8%)
 Frame = -1

Query  1674  RLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstV  1495
             +LA   +PF L   YFI  SL+GF A+K+SKPR IS +L DL VFFT+VS+ T+SSMSTV
Sbjct  4     QLAKPCSPFFL---YFIY-SLLGFLAVKISKPRTIS-RLNDL-VFFTSVSAITISSMSTV  57

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV  1315
             ++EVFSN QL+ +T +MF+G E FTS+L L+F       T  V  +NK   I++  + L 
Sbjct  58    DVEVFSNTQLIIITIIMFMGAEIFTSFLVLYFSH----LTNFVFPRNK---IENCRIDLE  110

Query  1314  TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIG  1135
              + +     +  +   S     VV   +L+                 ++VG  LV +Y+ 
Sbjct  111   NDTDLREGPSQINERASKCLYSVVLGYQLV----------------TNLVGSVLVLVYVS  154

Query  1134  FVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLG  955
             FV TA  VL  KG+    F+VFTTVSTF+NCGFVP NENM++F++N GLL +LIPQ+L+G
Sbjct  155   FVKTAGDVLSFKGISPLLFSVFTTVSTFANCGFVPMNENMVIFRKNSGLLWLLIPQVLMG  214

Query  954   NTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG--LIFL  781
             NTL+P  L L IW L K T+R EF  IL +   +GY HL S R   FL  TV G  +I +
Sbjct  215   NTLFPCFLALFIWGLYKITKREEFGYILKNYKKMGYYHLLSVRLCIFLGLTVLGFVMIMI  274

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
             QL  F   EW S+++ G++ YEK+VGSLF VVNSR+TGE+I+D+S L+PA+L L ++MMY
Sbjct  275   QLLFFCTFEWSSESLGGMSWYEKLVGSLFQVVNSRYTGETIVDISTLSPAILILFILMMY  334

Query  600   LPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDP  421
             LPP T F P+ +E   SK K            + +S L  L + I LI ITEREK++ DP
Sbjct  335   LPPYTLFMPLTEEKERSKKK----------SGLFVSQLSFLVMCIFLISITEREKLQRDP  384

Query  420   LNFNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIV  244
             LNFNVLNI +EVISAYGNVGF+TGYSC R++   +G C D  +GFVGRWS  GK IL+IV
Sbjct  385   LNFNVLNITLEVISAYGNVGFTTGYSCKRRLDINDGGCIDASYGFVGRWSPTGKVILVIV  444

Query  243   MFFGRLKKYHMKGGKAWKL  187
             MF+GR K +  K G+AW L
Sbjct  445   MFYGRFKHFTAKSGRAWIL  463



>ref|XP_009415042.1| PREDICTED: cation transporter HKT8-like [Musa acuminata subsp. 
malaccensis]
Length=517

 Score =   330 bits (847),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 239/514 (46%), Positives = 330/514 (64%), Gaps = 23/514 (4%)
 Frame = -1

Query  1716  SLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvff  1537
             S+ +  T++ S  R L F+ NPF ++  YF  LS+ GF  LK+   R ++ K  ++D+ F
Sbjct  20    SIESIPTLVASLYRFLLFQANPFWIQSCYFFSLSMAGFLLLKILPLRDVTSKPTNVDLLF  79

Query  1536  tavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEK  1357
              + S+ TVSSM  +EMEVFSN QL  +T LM  GGE F S LGLHF + K    +  L+ 
Sbjct  80    MSASANTVSSMDAMEMEVFSNYQLGVLTLLMVTGGEVFVSLLGLHFAKIKSQKKDSSLDA  139

Query  1356  NKV---IVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDI--KLLGCVRVLARvvl  1192
             + +    + D  ELG         DL P D    +++    + +   +LG + V      
Sbjct  140   SGMELATLSDEAELG-----HQKPDLMPPDMTVLDMKSSSRKHLFFVVLGYLIV------  188

Query  1191  syivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMI  1012
                   HVVGF L+ +Y+  VP A  VL +KG++ + F++FTTVSTF+NCGFV TNENM+
Sbjct  189   -----AHVVGFLLILVYLRLVPDAGTVLDRKGINASMFSIFTTVSTFANCGFVLTNENMV  243

Query  1011  VFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFS  832
             VF+   GLLLI+I Q L+GNT+Y + LR  IW L K T+R E+  +L +   +GY HL  
Sbjct  244   VFRTCSGLLLIVIVQALVGNTMYASSLRAVIWLLKKLTKRQEYDYLLNNYGEMGYDHLLP  303

Query  831   GRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIld  652
             G  + +LA TV GL+ LQL +F  +EW SD+I GL+ Y+K+VG++F+ VNSR+ GESI+D
Sbjct  304   GPHALYLAITVAGLVLLQLILFCCMEWTSDSITGLSTYQKIVGAVFMSVNSRYAGESIVD  363

Query  651   lsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSI  472
             LS ++PA+L L VVMMYLPP T F P  D+    +    S +   +   ++LSPL +++I
Sbjct  364   LSAISPAILVLFVVMMYLPPYTCFLPREDDRRLLEDGETSRRTTGL--GLILSPLSSIAI  421

Query  471   FIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFG  292
             F I+ICITER +M  DPLNF+VLN+VVEV+SAYG VG++TGYSC RQ+K +  CKD   G
Sbjct  422   FTIIICITERRQMSRDPLNFSVLNVVVEVVSAYGTVGYTTGYSCKRQVKADVHCKDVSAG  481

Query  291   FVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWK  190
             F  +WSN GK +LI VMFFGRLKK+ M GGK W+
Sbjct  482   FSAKWSNKGKLVLIAVMFFGRLKKFSMGGGKYWQ  515



>gb|KDP35912.1| hypothetical protein JCGZ_09884 [Jatropha curcas]
Length=333

 Score =   324 bits (830),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 188/328 (57%), Positives = 239/328 (73%), Gaps = 1/328 (0%)
 Frame = -1

Query  1164  GFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGll  985
             G  LVA Y   V +A++VL +KG+ + TF++F TVSTFSN GFVPTNENMIVFK+N GLL
Sbjct  3     GVILVASYTSLVSSAREVLTKKGISIQTFSIFVTVSTFSNTGFVPTNENMIVFKKNSGLL  62

Query  984   lilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAA  805
             L+LIPQ LLGNTL+   LR  IW L K T+R ++R +L +   +GYGHL S  +  FLA 
Sbjct  63    LLLIPQTLLGNTLFAPSLRFLIWVLEKLTKREDYRYMLKNSKEMGYGHLISSVKCQFLAM  122

Query  804   TVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavl  625
             TV G I +Q  +  A+EW S  + GL+ +EK+V + F VVN+RH+GE++ DLS+++ A+L
Sbjct  123   TVLGFIVIQFVLLCAMEWNSQVMDGLSWFEKLVAAFFQVVNTRHSGEAVFDLSIVSSAIL  182

Query  624   alivVMMYLPPDTTFFPIMDENNNSKT-KGCSPKKFNIIEKILLSPLGNLSIFIILICIT  448
              L V MMYLP   +F PI  E   +K+ KG   +    ++ IL S L  L IFI+LICI 
Sbjct  183   VLFVAMMYLPQYFSFMPIKPEEEVTKSGKGHKNEGRTAMQCILFSQLSYLVIFIVLICIL  242

Query  447   EREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNM  268
             EREKMK DPLNFNVL+I +EVISAYGNVG+STGYSCARQIK E  CKD+ +GFVGRWSN+
Sbjct  243   EREKMKTDPLNFNVLSITLEVISAYGNVGYSTGYSCARQIKAEASCKDRWYGFVGRWSNL  302

Query  267   GKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              KF+LIIVM FGRLKK+   GGKAW++S
Sbjct  303   PKFVLIIVMLFGRLKKFTSHGGKAWRVS  330



>dbj|BAO66167.1| sodium transporter HKT1;5 [Phragmites australis]
Length=511

 Score =   330 bits (845),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 238/530 (45%), Positives = 324/530 (61%), Gaps = 55/530 (10%)
 Frame = -1

Query  1704  KHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLDv  1543
             +H+ +    R L F V+PF ++L YF+ +SL GF  LK       + PRP      DLDV
Sbjct  12    QHSKLQRVYRLLLFHVHPFWIQLLYFLFISLFGFLMLKTLPMKTGAVPRP-----TDLDV  66

Query  1542  fftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL  1363
              FT+VS+ TVSSM  VEME FSN QL+ MT LM LGGE FTS LGLHF  ++    E + 
Sbjct  67    IFTSVSATTVSSMVAVEMESFSNSQLLLMTLLMLLGGEVFTSMLGLHFTYTRSKKKEALD  126

Query  1362  EKNK--------------VIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL  1225
             +  K               + ++ +ELG +   +Y               I  +  + +L
Sbjct  127   KAGKHPPSSLELTQTQVPAMALEQMELGFMNQRDY-------------TSIVSLLTLIVL  173

Query  1224  GCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSN  1045
             G + V+           H+ G+TL+ +Y+  V  A+ VL  K +   TF++FT VSTF+N
Sbjct  174   GYIMVV-----------HLAGYTLILVYLSVVSEARAVLAGKRISAHTFSIFTVVSTFAN  222

Query  1044  CGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGS  865
             CGFV TNE M+ F+  PGLLL+++P +LLGNTL+P  LRL I  L +TTRR E  ++L  
Sbjct  223   CGFVTTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLTIGALERTTRRRELGELL--  280

Query  864   PNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVV  685
                +GY HL    R+  LA T    + +QL +F A+EW SD + GLT ++K+V +LF+ V
Sbjct  281   RESIGYDHLLPVTRTWCLALTAAAFLVVQLVLFCAMEWGSDGLRGLTAFQKLVAALFMSV  340

Query  684   NSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN----  517
             NSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D +  S  +            
Sbjct  341   NSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVEDHHQQSGEQSDKKSVSGSSKS  400

Query  516   IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCA  337
             I  K+L+SPL  L  FI++I ITER ++ +DP+NF+VLNIVVEVISAYGNVGFSTGYSC 
Sbjct  401   IWRKLLMSPLSCLVAFIVVISITERRQIADDPVNFSVLNIVVEVISAYGNVGFSTGYSCG  460

Query  336   RQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             RQ++P+G C+D   G  G+WS  GK  L+ VMF+GRLKK+ M GG+AWKL
Sbjct  461   RQVRPDGSCRDAWIGLSGKWSREGKLALMAVMFYGRLKKFSMHGGQAWKL  510



>ref|XP_010421950.1| PREDICTED: sodium transporter HKT1-like [Camelina sativa]
Length=516

 Score =   329 bits (843),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 237/482 (49%), Positives = 318/482 (66%), Gaps = 29/482 (6%)
 Frame = -1

Query  1599  ALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFT  1420
             ALK++KPR  S +  DLD+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LM LGGE FT
Sbjct  48    ALKITKPRTTS-RPHDLDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMLLGGEIFT  106

Query  1419  SWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             S+L L+        T  V   NK   I H+         ++ DL  ED  +S+++  V  
Sbjct  107   SFLSLYLSH----FTNFVFPHNK---IRHLM------GSFNLDLPIED-GRSDLETVVDH  152

Query  1239  -------DIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
                    D +   C   L  VVLSY ++ ++ G  L+ +Y+ FV +A+ VL  K +   T
Sbjct  153   CEGRSKIDERASKC---LYSVVLSYHLISNLAGSLLLLVYVNFVKSARDVLSSKEISPLT  209

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTN+NMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  210   FSVFTTVSTFANCGFVPTNDNMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  269

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL +   +GY HL S R    L  TV G + +QL +F   EW S+++ G++ 
Sbjct  270   TKRDEYSYILKNHKKMGYSHLLSVRLCVLLGLTVLGFLMIQLLLFCTFEWSSESLEGMSS  329

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDEN--NNSK  547
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L  +MMYLPP T F P+ ++   N   
Sbjct  330   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILILFTLMMYLPPYTLFMPLTEQKTINKEG  389

Query  546   TKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGN  367
                   +K      + +S L  L+I I LI ITER+K++ DPLNFNVLNI++EVISAYGN
Sbjct  390   DDDSGNRKKVTKSGLFVSQLSFLTICIFLISITERQKLRSDPLNFNVLNIILEVISAYGN  449

Query  366   VGFSTGYSCARQ--IKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAW  193
             VGF+TGYSC R+  +  +G C+D  +GF GRWS  GKF+LIIVMF+GR K++    G+AW
Sbjct  450   VGFTTGYSCGRRLNVMSDGSCEDAGYGFAGRWSPTGKFVLIIVMFYGRFKQFTAISGRAW  509

Query  192   KL  187
              L
Sbjct  510   IL  511



>ref|XP_006289285.1| hypothetical protein CARUB_v10002754mg [Capsella rubella]
 gb|EOA22183.1| hypothetical protein CARUB_v10002754mg [Capsella rubella]
Length=482

 Score =   328 bits (840),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 241/497 (48%), Positives = 320/497 (64%), Gaps = 35/497 (7%)
 Frame = -1

Query  1674  RLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstV  1495
              LA   +PF L L YF+  S +GF ALK+SKPR  S  L DLD+FFT+VS+ TVSSMSTV
Sbjct  15    ELAKHCSPFFLYLIYFLSFSSLGFLALKISKPRTTS-PLHDLDLFFTSVSAITVSSMSTV  73

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV  1315
             ++EVFSN QLV +T ++F+G E FTS+L L+F       T+ V+ +NK   I++  + L 
Sbjct  74    DVEVFSNTQLVIITIIIFMGAEIFTSFLVLYFSH----LTKFVIPRNK---IENCRIDL-  125

Query  1314  TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIG  1135
                   ND+   D  +   QI       L   V       L Y +V ++VG  ++ +Y+ 
Sbjct  126   -----ENDI---DLVEGPSQINEKASKSLYSVV-------LGYQLVTNLVGSMVLLVYVN  170

Query  1134  FVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLG  955
             FV TA+ VL  KG+    F+VFTTVSTF+NCG+VP NENM + ++N GLL +LIPQ+L+G
Sbjct  171   FVKTARDVLSSKGISPLLFSVFTTVSTFANCGYVPMNENMAILRKNSGLLWLLIPQVLMG  230

Query  954   NTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQL  775
             NT++P  L L IW L K T+R EF  IL +   +GY HL S R    L  TV G + +QL
Sbjct  231   NTMFPCFLVLFIWGLYKITKRDEFGYILKNHKKMGYYHLLSVRLCILLGLTVLGFVMIQL  290

Query  774   TVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLP  595
               F   EW S+++ G++ YEK+VGSLF VVNSR TGE+I+D+S L+PA+L L V+MMYLP
Sbjct  291   FFFCTFEWSSESLQGMSSYEKLVGSLFQVVNSRFTGETIVDISKLSPAILVLFVLMMYLP  350

Query  594   PDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLN  415
             P T F P+ +E      K            + +S L  L+I I LI ITER+ ++ DPLN
Sbjct  351   PYTLFMPLTEEKKKKNKK----------SGLFVSQLSFLTICIFLISITERQNLRSDPLN  400

Query  414   FNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMF  238
             FNVLNI +EVISAYGNVGF+TGYSC R++   +G C D  +GFVGRWS +GK ILIIVMF
Sbjct  401   FNVLNITLEVISAYGNVGFTTGYSCKRRLNMNDGGCIDASYGFVGRWSPIGKVILIIVMF  460

Query  237   FGRLKKYHMKGGKAWKL  187
             +GR K++  K  +AW L
Sbjct  461   YGRFKQFTAKSSRAWIL  477



>ref|XP_006645804.1| PREDICTED: cation transporter HKT8-like [Oryza brachyantha]
Length=526

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 242/516 (47%), Positives = 333/516 (65%), Gaps = 36/516 (7%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L++ YF+ +SL GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQVLYFLFISLFGFLMLKALPMKTGMVPRPL-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK---VSTTERVLEKNKVIVIDH  1333
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K   ++ T    +K   I    
Sbjct  78    VAVEMESFSNSQLLLLTLLMLLGGEVFTSILGLYFTYTKSEKMAATAEYSDKPPPISTP-  136

Query  1332  VELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIK-----------LLGCVRVLARvvlsy  1186
             VEL  +       D+   + A +  Q+E+  D K                R+L  VV+ Y
Sbjct  137   VELAAM-------DVVVINPATAQNQMELGLDQKKRSCTHTSSSSPSSMTRLLMFVVMGY  189

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
              VV+H+ G+TL+ +Y+  V  A+ VL  K +   TF++FT VSTF+NCGFVPTNE MI F
Sbjct  190   HVVVHLAGYTLIVVYLSVVSGARAVLAGKRISPHTFSIFTVVSTFANCGFVPTNEGMISF  249

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRR-IEFRQILGSPNGLGYGHLFSG  829
             +  PGLLL+++P +LLGNTL+P  LRLAI  L + TRR            G GY HL  G
Sbjct  250   RSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTRRPELGELRRRRGGGGGYDHLLPG  309

Query  828   RRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldl  649
              R+ FLA TV   + +QL +F A+EW ++ + GLT  +K+VG+LF+ VNSRH+GE ++DL
Sbjct  310   SRTCFLALTVAVFLLVQLVLFCAMEWGNEGLQGLTAGQKLVGALFMSVNSRHSGEMVVDL  369

Query  648   sllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN--IIEKILLSPLGNLS  475
             S ++ AV+ L VVMMYLPP TTF P+ +++  +  +    ++ +  I +K+L+SPL  L+
Sbjct  370   STVSSAVVVLFVVMMYLPPYTTFLPVQEKHQQTGDQSGQERRSSSSIWQKLLMSPLSCLA  429

Query  474   IFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQF  295
             IF ++ICITER ++ +DP+N++VLNIVVEVISAYGNVGFSTGYSCARQ++P+G C+D   
Sbjct  430   IFTVVICITERRQLADDPINYSVLNIVVEVISAYGNVGFSTGYSCARQVRPDGSCRDLWV  489

Query  294   GFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             GF G+WS  GK  L+ VM +GRLKK+ M GG+AWK+
Sbjct  490   GFSGKWSWEGKLTLMAVMLYGRLKKFTMHGGQAWKI  525



>ref|XP_004967537.1| PREDICTED: cation transporter HKT8-like [Setaria italica]
Length=534

 Score =   329 bits (843),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 248/534 (46%), Positives = 338/534 (63%), Gaps = 59/534 (11%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLDvfftavssatvs  1510
             L F V+PF ++L YF+ +SL GF  LK       + P P       LD+ FT+VS+ TVS
Sbjct  20    LLFHVHPFWIQLVYFLSISLFGFMMLKALPMKTSAVPTP-----SGLDLIFTSVSATTVS  74

Query  1509  smstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHV  1330
             SM  VEME FSN QL+ +T LM LGGE FTS LGLHF  +K+        K +   I H 
Sbjct  75    SMVAVEMESFSNSQLLLVTLLMLLGGEVFTSMLGLHFTYTKL--------KKRETQIPH-  125

Query  1329  ELGLVTNNEYHNDLNPEDSA-----------KSNVQIEVVE-------DIKLLGCVRVLA  1204
                   + + +N L P  S+            +   +E +E       D   +   R+L 
Sbjct  126   ------DLDGNNGLPPPSSSLELRTMGGGAPAAVAALEQMETGFKNNLDFTSIARTRMLM  179

Query  1203  RvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTN  1024
              VVL Y+VV+H+ G+TL+ +Y+  V  A++VL  K ++ +TF++FT VSTF+NCGFVPTN
Sbjct  180   FVVLGYLVVVHLAGYTLMLIYLSAVAGAREVLIGKKINPSTFSIFTVVSTFANCGFVPTN  239

Query  1023  ENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQIL---GSP---  862
             E M+ FK  PG+LL+ +P +LLGNTL+P  LRL+I  L + TRR +  ++L   G P   
Sbjct  240   EGMVSFKSYPGMLLLAMPHVLLGNTLFPVFLRLSIGALERVTRRRDLGELLVRGGGPGPA  299

Query  861   ---NGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFV  691
                + +GY HL    R+  LA TV  L+  QL +F A+EW SD + GLT  +K+V +LF+
Sbjct  300   AATSTIGYDHLLPAARTWHLAFTVAALVAAQLVLFCAMEWGSDGLRGLTASQKLVAALFM  359

Query  690   VVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKF---  520
              VNSRH+GE  +DL+ ++ AV+ L VVMMYLPP TTF P+  E+++   +  S +K    
Sbjct  360   SVNSRHSGEMAVDLAAVSSAVVVLYVVMMYLPPYTTFLPVPVEDHHQYREAQSDEKSKIT  419

Query  519   ---NIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTG  349
                NI +K+L+SPL  L+IFII+ICITER ++  DP+NF+V NIVVE+ISAYGNVGFSTG
Sbjct  420   SSKNIWQKLLMSPLSCLAIFIIVICITERRQIAHDPINFSVRNIVVEIISAYGNVGFSTG  479

Query  348   YSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             YSC RQ+KP+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ M GG+AWKL
Sbjct  480   YSCGRQVKPDGSCRDAWVGFSGKWSREGKLTLMAVMFYGRLKKFSMHGGQAWKL  533



>gb|AGZ93642.1| HKT1;4-1 [Triticum turgidum subsp. durum]
Length=563

 Score =   328 bits (842),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 238/509 (47%), Positives = 319/509 (63%), Gaps = 14/509 (3%)
 Frame = -1

Query  1674  RLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPI---SFKLKDLDvfftavssatvssm  1504
             R   R+   L+ ++YF+ +S +G+  L   + R     + + + +D+FFTAVS+ATVSSM
Sbjct  57    RFWRRLGSLLVHVAYFLAVSWLGYLLLAQLRFRAGGDGTRRPRGIDLFFTAVSAATVSSM  116

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
             STVEMEVFSN QL+ +T LMF+GGE F S LGL    SK+          +V   D  EL
Sbjct  117   STVEMEVFSNGQLLVLTVLMFVGGEVFLSLLGLASKWSKLRKQAVHKSSRRVDNHDVPEL  176

Query  1323  GLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvv--------lsyivvihv  1168
              +   +      NP  S  S V  E+ + +      R+    V           + V  +
Sbjct  177   EMPPVDAATELANPT-SMTSTVDDEMSKPLDHFDDTRLRRDAVLSLFFVVLAILLAVHVL  235

Query  1167  VGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGl  988
                 +VA  +   P A++ L+ K L++ TFAVFTTVSTFS+CG++PTNENMIVFKR+ GL
Sbjct  236   GSGAIVAYVLHASPAARRTLRDKALNMWTFAVFTTVSTFSSCGYMPTNENMIVFKRDTGL  295

Query  987   llilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGL-GYGHLFSGRRSGFL  811
              L+L+PQ L+GNTL+P  L   +      TRR+E ++       L GY HL   RR   L
Sbjct  296   QLLLVPQALVGNTLFPPLLAACVRVAAAATRRVELKETAKKGRELTGYYHLLPARRCAML  355

Query  810   AATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapa  631
             AATV G + +Q+ +   +EW   A+ G++ +EKV  ++F+ VNSRHTGES LDL  LAPA
Sbjct  356   AATVVGFLAVQVAMLCGMEW-GGALRGMSAWEKVSNAVFLAVNSRHTGESTLDLFTLAPA  414

Query  630   vlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             +L L V+MMYLPP TT+FP  + +          +   +++  LLS L  L+IF+I ICI
Sbjct  415   ILVLFVLMMYLPPYTTWFPFEESSGVKDQPREETQGVRLLKSTLLSQLSYLAIFVIAICI  474

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSN  271
             TEREK+KEDPLNFN+L+IVVEV+SAYGNVGFS GYSC+RQI P+G C D+  GF GRWS+
Sbjct  475   TEREKLKEDPLNFNLLSIVVEVVSAYGNVGFSMGYSCSRQISPDGMCTDRWTGFAGRWSD  534

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GK ILI+VM FGR+KK+ MK GKAWKLS
Sbjct  535   SGKLILILVMLFGRMKKFSMKAGKAWKLS  563



>ref|XP_009128719.1| PREDICTED: sodium transporter HKT1-like [Brassica rapa]
 emb|CDY25243.1| BnaA02g22130D [Brassica napus]
Length=507

 Score =   326 bits (835),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 243/511 (48%), Positives = 325/511 (64%), Gaps = 25/511 (5%)
 Frame = -1

Query  1692  MMSTVRRLAF--RVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssa  1519
             +++ +R   F   ++P  L   YF+  S++GF ALK+SKPR I+ +  D D+FFT+VS+ 
Sbjct  8     ILAKIRSQVFAKHLSPLCLYFIYFLTFSILGFLALKISKPR-ITSRPHDFDLFFTSVSAL  66

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKV-IV  1342
             T+SSMST++MEVFSN QL+F+T LMFLGGE FTS+L L+F       T+ V   NKV  +
Sbjct  67    TISSMSTIDMEVFSNTQLIFLTILMFLGGEVFTSFLNLYFSH----FTKFVYPHNKVRHL  122

Query  1341  IDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVG  1162
              D  +L         +  N  D  + ++Q+       +    + L  VVL Y ++ H+VG
Sbjct  123   TDSFDLDRRMEEPRIDIENVIDHQEGSIQM-------IERASKCLYSVVLGYHLITHLVG  175

Query  1161  FTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlll  982
               LV +Y+ F+ TA+ VL  K +   TF+VF TVSTF+N GFVPTNENMI+F++N GLL 
Sbjct  176   SLLVLVYVSFIKTARDVLSSKDISPLTFSVFMTVSTFANGGFVPTNENMIIFRKNSGLLW  235

Query  981   ilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAAT  802
             +LIPQ L+GNTL+P  L L IW L K T+R EF  IL +   +GY HL S R    L  T
Sbjct  236   LLIPQGLMGNTLFPCFLVLIIWGLYKITKRNEFGYILKNHKKMGYYHLLSVRVCILLGLT  295

Query  801   VFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavla  622
             V G    Q  +F   EW S+ + G++ YEK+VGSLF VVNSRHTGE+I+D+S L+PA L 
Sbjct  296   VLGFFLFQFLLFCTFEWSSEPLEGMSWYEKLVGSLFQVVNSRHTGETIVDISTLSPATLI  355

Query  621   livVMMYLPPDTTFFPIMDENNNSKTK-----GCSPKKFNIIEKILLSPLGNLSIFIILI  457
               + MM+LPP T F P+ +ENNN   +     G   K+        +S L  L I I L+
Sbjct  356   FFITMMFLPPYTLFMPLTEENNNKDEEDDSGNGNKRKR----SGFFVSQLSFLVICIFLV  411

Query  456   CITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP-EGQCKDKQFGFVGR  280
              I E E+++ DPLNFNVLNI +EVISAYGNVGF+TGYSC R++   +G CKD  +GFVGR
Sbjct  412   SIVEEEQLRRDPLNFNVLNITLEVISAYGNVGFTTGYSCKRRLDASDGVCKDASYGFVGR  471

Query  279   WSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             WS  GK ILI+VM +GR K +  K G+AW L
Sbjct  472   WSPTGKIILILVMLYGRFKHFTSKSGRAWIL  502



>ref|XP_002448492.1| hypothetical protein SORBIDRAFT_06g027900 [Sorghum bicolor]
 gb|EES12820.1| hypothetical protein SORBIDRAFT_06g027900 [Sorghum bicolor]
Length=563

 Score =   327 bits (837),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 247/502 (49%), Positives = 331/502 (66%), Gaps = 10/502 (2%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPR-PISFKLKDLDvfftavssatvssmstV  1495
             +A R+N  L+ + YF+ +S +G+  L   K R P   + + +D FFTAVS+ATVSSMS V
Sbjct  66    VAARLNSLLVHVVYFVAISCVGWGLLDALKVRAPSGRRPRGIDTFFTAVSAATVSSMSAV  125

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVI---DHVEL  1324
             EMEVFS+ QL+ +T LMF GGE F S +GL    SK+   ++++ +++ +     D +EL
Sbjct  126   EMEVFSHGQLLVLTALMFGGGEVFLSLVGLASKWSKMR--KQIMNRSRRVESHDDDDIEL  183

Query  1323  GLVTNNEYHN-DLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVA  1147
                T  E  +  +    + +++  I V   +     VR L  +VL  ++V+HVVG   VA
Sbjct  184   ETTTAAEADSRSITTAVTEENDDDIPVDAKVLRRNAVRSLFFIVLGILLVVHVVGAVAVA  243

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
              Y+   P A+Q L++K L++ TF+VFTTVSTFS+CGF+PTNENM+VF R+  L L+L+PQ
Sbjct  244   AYVYAAPGARQTLRRKALNVWTFSVFTTVSTFSSCGFMPTNENMMVFSRDVPLQLLLVPQ  303

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQIL-GSPNGLGYGHLFSGRRSGFLAATVFGL  790
              L+GNTL+P  L   +W     TRR E  +I        GY HL   RR   LA TV GL
Sbjct  304   ALVGNTLFPPLLAACVWAAAAATRREEMVEIARKGREATGYYHLLPARRCWMLAGTVGGL  363

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             I +Q+ +   +EW   A+ G++  EK+  +LF+ VNSRHTGES LDLS LA A+L L V+
Sbjct  364   IAVQVALVCGMEW-GGALRGMSAGEKLSNALFLAVNSRHTGESTLDLSTLATAILVLFVL  422

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMK  430
             MMYLPP TT+FP  +EN+         +   +++  +LS L  L+IF+I ICITER K+K
Sbjct  423   MMYLPPYTTWFPF-EENSKRGHHSTESQGIRLLKSTVLSQLSYLTIFVIAICITERRKLK  481

Query  429   EDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILI  250
             EDPLNFNVL+IVVEV+SAYGNVGFS GYSC+RQI P+G C D+  GF GRWS+ GK ILI
Sbjct  482   EDPLNFNVLSIVVEVVSAYGNVGFSMGYSCSRQINPDGLCTDRWTGFAGRWSDSGKLILI  541

Query  249   IVMFFGRLKKYHMKGGKAWKLS  184
              VMFFGRLKK+ MKGGKAWKLS
Sbjct  542   AVMFFGRLKKFSMKGGKAWKLS  563



>gb|ABK30935.1| potassium transporter [Eutrema halophilum]
 dbj|BAJ34563.1| unnamed protein product [Thellungiella halophila]
Length=500

 Score =   325 bits (832),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 229/474 (48%), Positives = 309/474 (65%), Gaps = 24/474 (5%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K+SKPR  S +  DLD+FFT+VS+ TVSSMST++MEVFSN QL+ +T LMFLGGE FTS+
Sbjct  41    KISKPRTTS-RPHDLDLFFTSVSAITVSSMSTIDMEVFSNTQLIIITILMFLGGEIFTSF  99

Query  1413  LGL---HFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVV  1243
             + L   HF   K+         ++ I     +L  VTN   H  L+ + + +++  +  V
Sbjct  100   VNLYFSHFINFKIKHLVGSFNFDRPINDPGSDLENVTN---HVKLSSQINERASKCLYSV  156

Query  1242  EDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavftt  1063
                 +LG + V            ++ G TL+ +Y+ FV TA+ VL  K +   TF+VFT 
Sbjct  157   ----VLGYLFV-----------TNIAGSTLLLLYVNFVKTARDVLSSKKISPLTFSVFTA  201

Query  1062  vstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF  883
             VST S+CGFVPTNENMI+F++N GLL +LIPQ+ +G+TL+P  L LAIW L K T R E 
Sbjct  202   VSTLSDCGFVPTNENMIIFRKNSGLLWLLIPQVFMGDTLFPCFLVLAIWGLHKITNREEL  261

Query  882   RQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVG  703
               IL +   +GY HL S R    LA TV GL+ +Q  +F   EW S+++ G+  YEK+VG
Sbjct  262   GYILKNHKKMGYSHLLSVRLCVLLALTVLGLVMIQFLLFCTFEWNSESLEGMNSYEKLVG  321

Query  702   SLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKK  523
             SLF VVNSRHTGE+++DLS L+PA+L L ++MMYLPP T F P+  E N  + +  S  +
Sbjct  322   SLFQVVNSRHTGETVVDLSTLSPAILVLFILMMYLPPYTLFMPLTVEKNKKEGEHDSGDE  381

Query  522   FNIIEK-ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGY  346
                 +    +S L  L+I I LI  TE +K++ DPLNFN+LNI  EVISAYGNVGF+TGY
Sbjct  382   IKGKKNGFYVSQLTFLAICIFLISTTESQKLRRDPLNFNILNITFEVISAYGNVGFTTGY  441

Query  345   SCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             SC R++   +G CKD  +GF GRWS +GKFILIIVMF+G+ K++  K G+AW L
Sbjct  442   SCERRLDISDGSCKDASYGFAGRWSPVGKFILIIVMFYGKFKQFSAKSGRAWIL  495



>dbj|BAE44386.1| high-affinity potassium transporter [Phragmites australis]
Length=556

 Score =   325 bits (834),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 219/506 (43%), Positives = 317/506 (63%), Gaps = 17/506 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  ++PF ++LSYF+V+ L+G   L   KP    F  + +D+ F +  + TVS +ST
Sbjct  58    RFVASHLHPFFIQLSYFLVIDLLGSVLLISLKPNNPDFSPRYVDMLFLSTPALTVSGLST  117

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVI-------VI  1339
             V+ME  S+ Q+V +T LMF+GGE F S+LGL    +  +        N+V         I
Sbjct  118   VKMEDLSSTQIVVLTLLMFVGGEVFVSFLGLMLRPNHQAKQTDPAGNNRVSSVAAELETI  177

Query  1338  DHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGF  1159
             D V   +    +   +++   S  SN       D+K    VR L  VV  Y+ VIHV+GF
Sbjct  178   DTVSAIICEELQLEEEMHATPSLSSN-------DLKKSRSVRYLGFVVFGYLAVIHVLGF  230

Query  1158  TLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGllli  979
              LV +YI  VPTA+ VL +KG+++  F+V  TVS+F+N G VPTNENM +F +N GLL +
Sbjct  231   LLVFLYITHVPTARAVLTKKGINVALFSVSVTVSSFANGGLVPTNENMAIFSKNAGLLPL  290

Query  978   lipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATV  799
             L  Q+L GNTL+P  LRL IWFLG+ T+      ++ +P  L + HL     + FL++TV
Sbjct  291   LTGQVLAGNTLFPLFLRLLIWFLGRVTKLKGLELMIRNPKELRFRHLLPKLLTAFLSSTV  350

Query  798   FGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
              GL  L + +F A++W S    GL+ Y+K++ +LF+ VN+RH GE+ +D SL++PAVL L
Sbjct  351   VGLAALAVVLFSAIDWNSLVFDGLSSYQKIINALFMAVNTRHAGENSIDCSLISPAVLVL  410

Query  618   ivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
             ++VMMYLP  TTF P  + ++ +K     PK+ ++++ +  S LG   IF++++CITER 
Sbjct  411   LIVMMYLPSSTTFAP-PNRDDKTKDDKVVPKRRSLVQNLAFSQLGCNIIFVMVVCITERR  469

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMG  265
             +++ DPLNF+ LN++ EVISAYGN G STGYSC+R  Q+ PE  C DK + F G WSN G
Sbjct  470   RLRNDPLNFSTLNMIFEVISAYGNAGLSTGYSCSRLQQLHPESICHDKPYSFSGWWSNEG  529

Query  264   KFILIIVMFFGRLKKYHMKGGKAWKL  187
             K +LI VM +GRLK + M  GK+WKL
Sbjct  530   KLMLIFVMLYGRLKAFTMGTGKSWKL  555



>ref|XP_003570995.1| PREDICTED: probable cation transporter HKT6 isoform X1 [Brachypodium 
distachyon]
Length=519

 Score =   324 bits (831),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 222/502 (44%), Positives = 321/502 (64%), Gaps = 23/502 (5%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEV  1483
             + NP  ++L+YF ++S  G+ ALKV K +  S  +KDLD+ FT+VS++TVSSM+TVEME 
Sbjct  30    QTNPLFIQLTYFTLISFAGYEALKVLKSQDKSNTMKDLDLLFTSVSASTVSSMATVEMED  89

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNE  1303
             FS+ QL  +  LM +G E FTS LGLHF + K +T +     NK     HV++  +  N 
Sbjct  90    FSSTQLWILAILMLIGSEVFTSILGLHFMRVKFNTEK---PANKSDRSSHVDIESI--NA  144

Query  1302  YHNDLNPEDSAKSNVQIEVV----------EDIKLLGCVRVLARvvlsyivvihvVGFTL  1153
              + D +P    +  V    +          + IK LG V V+A     Y+++ ++    L
Sbjct  145   ANFDPSPSQGTEVTVPSSQLCLANKEHVDPKTIKFLGTV-VMA-----YLLITNLGSLLL  198

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             + +Y+  VP A++VLK+KG+    F+VFT +S+ +NCGF P NENM++F++N  LLL++I
Sbjct  199   IYIYLKLVPDAQEVLKRKGIGNFLFSVFTAISSVANCGFTPVNENMVIFQKNSILLLLII  258

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
             PQIL GNTL+  CLR  +W   K T + E   IL  P  +G  HL S R+  +L  TV  
Sbjct  259   PQILAGNTLFAPCLRYMVWTFKKITGKEECHFILQHPKAIGCRHLMSTRKCVYLVVTVVS  318

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
              I LQ  +F +LEW S+A+  ++ YEK+VG+LF   N+RH GES++DLS ++ A+  L  
Sbjct  319   FIILQTILFCSLEWSSEALQEMSSYEKIVGALFQSTNARHAGESVVDLSSVSSAITVLYT  378

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKM  433
             VMMYLP  T+F    ++  +   +  + ++  +++  + S L  L+IF++LICITERE M
Sbjct  379   VMMYLPGYTSFLHNYEDPYSKARERDNSRR--LLKDWVFSQLSYLAIFLMLICITEREAM  436

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFIL  253
               DPLNFNV +I+ E++SAYGNVGFS GYSC R +K +  CKD  +GFVG+WS+ GK IL
Sbjct  437   TTDPLNFNVFSILFEIVSAYGNVGFSVGYSCKRLLKHDVYCKDASYGFVGKWSDKGKLIL  496

Query  252   IIVMFFGRLKKYHMKGGKAWKL  187
             I+VM FGRLK +++KGG AWKL
Sbjct  497   IVVMVFGRLKTFNLKGGSAWKL  518



>ref|XP_004968907.1| PREDICTED: cation transporter HKT8-like isoform X1 [Setaria italica]
Length=537

 Score =   324 bits (830),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 244/538 (45%), Positives = 336/538 (62%), Gaps = 64/538 (12%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLDvfftavssatvs  1510
             L F V+PF ++L YF+ +SL GF  LK       + P P       LD+ FT+VS+ TVS
Sbjct  20    LLFHVHPFWIQLVYFLSISLFGFMMLKALPMKTSAVPTP-----SGLDLIFTSVSATTVS  74

Query  1509  smstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHV  1330
             SM  VEME FSN QL+ +T LM LGGE FTS LGLHF  +K+        K +   I H 
Sbjct  75    SMVAVEMESFSNSQLLLVTLLMLLGGEVFTSMLGLHFTYTKL--------KKRETQIPHD  126

Query  1329  ELGLVTNNEYHNDLNPEDSAKSNVQ------------IEVVE-------DIKLLGCVRVL  1207
               G        N+ +P  S    ++            +E +E       D   +   R+L
Sbjct  127   LDG--------NNGSPPPSPSLELRTMGGGAPAAVAALEQMETRFKNNLDFTSIARTRML  178

Query  1206  ARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPT  1027
               VVL Y VV+H+ G+TL+ +Y+  V  A++VL  K ++ +TF++FT VSTF+NCGFVPT
Sbjct  179   MFVVLGYHVVVHLAGYTLMLIYLSAVTGAREVLIGKKINPSTFSIFTVVSTFANCGFVPT  238

Query  1026  NENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQIL--------  871
             NE M+ FK  PG+LL+ +P +LLGNTL+P  LRL+I  L + TRR +  ++L        
Sbjct  239   NEGMVSFKSYPGMLLLAMPHVLLGNTLFPVFLRLSIGALERVTRRRDLGELLVSGGGGGG  298

Query  870   ----GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVG  703
                  + + +GY HL    R+  LA TV  L+  QL +F A+EW SD + GLT  +K+V 
Sbjct  299   PGRAAATSTIGYDHLLPAARTWHLAFTVAALVAAQLVLFCAMEWGSDGLRGLTASQKLVA  358

Query  702   SLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKK  523
             +LF+ VNSRH+GE  +DL+ ++ AV+ L VVMMYLPP TTF P+  E+++   +  S +K
Sbjct  359   ALFMSVNSRHSGEMAVDLAAVSSAVVVLYVVMMYLPPYTTFLPVPVEDDHQHREAQSDEK  418

Query  522   F------NIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVG  361
                    NI +K+L+SPL  L+IFII+ICITE+ ++ +DP+NF+V NIVVE+ISAYGNVG
Sbjct  419   SKTTTSKNIWQKLLMSPLSCLAIFIIVICITEQRQIADDPINFSVRNIVVEIISAYGNVG  478

Query  360   FSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             FSTGYSC RQ+KP+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ M GG+AW+L
Sbjct  479   FSTGYSCGRQVKPDGSCRDAWVGFSGKWSREGKLTLMAVMFYGRLKKFSMHGGQAWRL  536



>gb|ABK41858.1| putative sodium transporter HKT7-A1 [Triticum monococcum]
Length=563

 Score =   324 bits (830),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 233/508 (46%), Positives = 322/508 (63%), Gaps = 12/508 (2%)
 Frame = -1

Query  1674  RLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPI---SFKLKDLDvfftavssatvssm  1504
             R   R    L+ ++YF+ +S +G+  L   + R     + + + +D+FFTAVS+ATVSSM
Sbjct  57    RFWRRFGSLLVHVAYFLAVSWLGYLLLAQLRFRAGGDGTRRPRGIDLFFTAVSAATVSSM  116

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK-----VSTTERVLEKNKVIVI  1339
             STVEMEVFSN QLV +T LMF+GGE F S LGL    SK     V  + R ++ + V  +
Sbjct  117   STVEMEVFSNGQLVVLTVLMFVGGEVFLSLLGLASKWSKLRKQTVHKSSRRVDSHDVPEL  176

Query  1338  DHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL--GCVRVLARvvlsyivvihvV  1165
             +   +   T  +    +      + +  ++  +D +L     + +   V+   + V  + 
Sbjct  177   EMPPVDAATELDNPTSMTSTVDDEMSKPLDHFDDTRLRRDAVLSLFFVVLAILLAVHVLG  236

Query  1164  GFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGll  985
                +VA  +   P A++ L+ K L++ TFAVFTTVSTFS+CG++PTNENMIVFKR+ GL 
Sbjct  237   SGAIVAYVLHASPAARRTLRDKALNVWTFAVFTTVSTFSSCGYMPTNENMIVFKRDTGLQ  296

Query  984   lilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGL-GYGHLFSGRRSGFLA  808
             L+L+PQ L+GNTL+P  L   +      TRR+E ++       L GY HL   RR   LA
Sbjct  297   LLLVPQALVGNTLFPPLLAACVRVAAAATRRVELKETAKKGRELTGYYHLLPARRCAMLA  356

Query  807   ATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapav  628
             ATV G + +Q  +   +EW   A+ G++ +EKV  ++F+ VNSRHTGES LDL  LAPA+
Sbjct  357   ATVVGFLGVQAAMLCGMEW-GGALRGMSAWEKVSNAVFLAVNSRHTGESTLDLFTLAPAI  415

Query  627   lalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICIT  448
             L L V+MMYLPP TT+FP  + +          +   +++  LLS L  L+IF+I ICIT
Sbjct  416   LVLFVLMMYLPPYTTWFPFEESSGVKDQPREETQGVRLLKSTLLSQLSYLAIFVIAICIT  475

Query  447   EREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNM  268
             EREK+KEDPLNF++L+I+VEV+SAYGNVGFS GYSC+RQI P+G C D+  GF GRWS+ 
Sbjct  476   EREKLKEDPLNFSLLSILVEVVSAYGNVGFSMGYSCSRQIGPDGMCTDRWTGFAGRWSDS  535

Query  267   GKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             GK ILI+VM FGRLKK+ MK GKAWKLS
Sbjct  536   GKLILILVMLFGRLKKFSMKAGKAWKLS  563



>dbj|BAE44385.1| high-affinity potassium transporter [Phragmites australis]
Length=530

 Score =   323 bits (827),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 220/506 (43%), Positives = 316/506 (62%), Gaps = 17/506 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  ++PF ++LSYF+V+ L+G   L   KP    F  + +D+ F + S+ TVS +ST
Sbjct  32    RFVASHLHPFFIQLSYFLVIDLLGSVLLISLKPNNPDFSPRYVDMLFLSTSALTVSGLST  91

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVI-------VI  1339
             V+ME  S+ Q+V +T LMF+GGE F S+LGL    +  +        NKV         I
Sbjct  92    VKMEDLSSTQIVVLTLLMFVGGEVFVSFLGLMLRPNHQAKPTDPAGNNKVSSIAVELETI  151

Query  1338  DHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGF  1159
             D     +    +   +++   S  SN       D+K    VR L  VV  Y+ VIHV+GF
Sbjct  152   DTASAIICEELQLEEEMHATPSLSSN-------DLKKSKSVRYLGFVVFGYLAVIHVLGF  204

Query  1158  TLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGllli  979
              LV +YI  VPTA+ VL +KG+++  F+V  TVS+F+N G VPTNENM +F +N GLLL+
Sbjct  205   LLVFLYITHVPTARAVLTKKGINVALFSVSVTVSSFANGGLVPTNENMAIFSKNAGLLLL  264

Query  978   lipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATV  799
             L  Q+L GNTL+P  LRL IWFLG+ T+      ++ +P  L + HL     + FL++TV
Sbjct  265   LTGQVLAGNTLFPLFLRLLIWFLGRVTKLEGLELMIRNPKELRFRHLLPKLLTAFLSSTV  324

Query  798   FGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
              GL  L + +F  ++W S    GL+ Y+K++ +LF+ VN+RH GE+ +D SL++PAVL L
Sbjct  325   VGLAALAVVLFSVIDWNSLVFDGLSSYQKIINALFMAVNTRHAGENSIDCSLISPAVLVL  384

Query  618   ivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
             ++VMMYLP  TTF P  + ++  K     PK+ ++++ +  S LG   IF++++CITER 
Sbjct  385   LIVMMYLPSSTTFAP-PNRDDKRKDDKVVPKRRSLVQNLAFSQLGCNIIFVMVVCITERR  443

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMG  265
             +++ DPLNF+ LN++ EVISAYGN G STGYSC+R  Q+ PE  C DK + F G WSN G
Sbjct  444   RLRNDPLNFSTLNMIFEVISAYGNAGLSTGYSCSRLQQLHPESICHDKPYSFSGWWSNEG  503

Query  264   KFILIIVMFFGRLKKYHMKGGKAWKL  187
             K +LI VM +GRLK + M  GK+WKL
Sbjct  504   KLMLIFVMLYGRLKAFTMGTGKSWKL  529



>ref|XP_002457736.1| hypothetical protein SORBIDRAFT_03g012590 [Sorghum bicolor]
 gb|EES02856.1| hypothetical protein SORBIDRAFT_03g012590 [Sorghum bicolor]
Length=498

 Score =   320 bits (819),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 233/514 (45%), Positives = 321/514 (62%), Gaps = 64/514 (12%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
              +S PRP       LD+ FT+VS+ TVSSM  VEME FSN QL+ MT LM LGGE FTS 
Sbjct  3     SISVPRP-----SALDLVFTSVSATTVSSMVAVEMESFSNSQLLLMTLLMLLGGEVFTSM  57

Query  1413  LGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLN-PEDSAKSN--------  1261
             LGLHF  +K      +   N              NN  H ++N P  +A S+        
Sbjct  58    LGLHFTFTKFIKKREIPHSN--------------NNSLHGNINGPAPAAPSSLEHGHRRR  103

Query  1260  ----------VQIEVV----EDIKLLGCV-RVLARvvlsyivvihvVGFTLVAMYIGFVP  1126
                       VQ+E+     +D +    + R+L  +VL Y+ V+H+ G+TL+ +Y+  V 
Sbjct  104   PMEMEAQAAAVQMELAGFNNDDQRDFASIARLLMFIVLGYLSVVHLAGYTLILIYLSVVG  163

Query  1125  TAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTL  946
             +A++VL  K + L+TF+VFT VSTF+NCGFVPTNE M  FK  PG+LL+++P ILLGNTL
Sbjct  164   SAREVLVGKRISLSTFSVFTVVSTFANCGFVPTNEGMASFKSFPGMLLLVMPHILLGNTL  223

Query  945   YPACLRLAIWFLGKTTRRIEFRQIL--------------GSPNGLGYGHLFSGRRSGFLA  808
             +P  LRL+I  L + TRR + R++L               +   +GY HL  G R+  LA
Sbjct  224   FPVFLRLSITALERVTRRGDLRELLRDGGPGGGGGGGGGPAAAAIGYDHLLPGGRTWCLA  283

Query  807   ATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapav  628
              TV   +  QL ++ A+EW SD + GLT ++K+V +LF+ VNSRH+GE ++DL+ ++ A+
Sbjct  284   LTVAVFLAGQLLLYCAMEWGSDGLRGLTAFQKLVAALFMSVNSRHSGEMVVDLATVSSAI  343

Query  627   lalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNII-------EKILLSPLGNLSIF  469
             + L V+MMYLPP TTF PI  E++  +         +         +K+L+SPL  L+IF
Sbjct  344   VVLYVLMMYLPPYTTFLPIAMEDHQQQQNEAQSDDKSKSSSSISIWQKLLMSPLSCLTIF  403

Query  468   IILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGF  289
             I++ICITER ++ +DP+NF+VLNIVVEVISAYGNVGFSTGYSC+RQ+ P+G C+D   GF
Sbjct  404   IVVICITERRQIADDPINFSVLNIVVEVISAYGNVGFSTGYSCSRQVTPDGSCRDAWVGF  463

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              G+WS  GK  L+ VMF+GRLKK+ M GG+AWKL
Sbjct  464   SGKWSREGKLTLMAVMFYGRLKKFSMHGGQAWKL  497



>gb|EMT13934.1| Putative cation transporter HKT6 [Aegilops tauschii]
Length=452

 Score =   318 bits (814),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 199/451 (44%), Positives = 286/451 (63%), Gaps = 19/451 (4%)
 Frame = -1

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV  1315
             EME FS+ QL  +  LM +G E FTS LGLHF ++K +    +  ++ +  ID +E   V
Sbjct  5     EMEEFSSKQLWVLAILMLIGSEVFTSVLGLHFMRAKFNKENSLNTRDHISHID-IESINV  63

Query  1314  TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTL-VAMYI  1138
              N + +     +D A S  +I +     +     VL    ++  ++I  +G +L + +Y+
Sbjct  64    ANFDPNTSHGTKD-AVSFSEIRLANKQHVDPKTTVLLGTAVTVYLLITNLGSSLLIYLYL  122

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VP A++VLK+KG+ L  F+VFT +S+ +NCGF P NENM++F++N GLLL++IPQ+L+
Sbjct  123   KLVPDAQEVLKRKGVGLFLFSVFTAISSVANCGFTPVNENMVIFQKNSGLLLLIIPQMLV  182

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GNTL+  CLR  +W L K T + E+  IL   N +GY HL S R+   L  TV G I LQ
Sbjct  183   GNTLFAPCLRFMVWSLQKITGKQEWCYILEHANAIGYRHLMSTRKCACLILTVVGFIILQ  242

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
               +F ALEW S+A+  ++ Y+K+VG+LF   N+RH GE+I+DLS ++ A++ L +VMMYL
Sbjct  243   TILFCALEWSSEALQEMSSYQKIVGALFQSTNARHAGETIVDLSSISSAIIVLYIVMMYL  302

Query  597   PPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPL  418
             P  T+ F   D+  +   K  + K   ++E  +LS L  L+IF++LICITERE +  DPL
Sbjct  303   PGYTSIFTNYDDRYSKDEKRYNRK--GLLEDWILSQLSYLAIFVMLICITEREALTTDPL  360

Query  417   NFNVLNIVVEVI--------------SAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGR  280
             NFNV +++ E++               AYGNVGFS GYSC R +K +  CKD  +GFVG+
Sbjct  361   NFNVFSLLFEIVRQVTEIHYILKRNSCAYGNVGFSMGYSCKRLLKQDLHCKDASYGFVGK  420

Query  279   WSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             WS+ GK ILIIVM FGRLK Y++KGGKAWKL
Sbjct  421   WSDEGKMILIIVMVFGRLKGYNLKGGKAWKL  451



>gb|EMT29177.1| Cation transporter HKT8 [Aegilops tauschii]
Length=433

 Score =   317 bits (812),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 220/444 (50%), Positives = 288/444 (65%), Gaps = 21/444 (5%)
 Frame = -1

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL-------EKNKVIVIDH  1333
             ME FSN QL+ +T LM LGGE FTS LGLHF   K    E          +K K      
Sbjct  1     MESFSNPQLLLLTLLMLLGGEVFTSMLGLHFTYVKSKKKEAQAPHDHDDGDKGKPAPSSS  60

Query  1332  VELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTL  1153
             +EL + T       ++  D  +   + +   D   L   R+L  +VL Y VV+H+ G++L
Sbjct  61    LELAVTTG------MDDVDRVEQGFKDQPRYDRAFL--TRLLLFIVLGYHVVVHLAGYSL  112

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             + +Y+  V  A+ VL  KG+ L TF+VFT VSTF+NCGFVP NE MI F+  PGLLL+++
Sbjct  113   MLVYLSVVSGARAVLTGKGISLHTFSVFTVVSTFANCGFVPNNEGMIAFRSFPGLLLLVM  172

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
             P ILLGNTL+P  LRLAIW L + TRR E    LG    +GY HL + R + FLA TV  
Sbjct  173   PHILLGNTLFPVFLRLAIWALRRVTRRPE----LGELRSIGYDHLLTSRHTWFLAFTVAA  228

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
              +  QL +F A+EW S+ + GLT  +K+V  LF+ VNSRHTGE ++DLS ++ AV+ L V
Sbjct  229   FVLAQLLLFCAMEWGSNGLRGLTAVQKLVAGLFMSVNSRHTGEMVVDLSTVSSAVVVLYV  288

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKK--FNIIEKILLSPLGNLSIFIILICITERE  439
             VMMYLPP TTF P+ D+++         +K   +I  K+L+SPL  L+IFI ++CITER 
Sbjct  289   VMMYLPPYTTFLPVEDDSDQQVGADQRDQKRITSIWRKLLMSPLSCLAIFIAVVCITERR  348

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKF  259
             ++ +DPLNFNVLNI VEVISAYGNVGFSTGYSC RQ+ P+G C+D   GF G+WS  GK 
Sbjct  349   QISDDPLNFNVLNITVEVISAYGNVGFSTGYSCGRQVTPDGGCRDTWVGFSGKWSWQGKL  408

Query  258   ILIIVMFFGRLKKYHMKGGKAWKL  187
              LI VMF+GRLKK+ M GG+AW++
Sbjct  409   ALIAVMFYGRLKKFSMHGGEAWRI  432



>gb|AID46989.1| putative Na+/K+ transporter [Triticum aestivum]
Length=531

 Score =   320 bits (819),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 211/506 (42%), Positives = 324/506 (64%), Gaps = 8/506 (2%)
 Frame = -1

Query  1692  MMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatv  1513
             M+   R +A  V+PF ++LSYF+ ++++G   L   KP    F    +D+ + + S+ TV
Sbjct  30    MVFIYRFVALHVHPFWIQLSYFLAMAILGSVLLMSLKPSNPEFCPPYIDMLYLSTSALTV  89

Query  1512  ssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH  1333
             S +STV+ME  S+ Q+V +T LM +GGE F S LGL    +     +    K   + ++ 
Sbjct  90    SGLSTVKMEDLSSSQIVVLTLLMLVGGEIFVSLLGLMLRVNHQDMQDLPSVKISSVPVEL  149

Query  1332  VELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTL  1153
               L L  +    ++   E++A + +  +   ++K    V+    V+  Y  VIHV+GF L
Sbjct  150   EVLDLANSMALCDESQLEEAAHA-IPPKKCTELKRTESVKCFGHVIFGYFAVIHVLGFLL  208

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V +YI  VPTA   L +KG+++  F++  TVS+F+N G VPTNENM++F +N GLLL+L 
Sbjct  209   VFLYITHVPTASAPLNKKGINIVLFSLSVTVSSFANAGLVPTNENMVIFSKNSGLLLLLS  268

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
              Q+L GNTL+P  LRL +WFLGK T+  E R ++ +P  + + +L  G R+ FL++TV G
Sbjct  269   GQMLAGNTLFPLFLRLLVWFLGKLTKVKELRLMIKNPEEVHFANLLPGLRTVFLSSTVVG  328

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
             L    +T+F A++W S    GL+ Y+K V + F+VVN+RH+GE+ +D SL++PA++ L +
Sbjct  329   LAAAGVTLFCAVDWNSSVFDGLSSYQKTVNAFFMVVNARHSGENSIDCSLMSPAIIVLFI  388

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSP--KKFNIIEKILLSPLGNLSIFIILICITERE  439
             +MMYLP   TF P    N ++KT   S   K+ ++++ ++ SPLG   IF+I+ CITER 
Sbjct  389   IMMYLPSSATFAP---PNGDTKTTDASTKGKRGSLVQNLVFSPLGCNIIFVIVACITERR  445

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMG  265
             +++ DPLNF+ LN++ EVISAYGNVG STGYSC+R  Q+ PE  C+DK + F G WS+ G
Sbjct  446   RLRNDPLNFSTLNMIFEVISAYGNVGLSTGYSCSRLHQLHPEIICQDKPYSFSGWWSDGG  505

Query  264   KFILIIVMFFGRLKKYHMKGGKAWKL  187
             KF+L++VM +GRLK + +  GK+WK+
Sbjct  506   KFLLVLVMLYGRLKAFAVSTGKSWKV  531



>ref|XP_008801453.1| PREDICTED: cation transporter HKT1-like [Phoenix dactylifera]
Length=515

 Score =   319 bits (818),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 221/514 (43%), Positives = 324/514 (63%), Gaps = 12/514 (2%)
 Frame = -1

Query  1719  ISLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvf  1540
             I+ R+ H +M       A  ++PF ++LSYF+ L+L+G   L + KP   +F  + +D+ 
Sbjct  10    INSRHVHQIM-------ALHLSPFWIQLSYFVSLALLGSLVLMILKPSNPAFSPRYVDML  62

Query  1539  ftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLE  1360
             F + S+ T+SS+S+VEME FS+ Q+  +T  MFLGGE F S LGL   +          +
Sbjct  63    FMSTSAVTLSSLSSVEMENFSSSQIAVLTLWMFLGGEVFVSLLGLLLRKDDRYGDPGTAD  122

Query  1359  KNKVIVID-HVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyi  1183
                  V+D  +E    +N     +L P     S+  +   +D++L   V  L  VV+ Y+
Sbjct  123   NRVDPVVDAELESTDPSNAVDRMELGPA-VIGSDASLSDGKDLRL-RSVTYLGYVVMVYL  180

Query  1182  vvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFK  1003
             ++IHV G   + +Y+  V +A+ VLK+KG+ +  F++ TTVS+F+N GF+PTNENM +FK
Sbjct  181   LLIHVAGSLSILLYMASVSSARDVLKRKGIHVFLFSLSTTVSSFANAGFIPTNENMAIFK  240

Query  1002  RNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRR  823
              NPGLLL++IPQIL GNTL+P  L L IW L + +   EF  +L +   + + HL    R
Sbjct  241   TNPGLLLLIIPQILAGNTLFPLFLGLVIWALMRLSGAAEFEYLLKNSREIRFRHLLPKLR  300

Query  822   SGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsl  643
             + FL+ TV   I   + +F +L+W S    GL  Y+K+V +LF+ VN+RH GE+ +D+SL
Sbjct  301   TAFLSLTVLSFIAAMVVLFCSLDWSSAVFDGLNPYQKIVSALFMAVNTRHAGENSIDVSL  360

Query  642   lapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFII  463
             ++PAVL L +VMMYLP  TTF PI +++ +S     S +K  +++ ++LSPL  + IF+I
Sbjct  361   VSPAVLVLFIVMMYLPSSTTFLPIQEDDTSSVGNKKSKRKRWLVQNLILSPLSYIVIFVI  420

Query  462   LICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGF  289
              I I ER K+  DPLNF++LNI  EV+SAYG VG STGYSCAR  Q+ P+ +C+DK + F
Sbjct  421   AISIIERRKLSRDPLNFSILNISFEVMSAYGTVGLSTGYSCARLLQLHPDVKCQDKLYSF  480

Query  288   VGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             VG WS+ GK IL  VM +GRLKK+   GGKAWK+
Sbjct  481   VGAWSDEGKLILAFVMLYGRLKKFSWGGGKAWKI  514



>ref|XP_004150748.1| PREDICTED: cation transporter HKT8-like, partial [Cucumis sativus]
Length=473

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 236/507 (47%), Positives = 322/507 (64%), Gaps = 55/507 (11%)
 Frame = -1

Query  1659  VNPFLLELSYFIVLSLIGFFALKVSKPRPISF-KLKDLDvfftavssatvssmstVEMEV  1483
             +NPF ++  YFI +S  GF  L + KP+   F +   LD+F+T+VS++TVSSMS++EMEV
Sbjct  5     INPFWIQFFYFIFISSFGFLILMILKPKTYPFFQPTKLDLFYTSVSASTVSSMSSIEMEV  64

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNE  1303
             FSN QL+ +T LMF+GGE FTS +GLH          R+ +KN                 
Sbjct  65    FSNSQLIVLTVLMFIGGEIFTSMVGLHL--------RRLFKKN-----------------  99

Query  1302  YHNDLNPEDSAKSNVQI-EVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVP  1126
                           +QI   +E    L  ++ L  VVL Y+++ H+VG  ++ +Y  F+ 
Sbjct  100   --------------LQIPTTLEGFDSLSLIKFLGFVVLGYLLITHIVGIGMIVVYFLFIS  145

Query  1125  T-AKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNT  949
             + AK++L +KG++L TF+ FT VST ++CGFVPTNENMIVF +N GLLLILIPQIL+GNT
Sbjct  146   SFAKEILDEKGINLVTFSFFTCVSTLASCGFVPTNENMIVFHKNSGLLLILIPQILVGNT  205

Query  948   LYPACLRLAIWFLGKTTR-------RIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             LYP+CLR  IW +GK ++       R++   +L +   +GY HL     S  L  TVFG 
Sbjct  206   LYPSCLRFCIWVIGKFSKDHHNDEHRLKVDYLLKTSEEIGYIHLLPSLHSCLLVVTVFGF  265

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             IF+Q  +  ++EW S+  +GL  Y+KVV  LF+  NSRH GE+I+++S L+ A+L + +V
Sbjct  266   IFIQFVLICSMEWDSNGFSGLNSYQKVVAILFLSTNSRHAGETIVNISSLSSAILIMFIV  325

Query  609   MMYLPPDTTFFPI------MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICIT  448
             MMYLPP T+F P+       D   + + +    KK    + +L S L  L IFI +ICI 
Sbjct  326   MMYLPPYTSFLPLNEKQELEDHFRHLQRRKVRSKKAKAWQNLLFSQLSYLIIFITIICII  385

Query  447   EREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNM  268
             ER+KM EDP+NF+VLNIV+EVISAYGNVGFSTGYSC  QI P   C DK +GF  +WSN 
Sbjct  386   ERKKMVEDPINFSVLNIVLEVISAYGNVGFSTGYSCKLQIHPPNDCVDKWYGFSAKWSNK  445

Query  267   GKFILIIVMFFGRLKKYHMKGGKAWKL  187
              K +LI+VM FGRLKK++M GGKAWKL
Sbjct  446   AKIVLILVMMFGRLKKFNMDGGKAWKL  472



>gb|EMT30073.1| Cation transporter HKT1 [Aegilops tauschii]
Length=531

 Score =   319 bits (817),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 211/506 (42%), Positives = 324/506 (64%), Gaps = 8/506 (2%)
 Frame = -1

Query  1692  MMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatv  1513
             M+   R +A  V+PF ++LSYF+ ++++G   L   KP    F    +D+ + + S+ TV
Sbjct  30    MVFIYRFVALHVHPFWIQLSYFLAMAILGSVLLMSLKPSNPEFCPPYIDMLYLSTSALTV  89

Query  1512  ssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH  1333
             S +STV+ME  S+ Q+V +T LM +GGE F S LGL    +     +    K   + ++ 
Sbjct  90    SGLSTVKMEDLSSSQIVVLTLLMLVGGEIFVSLLGLMLRVNHQDMQDLPSVKISSVPVEL  149

Query  1332  VELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTL  1153
               L L  +    ++   E++A + +  +   ++K    V+    V+  Y  VIHV+GF L
Sbjct  150   EVLDLANSMALCDESQLEEAAHA-IPPKKCTELKRTESVKCFGHVIFGYFAVIHVLGFLL  208

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V +YI  VPTA   L +KG+++  F++  TVS+F+N G VPTNENM++F +N GLLL+L 
Sbjct  209   VFLYITHVPTASAPLNKKGINIVLFSLSVTVSSFANAGLVPTNENMVIFSKNSGLLLLLS  268

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
              Q+L GNTL+P  LRL +WFLGK T+  E R ++ +P  + + +L  G R+ FL++TV G
Sbjct  269   GQMLAGNTLFPLFLRLLVWFLGKLTKVKELRLMIKNPEEVHFANLLPGLRTVFLSSTVVG  328

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
             L    +T+F A++W S    GL+ Y+K V + F+VVN+RH+GE+ +D SL++PA++ L +
Sbjct  329   LAAAGVTLFCAVDWNSSVFDGLSSYQKTVNAFFMVVNARHSGENSIDCSLMSPAIIVLFI  388

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSP--KKFNIIEKILLSPLGNLSIFIILICITERE  439
             +MMYLP   TF P    N ++KT   S   K+ ++++ ++ SPLG   IF+I+ CITER 
Sbjct  389   IMMYLPSSATFAP---PNGDTKTTDASTKGKRGSLVQNLVFSPLGCNIIFVIVACITERR  445

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMG  265
             +++ DPLNF+ LN++ EVISAYGNVG STGYSC+R  Q+ PE  C+DK + F G WS+ G
Sbjct  446   RLRNDPLNFSTLNMIFEVISAYGNVGLSTGYSCSRLHQLHPEIICQDKPYSFSGWWSDGG  505

Query  264   KFILIIVMFFGRLKKYHMKGGKAWKL  187
             KF+L++VM +GRLK + +  GK+WK+
Sbjct  506   KFLLVLVMLYGRLKAFVVSTGKSWKV  531



>ref|XP_004976741.1| PREDICTED: probable cation transporter HKT7-like [Setaria italica]
Length=564

 Score =   318 bits (816),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 249/509 (49%), Positives = 331/509 (65%), Gaps = 20/509 (4%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             +A R+N  L+ + YF+ LS  G+  L   K R      + +D+FFTAVS+ATVSSMS VE
Sbjct  63    VAARLNSLLIHVVYFVALSCAGWGLLSALKVRAPHGSPRGIDMFFTAVSAATVSSMSAVE  122

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVI--DHVELGL  1318
             MEVFSN QL+ +T LMF GGE F S +GL    SK+   +R++ +++ +    D VEL  
Sbjct  123   MEVFSNGQLLIITALMFAGGEVFISLVGLSSKWSKLR--KRIINRSQRVESHDDGVELET  180

Query  1317  -VTNNEYHNDLNPEDSAKSNVQIEVVE--------DIKLL--GCVRVLARvvlsyivvih  1171
                           D  +S++ I  V         D K+L    VR +  +VL+ ++V+H
Sbjct  181   PAAIAAEAEAAADADDERSSMTITTVTEDHTGPVVDSKMLRLNAVRSMFYIVLAILLVVH  240

Query  1170  vVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPG  991
             VVG   VA+Y+   P A+Q L++K L++ TFAVFTTVSTFS+CGF+PTNENM+VF R+  
Sbjct  241   VVGAVAVAVYMHAAPGARQTLRRKALNVWTFAVFTTVSTFSSCGFMPTNENMMVFSRDVP  300

Query  990   lllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFL  811
             L L+L+PQ L+GNTL+P  L   +W     TRR +  ++    +G     L   RR   L
Sbjct  301   LQLLLVPQALVGNTLFPPLLAACVWAAAAATRRQDLAEMARKGSG---EDLLPARRCWML  357

Query  810   AATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapa  631
             A TV   + +Q+ +  A+EW   A+ GL+  EKV  +LF+ VNSRHTGES LDLS LAPA
Sbjct  358   AGTVAWFLAVQVALVCAMEW-GGALQGLSSGEKVANALFLAVNSRHTGESTLDLSTLAPA  416

Query  630   vlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             +L L V+MMYLPP TT+FP  +EN+ ++      +    ++  +LS L  L+IF+I ICI
Sbjct  417   ILVLFVLMMYLPPYTTWFPF-EENSTTRDHSTESQGIRFLKSTVLSQLSYLTIFVIAICI  475

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSN  271
             TER K+KEDPLNFNVL+I+VEV+SAYGNVGFS GYSC+RQI P+  C D+  GF GRWS+
Sbjct  476   TERRKLKEDPLNFNVLSIIVEVVSAYGNVGFSMGYSCSRQINPDQLCTDRWTGFAGRWSD  535

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GK ILIIVMFFGRLKK+ MKGGKAWKLS
Sbjct  536   SGKLILIIVMFFGRLKKFSMKGGKAWKLS  564



>gb|AGZ93643.1| HKT1;4-2 [Triticum turgidum subsp. durum]
Length=561

 Score =   318 bits (815),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 244/508 (48%), Positives = 333/508 (66%), Gaps = 13/508 (3%)
 Frame = -1

Query  1674  RLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPI---SFKLKDLDvfftavssatvssm  1504
             RL+ R+   L+ ++YF+ +S +G+  L   + R     + +   +D+FFTAVS+ATVSSM
Sbjct  56    RLSPRLGSLLVHVAYFLAVSWLGYLVLAQLRFRAGGEGTRRPGAIDLFFTAVSAATVSSM  115

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
             STVEME FSN QL+ +T LMF+GGE F S LGL    SK+   + V +  +V + D  EL
Sbjct  116   STVEMEAFSNGQLLVLTVLMFVGGEVFLSLLGLASKWSKLRK-QAVRKSRRVEIHDVAEL  174

Query  1323  GL---VTNNEYHNDLNPEDSAKSNVQ--IEVVEDIKLL-GCVRVLARvvlsyivvihvVG  1162
              +       E+ N  +   +A   +   ++  +D +L    V  L  VVL+ ++ +HVVG
Sbjct  175   EMPPVAAAGEFDNPTSITSTADDEMSKPLDRFDDTRLRRDAVLSLFFVVLAILLTVHVVG  234

Query  1161  FTLVAMYIGFV-PTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGll  985
                VA YI    P A++ L++K L+  TFAVFTTVSTFS+CG++PTNENM VFKR+ GL 
Sbjct  235   AVAVAAYILHASPAARRTLREKALNEWTFAVFTTVSTFSSCGYMPTNENMAVFKRDTGLQ  294

Query  984   lilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGL-GYGHLFSGRRSGFLA  808
             L+L+PQ L+GNTL+P  L   +      TRR+E ++       L GY HL   RR   LA
Sbjct  295   LLLVPQALVGNTLFPPLLAACVRAAAAATRRVELKETAKEGGELTGYYHLLPARRCAMLA  354

Query  807   ATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapav  628
             ATV G + +Q  +   +EW   A++G++ +EKV  ++F+ VNSRHTGE+ LDLS LAPA+
Sbjct  355   ATVAGFVAVQAAMLCGMEW-GGALSGMSAWEKVSNAVFLAVNSRHTGETTLDLSTLAPAI  413

Query  627   lalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICIT  448
             L L V+MMYLPP TT+FP  + ++         +   +++  LLS L  L+IF+I IC+T
Sbjct  414   LVLFVLMMYLPPYTTWFPFGESSSVKDHPTEETQGVRLLKSTLLSQLSYLAIFVIAICVT  473

Query  447   EREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNM  268
             EREK+KEDPLNFN+L+IVVEV+SAYGNVGFS GYSC+RQI P+G C D+  GF GRWS+ 
Sbjct  474   EREKLKEDPLNFNLLSIVVEVVSAYGNVGFSMGYSCSRQISPDGMCTDRWTGFAGRWSDS  533

Query  267   GKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             GK ILI+VM FGRLKK+ M  GKAWKLS
Sbjct  534   GKLILILVMLFGRLKKFSMNAGKAWKLS  561



>ref|XP_008673123.1| PREDICTED: uncharacterized protein LOC100382359 isoform X1 [Zea 
mays]
Length=535

 Score =   317 bits (811),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 235/527 (45%), Positives = 331/527 (63%), Gaps = 45/527 (9%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLDvfftavssatvssm  1504
             F V+PF +++ YF+++S++GF  L+V      S PRP       LD+ FT+VS+ TVSSM
Sbjct  21    FHVHPFWIQVLYFLLISVLGFLMLRVLPMKSSSVPRP-----SALDLLFTSVSATTVSSM  75

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
               VEME FSN QL+ MT LM LGGE FTS LGLHF  +K+         N      H   
Sbjct  76    IAVEMESFSNAQLLLMTLLMLLGGEVFTSMLGLHFTCTKLRNKRETPHNNL-----HGN-  129

Query  1323  GLVTNNEYHNDLNPEDSAKSNVQIEVVEDIK-----LLGCVRVLARvvlsyivvihvVGF  1159
              L  +   H  +  E  A + VQ+E+    K          R+L  +VL YI+V+H+ G+
Sbjct  130   SLEQSRRRHRPMEMEAQAAA-VQMELAGFNKDGHGDFASMARLLMFIVLGYILVVHIAGY  188

Query  1158  TLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGllli  979
              L+ +Y+  V +A+ VL +K + L+TF+VFT VS+F+NCGFVPTNE M+ FK  PG+LL+
Sbjct  189   ALILIYLSVVGSARAVLVRKRISLSTFSVFTVVSSFANCGFVPTNEGMVSFKSFPGMLLL  248

Query  978   lipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQIL------------GSPNGLGYGHLF  835
             ++P ILLGNTL+P  LRL+I  L + TR  +  ++L             +   +GY HL 
Sbjct  249   VMPHILLGNTLFPIFLRLSITALERVTRWRDLCELLRDRGPGGGPAAAAAAAAIGYDHLL  308

Query  834   SGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIl  655
              G R+ FLA TV   + +QL ++ A+EW S  + GL  ++K+V ++F+ VNSRH+GE ++
Sbjct  309   PGPRTWFLALTVAVFLAVQLVLYCAMEWGSGGLGGLNAFQKLVAAVFMSVNSRHSGEMVV  368

Query  654   dlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKK---------FNIIEKI  502
             DL+ ++ AV+ L V+MMYLPP TTF P+  E++  +     P            +I   +
Sbjct  369   DLATVSSAVVVLYVLMMYLPPYTTFLPVAVEDDQQQQNEAQPHDNSTSKSSTSISIWHNL  428

Query  501   LLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKP  322
             L+SPL  L+IFI++ICITER ++  DP+NF+VLNIVVEVISAYGNVGFSTGYSC+RQ+ P
Sbjct  429   LMSPLSCLTIFIVVICITERRQIARDPINFSVLNIVVEVISAYGNVGFSTGYSCSRQVTP  488

Query  321   EGQ-CKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              G  CKD      G+WS  GK  L+ +MF+GRLKK+ M GG+AW+L+
Sbjct  489   GGGCCKDAWVSLSGKWSVEGKLTLMAIMFYGRLKKFSMLGGQAWRLN  535



>ref|XP_010240387.1| PREDICTED: cation transporter HKT4-like [Brachypodium distachyon]
Length=585

 Score =   317 bits (813),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 215/494 (44%), Positives = 312/494 (63%), Gaps = 7/494 (1%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKP--RPISFKLKDLDvfftavssatvssmst  1498
             L F+ NP ++++ YF++L L GF ALK  KP  +P +   ++LD+ FT+VS+ TVSSM+T
Sbjct  95    LLFQSNPLIVQIIYFMLLPLAGFLALKNLKPLNKPTT---RNLDLMFTSVSTVTVSSMAT  151

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             VEME FS  QL  +  LM  GG+ FT  LGLH   ++ +T + + +++  I  D +E   
Sbjct  152   VEMEDFSGQQLWILIILMLFGGDMFTKMLGLHLKNARGNTGDTLPKRSSFISRD-IETCD  210

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKL-LGCVRVLARvvlsyivvihvVGFTLVAMY  1141
             V NN   N++    S  +    +V E   L L    +LA VV  Y +   V G  ++ +Y
Sbjct  211   VFNNNSQNNMEAIQSEATIPHNKVQESKGLNLNSCNILAHVVTGYFIAAIVCGSVVITIY  270

Query  1140  IGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqil  961
             +     A+Q+LK K + + TF+VFT VS+F+NCGF P N+NM +F+ NP LLL++ PQIL
Sbjct  271   LLIDSDARQLLKSKDIKICTFSVFTAVSSFANCGFTPVNDNMAIFRNNPTLLLLVTPQIL  330

Query  960   LGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFL  781
             +GNTL+P  LRL+IW LGK +RR E+  IL  P  +GY HL   + S  L  T   +I L
Sbjct  331   IGNTLFPPLLRLSIWALGKVSRREEYAYILQHPKEIGYRHLRPYKNSVHLVLTGVLIILL  390

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
             Q       EW S A+ G+  ++K+VGSLF   NSRH GE+++++S L+P +L +  V+MY
Sbjct  391   QAIFLCYFEWDSKALEGMKWFQKLVGSLFQSANSRHAGETVINISTLSPPILVIFAVVMY  450

Query  600   LPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDP  421
             LP DT+FFP   + +    K  +P    + +K +++    L+I  IL CITER+ M  DP
Sbjct  451   LPSDTSFFPTYGDRHILTNKKENPNSRAMWKKFIITKPACLAILTILACITERKSMSADP  510

Query  420   LNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVM  241
             LNF++ ++V EVISAYGNVG+S GYSC + +KP+ +CKD  +GFVGRW++ GK I+I+VM
Sbjct  511   LNFSIFSVVFEVISAYGNVGYSLGYSCDKLLKPDPRCKDFSYGFVGRWTDKGKVIIIVVM  570

Query  240   FFGRLKKYHMKGGK  199
             F GR K + + G K
Sbjct  571   FLGRFKTFTLNGRK  584



>ref|XP_006397079.1| hypothetical protein EUTSA_v10028594mg [Eutrema salsugineum]
 gb|ESQ38532.1| hypothetical protein EUTSA_v10028594mg [Eutrema salsugineum]
Length=505

 Score =   314 bits (805),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 226/486 (47%), Positives = 309/486 (64%), Gaps = 29/486 (6%)
 Frame = -1

Query  1614  LIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLG  1435
             ++GF ALK+SKPR  S +  DLD+FFT+VS+ TVSSMSTV+MEVFSN QL+ +T LMFLG
Sbjct  34    VLGFLALKISKPRTTS-RPHDLDIFFTSVSAITVSSMSTVDMEVFSNTQLIIITILMFLG  92

Query  1434  GECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLN---PEDSAKS  1264
             GE FTS+L L+F                  V  H ++G      +    N   P     S
Sbjct  93    GEIFTSFLQLYF------------SHFTKFVFPHYKIG-----HHMGSFNLECPITDPGS  135

Query  1263  NVQIEVVEDIKLLGCV-----RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQK  1099
             +++  V + +K+   +     + L  VV+SY++V  + G TL+ +Y+ FV TA+ VL  K
Sbjct  136   DLE-NVTDHVKISSQINERASKCLYSVVVSYLLVTTIAGSTLLLVYVNFVKTARDVLSSK  194

Query  1098  GLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAI  919
              +   TF+VFT VSTF NCGFVPTNENM++F++N GLL +LIPQ L+GNTL+P  L   +
Sbjct  195   EISPLTFSVFTAVSTFVNCGFVPTNENMVIFRKNSGLLWLLIPQALMGNTLFPCFLFFLV  254

Query  918   WFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDA  739
               L K T+R EF  IL +   +GY HL S R    L  TV G + +Q  +F   EW S +
Sbjct  255   SGLDKITKRDEFGYILKNHKKMGYSHLLSVRLCVLLGLTVLGFVMIQFLLFCTFEWNSVS  314

Query  738   IAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDEN  559
             + G+  YEK+V SLF VVNSR TGE+++D + L+PA+L L ++MMYLPP T F P+ +E 
Sbjct  315   LEGMNSYEKIVVSLFQVVNSRQTGETVVDFATLSPAILVLFILMMYLPPYTLFMPLTEEK  374

Query  558   NNSKTKG-CSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
                + +  C  +K        +S L  L+I +  I ITE + ++ DPLNFNVLNI +EVI
Sbjct  375   TKREGEDHCGNEKKGKKSGFFVSQLSFLAICVFFISITESQNLRRDPLNFNVLNITLEVI  434

Query  381   SAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKG  205
             SA+GNVGF+TGYSC R++    G CK++ +GF GRWS  GKF+LIIVMF+GR K++  K 
Sbjct  435   SAFGNVGFTTGYSCERRLDISNGGCKNEGYGFAGRWSPTGKFVLIIVMFYGRFKQFTAKS  494

Query  204   GKAWKL  187
             G+AW L
Sbjct  495   GRAWIL  500



>gb|AAA52749.1| HKT1 [Triticum aestivum]
 gb|AAY25397.1| high-affinity potassium uptake transporter [Triticum aestivum]
 prf||2017355A K uptake transporter
Length=533

 Score =   315 bits (807),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 207/501 (41%), Positives = 319/501 (64%), Gaps = 6/501 (1%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  V+PF ++LSYF+ ++++G   L   KP    F    +D+ F + S+ TVS +ST
Sbjct  35    RFVALHVHPFWIQLSYFLAIAILGSVLLMSLKPSNPDFSPPYIDMLFLSTSALTVSGLST  94

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             + ME  S+ Q+V +T LM +GGE F S LGL    +     +    K   + ++  EL L
Sbjct  95    ITMEDLSSSQIVVLTLLMLIGGEIFVSLLGLMLRVNHQDMQDLPSVKISSVPVELEELDL  154

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
               +    ++   E++A + +  +   ++K    V+ L  VV  Y  +IHV+GF LV +YI
Sbjct  155   PNSMALCDESQLEEAAHA-IPPKKCTELKRSRSVKCLGYVVFGYFAMIHVLGFLLVFLYI  213

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VPTA   L +KG+++  F++  TV++ +N G VPTNENM++F +N GLLL+L  Q+L 
Sbjct  214   THVPTASAPLNKKGINIVLFSLSVTVASCANAGLVPTNENMVIFSKNSGLLLLLSGQMLA  273

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GNTL+P  LRL +WFLG+ T+  E R ++ +P  + + +L +   + FL++TV GL+   
Sbjct  274   GNTLFPLFLRLLVWFLGRITKVKELRLMINNPEEVRFANLLARLPTVFLSSTVVGLVAAG  333

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
             +T+F A++W S    GL+ Y+K V + F+VVN+RH+GE+ +D SL++PA++ L +VMMYL
Sbjct  334   VTMFCAVDWNSSVFDGLSSYQKTVNAFFMVVNARHSGENSIDCSLMSPAIIVLFIVMMYL  393

Query  597   PPDTTFFPIMDE--NNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKED  424
             P   TF P   +    N  TKG   K+ ++++ +  SPLG   IF+++ CITER +++ D
Sbjct  394   PSSATFAPPSGDTKTTNENTKG-KVKRGSLVQNLAFSPLGCNIIFVMVACITERRRLRND  452

Query  423   PLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKFILI  250
             PLNF+ LN++ EVISAYGN G STGYSC+R  Q+ PE  C+DK + F G WS+ GKF+LI
Sbjct  453   PLNFSTLNMIFEVISAYGNAGLSTGYSCSRLHQLHPEIICQDKPYSFSGWWSDGGKFVLI  512

Query  249   IVMFFGRLKKYHMKGGKAWKL  187
             +VM +GRLK + +  GK+WK+
Sbjct  513   LVMLYGRLKAFTLATGKSWKV  533



>gb|KGN65514.1| hypothetical protein Csa_1G433620 [Cucumis sativus]
Length=417

 Score =   311 bits (796),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 283/451 (63%), Gaps = 54/451 (12%)
 Frame = -1

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV  1315
             EMEVFSN QL+ +T LMF+GGE FTS +GLH          R+ +KN             
Sbjct  5     EMEVFSNSQLIVLTVLMFIGGEIFTSMVGLHL--------RRLFKKN-------------  43

Query  1314  TNNEYHNDLNPEDSAKSNVQI-EVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
                               +QI   +E    L  ++ L  VVL Y+++ H+VG  ++ +Y 
Sbjct  44    ------------------LQIPTTLEGFDSLSLIKFLGFVVLGYLLITHIVGIGMIVVYF  85

Query  1137  GFVPT-AKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqil  961
              F+ + AK++L +KG++L TF+ FT VST ++CGFVPTNENMIVF +N GLLLILIPQIL
Sbjct  86    LFISSFAKEILDEKGINLVTFSFFTCVSTLASCGFVPTNENMIVFHKNSGLLLILIPQIL  145

Query  960   LGNTLYPACLRLAIWFLGKTTR-------RIEFRQILGSPNGLGYGHLFSGRRSGFLAAT  802
             +GNTLYP+CLR  IW +GK ++       R++   +L +   +GY HL     S  L  T
Sbjct  146   VGNTLYPSCLRFCIWVIGKFSKDHHNDEHRLKVDYLLKTSEEIGYIHLLPSLHSCLLVVT  205

Query  801   VFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavla  622
             VFG IF+Q  +  ++EW S+  +GL  Y+KVV  LF+  NSRH GE+I+++S L+ A+L 
Sbjct  206   VFGFIFIQFVLICSMEWDSNGFSGLNSYQKVVAILFLSTNSRHAGETIVNISSLSSAILI  265

Query  621   livVMMYLPPDTTFFPI------MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIIL  460
             + +VMMYLPP T+F P+       D   + + +    KK    + +L S L  L IFI +
Sbjct  266   MFIVMMYLPPYTSFLPLNEKQELEDHFRHLQRRKVRSKKAKAWQNLLFSQLSYLIIFITI  325

Query  459   ICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGR  280
             ICI ER+KM EDP+NF+VLNIV+EVISAYGNVGFSTGYSC  QI P   C DK +GF  +
Sbjct  326   ICIIERKKMVEDPINFSVLNIVLEVISAYGNVGFSTGYSCKLQIHPPNDCVDKWYGFSAK  385

Query  279   WSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             WSN  K +LI+VM FGRLKK++M GGKAWKL
Sbjct  386   WSNKAKIVLILVMMFGRLKKFNMDGGKAWKL  416



>gb|ABK41857.1| putative sodium transporter HKT7-A2 [Triticum monococcum]
Length=554

 Score =   315 bits (807),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 246/502 (49%), Positives = 335/502 (67%), Gaps = 14/502 (3%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPI---SFKLKDLDvfftavssatvssmstVE  1492
             RV   L+ ++YF+ +S +G+  L   + R     + + + +D+FFTAVS+ATVSSMST+E
Sbjct  58    RVGSLLVHVAYFLTVSWLGYLLLAQLRFRAGGDGTRRPRGIDLFFTAVSAATVSSMSTIE  117

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHV-ELGLV  1315
             MEVFSN QL+ +T LM +GGE F S +GL    SK+   ++   K++ + I HV EL ++
Sbjct  118   MEVFSNGQLLVLTVLMLVGGEVFLSLVGLASKWSKLR--KQAAHKSRRVEIHHVAELEML  175

Query  1314  TNNEYHNDLNPEDSA--KSNVQIEVVEDIKLL-GCVRVLARvvlsyivvihvVGFTLVAM  1144
                    D NP  +A  +++  +E V D +L    VR L  VVL+  +V+HV+G   +A 
Sbjct  176   PAAAADID-NPTSTADDETSKSLEHVPDTRLRRDAVRSLFFVVLAIFLVVHVLGAGAIAA  234

Query  1143  YIGFV-PTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             YI    P A++ L+ K L++ TFAVFTTVSTFSNCGF+PTNENM VF+R+ GL L+L+PQ
Sbjct  235   YILHASPAARRTLRDKALNVWTFAVFTTVSTFSNCGFMPTNENMAVFQRDTGLQLLLVPQ  294

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGL-GYGHLFSGRRSGFLAATVFGL  790
             +L+GNTL+   L   +      TRR+E ++ L     L GY HL   RR G LAATV G 
Sbjct  295   VLVGNTLFAPLLAACVRAAAAATRRVELKETLKQGRELTGYSHLLPARRCGMLAATVAGF  354

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             + +Q+ +   +EW S A+ G++ +EKV  ++F+ VNSRH GES LD+S LAPA+L L V+
Sbjct  355   LAVQVAMLCGMEW-SGALRGMSAWEKVSNAVFLAVNSRHAGESTLDISTLAPAILVLFVL  413

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMK  430
             MMYLP  TT+FP    +  +       +   +I+   LS L  L+IF+I IC+TEREK+ 
Sbjct  414   MMYLPSYTTWFPFAGSSGTTD-HAEETQGIRLIKSTALSQLSYLTIFVIAICVTEREKLT  472

Query  429   EDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILI  250
             EDPLNFN+L+IVVEV+SAYGNVGFS GYSC RQI P+  C D+  GFVGRWS+ GK +LI
Sbjct  473   EDPLNFNLLSIVVEVVSAYGNVGFSMGYSCNRQISPDQLCTDRWTGFVGRWSDSGKLVLI  532

Query  249   IVMFFGRLKKYHMKGGKAWKLS  184
             +VM FGRLKK+ MKGGKAWKLS
Sbjct  533   LVMLFGRLKKFSMKGGKAWKLS  554



>gb|AFY08297.1| sodium transporter HKT1.5 [Oryza sativa]
Length=553

 Score =   314 bits (805),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 248/540 (46%), Positives = 336/540 (62%), Gaps = 57/540 (11%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH---  1333
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S     L  +     DH   
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSKMIPTLPDDD----DHGGN  133

Query  1332  --------------VELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGC-------  1219
                           VEL L    +    +NP  +A ++ ++E+ +      GC       
Sbjct  134   GKPPPPTTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHT  192

Query  1218  -----------VRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfav  1072
                         R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+
Sbjct  193   SSSPSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSVVGGAGAVVAGKGISAHTFAI  252

Query  1071  fttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRR  892
             FT VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T  
Sbjct  253   FTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGW  312

Query  891   IEFRQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
              E  ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT 
Sbjct  313   PELGELLIRRRRGGGEGYDHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTA  372

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
              +K+VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +
Sbjct  373   GQKLVGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQKTGAQ  432

Query  540   GCSPKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGN  367
                    +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGN
Sbjct  433   SGQEGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGN  492

Query  366   VGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             VGFSTGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  493   VGFSTGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  552



>gb|AFY08294.1| sodium transporter HKT1.5 [Oryza sativa]
Length=554

 Score =   314 bits (804),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 249/541 (46%), Positives = 337/541 (62%), Gaps = 58/541 (11%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTE-RVLEKNKVIVIDH--  1333
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+     L  N     DH  
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDND----DHGG  133

Query  1332  ---------------VELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV-----  1216
                            VEL L    +    +NP  +A ++ ++E+ +      GC      
Sbjct  134   SGKPPPATTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTH  192

Query  1215  -------------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfa  1075
                          R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA
Sbjct  193   TSSSSSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFA  252

Query  1074  vfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTR  895
             +FT VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T 
Sbjct  253   IFTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTG  312

Query  894   RIEFRQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLT  724
               E  ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT
Sbjct  313   WPELGELLIRRRRGGGEGYDHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLT  372

Query  723   GYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKT  544
               +K+VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  
Sbjct  373   AGQKLVGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGA  432

Query  543   KGCSPKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYG  370
             +       +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYG
Sbjct  433   QSGQEGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYG  492

Query  369   NVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWK  190
             NVGFSTGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK
Sbjct  493   NVGFSTGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWK  552

Query  189   L  187
             +
Sbjct  553   I  553



>gb|AFY08289.1| sodium transporter HKT1.5 [Oryza rufipogon]
Length=553

 Score =   313 bits (803),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 245/536 (46%), Positives = 335/536 (63%), Gaps = 49/536 (9%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVST--------------TERV  1366
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+              + + 
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDDDDHGGSGKP  137

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV---------  1216
                        VEL L    +    +NP  +A ++ ++E+ +      GC          
Sbjct  138   PPPTTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSS  196

Query  1215  ---------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavftt  1063
                      R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+FT 
Sbjct  197   SSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTV  256

Query  1062  vstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF  883
             VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T   E 
Sbjct  257   VSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPEL  316

Query  882   RQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEK  712
              ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT  +K
Sbjct  317   GELLIRRRRGGGEGYDHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQK  376

Query  711   VVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS  532
             +VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +   
Sbjct  377   LVGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQSSQ  436

Query  531   PKKFNII-EKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFS  355
                 + I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGNVGFS
Sbjct  437   EGSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGFS  496

Query  354   TGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             TGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  497   TGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  552



>gb|EEC70498.1| hypothetical protein OsI_01579 [Oryza sativa Indica Group]
 gb|ADM87303.1| sodium transporter HKT1;5 [Oryza sativa Indica Group]
Length=554

 Score =   313 bits (802),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 250/541 (46%), Positives = 337/541 (62%), Gaps = 58/541 (11%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTE-RVLEKNKVIVIDH--  1333
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+     L  N     DH  
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDND----DHGG  133

Query  1332  ---------------VELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV-----  1216
                            VEL L    +    +NP  +A ++ ++E+ +      GC      
Sbjct  134   SGKPPPATTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTH  192

Query  1215  -------------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfa  1075
                          R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA
Sbjct  193   TSSSSSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFA  252

Query  1074  vfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTR  895
             +FT VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T 
Sbjct  253   IFTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTG  312

Query  894   RIEFRQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLT  724
               E  ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT
Sbjct  313   WPELGELLIRRRRGGGEGYHHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLT  372

Query  723   GYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKT  544
               +K+VG+LF+ VNSRH+GE +LDLS ++ AV+ L VVMMYLPP TTF P+ D++  +  
Sbjct  373   AGQKLVGALFMAVNSRHSGEMVLDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGA  432

Query  543   KGCSPKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYG  370
             +       +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYG
Sbjct  433   QSGQEGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYG  492

Query  369   NVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWK  190
             NVGFSTGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK
Sbjct  493   NVGFSTGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWK  552

Query  189   L  187
             +
Sbjct  553   I  553



>gb|AAY42148.1| high-affinity potassium uptake transporter [Triticum aestivum]
Length=533

 Score =   312 bits (800),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 206/501 (41%), Positives = 318/501 (63%), Gaps = 6/501 (1%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  V+PF ++ SYF+ ++++G   L   KP    F    +D+ F + S+ TVS +ST
Sbjct  35    RFVALHVHPFWIQPSYFLAIAILGSVLLMSLKPSNPDFSPPYIDMLFLSTSALTVSGLST  94

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             + ME  S+ Q+V +T LM +GGE F S LGL    +     +    K   + ++  EL L
Sbjct  95    ITMEDLSSSQIVVLTLLMLIGGEIFVSLLGLMLRVNHQDMQDLPSVKISSVPVELEELDL  154

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
               +    ++   E++A + +  +   ++K    V+ L  VV  Y  +IHV+GF LV +YI
Sbjct  155   PNSMALCDESQLEEAAHA-IPPKKCTELKRSRSVKCLGYVVFGYFAMIHVLGFLLVFLYI  213

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VPTA   L +KG+++  F++  TV++ +N G VPTNENM++F +N GLLL+L  Q+L 
Sbjct  214   THVPTASAPLNKKGINIVLFSLSVTVASCANAGLVPTNENMVIFSKNSGLLLLLSGQMLA  273

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GNTL+P  LRL +WFLG+ T+  E R ++ +P  + + +L +   + FL++TV GL+   
Sbjct  274   GNTLFPLFLRLLVWFLGRITKVKELRLMINNPEEVRFANLLARLPTVFLSSTVVGLVAAG  333

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
             +T+F A++W S    GL+ Y+K V + F+VVN+RH+GE+ +D SL++PA++ L +VMMYL
Sbjct  334   VTMFCAVDWNSSVFDGLSSYQKTVNAFFMVVNARHSGENSIDCSLMSPAIIVLFIVMMYL  393

Query  597   PPDTTFFPIMDE--NNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKED  424
             P   TF P   +    N  TKG   K+ ++++ +  SPLG   IF+++ CITER +++ D
Sbjct  394   PSSATFAPPSGDTKTTNENTKG-KVKRGSLVQNLAFSPLGCNIIFVMVACITERRRLRND  452

Query  423   PLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKFILI  250
             PLNF+ LN++ EVISAYGN G STGYSC+R  Q+ PE  C+DK + F G WS+ GKF+LI
Sbjct  453   PLNFSTLNMIFEVISAYGNAGLSTGYSCSRLHQLHPEIICQDKPYSFSGWWSDGGKFVLI  512

Query  249   IVMFFGRLKKYHMKGGKAWKL  187
             +VM +GRLK + +  GK+WK+
Sbjct  513   LVMLYGRLKAFTLATGKSWKV  533



>gb|AAZ76552.1| sodium transporter [Oryza sativa Indica Group]
 gb|ABN48306.1| sodium transporter HKT1;5 [Oryza sativa Indica Group]
 gb|AFY08291.1| sodium transporter HKT1.5 [Oryza sativa]
 gb|AFY08293.1| sodium transporter HKT1.5 [Oryza sativa]
 gb|AFY08296.1| sodium transporter HKT1.5 [Oryza sativa]
Length=554

 Score =   313 bits (801),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 241/536 (45%), Positives = 329/536 (61%), Gaps = 48/536 (9%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVST------------------  1378
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+                  
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDDDDHGGSGKP  137

Query  1377  -------TERVLEKNKVIVIDHVELGLVTNNEYHNDL-------NPEDSAKSNVQIEVVE  1240
                    +  ++E      +D V +   T    H+++       N      +        
Sbjct  138   PPATTSPSSTLVELELAPPMDVVVVNPTTTATTHDEVELGLGRRNKHGCTCTTTHTSSSS  197

Query  1239  DIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttv  1060
                     R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+FT V
Sbjct  198   SASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTVV  257

Query  1059  stfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFR  880
             STF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T   E  
Sbjct  258   STFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPELG  317

Query  879   QIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKV  709
             ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT  +K+
Sbjct  318   ELLIRRRRGGGEGYDHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQKL  377

Query  708   VGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSP  529
             VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +    
Sbjct  378   VGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQSGQE  437

Query  528   KKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFS  355
                +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGNVGFS
Sbjct  438   GSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGFS  497

Query  354   TGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             TGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  498   TGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  553



>gb|AFY08290.1| sodium transporter HKT1.5 [Oryza sativa]
Length=554

 Score =   312 bits (800),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 245/537 (46%), Positives = 335/537 (62%), Gaps = 50/537 (9%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVST--------------TERV  1366
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+              + + 
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDDDDHGGSGKP  137

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV---------  1216
                        VEL L    +    +NP  +A ++ ++E+ +      GC          
Sbjct  138   PPPTTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSS  196

Query  1215  ---------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavftt  1063
                      R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+FT 
Sbjct  197   SSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTV  256

Query  1062  vstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF  883
             VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T   E 
Sbjct  257   VSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPEL  316

Query  882   RQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEK  712
              ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT  +K
Sbjct  317   GELLIRRRRGGGEGYDHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQK  376

Query  711   VVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS  532
             +VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +   
Sbjct  377   LVGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQSGQ  436

Query  531   PKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGF  358
                 +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGNVGF
Sbjct  437   EGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGF  496

Query  357   STGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             STGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  497   STGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  553



>ref|NP_001042848.1| Os01g0307500 [Oryza sativa Japonica Group]
 sp|Q0JNB6.1|HKT8_ORYSJ RecName: Full=Cation transporter HKT8; Short=OsHKT8; AltName: 
Full=HKT1;5 [Oryza sativa Japonica Group]
 dbj|BAB93392.1| putative high affinity potassium transporter 2 [Oryza sativa 
Japonica Group]
 dbj|BAD88380.1| putative high affinity potassium transporter 2 [Oryza sativa 
Japonica Group]
 dbj|BAF04762.1| Os01g0307500 [Oryza sativa Japonica Group]
 gb|EEE54420.1| hypothetical protein OsJ_01471 [Oryza sativa Japonica Group]
Length=554

 Score =   312 bits (800),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 246/537 (46%), Positives = 335/537 (62%), Gaps = 50/537 (9%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVST--------------TERV  1366
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+              + + 
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDDDDHGGSGKP  137

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV---------  1216
                        VEL L    +    +NP  +A ++ ++E+ +      GC          
Sbjct  138   PPPTTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSS  196

Query  1215  ---------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavftt  1063
                      R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+FT 
Sbjct  197   SSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTV  256

Query  1062  vstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF  883
             VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T   E 
Sbjct  257   VSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPEL  316

Query  882   RQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEK  712
              ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT  +K
Sbjct  317   GELLIRRRRGGGEGYHHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQK  376

Query  711   VVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS  532
             +VG+LF+ VNSRH+GE +LDLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +   
Sbjct  377   LVGALFMAVNSRHSGEMVLDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQSGQ  436

Query  531   PKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGF  358
                 +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGNVGF
Sbjct  437   EGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGF  496

Query  357   STGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             STGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  497   STGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  553



>gb|AFY08287.1| sodium transporter HKT1.5 [Oryza rufipogon]
Length=554

 Score =   312 bits (800),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 245/537 (46%), Positives = 335/537 (62%), Gaps = 50/537 (9%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVST--------------TERV  1366
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+              + + 
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMISTLPDDDDHGGSGKP  137

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV---------  1216
                        VEL L    +    +NP  +A ++ ++E+ +      GC          
Sbjct  138   PPPTTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSS  196

Query  1215  ---------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavftt  1063
                      R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+FT 
Sbjct  197   SSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTV  256

Query  1062  vstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF  883
             VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T   E 
Sbjct  257   VSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPEL  316

Query  882   RQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEK  712
              ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT  +K
Sbjct  317   GELLIRRRRGGGEGYDHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQK  376

Query  711   VVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS  532
             +VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +   
Sbjct  377   LVGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQKTGAQSGQ  436

Query  531   PKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGF  358
                 +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGNVGF
Sbjct  437   EGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGF  496

Query  357   STGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             STGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  497   STGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  553



>sp|A2WNZ9.2|HKT8_ORYSI RecName: Full=Cation transporter HKT8; Short=OsHKT8; AltName: 
Full=HKT1;5 [Oryza sativa Indica Group]
Length=554

 Score =   312 bits (800),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 248/540 (46%), Positives = 336/540 (62%), Gaps = 56/540 (10%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH---  1333
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+       +     DH   
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDD---DDHGGS  134

Query  1332  --------------VELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV------  1216
                           VEL L    +    +NP  +A ++ ++E+ +      GC       
Sbjct  135   GKPPPATTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHT  193

Query  1215  ------------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfav  1072
                         R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+
Sbjct  194   SSSSSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAI  253

Query  1071  fttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRR  892
             FT VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T  
Sbjct  254   FTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGW  313

Query  891   IEFRQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
              E  ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT 
Sbjct  314   PELGELLIRRRRGGGEGYHHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTA  373

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
              +K+VG+LF+ VNSRH+GE +LDLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +
Sbjct  374   GQKLVGALFMAVNSRHSGEMVLDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQ  433

Query  540   GCSPKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGN  367
                    +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGN
Sbjct  434   SGQEGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGN  493

Query  366   VGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             VGFSTGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  494   VGFSTGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  553



>gb|AFY08288.1| sodium transporter HKT1.5 [Oryza rufipogon]
Length=554

 Score =   312 bits (799),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 247/540 (46%), Positives = 336/540 (62%), Gaps = 56/540 (10%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH---  1333
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+       +     DH   
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDD---DDHGGS  134

Query  1332  --------------VELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV------  1216
                           VEL L    +    +NP  +A ++ ++E+ +      GC       
Sbjct  135   GKPPPATTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHT  193

Query  1215  ------------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfav  1072
                         R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+
Sbjct  194   SSSSSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAI  253

Query  1071  fttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRR  892
             FT VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T  
Sbjct  254   FTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGW  313

Query  891   IEFRQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
              E  ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT 
Sbjct  314   PELGELLIRRRRGGGEGYDHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTA  373

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
              +K+VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +
Sbjct  374   GQKLVGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQKTGAQ  433

Query  540   GCSPKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGN  367
                    +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGN
Sbjct  434   SGQEGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGN  493

Query  366   VGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             VGFSTGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  494   VGFSTGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  553



>gb|AFY08295.1| sodium transporter HKT1.5 [Oryza sativa]
Length=554

 Score =   312 bits (799),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 245/537 (46%), Positives = 335/537 (62%), Gaps = 50/537 (9%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVST--------------TERV  1366
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+              + + 
Sbjct  78    VAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDDDDHGGSGKP  137

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV---------  1216
                        VEL L    +    +NP  +A ++ ++E+ +      GC          
Sbjct  138   PPPTTSPSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSS  196

Query  1215  ---------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavftt  1063
                      R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA+FT 
Sbjct  197   SSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTV  256

Query  1062  vstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF  883
             VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T   E 
Sbjct  257   VSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPEL  316

Query  882   RQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEK  712
              ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT  +K
Sbjct  317   GELLIRRRRGGGEGYDHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQK  376

Query  711   VVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS  532
             +VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  +   
Sbjct  377   LVGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQKTGAQSGQ  436

Query  531   PKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGF  358
                 +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYGNVGF
Sbjct  437   EGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGF  496

Query  357   STGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             STGYSCARQ++P+G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK+
Sbjct  497   STGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKI  553



>ref|XP_009113602.1| PREDICTED: sodium transporter HKT1-like [Brassica rapa]
Length=503

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 235/483 (49%), Positives = 302/483 (63%), Gaps = 22/483 (5%)
 Frame = -1

Query  1614  LIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLG  1435
             L+GF ALKVSKPR  S +  DLD+ FT+VS+ TVSSMST++MEVFSN QL+ +T LMFLG
Sbjct  34    LLGFLALKVSKPRTTS-RPHDLDLLFTSVSAITVSSMSTIDMEVFSNTQLIIITILMFLG  92

Query  1434  GECFTSWLGLHFFQSKVSTTERVLEKNKV-IVIDHVELGLVTNNEYHNDLNPEDSAKSNV  1258
             GE FTS+L L+F       +  V   NK+  ++  + +   T +   +  N  D  K   
Sbjct  93    GEVFTSFLDLYFSH----FSNFVFPHNKIRHLMGSLNIKPPTEDRRRDLENITDHLKRPS  148

Query  1257  QIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttf  1078
             QI       L   V       L Y +V ++ G  LV +Y+ FV TAK VL  K +   TF
Sbjct  149   QINERASKYLYSVV-------LGYHLVTNLAGSVLVLVYVTFVKTAKVVLSSKEISPVTF  201

Query  1077  avfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTT  898
             ++FTTVSTF NCGFVPT ENM++F++N GLL +LIPQI +GNTL+P  L L IW L K T
Sbjct  202   SIFTTVSTFGNCGFVPTKENMVIFRKNSGLLWLLIPQIFMGNTLFPCFLFLLIWGLDKIT  261

Query  897   RRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGY  718
             +R EF  IL +   +GY HL S R    L  TV G + +Q  VF   EW S ++ G+  Y
Sbjct  262   KREEFGYILKNHKTMGYSHLLSLRLCVLLGLTVLGFVMIQFFVFCTFEWNSVSLEGMNPY  321

Query  717   EKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIM-----DENNN  553
             EK+VGSLF VVNSRHTGE+I+DLS L+PA+L L + MMYLPP T F P+       E   
Sbjct  322   EKLVGSLFQVVNSRHTGENIVDLSTLSPAILVLFIFMMYLPPYTLFMPLTTIKKYKEEVE  381

Query  552   SKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAY  373
               T     +K        +S L  L+I +  I ITE + ++ DPLNFN+LNI +EVISA+
Sbjct  382   DHTGNEEKRK---KTGFFVSQLSFLAISVFFISITESQNLRRDPLNFNILNITLEVISAF  438

Query  372   GNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKA  196
             GNVGF+TGYSC R++    G CKD  +GFVGRWS  GKFILIIVM +GR K++  K G+ 
Sbjct  439   GNVGFTTGYSCKRRLDINNGSCKDTSYGFVGRWSPNGKFILIIVMLYGRFKQFTAKSGRP  498

Query  195   WKL  187
             W L
Sbjct  499   WIL  501



>ref|XP_006287554.1| hypothetical protein CARUB_v10000766mg [Capsella rubella]
 gb|EOA20452.1| hypothetical protein CARUB_v10000766mg [Capsella rubella]
Length=506

 Score =   309 bits (791),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 234/490 (48%), Positives = 312/490 (64%), Gaps = 48/490 (10%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             +++KPR +S +  DLD+FFT+VS+  +SSMSTVEMEVFSN QL+ +T LM LGGE FTS+
Sbjct  41    RLTKPR-VSSRPHDLDLFFTSVSAINISSMSTVEMEVFSNTQLIILTTLMLLGGEIFTSF  99

Query  1413  LGL---HFFQ-----SKVSTT-------ERVLEKNKV---IVIDHVELGLVTNNEYHNDL  1288
             L L   HF +     SK+          +R +E  +     V+DH E+          +L
Sbjct  100   LSLYVSHFTKFVLPHSKIRHLLASFIYLDRPVEDGRSDLETVVDHCEV----------NL  149

Query  1287  NPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVL  1108
                D   S     VV    L   V  LA             G  L+ +Y+ FV +A  VL
Sbjct  150   TKIDERASKCLYYVVLSYHL---VSTLA-------------GSVLLLVYVNFVKSAGDVL  193

Query  1107  KQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLR  928
               KG+   TF+VFTTVSTF+NCGF+PTNENM++F++N GLL +LIPQ+L+GNTL+P  L 
Sbjct  194   SSKGISPLTFSVFTTVSTFANCGFLPTNENMVIFRKNSGLLWLLIPQVLMGNTLFPCFLV  253

Query  927   LAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWR  748
             L IW L K T+R EF  IL +   +GY HLFS R    L  TV G + +QL +F   EW 
Sbjct  254   LFIWGLYKITKREEFSYILKNHKKMGYSHLFSVRVCVLLGLTVLGFLMVQLLLFATSEWS  313

Query  747   SDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIM  568
             S ++ G++ YEK+VGSLF VVNSRH GESI+DLS L+PA+L L +VMMYLPP T   P+ 
Sbjct  314   SKSLEGMSSYEKLVGSLFQVVNSRHAGESIVDLSTLSPAILILFIVMMYLPPYTLLMPLT  373

Query  567   DENNNSKTK-GCSPKKFNIIEK-ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIV  394
             ++    K +   S  + N+++  + +S L  L+I I LI ITER+K++ DPLNFNV NI 
Sbjct  374   EQKTIKKEEDDDSGNRKNVMKSGLFMSQLSFLTICIFLISITERQKLRRDPLNFNVFNIT  433

Query  393   VEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKY  217
             +EVISAYGNVGF+TGYSC R++   +G C+D  +GF GRWS  GKF+LI+VMF+GR K++
Sbjct  434   LEVISAYGNVGFTTGYSCERRLNVSDGGCEDASYGFAGRWSPTGKFVLILVMFYGRFKQF  493

Query  216   HMKGGKAWKL  187
               K G+AW L
Sbjct  494   TAKSGRAWVL  503



>gb|AID46987.1| putative Na+/K+ transporter [Triticum aestivum]
Length=533

 Score =   310 bits (793),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 206/503 (41%), Positives = 317/503 (63%), Gaps = 10/503 (2%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  V+PF ++LSYF+ ++++G   L   KP    F    +D+ + + S+ TVS +ST
Sbjct  35    RFVALHVHPFWIQLSYFLAIAILGSVLLISLKPSNPEFSPPYIDMLYLSTSALTVSGLST  94

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             V+ME  S+ Q+V +T LM +GGE F S LGL    +     +    K   + ++   L L
Sbjct  95    VKMEDLSSSQIVVLTLLMLVGGEIFVSLLGLMLRVNHQDMQDLPSVKISSVPVELEVLDL  154

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
               +    ++   ED++ + +  +   ++K    V+ L  VV  Y  VIHV+GF LV +YI
Sbjct  155   ANSMALCDESQLEDASHA-IPPKKCTELKRSRSVKCLGYVVFGYFAVIHVLGFVLVFLYI  213

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VPTA   L +KG+++  F++  TV++ +N G VPTNENM++F +N GLLL+L  Q+L 
Sbjct  214   THVPTASAPLNKKGINIVLFSLSVTVASCANAGLVPTNENMVIFSKNSGLLLLLSGQMLA  273

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GNTL+P  LRL +WFLGK T+  E R +  +P  + + +L     + FL++TV G++   
Sbjct  274   GNTLFPLFLRLLVWFLGKLTKVKELRLMTKNPEEVHFANLLPRLPTVFLSSTVIGIVAAG  333

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
             +T+F +++W S    GL  Y+K V + F+VVN+RH+GE+ +D SL++PA++ L + MMYL
Sbjct  334   VTLFCSVDWNSSVFDGLGSYQKTVNAFFMVVNARHSGENSIDCSLMSPAIVVLFIGMMYL  393

Query  597   PPDTTFFPIMDE----NNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMK  430
             P   TF P   +    N N+K KG   K+ ++++ +  SPLG   IF+I+ CITER +++
Sbjct  394   PSSATFAPPSGDTKTTNENTKGKG---KRGSLVQNLAFSPLGCNIIFVIVACITERRRLR  450

Query  429   EDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKFI  256
              DPLNF+ LN++ EVISAYGNVG STGYSC+R  Q+ PE  C+D  + F G WS+ GKF+
Sbjct  451   SDPLNFSTLNMIFEVISAYGNVGLSTGYSCSRLHQLHPEIICQDMPYSFSGWWSDGGKFL  510

Query  255   LIIVMFFGRLKKYHMKGGKAWKL  187
             L++VM +GRLK + +  GK+WK+
Sbjct  511   LVLVMLYGRLKVFAVSTGKSWKV  533



>ref|NP_001058486.1| Os06g0701700 [Oryza sativa Japonica Group]
 sp|Q0D9S3.1|HKT1_ORYSJ RecName: Full=Cation transporter HKT1; Short=OsHKT1; AltName: 
Full=Ni-OsHKT1; AltName: Full=Po-OsHKT1 [Oryza sativa Japonica 
Group]
 sp|A2YGP9.2|HKT1_ORYSI RecName: Full=Cation transporter HKT1; Short=OsHKT1; AltName: 
Full=Ni-OsHKT1; AltName: Full=Po-OsHKT1 [Oryza sativa Indica 
Group]
 gb|AAG37274.1| HKT-type transporter [Oryza sativa Indica Group]
 dbj|BAB61789.1| sodium ion transporter [Oryza sativa Japonica Group]
 dbj|BAB61790.1| sodium ion transporter [Oryza sativa Indica Group]
 gb|AAM46870.1| HKT-type transporter [Oryza sativa Indica Group]
 dbj|BAD53775.1| HKT-type transporter [Oryza sativa Japonica Group]
 dbj|BAF20400.1| Os06g0701700 [Oryza sativa Japonica Group]
Length=530

 Score =   309 bits (791),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 215/504 (43%), Positives = 318/504 (63%), Gaps = 13/504 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  ++PF ++LSYF+++S++G   L   KP    F+   +D+ F + S+ T+SS+ T
Sbjct  32    RFIALHIHPFWIQLSYFLLISILGSVLLMFLKPSNPEFRPGYIDMLFLSTSALTLSSLIT  91

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             +EMEV S+ Q+V +T LM LGGE F S+LGL    +     E   +K     +  V + L
Sbjct  92    IEMEVLSSSQIVVITLLMLLGGEVFVSFLGLMLRLNHKHNPEFSGDK-----VSSVPIEL  146

Query  1317  VTNNEYHNDLNPED----SAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTL  1153
              T N     ++ E+    +A   V    ++D+K    +R  L  VV SY VVIHV GF L
Sbjct  147   DTINSASTVISCEELQLEAAIPEVPSSTIKDLKRSKRLRWFLGFVVFSYFVVIHVAGFLL  206

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V  YI  V +AK  LK+KG+++  F+   TVS+F+N G VPTNENM +F +NPGLLL+ I
Sbjct  207   VLWYISRVSSAKAPLKKKGINIALFSFSVTVSSFANVGLVPTNENMAIFSKNPGLLLLFI  266

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
              QIL GNTLYP  LRL IWFLGK T+  E + ++ +P  L Y +L     + FLA+TV G
Sbjct  267   GQILAGNTLYPLFLRLLIWFLGKVTKLRELKLMIKNPEELQYDYLLPKLPTAFLASTVIG  326

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
             L+   +T+F A++W S    GL+ Y+K++ +LF+ VN+RH+GE+ +D SL+APAVL L +
Sbjct  327   LMASLVTLFGAVDWNSSVFDGLSSYQKIINALFMAVNARHSGENSIDCSLIAPAVLVLFI  386

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKM  433
             ++MYLPP TT F + + +  +  K    K   +++ +  S L  +S+F+I+  ITER ++
Sbjct  387   ILMYLPPSTT-FALSNGDEKTANKKAKRKLGLVVQNLAFSQLACISVFVIVAFITERSRL  445

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKF  259
             + DPLNF+ LN++ E+ISAYGNVG STGYSC+R  ++ P   C+DK +   G WS+ GK 
Sbjct  446   RNDPLNFSALNMIFEIISAYGNVGLSTGYSCSRLQKLHPGSICQDKPYSLSGWWSDEGKL  505

Query  258   ILIIVMFFGRLKKYHMKGGKAWKL  187
             +L+ VM +GRLK +    G+ W+L
Sbjct  506   LLVFVMLYGRLKAFTKGTGEYWRL  529



>emb|CAD37196.1| putative sodium transporter [Oryza sativa Japonica Group]
Length=530

 Score =   309 bits (791),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 215/504 (43%), Positives = 318/504 (63%), Gaps = 13/504 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  ++PF ++LSYF+++S++G   L   KP    F+   +D+ F + S+ T+SS+ T
Sbjct  32    RFIALHIHPFWIQLSYFLLISILGSVLLMFLKPTNPEFRPGYIDMLFLSTSALTLSSLIT  91

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             +EMEV S+ Q+V +T LM LGGE F S+LGL    +     E   +K     +  V + L
Sbjct  92    IEMEVLSSSQIVVITLLMLLGGEVFVSFLGLMLRLNHKHNPEFSGDK-----VSSVPIEL  146

Query  1317  VTNNEYHNDLNPED----SAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTL  1153
              T N     ++ E+    +A   V    ++D+K    +R  L  VV SY VVIHV GF L
Sbjct  147   DTINSASTVISCEELQLEAAIPEVPSSTIKDLKRSKRLRWFLGFVVFSYFVVIHVAGFLL  206

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V  YI  V +AK  LK+KG+++  F+   TVS+F+N G VPTNENM +F +NPGLLL+ I
Sbjct  207   VLWYISRVSSAKAPLKKKGINIALFSFSVTVSSFANVGLVPTNENMAIFSKNPGLLLLFI  266

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
              QIL GNTLYP  LRL IWFLGK T+  E + ++ +P  L Y +L     + FLA+TV G
Sbjct  267   GQILAGNTLYPLFLRLLIWFLGKVTKLRELKLMIKNPEELQYDYLLPKLPTAFLASTVIG  326

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
             L+   +T+F A++W S    GL+ Y+K++ +LF+ VN+RH+GE+ +D SL+APAVL L +
Sbjct  327   LMASLVTLFGAVDWNSSVFDGLSSYQKIINALFMAVNARHSGENSIDCSLIAPAVLVLFI  386

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKM  433
             ++MYLPP TT F + + +  +  K    K   +++ +  S L  +S+F+I+  ITER ++
Sbjct  387   ILMYLPPSTT-FALSNGDEKTANKKAKRKLGLVVQNLAFSQLACISVFVIVAFITERSRL  445

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKF  259
             + DPLNF+ LN++ E+ISAYGNVG STGYSC+R  ++ P   C+DK +   G WS+ GK 
Sbjct  446   RNDPLNFSALNMIFEIISAYGNVGLSTGYSCSRLQKLHPGSICQDKPYSLSGWWSDEGKL  505

Query  258   ILIIVMFFGRLKKYHMKGGKAWKL  187
             +L+ VM +GRLK +    G+ W+L
Sbjct  506   LLVFVMLYGRLKAFTKGTGEYWRL  529



>gb|AFY08292.1| sodium transporter HKT1.5 [Oryza glaberrima]
Length=555

 Score =   309 bits (791),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 246/541 (45%), Positives = 335/541 (62%), Gaps = 57/541 (11%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSK------PRPISFKLKDLDvfftavssatvssm  1504
             F  +PF L+L YF+ +SL+GF  LK         PRP+     DLD+ FT+VS+ TVSSM
Sbjct  23    FHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPM-----DLDLIFTSVSATTVSSM  77

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDH---  1333
               VEME FSN QL+ +T LM LGGE FTS LGL+F  +K S+       +     DH   
Sbjct  78    VAVEMESFSNSQLLLVTLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDD---DDHGGS  134

Query  1332  --------------VELGLVTNNEYHNDLNPEDSAKSNVQIEV-VEDIKLLGCV------  1216
                           VEL L    +    +NP  +A ++ ++E+ +      GC       
Sbjct  135   GKPPPPTTSRSSTLVELELAPPMDV-VVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHT  193

Query  1215  -------------RVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfa  1075
                          R+L  VV+ Y  V+HV G+T + +Y+  V  A  V+  KG+   TFA
Sbjct  194   SSSSSASKTTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFA  253

Query  1074  vfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTR  895
             +FT VSTF+NCGFVPTNE M+ F+  PGLLL+++P +LLGNTL+P  LRLAI  L + T 
Sbjct  254   IFTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTG  313

Query  894   RIEFRQIL---GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLT  724
               E  ++L       G GY HL    R+ FLA TV  L+  QL +F A+EW SD + GLT
Sbjct  314   WPELGELLIRRRRGGGEGYDHLLPSPRTRFLALTVAVLVVAQLALFCAMEWSSDGLRGLT  373

Query  723   GYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKT  544
               +K+VG+LF+ VNSRH+GE ++DLS ++ AV+ L VVMMYLPP TTF P+ D++  +  
Sbjct  374   AGQKLVGALFMAVNSRHSGEMVVDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGA  433

Query  543   KGCSPKKFN--IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYG  370
             +       +  I +K+L+SPL  L+IFI++ICITER ++ +DP+N++VLNIVVEVISAYG
Sbjct  434   QSGQEGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYG  493

Query  369   NVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWK  190
             NVGFSTGYSCARQ++ +G C+D   GF G+WS  GK  L+ VMF+GRLKK+ + GG+AWK
Sbjct  494   NVGFSTGYSCARQVRSDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWK  553

Query  189   L  187
             +
Sbjct  554   I  554



>gb|AAQ91202.1| sodium transporter [Oryza sativa Indica Group]
Length=530

 Score =   308 bits (788),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 214/502 (43%), Positives = 317/502 (63%), Gaps = 13/502 (3%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             +A  ++PF ++LSYF+++S++G   L   KP    F+   +D+ F + S+ T+SS+ T+E
Sbjct  34    IALHIHPFWIQLSYFLLISILGSVLLMFLKPSNPEFRPGYIDMLFLSTSALTLSSLITIE  93

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVT  1312
             MEV S+ Q+V +T LM LGGE F S+LGL    +     E   +K     +  V + L T
Sbjct  94    MEVLSSSQIVVITLLMLLGGEVFVSFLGLMLRLNHKHNPEFSGDK-----VSSVPIELDT  148

Query  1311  NNEYHNDLNPED----SAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTLVA  1147
              N     ++ E+    +A   V    ++D+K    +R  L  VV SY VVIHV GF LV 
Sbjct  149   INSASTVISCEELQLEAAIPEVPSSTIKDLKRSKRLRWFLGFVVFSYFVVIHVAGFLLVL  208

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
              YI  V +AK  LK+KG+++  F+   TVS+F+N G VPTNENM +F +NPGLLL+ I Q
Sbjct  209   WYISRVSSAKAPLKKKGINIALFSFSVTVSSFANVGLVPTNENMAIFSKNPGLLLLFIGQ  268

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             IL GNTLYP  LRL IWFLGK T+  E + ++ +P  L Y +L     + FLA+TV GL+
Sbjct  269   ILAGNTLYPLFLRLLIWFLGKVTKLRELKLMIKNPEELQYDYLLPKLPTAFLASTVIGLM  328

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
                +T+F A++W S    GL+ Y+K++ +LF+ VN+RH+GE+ +D SL+APAVL L +++
Sbjct  329   ASLVTLFGAVDWNSSVFDGLSSYQKIINALFMAVNARHSGENSIDCSLIAPAVLVLFIIL  388

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLPP TT F + + +  +  K    K   +++ +  S L  +S+F+I+  ITER +++ 
Sbjct  389   MYLPPSTT-FALSNGDEKTANKKAKRKLGLVVQNLAFSQLACISVFVIVAFITERSRLRN  447

Query  426   DPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKFIL  253
             DPLNF+ LN++ E+ISAYGNVG STGYSC+R  ++ P   C+DK +   G WS+ GK +L
Sbjct  448   DPLNFSALNMIFEIISAYGNVGLSTGYSCSRLQKLHPGSICQDKPYSLSGWWSDEGKLLL  507

Query  252   IIVMFFGRLKKYHMKGGKAWKL  187
             + VM +GRLK +    G+ W+L
Sbjct  508   VFVMLYGRLKAFTKGTGEYWRL  529



>gb|AFH37929.1| high-affinity K+ transporter 1 [Cochlearia anglica]
Length=509

 Score =   306 bits (785),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 218/475 (46%), Positives = 302/475 (64%), Gaps = 18/475 (4%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K+SKPR  +  L DLD++FT+VS+ T SS+STV+MEVFSN QL+ +T +MFLG E  TS+
Sbjct  41    KISKPRT-TLPLHDLDLYFTSVSAITASSISTVDMEVFSNTQLIIITLVMFLGSEISTSF  99

Query  1413  LGL---HFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVV  1243
             L L   HF       T  V  + K I      L L    E    ++ ED        +V 
Sbjct  100   LSLCLTHF-------TNFVFPRYKTISHLMGSLNLDLPQE-DCSIDLEDVTNHRESHDVK  151

Query  1242  EDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavftt  1063
              + K   C   L +VVL Y +V ++ G  L+ +Y+ FV T + +L  K +   TF++FT+
Sbjct  152   MNEKASKC---LYKVVLGYHLVTNLAGSLLLLVYVNFVKTVRDILDSKKISPLTFSIFTS  208

Query  1062  vstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF  883
             +STF+NCGF+P NENM++F++N GLL ILIPQ+L+GNTL+P  LRL +W L K T+R E+
Sbjct  209   ISTFANCGFIPMNENMVIFRKNSGLLWILIPQVLMGNTLFPCFLRLLLWGLDKITKREEY  268

Query  882   RQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVG  703
               IL +   + Y HL S R    L  TV G + + L +    EWR +++ G+  YEK+VG
Sbjct  269   GYILKNHKKMRYSHLLSVRLCVSLGLTVLGFLIIHLILLCVFEWRLESLQGMNWYEKIVG  328

Query  702   SLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKK  523
             SLF+VVN+RH GE+I+D S L+PA+L L   +MYLPP T F  +  +N N+K +G   + 
Sbjct  329   SLFLVVNTRHAGETIVDFSTLSPAILILFTFIMYLPPYTLFMTLTKKNKNNKERGKETEN  388

Query  522   FNIIEK--ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTG  349
                 +K    +S L  L+I I L+C TER+K++ DPLNFNV NI +EVISAYGNVGF+TG
Sbjct  389   EKEAKKSGFFVSQLSFLAICIFLVCTTERQKLQRDPLNFNVFNITLEVISAYGNVGFTTG  448

Query  348   YSCARQIKPEG-QCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             YSC R++  +   CK+  +GF GRWS+ GK ILIIVMF+GR K++  K G+ W L
Sbjct  449   YSCERRLNIDDVGCKNASYGFAGRWSSSGKIILIIVMFYGRFKQFSAKSGRTWIL  503



>gb|AAC62807.1| similar to potassium transport proteins [Arabidopsis thaliana]
Length=458

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 222/476 (47%), Positives = 290/476 (61%), Gaps = 70/476 (15%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDI  1234
             L L+     VS     +E       D  ++  VT  +Y   L   D   S     VV   
Sbjct  100   LNLY-----VSYFTNSIE-------DRCDVETVT--DYREGLIKIDERASKCLYSVVLSY  145

Query  1233  KLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvst  1054
              L+                 ++VG  L+ +Y+ FV TA+ VL  K +   TF+VFTTVST
Sbjct  146   HLV----------------TNLVGSVLLLVYVNFVKTARDVLSSKEISPLTFSVFTTVST  189

Query  1053  fSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQI  874
             F+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K T+R E+  I
Sbjct  190   FANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKITKRDEYGYI  249

Query  873   LGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLF  694
             L + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ YEK+VGSLF
Sbjct  250   LKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSSYEKLVGSLF  309

Query  693   VVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNI  514
              VVNSRHTGE+I+DLS L+             P     F +M                  
Sbjct  310   QVVNSRHTGETIVDLSTLS-------------PAILVLFILMI-----------------  339

Query  513   IEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI------SAYGNVGFST  352
                +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVI      SAYGNVGF+T
Sbjct  340   --GLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVIRYFCNGSAYGNVGFTT  397

Query  351   GYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             GYSC R++   +G CKD  +GF GRWS MGKF+LIIVMF+GR K++  K G+AW L
Sbjct  398   GYSCERRVDISDGGCKDASYGFAGRWSPMGKFVLIIVMFYGRFKQFTAKSGRAWIL  453



>ref|XP_008453695.1| PREDICTED: cation transporter HKT8-like [Cucumis melo]
Length=501

 Score =   305 bits (780),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 242/524 (46%), Positives = 330/524 (63%), Gaps = 47/524 (9%)
 Frame = -1

Query  1689  MSTVRRLA---FRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssa  1519
             MS ++RL+     +NPF + + YF+ +S  GF+ L +  P+      K LD+FFT+VS++
Sbjct  1     MSRIQRLSCFLILLNPFWIHVLYFLFISSFGFWVLLILNPKLTP---KKLDLFFTSVSAS  57

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVI  1339
             TVSSMST+EMEVFSN QL+ +T LMF+GGE FTS + L   + K+  +E+ +   +  + 
Sbjct  58    TVSSMSTMEMEVFSNSQLIVLTILMFIGGEVFTSMVELQLRKLKLKFSEKKIACVENDLN  117

Query  1338  DHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGF  1159
               +ELG +      +D N  D  K N        IK LG V VL  +++   +     G 
Sbjct  118   SSLELGDI------DDHNNFDILKYN-------SIKFLGYV-VLGYLLIFNFL-----GI  158

Query  1158  TLVAMYIGFVP-TAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlll  982
              +V +Y+  V  TA +VLK KGL  +TF+VF  VSTF++CGFVPTNENMIVF++N GLL+
Sbjct  159   VMVLVYLKCVSSTATEVLKSKGLKTSTFSVFVIVSTFASCGFVPTNENMIVFRKNLGLLI  218

Query  981   ilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILG----SPNGLGYGHLFSGRRSGF  814
             ILIPQ L+GNTL+P+CLR  IW LGK  ++   ++++G    +   +GY HL     S  
Sbjct  219   ILIPQALIGNTLFPSCLRFCIWSLGKIMKKK--KEVVGFLLENSEEIGYLHLLPKLYSLV  276

Query  813   LAATVFGLIFLQLTVFLALEWRS---DAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsl  643
             L A+VFG + +Q     A+EWRS   +  +GL   EK++G LF+ VNSRH+GESI+DLS 
Sbjct  277   LVASVFGFVLIQSVAIGAMEWRSSSNNGFSGLNWVEKLIGILFLSVNSRHSGESIVDLST  336

Query  642   lapavlalivVMMYLPPDTTFFPI------------MDENNNSKTKGCSPKKFNIIEKIL  499
             L+ A+L L V MMYLPP T+F PI             +E      K    K+   ++  +
Sbjct  337   LSSAILVLFVAMMYLPPYTSFMPIKIEEGEEGEGEEENEIMEGNKKRRKTKRAKFVDNFV  396

Query  498   LSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPE  319
              S L  L IFI +ICITER  +K+DPLNFN+ NIV EVISAYGNVGFS GYSC RQ+ P+
Sbjct  397   FSQLSYLIIFIFIICITERHNIKQDPLNFNIFNIVFEVISAYGNVGFSMGYSCGRQVHPQ  456

Query  318   GQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
               C D  FGF G+WS+ GK +LI+VM FGRLKK++M   +AWKL
Sbjct  457   SNCVDMSFGFSGKWSDNGKLVLIVVMIFGRLKKFNMNRQRAWKL  500



>gb|KDP36066.1| hypothetical protein JCGZ_08710 [Jatropha curcas]
Length=278

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 164/279 (59%), Positives = 211/279 (76%), Gaps = 4/279 (1%)
 Frame = -1

Query  1017  MIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNG--LGYG  844
             M+VF +N GLLL+LIPQ+LLGNTL+P+CLR  +WFLGK  ++ E+   L + +G  +GY 
Sbjct  1     MVVFSKNSGLLLMLIPQVLLGNTLFPSCLRFFVWFLGKKLKKEEYSNYLLTYSGKKIGYT  60

Query  843   HLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGE  664
             HL     S FL  TVFG I  Q  +F +LEW SDA+ G+  Y+K++G LF VVNSRHTGE
Sbjct  61    HLLPSLHSSFLVVTVFGFILAQFILFCSLEWNSDALNGMNSYQKIMGVLFQVVNSRHTGE  120

Query  663   SIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLG  484
             +I+DLS+L+PA+L L +VMMYLPP T+F P+ D+    +      +K  ++E I+ S L 
Sbjct  121   TIVDLSILSPAILVLFIVMMYLPPYTSFHPVNDDPKMHENG--RKRKRKLLENIIFSQLS  178

Query  483   NLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKD  304
              L IF+ILICITER+K+KEDPLNFN LNIV+EVISAYGNVGF+TGYSC RQ+ PE  CKD
Sbjct  179   YLVIFVILICITERKKLKEDPLNFNALNIVLEVISAYGNVGFTTGYSCKRQLNPEMNCKD  238

Query  303   KQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             K +GF G+WS+ GK +LI+VMFFGRLKK++MKGGKAW L
Sbjct  239   KWYGFSGKWSDEGKILLIVVMFFGRLKKFNMKGGKAWIL  277



>ref|XP_004150749.1| PREDICTED: sodium transporter HKT1-like [Cucumis sativus]
 ref|XP_004172341.1| PREDICTED: sodium transporter HKT1-like [Cucumis sativus]
Length=495

 Score =   304 bits (778),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 238/518 (46%), Positives = 329/518 (64%), Gaps = 41/518 (8%)
 Frame = -1

Query  1689  MSTVRRL---AFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssa  1519
             MS ++RL      +NPF + + YF+ +S  GF+ L +  P+      K LD+FFT+VS++
Sbjct  1     MSRIQRLFCFLILLNPFWIHVLYFLFISSFGFWVLLILNPK---LAPKKLDLFFTSVSAS  57

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVI  1339
             TVSSMST+EMEVFSN QL+ +T LMF+GGE FTS + L   + K+  +E+          
Sbjct  58    TVSSMSTMEMEVFSNSQLIVLTVLMFIGGEVFTSMVELQLRKLKLKFSEQ----------  107

Query  1338  DHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGF  1159
                ++  V N+  +N+L       S   I   + IK LG V VL      Y+++ + +G 
Sbjct  108   ---KIACVENDFNNNNLELGVINNSFDIILKYDSIKFLGYV-VLG-----YLLIFNFLGI  158

Query  1158  TLVAMYIGFVP-TAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlll  982
              LV +Y+  V  TA++VLK KGL  +TF++F  VSTF++CGFVPTNENMIVF++N GLLL
Sbjct  159   ALVLIYLKRVSSTAREVLKSKGLRTSTFSLFVVVSTFASCGFVPTNENMIVFRKNLGLLL  218

Query  981   ilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILG----SPNGLGYGHLFSGRRSGF  814
             ILIPQ L+GNTL+P+CLR  IW LGK  ++   ++++G    +   +GY HL     S  
Sbjct  219   ILIPQALIGNTLFPSCLRFCIWSLGKIMKKK--KEVIGFLLENSEEIGYLHLLPKLYSLV  276

Query  813   LAATVFGLIFLQLTVFLALEWRS--DAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsll  640
             L  +V G + +Q     A+EWRS  +  +GL   EK++G LF+ VNSRH+GES +DLS L
Sbjct  277   LVGSVLGFVLIQFVAIGAMEWRSSNNGFSGLNWVEKLIGILFLSVNSRHSGESTVDLSTL  336

Query  639   apavlalivVMMYLPPDTTFFPIMD------ENNNSKTKGCSPKKFNIIEKILLSPLGNL  478
             + A+L L V MMYLPP T+F PI        E   ++ +    K+   ++  + S L  L
Sbjct  337   SSAILVLFVAMMYLPPYTSFMPIKSIEEEENEMEGNRKRRSRTKRAKFMDNFVFSQLSYL  396

Query  477   SIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQ  298
              IF  +ICITER  MK+DPLNFN+ NIV EVISAYGNVGFS GYSC R++ P+  C DK 
Sbjct  397   IIFTFIICITERHNMKQDPLNFNIFNIVFEVISAYGNVGFSMGYSCGRRVHPQSNCVDKS  456

Query  297   FGFVGRWSNMGKFILIIVMFFGRLKKYHM-KGGKAWKL  187
             FGF G+WS+ GK +LI+VM FGRLKK++M +  +AWKL
Sbjct  457   FGFSGKWSDNGKLVLIVVMIFGRLKKFNMNRSQRAWKL  494



>ref|XP_008781919.1| PREDICTED: probable cation transporter HKT6 [Phoenix dactylifera]
Length=498

 Score =   301 bits (772),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 231/502 (46%), Positives = 306/502 (61%), Gaps = 47/502 (9%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R L    NP  + + YF  +S +GF  LK  K +  S   +D+D+FF +VS+ATVSSMST
Sbjct  38    RFLLSHSNPLCIRIIYFFSISSLGFLVLKSFKLKKPSNTPRDIDMFFMSVSAATVSSMST  97

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKV---STTERVLEKNKVIVIDHVE  1327
             VEMEVFSN QLV +  LM +GGE F+S +GL F + ++   + TE  +E       D  +
Sbjct  98    VEMEVFSNSQLVALAILMLIGGELFSSMIGLQFRKEQLKQQAMTESCVESVARSSPDMKD  157

Query  1326  LGLVTNNEYHNDLNPEDSAKSNVQIEVVE--DIKLLGCVRVLARvvlsyivvihvVGFTL  1153
                  ++    D +  ++     Q   ++  D+K    V  LARVV  Y++VIHV GF  
Sbjct  158   DQFEMDSAAAPDPDCIEAGMVGSQSHPIDTKDLKY-HAVTYLARVVTGYLLVIHVGGFIS  216

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V +YI  V +A+ VLK KG+ +  F+ FTT+S+FSNCGF+PTNENM++FK+N GLLL++I
Sbjct  217   VIVYINLVRSARAVLKDKGIGVLIFSFFTTISSFSNCGFIPTNENMMIFKKNSGLLLLII  276

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
             PQ+LLGNT++P+CLR  +W L  TTRR EF  +L +   +GY HL     S  L  TV  
Sbjct  277   PQVLLGNTMFPSCLRFLLWVLKSTTRRAEFEYMLKNSQEIGYYHLLPHLHSLLLLVTVLL  336

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
              + +QL    ALEWRS+A+ G+  Y+K++G+LF+ VNSRH GESI DLS L+        
Sbjct  337   FVAIQLIFCCALEWRSEALGGMNFYQKLIGALFLSVNSRHAGESIADLSTLS--------  388

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKM  433
                  P     F IM                          +  LS + IL     R  +
Sbjct  389   -----PAILVLFAIM--------------------------MLVLSTYSIL--FHHRLLL  415

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFIL  253
              EDPLNF+V +IV+EV+SAYGNVGFSTGYSC RQ+K +G CKD  +GF GRWSN GK IL
Sbjct  416   SEDPLNFSVFSIVIEVVSAYGNVGFSTGYSCDRQLKHDGVCKDAWYGFAGRWSNEGKLIL  475

Query  252   IIVMFFGRLKKYHMKGGKAWKL  187
             I VMFFGRLKKY+M+GGKAWKL
Sbjct  476   IFVMFFGRLKKYNMRGGKAWKL  497



>ref|XP_010929481.1| PREDICTED: cation transporter HKT2-like [Elaeis guineensis]
Length=549

 Score =   303 bits (775),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 212/511 (41%), Positives = 313/511 (61%), Gaps = 28/511 (5%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             + F ++PF ++LSYF+ L L+G  A+ + KP   +F  + +D+ F + S+ TV+ + TVE
Sbjct  52    ITFHLSPFWIQLSYFVSLGLVGSLAMMILKPSNPAFSPRYVDMLFMSTSAVTVTGLGTVE  111

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVI-----------  1345
             ME FS+ Q+V +T LMFLGGE F   LGL   +            N+V            
Sbjct  112   MENFSSSQIVVLTLLMFLGGEVFVCLLGLLLRKDDPHGINPDTADNRVDPVVAELNPMDP  171

Query  1344  --VIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvih  1171
                ID +ELG          + P+ S     +   ++ ++ LG V ++      Y+++IH
Sbjct  172   SNTIDGIELGPTI-------VGPDTSLSDGGKDLRIDSVRYLGFVVLV------YVLLIH  218

Query  1170  vVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPG  991
              +G  L+ +YI  V +A+ VLK K + +  F+   TVS+F+N G +PTNENM +F  NPG
Sbjct  219   AIGSLLILLYIASVSSARDVLKVKSIHIFLFSWSATVSSFANGGLIPTNENMAIFNVNPG  278

Query  990   lllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFL  811
             LLL++IPQIL GNTL+P  LR  IW L + ++  EF  +L     + + HL    R+ FL
Sbjct  279   LLLLMIPQILAGNTLFPLFLRSVIWALRRCSKAAEFEYLLKHSRDIRFDHLLPNLRAAFL  338

Query  810   AATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapa  631
             + TV   I + + +  +L+W S    GL  Y+K+V +LF+ VN+RH GE+ +D+SLL+PA
Sbjct  339   SLTVLSFIAVMVVLSCSLDWNSAVFDGLDSYQKIVSALFMAVNTRHAGENSIDVSLLSPA  398

Query  630   vlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             VL L +VMMYLP  TTF PI + + +      + +K  +++ ++LSPL  + IFII+ICI
Sbjct  399   VLVLFIVMMYLPSSTTFLPIQENDASPGGNKKNKRKRRLVQMLILSPLSCVVIFIIVICI  458

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRW  277
             TER K+  DPLNF+ LNI+ EV+S YGN G STGYSCAR  Q+ P+ +C+DK + F G W
Sbjct  459   TERRKLSRDPLNFSTLNIIFEVMSGYGNAGLSTGYSCARFQQLHPDVKCQDKLYSFSGAW  518

Query  276   SNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             S+ GK IL  VM +GRLKK+ ++GGKAWK++
Sbjct  519   SDEGKLILAFVMLYGRLKKFSLEGGKAWKIN  549



>ref|XP_010048540.1| PREDICTED: probable cation transporter HKT7 [Eucalyptus grandis]
 gb|KCW80812.1| hypothetical protein EUGRSUZ_C02181 [Eucalyptus grandis]
Length=546

 Score =   302 bits (773),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 234/509 (46%), Positives = 321/509 (63%), Gaps = 15/509 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R L F V+PF ++L Y++ +SL G+  LK +       + +DLD+FFT+VS+ T SSMST
Sbjct  42    RFLLFHVHPFWIQLGYYLAVSLAGYLVLKATARDGSELRHRDLDLFFTSVSATTASSMST  101

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEK--NKVIVIDHVEL  1324
             VEME  S  QL+ M  LM L GE FTS L L   + K+    R+ E+   +   +D +EL
Sbjct  102   VEMEELSRAQLLVMIVLMLLSGEVFTSLLELQLLRLKLLKQSRLDEQADRRSGFVDCIEL  161

Query  1323  GLVTNNEYHNDLNPEDSAKS-NVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVA  1147
             G+ ++ +   D N  + AK+ +V+   + +         L++VVL YI+V HV+G  L+ 
Sbjct  162   GIPSSAQ-KVDSNQHNEAKAVSVRNPNMSNKLKYDAATCLSQVVLGYILVFHVLGSGLIT  220

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +Y+     AKQVL++KGL    F++FT VSTF++CGFVP NE M+ F+++PGLLLILIPQ
Sbjct  221   LYVYLDRDAKQVLERKGLRGDLFSLFTMVSTFASCGFVPLNEGMVAFRKSPGLLLILIPQ  280

Query  966   ilLGNTLYPACLRLAIWFLGKTT-RRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             +L GNTLY  CL  A+W L K + +R E    L +   +GY HL    R  ++  T    
Sbjct  281   VLAGNTLYAPCLHAALWALEKASAKRKELGDALRNGRDVGYFHLLGSVRCRYICLTALLF  340

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             + +QL +F  LEWRS  ++GLT Y+K+V SLF VVNSR+ GES  DLS+++PAVL L +V
Sbjct  341   VTVQLVLFCGLEWRSGIMSGLTPYQKLVCSLFQVVNSRYAGESAFDLSMVSPAVLVLFLV  400

Query  609   MMYLPPDTTFFPIMDENNNSKT-------KGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             MMYLPP T+F P   E  + K             +   +     LS +  L I ++ +CI
Sbjct  401   MMYLPPYTSFAP---EKYHQKVVLGRPTGNAAHHQSSTLGGYFTLSQISYLVICVVGVCI  457

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSN  271
             TER  M +DPLNF+ LNI VEVISAYGNVGF+TGYSC R+ K EG CKD  +GFVGRWS 
Sbjct  458   TERRAMVDDPLNFSALNIAVEVISAYGNVGFTTGYSCERRPKAEGYCKDATYGFVGRWSK  517

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GK I++ VMFFG+L K+  +GG+AW LS
Sbjct  518   TGKLIIVAVMFFGKLSKFSKRGGQAWDLS  546



>gb|ACT21087.1| high-affinity potassium transporter [Puccinellia tenuiflora]
Length=531

 Score =   301 bits (771),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 205/508 (40%), Positives = 315/508 (62%), Gaps = 11/508 (2%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssat  1516
             +++S  R +A  V+PF ++LSYF+ +++ G   L   KP    F    +D+ F + S+ T
Sbjct  29    LIVSVYRFVALNVHPFWIQLSYFLAIAIFGSVLLMSLKPSNPEFSPAYIDLLFLSTSALT  88

Query  1515  vssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID  1336
             VS +STV ME  S+ Q+V +T LMF+GGE F S LGL   +      + +   N   V  
Sbjct  89    VSGLSTVTMEDLSSSQIVVLTLLMFVGGEIFVSILGL-MLRVNHKDIQDLPSVNTSSV--  145

Query  1335  HVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFT  1156
              VEL  +       + + E++A++ +     ++ K    ++ L  V+  Y  +IHV+GF 
Sbjct  146   SVELEAIDGVALCEESSLEEAARA-IPPRSAKEFKRNSSIKCLVYVIFGYFAMIHVLGFL  204

Query  1155  LVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllil  976
             LV +YI  VPTA   LK+KG+++  F++  TVS+ +N G VP NENM +F ++ GLLL+L
Sbjct  205   LVLVYITRVPTASAPLKKKGINIVLFSISITVSSCANAGLVPANENMAIFSKHSGLLLLL  264

Query  975   ipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVF  796
                IL GNTL+P  LRL +WFLG+ T+  + + ++ +P  + +  L     + FL++TV 
Sbjct  265   SGMILAGNTLFPLFLRLLVWFLGRLTKVKDLQLMINNPLEMHFFSLLPRSTTMFLSSTVV  324

Query  795   GLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlali  616
             GL+ + +T+   ++W S    GL+ Y+K+V + F VVN RH+GE+ +D SL++  +L L 
Sbjct  325   GLVAVAVTLLCTVDWNSVVFDGLSPYQKIVNAFFTVVNVRHSGENSIDCSLMSTTILVLF  384

Query  615   vVMMYLPPDTTFFPIMD--ENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITER  442
             VVMMYLP   TF P  D  +     TKG   K+++ ++  + SPLG  ++F+I+ CITER
Sbjct  385   VVMMYLPSSATFAPPSDGTKTTEENTKG---KRWSSVQNFIFSPLGCNAVFVIVACITER  441

Query  441   EKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNM  268
              K++ DPLNF+ L ++ EVISAYGNVG STGYSC+R  Q+ PE  C+DK + F G WS+ 
Sbjct  442   RKIRNDPLNFSTLKMIFEVISAYGNVGLSTGYSCSRLHQLHPEIICQDKPYSFSGWWSDG  501

Query  267   GKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             GKF+L+++M +GRLK + M  GK WK++
Sbjct  502   GKFMLVLIMLYGRLKAFTMGTGKYWKVA  529



>gb|AEM55590.1| high-affinity potassium transporter [Hordeum vulgare]
Length=531

 Score =   301 bits (771),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 207/499 (41%), Positives = 315/499 (63%), Gaps = 4/499 (1%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  V+PF ++LSYF+ ++++G   L   KP    F    +D+ F + S+ TVS +ST
Sbjct  35    RFVALHVHPFWIQLSYFLAIAILGSVLLMSLKPSNPDFSPPYIDMLFLSTSALTVSGLST  94

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             + ME  S+ Q+V +T LM +GGE F S LGL    +     +    K   + ++  E+ L
Sbjct  95    ITMEDLSSAQIVVLTLLMLVGGEIFVSLLGLMLRVNHQDMPDLPRVKISSVPVELEEIDL  154

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
               N+   +D +  + A   +  +    +K    V+ L  VV  Y  VIH++GF LV +YI
Sbjct  155   -ANSMALSDESQLEEATHAITPKKCTGLKRSRSVKCLGYVVFGYFAVIHILGFLLVFLYI  213

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VPTA   L +KG+++  F++  TV++ +N G VPTNENM++F +N GLLL+L  QIL 
Sbjct  214   TRVPTASAPLNKKGINIVLFSLSVTVASIANGGLVPTNENMVIFSKNSGLLLLLSGQILA  273

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GN L+P  LRL +WFLG+ T+  E R ++ +P  + +G+L     + FL++T  GL+   
Sbjct  274   GNLLFPLFLRLLVWFLGRLTKVKELRLMIKNPEEVHFGNLLPRLPTVFLSSTAIGLVAAG  333

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
             +T+F A++W S    GL+ Y+K V + F+VVN+RH+GE+ +D SL++PA++ L +VMMYL
Sbjct  334   VTMFSAVDWNSSVFDGLSSYQKAVNAFFMVVNARHSGENSIDCSLMSPAIIVLFIVMMYL  393

Query  597   PPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPL  418
             PP  TF P  D +  +  +    K+ ++++K+  SPLG   IF+I+ CITER +++ DPL
Sbjct  394   PPSATFAP-PDGDIKTTNENTKAKRGSLVQKLAFSPLGFNIIFVIVACITERRRLRNDPL  452

Query  417   NFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKFILIIV  244
             NF+ LN++ EVISAYGNVG STGY C+R  Q+ PE  C+DK + F G WS+ GKF+LI+ 
Sbjct  453   NFSTLNMIFEVISAYGNVGLSTGYGCSRLHQLHPEIICQDKPYSFSGWWSDGGKFVLILA  512

Query  243   MFFGRLKKYHMKGGKAWKL  187
             M +GRLK + M  GK+WK+
Sbjct  513   MLYGRLKAFTMTMGKSWKV  531



>emb|CAJ01326.1| high-affinity sodium transporter [Hordeum vulgare subsp. vulgare]
 emb|CAJ01327.1| high-affinity sodium transporter [Hordeum vulgare subsp. vulgare]
 gb|AEA08582.1| high affinity potassium transporter [Hordeum vulgare]
 gb|AEM44691.1| high-affinity K+ transporter 1 [Hordeum vulgare subsp. spontaneum]
Length=531

 Score =   301 bits (771),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 207/499 (41%), Positives = 315/499 (63%), Gaps = 4/499 (1%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  V+PF ++LSYF+ ++++G   L   KP    F    +D+ F + S+ TVS +ST
Sbjct  35    RFVALHVHPFWIQLSYFLAIAILGSVLLMSLKPSNPDFSPPYIDMLFLSTSALTVSGLST  94

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             + ME  S+ Q+V +T LM +GGE F S LGL    +     +    K   + ++  E+ L
Sbjct  95    ITMEDLSSAQIVVLTLLMLVGGEIFVSLLGLMLRVNHQDMPDLPRVKISSVPVELEEIDL  154

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
               N+   +D +  + A   +  +    +K    V+ L  VV  Y  VIH++GF LV +YI
Sbjct  155   -ANSMALSDESQLEEATHAITPKKCTGLKRSRSVKCLGYVVFGYFAVIHILGFLLVFLYI  213

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VPTA   L +KG+++  F++  TV++ +N G VPTNENM++F +N GLLL+L  QIL 
Sbjct  214   TRVPTASAPLNKKGINIVLFSLSVTVASIANGGLVPTNENMVIFSKNSGLLLLLSGQILA  273

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GN L+P  LRL +WFLG+ T+  E R ++ +P  + +G+L     + FL++T  GL+   
Sbjct  274   GNLLFPLFLRLLVWFLGRLTKVKELRLMIKNPEEVHFGNLLPRLPTVFLSSTAIGLVAAG  333

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
             +T+F A++W S    GL+ Y+K V + F+VVN+RH+GE+ +D SL++PA++ L +VMMYL
Sbjct  334   VTMFSAVDWNSSVFDGLSSYQKAVNAFFMVVNARHSGENSIDCSLMSPAIIVLFIVMMYL  393

Query  597   PPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPL  418
             PP  TF P  D +  +  +    K+ ++++K+  SPLG   IF+I+ CITER +++ DPL
Sbjct  394   PPSATFAP-PDGDIKTTNENTKAKRGSLVQKLAFSPLGFNIIFVIVACITERRRLRNDPL  452

Query  417   NFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKFILIIV  244
             NF+ LN++ EVISAYGNVG STGY C+R  Q+ PE  C+DK + F G WS+ GKF+LI+ 
Sbjct  453   NFSTLNMIFEVISAYGNVGLSTGYGCSRLHQLHPEIICQDKPYSFSGWWSDGGKFVLILA  512

Query  243   MFFGRLKKYHMKGGKAWKL  187
             M +GRLK + M  GK+WK+
Sbjct  513   MLYGRLKAFTMTMGKSWKV  531



>gb|AER42622.1| high-affinity potassium uptake transporter [Hordeum brevisubulatum]
Length=531

 Score =   300 bits (768),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 211/503 (42%), Positives = 315/503 (63%), Gaps = 12/503 (2%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  V+PF ++LSYF+ ++++G   L   KP    F    +D+ F + S+ TVS +ST
Sbjct  35    RFVALHVHPFWIQLSYFLAIAILGSVLLMSLKPSNPDFSPPYIDMLFLSTSALTVSGLST  94

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             + ME  S+ Q+V +T LM +GGE F S LGL    +   T +    K   + ++  E+ L
Sbjct  95    ITMEDLSSSQIVVLTLLMLVGGEIFVSLLGLMLRVNHQDTPDLPSVKISTVPVELEEIDL  154

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
               N+    D +  + A   +  +   ++K    V+ L  VV  Y  +IHV+GF LV +YI
Sbjct  155   -ANSVALCDESQLEEATHAIPPKKCTELKRGRSVKCLGYVVFGYFAMIHVLGFLLVFLYI  213

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VPTA   L +KG+++  F++  TV++ +N G VPTNENM +F +N GLLL+L  QIL 
Sbjct  214   THVPTASAPLNKKGINIVLFSLSVTVASIANGGLVPTNENMAIFSKNSGLLLLLSGQILA  273

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GN L+P  LRL +WFLG+ T+  E R ++ +P  + +G+L     + FL++T  GL+   
Sbjct  274   GNLLFPLLLRLLVWFLGRLTKVKELRLMIKNPEEVHFGNLLPRLPTLFLSSTAVGLVAAG  333

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
              T+F  ++W S    GL+ Y+K V + F+VVN+RH+GE+ +D SL++PA++ L +VMMYL
Sbjct  334   ATMFSTVDWNSSVFDGLSPYQKTVNAFFMVVNARHSGENSIDCSLMSPAIIVLFIVMMYL  393

Query  597   PPDTTFFP----IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMK  430
             PP  TF P    I   N N+K      K+ ++++K+  SPLG   IF+I+ CITER +++
Sbjct  394   PPSATFAPPNGDIKTTNENTKA-----KRGSLVQKLAFSPLGFNIIFVIVACITERRRLR  448

Query  429   EDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKFI  256
              DPLNF+ LN++ EVISAYGN G STGYSC+R  Q+ PE  C+DK + F G WS+ GKF+
Sbjct  449   NDPLNFSTLNMIFEVISAYGNAGLSTGYSCSRLHQLHPEIICQDKPYSFSGWWSDGGKFL  508

Query  255   LIIVMFFGRLKKYHMKGGKAWKL  187
             LI+VM +GRLK + M  GK+WK+
Sbjct  509   LILVMLYGRLKAFTMTTGKSWKV  531



>ref|XP_008798150.1| PREDICTED: cation transporter HKT1-like [Phoenix dactylifera]
Length=538

 Score =   300 bits (767),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 221/518 (43%), Positives = 335/518 (65%), Gaps = 20/518 (4%)
 Frame = -1

Query  1710  RNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvffta  1531
             R    ++M   R  +FRV+PF ++L YF+ L+L+G  A+ V KP   +F  + +D+ F +
Sbjct  30    RCIRELVMFLYRFFSFRVSPFWIQLCYFVSLALLGSLAMMVLKPDNPAFGPRYVDMLFMS  89

Query  1530  vssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNK  1351
             VS+ TVS + TVEME FS+ Q+V +  LMFLGG+     LGL F +S+      +    +
Sbjct  90    VSALTVSGLGTVEMENFSSSQIVVLALLMFLGGDVLVCLLGLLFRRSRHDNRPEITSSRR  149

Query  1350  VIVIDHVELGLVTNNEYHNDLNPEDSAKS-----NVQIEVVEDIKLL--GCVRVLARvvl  1192
             V   D + + L       + + P ++  +     +V    ++D K L   C+R L  VVL
Sbjct  150   V---DSIGIEL-------DSMKPSNTLDNIELGRDVSGTPIDDGKDLMSSCIRYLGSVVL  199

Query  1191  syivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMI  1012
              +++V HVVG   + +YI  V +A+ VLK+KG++L  F++FTT+S+F+N G +PTNENM+
Sbjct  200   CFVIVFHVVGCLAIFLYIILVSSARDVLKRKGINLFLFSIFTTISSFANGGLIPTNENML  259

Query  1011  VFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFS  832
             +F  NPGL LI+IPQIL GN L P CLRL IW L + T+ +EF  +L +P+ + +GHL  
Sbjct  260   IFNNNPGLYLIIIPQILGGNLLLPLCLRLVIWALRRLTKAVEFEYMLKNPSEIQFGHLRP  319

Query  831   GRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIld  652
               ++ FL+ T  G I   + +F +++W S    GL  YEK+V +LF+ VNSRH+GE+ +D
Sbjct  320   DLQTLFLSLTCIGFIAAMVALFCSMDWTSAVFQGLNSYEKLVSALFMAVNSRHSGENSID  379

Query  651   lsllapavlalivVMMYLPPDTTFFPIMDENNNSK-TKGCSPKKFNIIEKILLSPLGNLS  475
             +SL +P+V+ L ++MMYLPP  +F PI +  ++S+  +  + K ++ ++ +LLS L ++ 
Sbjct  380   ISLASPSVIVLFILMMYLPPSVSFVPIHENESSSEGDRRENEKSWSPVDNLLLSQLSSIV  439

Query  474   IFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDK  301
             IFII+ICITER+K+ EDPLNF+ LN++ EV S YGNVG S GYSC+R  ++ P+  C D+
Sbjct  440   IFIIMICITERKKLTEDPLNFSTLNVIFEVTSGYGNVGLSMGYSCSRFLRLHPDAHCLDR  499

Query  300   QFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
              + F G WSN GK IL I+M +GRLK + ++ GKAWKL
Sbjct  500   AYSFSGAWSNEGKLILAIIMLYGRLKNFTIENGKAWKL  537



>ref|XP_010929482.1| PREDICTED: cation transporter HKT1-like [Elaeis guineensis]
Length=543

 Score =   298 bits (764),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 217/519 (42%), Positives = 320/519 (62%), Gaps = 43/519 (8%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             + F ++PF ++LSYF+ L+++G   +   KP   +F    +D+ F + S+ T++S+ +VE
Sbjct  43    IVFHLSPFWIQLSYFVSLAMLGSLIMMKLKPSNPAFSPSYVDMLFMSTSAVTLASLGSVE  102

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVT  1312
             ME FS+ Q+V +T LMFLGGE F S +GL                  ++ I     G + 
Sbjct  103   MENFSSSQIVVLTLLMFLGGEIFVSLIGL------------------LLRIKDDGYGGIN  144

Query  1311  NNEYHN-------DLNPEDSAKSNVQIEVV-------------EDIKLLGCVRVLARvvl  1192
              +  HN       +LNP D + +   +EV              +D++L   VR L  V+ 
Sbjct  145   PDTAHNRVDPVVPELNPMDPSNAIDCVEVGPTIICSETSLSDGKDLRL-RSVRYLGHVLW  203

Query  1191  syivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMI  1012
              Y+++IHV G   +  YI  V +A  VLK+KG+++  F++ TTVS+F+N GF+PTNENM 
Sbjct  204   FYLLLIHVTGSLSILSYIASVTSAWDVLKRKGINVFLFSLSTTVSSFANAGFIPTNENMA  263

Query  1011  VFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGS-PNGLGYGHLF  835
             +FK NPGLLL++IPQIL GNTL+P  LRL IW L + T   EF  +L +    +G+ HL 
Sbjct  264   IFKVNPGLLLLIIPQILAGNTLFPLFLRLVIWALRRCTGAAEFEYLLKNYSREIGFRHLL  323

Query  834   SGR-RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESI  658
                 R+ FL+ TV       + +F +L+W S    GL  Y+K++ +LF+ VN+RH GE+ 
Sbjct  324   PNLLRTAFLSLTVLSFTATMVVLFCSLDWNSSVFDGLNSYQKIINALFMAVNTRHAGENS  383

Query  657   ldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNL  478
             +D+SL++PAVL   +VMMYLP  TTF P+ +++ +S     + ++  +++ I+LSPL  +
Sbjct  384   IDVSLVSPAVLVFFIVMMYLPSSTTFLPVQEDDTSSAGNKKNNRRRRLVDNIILSPLSYI  443

Query  477   SIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKD  304
              IFII ICI ER  +  DPLNF+ LNI  EV+SAYG VG STGYSCAR  Q+ P+ +C+D
Sbjct  444   VIFIIAICIIERRNLSSDPLNFSALNITFEVMSAYGTVGLSTGYSCARLLQLHPDVKCQD  503

Query  303   KQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             K + FVG WS+ GK IL  VM +GRLKK+ +KGGKAW++
Sbjct  504   KLYSFVGAWSDEGKLILAFVMLYGRLKKFSLKGGKAWRI  542



>tpg|DAA54361.1| TPA: hypothetical protein ZEAMMB73_606677 [Zea mays]
Length=493

 Score =   297 bits (760),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 224/495 (45%), Positives = 310/495 (63%), Gaps = 39/495 (8%)
 Frame = -1

Query  1587  SKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLG  1408
             S PRP       LD+ FT+VS+ TVSSM  VEME FSN QL+ MT LM LGGE FTS LG
Sbjct  11    SVPRP-----SALDLLFTSVSATTVSSMIAVEMESFSNAQLLLMTLLMLLGGEVFTSMLG  65

Query  1407  LHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIK-  1231
             LHF  +K+         N      H    L  +   H  +  E  A + VQ+E+    K 
Sbjct  66    LHFTCTKLRNKRETPHNNL-----HGN-SLEQSRRRHRPMEMEAQAAA-VQMELAGFNKD  118

Query  1230  ----LLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavftt  1063
                      R+L  +VL YI+V+H+ G+ L+ +Y+  V +A+ VL +K + L+TF+VFT 
Sbjct  119   GHGDFASMARLLMFIVLGYILVVHIAGYALILIYLSVVGSARAVLVRKRISLSTFSVFTV  178

Query  1062  vstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEF  883
             VS+F+NCGFVPTNE M+ FK  PG+LL+++P ILLGNTL+P  LRL+I  L + TR  + 
Sbjct  179   VSSFANCGFVPTNEGMVSFKSFPGMLLLVMPHILLGNTLFPIFLRLSITALERVTRWRDL  238

Query  882   RQIL------------GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDA  739
              ++L             +   +GY HL  G R+ FLA TV   + +QL ++ A+EW S  
Sbjct  239   CELLRDRGPGGGPAAAAAAAAIGYDHLLPGPRTWFLALTVAVFLAVQLVLYCAMEWGSGG  298

Query  738   IAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDEN  559
             + GL  ++K+V ++F+ VNSRH+GE ++DL+ ++ AV+ L V+MMYLPP TTF P+  E+
Sbjct  299   LGGLNAFQKLVAAVFMSVNSRHSGEMVVDLATVSSAVVVLYVLMMYLPPYTTFLPVAVED  358

Query  558   NNSKTKGCSPKK---------FNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNV  406
             +  +     P            +I   +L+SPL  L+IFI++ICITER ++  DP+NF+V
Sbjct  359   DQQQQNEAQPHDNSTSKSSTSISIWHNLLMSPLSCLTIFIVVICITERRQIARDPINFSV  418

Query  405   LNIVVEVISAYGNVGFSTGYSCARQIKPEGQ-CKDKQFGFVGRWSNMGKFILIIVMFFGR  229
             LNIVVEVISAYGNVGFSTGYSC+RQ+ P G  CKD      G+WS  GK  L+ +MF+GR
Sbjct  419   LNIVVEVISAYGNVGFSTGYSCSRQVTPGGGCCKDAWVSLSGKWSVEGKLTLMAIMFYGR  478

Query  228   LKKYHMKGGKAWKLS  184
             LKK+ M GG+AW+L+
Sbjct  479   LKKFSMLGGQAWRLN  493



>emb|CDX86866.1| BnaA09g22560D [Brassica napus]
Length=513

 Score =   296 bits (757),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 233/495 (47%), Positives = 301/495 (61%), Gaps = 36/495 (7%)
 Frame = -1

Query  1614  LIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLG  1435
             L+GF ALKVSKPR  S +  DLD+FFT+VS+ TVSSMST++MEVFSN QL+ +T LMFLG
Sbjct  34    LLGFLALKVSKPRTTS-RPHDLDLFFTSVSAITVSSMSTIDMEVFSNTQLIIITILMFLG  92

Query  1434  GECFTSWLGLHF--FQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSN  1261
             GE FTS+L L+F  F + V    ++       +   + +   T +   +  N  D  K  
Sbjct  93    GEVFTSFLDLYFSHFSNFVFPHSKIRH-----LTGSLNIKPPTEDRRRDLENITDHLKRP  147

Query  1260  VQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
              QI       L   V       L Y +V ++ G  LV +Y+ FV TAK VL  K +   T
Sbjct  148   SQINERASKYLYSVV-------LGYHLVTNLAGSVLVLVYVTFVKTAKVVLSSKEISPVT  200

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F++FTTVSTF NCGFVPT ENM++F++N GLL +LIPQI +GNTL+P  L L IW L K 
Sbjct  201   FSIFTTVSTFGNCGFVPTKENMVIFRKNSGLLWLLIPQIFMGNTLFPCFLFLLIWGLDKI  260

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R EF  IL +   +GY HL S R    L  TV G + +Q  VF   EW S ++ G+  
Sbjct  261   TKREEFGYILKNHKTMGYSHLLSLRLCVLLGLTVLGFVMIQFFVFCTFEWNSVSLEGMNP  320

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMM----------YLPPDTTFFPI  571
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L   + +           YLPP T F P+
Sbjct  321   YEKLVGSLFQVVNSRHTGENIVDLSTLSPAILWNKLFLAMNFNTFSLKRYLPPYTLFMPL  380

Query  570   M------DENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFN  409
                    +E  +        KK        +S L  L+I +  I ITE + ++ DPLNFN
Sbjct  381   TTIKKYKEEVEDHAGNEEKRKK----TGFFVSQLSFLAICVFFISITESQNLRRDPLNFN  436

Query  408   VLNIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFG  232
             +LNI +EVISA+GNVGF+TGYSC R +    G CKD  +GFVGRWS  GKFILIIVMF+G
Sbjct  437   ILNITLEVISAFGNVGFTTGYSCKRCLDINNGSCKDTSYGFVGRWSPNGKFILIIVMFYG  496

Query  231   RLKKYHMKGGKAWKL  187
             R K++  K G+ W L
Sbjct  497   RFKQFTAKSGRPWIL  511



>emb|CAH66787.1| OSIGBa0113I13.13 [Oryza sativa Indica Group]
 gb|EEC77958.1| hypothetical protein OsI_17315 [Oryza sativa Indica Group]
 gb|AEH68831.1| sodium transporter HKT1;4 [Oryza sativa Indica Group]
Length=500

 Score =   295 bits (754),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 252/505 (50%), Positives = 327/505 (65%), Gaps = 8/505 (2%)
 Frame = -1

Query  1689  MSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvs  1510
             M T RR A       + ++YF+ +S +G+  L V K R      + +D FFTAVS+ATVS
Sbjct  1     MPTSRR-ALAGGALSMHVAYFLAISCLGYGLLGVLKVREPGAAPRRIDRFFTAVSAATVS  59

Query  1509  smstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHV  1330
             SMSTVEMEVFSN QLV +T LM LGGE F S +GL    SK+ + + +    +V     V
Sbjct  60    SMSTVEMEVFSNGQLVVLTVLMLLGGEVFVSLVGLASKWSKLRS-DAMDRSQRVESHGDV  118

Query  1329  ELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
              L  +   +  N  +  + A S  +    + ++    VR L  +VL+   V+HVVG   V
Sbjct  119   ALADIDGGDVENPTSSGEEAASRRRPMDADTLRH-NAVRALFYIVLAIFAVVHVVGAVAV  177

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
             A Y+   P A++ L  K L+  TFAVFTTVSTFSNCGF+PTNENM+VFKR+  L L+L+P
Sbjct  178   AAYVLASPGARRTLGDKSLNTWTFAVFTTVSTFSNCGFMPTNENMVVFKRDAPLQLLLVP  237

Query  969   qilLGNTLYPACLRLAIWFLGKTTRR---IEFRQILGSPNGLGYGHLFSGRRSGFLAATV  799
             Q+L GNTL+   L   +W     TRR   +E  +  G     GY HL   RR   LAATV
Sbjct  238   QVLAGNTLFAPLLAACVWAAAAATRREELVEMAREGGRAAAAGYAHLMPARRCWMLAATV  297

Query  798   FGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
                + + + +   +EW   A+ G++ +EKVV +LF+ VN+RHTGES +DLS+LAPA+L L
Sbjct  298   AAFVAVLMALVCGMEW-GGALQGMSPWEKVVNALFLAVNARHTGESTVDLSILAPAILVL  356

Query  618   ivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
              V+MMYLPP TT+FP  +EN+ +K      +   ++E  LLS L  L+IF+I ICITER 
Sbjct  357   FVLMMYLPPYTTWFPF-EENSTTKDSNAENQGIRLLESTLLSQLSYLTIFVIAICITERR  415

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKF  259
             K+KEDPLNF+VL+IVVEV+SAYGNVGFS GYSC+RQI P+  C DK  GFVGRWS+ GK 
Sbjct  416   KLKEDPLNFSVLSIVVEVVSAYGNVGFSMGYSCSRQINPDHLCTDKWTGFVGRWSDSGKL  475

Query  258   ILIIVMFFGRLKKYHMKGGKAWKLS  184
             ILI VMFFGRLKK+ MKGGKAWKLS
Sbjct  476   ILIFVMFFGRLKKFSMKGGKAWKLS  500



>ref|NP_001053810.1| Os04g0607600 [Oryza sativa Japonica Group]
 sp|Q7XPF7.2|HKT7_ORYSJ RecName: Full=Probable cation transporter HKT7; Short=OsHKT7 
[Oryza sativa Japonica Group]
 emb|CAD37197.1| putative sodium transporter [Oryza sativa Japonica Group]
 dbj|BAF15724.1| Os04g0607600 [Oryza sativa Japonica Group]
 dbj|BAG98930.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00215.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   295 bits (754),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 254/509 (50%), Positives = 328/509 (64%), Gaps = 16/509 (3%)
 Frame = -1

Query  1689  MSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvs  1510
             M T RR A       + ++YF+ +S +G+  L V K R      + +D FFTAVS+ATVS
Sbjct  1     MPTSRR-ALAGGALSMHVAYFLAISCLGYGLLGVLKVREPGAAPRRIDRFFTAVSAATVS  59

Query  1509  smstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTT----ERVLEKNKVIV  1342
             SMSTVEMEVFSN QLV +T LM LGGE F S +GL    SK+ +      R +E +  + 
Sbjct  60    SMSTVEMEVFSNGQLVVLTVLMLLGGEVFVSLVGLASKWSKLRSDAMDRSRRVESHGDVA  119

Query  1341  IDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVG  1162
             +  ++ G V N         E++A     ++   D      VR L  +VL+   V+HVVG
Sbjct  120   LADIDGGDVENPTSSG----EEAASRRRPMDA--DTLRHNAVRALFYIVLAIFAVVHVVG  173

Query  1161  FTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlll  982
                VA Y+   P A++ L  K L+  TFAVFTTVSTFSNCGF+PTNENM+VFKR+  L L
Sbjct  174   AVAVAAYVLASPGARRTLGDKSLNTWTFAVFTTVSTFSNCGFMPTNENMVVFKRDAPLQL  233

Query  981   ilipqilLGNTLYPACLRLAIWFLGKTTRR---IEFRQILGSPNGLGYGHLFSGRRSGFL  811
             +L+PQ+L GNTL+   L   +W     TRR   +E  +  G     GY HL   RR   L
Sbjct  234   LLVPQVLAGNTLFAPLLAACVWAAAAATRREELVEMAREGGRAAAAGYAHLMPARRCWML  293

Query  810   AATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapa  631
             AATV   + + + +   +EW   A+ G++ +EKVV +LF+ VN+RHTGES +DLS+LAPA
Sbjct  294   AATVAAFVAVLMALVCGMEW-GGALQGMSPWEKVVNALFLAVNARHTGESTVDLSILAPA  352

Query  630   vlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICI  451
             +L L V+MMYLPP TT+FP  +EN+ +K      +   ++E  LLS L  L+IF+I ICI
Sbjct  353   ILVLFVLMMYLPPYTTWFPF-EENSTTKDSNAENQGIRLLESTLLSQLSYLTIFVIAICI  411

Query  450   TEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSN  271
             TER K+KEDPLNF+VL+IVVEV+SAYGNVGFS GYSC+RQI P+  C DK  GFVGRWS+
Sbjct  412   TERRKLKEDPLNFSVLSIVVEVVSAYGNVGFSMGYSCSRQINPDHLCTDKWTGFVGRWSD  471

Query  270   MGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
              GK ILI VMFFGRLKK+ MKGGKAWKLS
Sbjct  472   SGKLILIFVMFFGRLKKFSMKGGKAWKLS  500



>gb|AEM44690.1| high-affinity K+ transporter 4 [Hordeum vulgare subsp. spontaneum]
Length=576

 Score =   296 bits (759),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 297/496 (60%), Gaps = 11/496 (2%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALK----VSKPRPISFKLKDLDvfftavssatvssm  1504
             L F+ NP +++L Y + +S  GF ALK    ++KP P     ++LD+ FT+VS+ TVSSM
Sbjct  66    LVFKSNPLIVQLIYLLSISFAGFLALKNLRPLNKPSP-----RNLDLMFTSVSTVTVSSM  120

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
             +TVEME FS  QL     LM LGGE F S +GLHF   + +T E    +   I  D +E 
Sbjct  121   ATVEMEEFSGQQLWVFIILMILGGEVFASMIGLHFKNIRANTEEAFQTRLDFISRD-IES  179

Query  1323  GLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTLVA  1147
               V  N   N++    S ++    +V E   +    R VLA VV  Y +   V    ++ 
Sbjct  180   SDVFTNSGQNNMEGAQSEETMPHNQVQESKAMNQKSRNVLAHVVAVYFIAAIVCSSVVIT  239

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +++     A+ +LK K + + TF++FT VS+F+NCGF P N++M +FK NP  LL+L PQ
Sbjct  240   IFLWIDSDARHLLKSKHIKIWTFSIFTAVSSFANCGFTPLNDSMAIFKNNPTFLLLLTPQ  299

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             IL+GNTL+   LRL+IW LGK + R E+  IL  P  +GY HL   + S  L  T   LI
Sbjct  300   ILVGNTLFAPLLRLSIWTLGKVSSREEYAYILQHPKEIGYRHLQPHKNSVKLVLTGVMLI  359

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              LQ  +    EW S ++ G+  ++K+ GSLF   NSRH GE+++++S L+P ++ +  + 
Sbjct  360   LLQAMLICYFEWDSKSLEGMGWFQKLTGSLFQSANSRHAGETVINISTLSPPIMVIFALA  419

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLP  T+      +N +   K  +P      +K  ++    L IF IL CITER+ M  
Sbjct  420   MYLPSGTSILASRGDNRSLADKKENPNGRATWKKFAMTKRTCLVIFTILACITERKSMTA  479

Query  426   DPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILII  247
             DPLNF++ +++ EVISAYGNVG+S GYSC + +KP+  C+D  +GFVGRWS+ G+ I+I+
Sbjct  480   DPLNFSIFSVIFEVISAYGNVGYSLGYSCDKLVKPDATCRDASYGFVGRWSDQGRLIIIL  539

Query  246   VMFFGRLKKYHMKGGK  199
             VMF GR K Y++KG K
Sbjct  540   VMFLGRFKAYNLKGKK  555



>sp|Q93XI5.1|HKT2_ORYSI RecName: Full=Cation transporter HKT2; Short=OsHKT2; AltName: 
Full=Po-OsHKT2 [Oryza sativa Indica Group]
 dbj|BAB61791.1| potassium-sodium symporter [Oryza sativa Indica Group]
Length=530

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 210/504 (42%), Positives = 316/504 (63%), Gaps = 13/504 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R ++  V+PF ++LSYF+++S++G   L   KP    FK   +D+ F + S+ TVS +ST
Sbjct  32    RFVSLHVHPFWIQLSYFLLISILGSVLLMFLKPSSPEFKPGYIDMLFLSTSAMTVSGLST  91

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             +EMEV S+ Q+V +T LM +GGE F S+LGL          E   ++     +  V + L
Sbjct  92    IEMEVLSSSQIVVLTLLMLVGGEVFVSFLGLMLRLKHKHNPEFSGDR-----VSSVPIEL  146

Query  1317  VTNNEYHNDLNPED----SAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTL  1153
              T       ++ E+    +A  +V    ++D+K    +R  L  VV SY VVIHVVGF L
Sbjct  147   DTIEPTRTVMSSEELQIEAAAPDVPSSTIKDLKRSKRLRWFLGFVVFSYFVVIHVVGFLL  206

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V  YI  V +AK  LK+KG+++  F+   TVS+F+N G VPTNENM +F +NPGLLL+ I
Sbjct  207   VLWYISRVSSAKAPLKKKGINIALFSFSVTVSSFANGGLVPTNENMAIFSKNPGLLLLFI  266

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
              QIL GNTLYP  LR+ IWFLGK T+  + + ++ + + L Y +L     + FLA+TV G
Sbjct  267   GQILAGNTLYPLFLRILIWFLGKVTKLKDLKLMIKNSDELQYDYLLPKLPTAFLASTVIG  326

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
             L+   +T+F +++W S    GL+ Y+K++ +LF+ VN+RH+GE+ +D SL+APAVL L +
Sbjct  327   LMASLVTLFGSVDWNSSVFDGLSSYQKIINALFMAVNARHSGENSIDCSLIAPAVLVLFI  386

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKM  433
             ++MYLPP TT F + + +  +  K    K   ++  +  S L   ++F+I+  ITER ++
Sbjct  387   ILMYLPPSTT-FALSNGDEKTANKKAKRKLGLVVRNLAFSQLACNAVFVIVALITERSRL  445

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKF  259
             + DPLNF+ LN++ EVISAYGNVG +TGYSC+R  ++ P   C+DK +   G WS+ GK 
Sbjct  446   RNDPLNFSALNMIFEVISAYGNVGLTTGYSCSRLQKLHPGSICQDKPYSLSGWWSDEGKL  505

Query  258   ILIIVMFFGRLKKYHMKGGKAWKL  187
             +L+ VM +GRLK +    G+ W+L
Sbjct  506   LLVSVMLYGRLKAFTKGTGEYWRL  529



>gb|AEA08583.1| high affinity potassium transporter [Hordeum vulgare]
Length=586

 Score =   296 bits (759),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 297/496 (60%), Gaps = 11/496 (2%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALK----VSKPRPISFKLKDLDvfftavssatvssm  1504
             L F+ NP +++L Y + +S  GF ALK    ++KP P     ++LD+ FT+VS+ TVSSM
Sbjct  76    LVFKSNPLIVQLIYLLSISFAGFLALKNLRPLNKPSP-----RNLDLMFTSVSTVTVSSM  130

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
             +TVEME FS  QL     LM LGGE F S +GLHF   + +T E    +   I  D +E 
Sbjct  131   ATVEMEEFSGQQLWVFIILMILGGEVFASMIGLHFKNIRANTEEAFQTRLDFISRD-IES  189

Query  1323  GLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTLVA  1147
               V  N   N++    S ++    +V E   +    R VLA VV  Y +   V    ++ 
Sbjct  190   SDVFTNSGQNNMEGAQSEETMPHNQVQESKAMNQKSRNVLAHVVAVYFIAAIVCSSVVIT  249

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +++     A+ +LK K + + TF++FT VS+F+NCGF P N++M +FK NP  LL+L PQ
Sbjct  250   IFLWIDSDARHLLKSKHIKIWTFSIFTAVSSFANCGFTPLNDSMAIFKNNPTFLLLLTPQ  309

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             IL+GNTL+   LRL+IW LGK + R E+  IL  P  +GY HL   + S  L  T   LI
Sbjct  310   ILVGNTLFAPLLRLSIWTLGKVSSREEYAYILQHPKEIGYRHLQPHKNSVKLVLTGVMLI  369

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              LQ  +    EW S ++ G+  ++K+ GSLF   NSRH GE+++++S L+P ++ +  + 
Sbjct  370   LLQAMLICYFEWDSKSLEGMGWFQKLTGSLFQSANSRHAGETVINISTLSPPIMVIFALA  429

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLP  T+      +N +   K  +P      +K  ++    L IF IL CITER+ M  
Sbjct  430   MYLPSGTSILASRGDNRSLADKKENPNGRATWKKFAMTKRTCLVIFTILACITERKSMTA  489

Query  426   DPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILII  247
             DPLNF++ +++ EVISAYGNVG+S GYSC + +KP+  C+D  +GFVGRWS+ G+ I+I+
Sbjct  490   DPLNFSIFSVIFEVISAYGNVGYSLGYSCDKLVKPDATCRDASYGFVGRWSDQGRLIIIL  549

Query  246   VMFFGRLKKYHMKGGK  199
             VMF GR K Y++KG K
Sbjct  550   VMFLGRFKAYNLKGKK  565



>gb|ABN48305.1| potassium/sodium transporter HKT2;2 [Oryza sativa Indica Group]
Length=530

 Score =   295 bits (754),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 211/504 (42%), Positives = 316/504 (63%), Gaps = 13/504 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R ++  V+PF ++LSYF+++S++G   L   KP    FK   +D+ F + S+ TVS +ST
Sbjct  32    RFVSLHVHPFWIQLSYFLLISILGSVLLMFLKPSSPEFKPGYIDMLFLSTSAMTVSGLST  91

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             +EMEV S+ Q+V +T LM +GGE F S+LGL          E   ++     +  V + L
Sbjct  92    IEMEVLSSSQIVVLTLLMLVGGEVFVSFLGLMLRLKHKHNPEFSGDR-----VSSVPIEL  146

Query  1317  VTNNEYHNDLNPED----SAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTL  1153
              T       ++ E+    +A  +V    ++D+K    +R  L  VV SY VVIHVVGF L
Sbjct  147   DTIEPTRTVMSSEELQIEAAVPDVPSSTIKDLKRSKRLRWFLGFVVFSYFVVIHVVGFLL  206

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             V  YI  V +AK  LK+KG+++  F+   TVS+F+N G VPTNENM +F +NPGLLL+ I
Sbjct  207   VLWYISRVSSAKAPLKKKGINIALFSFSVTVSSFANGGLVPTNENMAIFSKNPGLLLLFI  266

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
              QIL GNTLYP  LR+ IWFLGK T+  + + ++ + + L Y +L     + FLA+TV G
Sbjct  267   GQILAGNTLYPLFLRILIWFLGKVTKLKDLKLMIKNSDELQYDYLLPKLPTAFLASTVIG  326

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
             L+   +T+F A++W S    GL+ Y+K++ +LF+ VN+RH+GE+ +D SL+APAVL L +
Sbjct  327   LMASLVTLFGAVDWNSSVFDGLSSYQKIINALFMAVNARHSGENSIDCSLIAPAVLVLFI  386

Query  612   VMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKM  433
             ++MYLPP TT F + + +  +  K    K   ++  +  S L   ++F+I+  ITER ++
Sbjct  387   ILMYLPPSTT-FALSNGDEKTANKKEKRKLGLVVRNLAFSQLACNAVFVIVALITERSRL  445

Query  432   KEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKF  259
             + DPLNF+ LN++ EVISAYGNVG +TGYSC+R  ++ P   C+DK +   G WS+ GK 
Sbjct  446   RNDPLNFSALNMIFEVISAYGNVGLTTGYSCSRLQKLHPGSICQDKPYSLSGWWSDEGKL  505

Query  258   ILIIVMFFGRLKKYHMKGGKAWKL  187
             +L+ VM +GRLK +    G+ W+L
Sbjct  506   LLVSVMLYGRLKAFTKGTGEYWRL  529



>dbj|BAJ95374.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=586

 Score =   296 bits (758),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 297/496 (60%), Gaps = 11/496 (2%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALK----VSKPRPISFKLKDLDvfftavssatvssm  1504
             L F+ NP +++L Y + +S  GF ALK    ++KP P     ++LD+ FT+VS+ TVSSM
Sbjct  76    LVFKSNPLIVQLIYLLSISFAGFLALKNLRPLNKPSP-----RNLDLMFTSVSTVTVSSM  130

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
             +TVEME FS  QL     LM LGGE F S +GLHF   + +T E    +   I  D +E 
Sbjct  131   ATVEMEEFSGQQLWVFIILMILGGEVFASMIGLHFKNIRANTEEAFQTRLDFISRD-IES  189

Query  1323  GLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTLVA  1147
               V  N   N++    S ++    +V E   +    R VLA VV  Y +   V    ++ 
Sbjct  190   SDVFTNSGQNNMEGAQSEETMPHNQVQESKAMNQKSRNVLAHVVAVYFIAAIVCSSVVIT  249

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +++     A+ +LK K + + TF++FT VS+F+NCGF P N++M +FK NP  LL+L PQ
Sbjct  250   IFLWIDSDARHLLKSKHIKIWTFSIFTAVSSFANCGFTPLNDSMAIFKNNPTFLLLLTPQ  309

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             IL+GNTL+   LRL+IW LGK + R E+  IL  P  +GY HL   + S  L  T   LI
Sbjct  310   ILVGNTLFAPLLRLSIWTLGKVSSREEYAYILQHPKEIGYRHLQPHKNSVKLVLTGVMLI  369

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              LQ  +    EW S ++ G+  ++K+ GSLF   NSRH GE+++++S L+P ++ +  + 
Sbjct  370   LLQAMLICYFEWDSKSLEGMGWFQKLTGSLFQSANSRHAGETVINISTLSPPIMVIFALA  429

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLP  T+      +N +   K  +P      +K  ++    L IF IL CITER+ M  
Sbjct  430   MYLPSGTSILASRGDNRSLADKKENPNGRATWKKFSMTKRTCLVIFTILTCITERKSMTA  489

Query  426   DPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILII  247
             DPLNF++ +++ EVISAYGNVG+S GYSC + +KP+  C+D  +GFVGRWS+ G+ I+I+
Sbjct  490   DPLNFSIFSVIFEVISAYGNVGYSLGYSCDKLLKPDATCRDASYGFVGRWSDQGRLIIIL  549

Query  246   VMFFGRLKKYHMKGGK  199
             VMF GR K Y++KG K
Sbjct  550   VMFLGRFKAYNLKGKK  565



>emb|CDX99535.1| BnaC09g24570D [Brassica napus]
Length=525

 Score =   294 bits (752),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 233/505 (46%), Positives = 302/505 (60%), Gaps = 44/505 (9%)
 Frame = -1

Query  1614  LIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLG  1435
             L+GF ALKVSKPR  S +  DLD+FFT+VS+ TVSSMST++MEVFSN QL+ +T LMFLG
Sbjct  34    LLGFLALKVSKPRTTS-RPHDLDLFFTSVSAITVSSMSTIDMEVFSNTQLIIITVLMFLG  92

Query  1434  GECFTSWLGLHFFQSKVSTTERVLEKNKV-IVIDHVELGLVTNNEYHNDLNPEDSAKSNV  1258
             GE FTS+L L+F       +  V   NK+  ++  + +   T +   +  N  D  K   
Sbjct  93    GEVFTSFLDLYFSH----FSNFVFPHNKIRHLMGSLNIKPPTEDRRRDLENITDHLKRPS  148

Query  1257  QIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttf  1078
             QI       L   V       L Y +V ++ G  LV +Y+ FV TAK VL  K +   TF
Sbjct  149   QINERASKYLYSVV-------LGYHLVTNLAGSVLVLVYVTFVKTAKVVLSSKEISPVTF  201

Query  1077  avfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTT  898
             ++FTTVSTF NCGFVPT ENM++F++N GLL +LIPQ+ +GNTL+P  L L IW L K T
Sbjct  202   SIFTTVSTFGNCGFVPTKENMVIFRKNSGLLWLLIPQVFMGNTLFPCFLFLLIWGLDKIT  261

Query  897   RRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGY  718
             +R EF  IL +   +GY HL S R    L  TV G   +Q  VF   EW S ++ G+  Y
Sbjct  262   KREEFGYILKNHKTMGYSHLLSLRLCALLGLTVLGFAMIQFFVFCTFEWNSVSLEGMNPY  321

Query  717   EKVVGSLFVVVNSRHTGESIldlsllapavlalivVM----------------------M  604
             EK+VGSLF VVNSRHTGE+I+DLS L+PA+L   + +                       
Sbjct  322   EKLVGSLFQVVNSRHTGENIVDLSTLSPAILWNKLFLAMNFNTFSLKRKKCDSLFYYSST  381

Query  603   YLPPDTTFFPI-----MDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
             YLPP T F P+       E   S T     +K        +S L  L+I +  I ITE +
Sbjct  382   YLPPYTLFMPLTTIEKYKEEVESHTGNEGKRK---KTGFFVSQLSFLAICVFFISITESQ  438

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGK  262
              ++ DPLNFN+LNI +EVISA+GNVGF+TGYSC R++    G CKD  +GFVGRWS  GK
Sbjct  439   NLRRDPLNFNILNITLEVISAFGNVGFTTGYSCERRLDINNGSCKDTSYGFVGRWSPNGK  498

Query  261   FILIIVMFFGRLKKYHMKGGKAWKL  187
             FILII+MF+GR K++  K G+ W L
Sbjct  499   FILIILMFYGRFKQFTAKSGRPWIL  523



>ref|XP_010927280.1| PREDICTED: cation transporter HKT1-like [Elaeis guineensis]
Length=535

 Score =   294 bits (752),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 211/506 (42%), Positives = 317/506 (63%), Gaps = 13/506 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R  AF V PF ++L YF+ L+L+G  A+ + KP   +F  + +D+ F +VS+ TVS +  
Sbjct  33    RFFAFGVTPFWIQLCYFVSLALLGSLAMMLLKPDNPAFTPRYVDMLFMSVSALTVSGLGA  92

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             VEME  S+ Q+  +  LMFLGG    S LGL F +S+ +    ++       +D + + L
Sbjct  93    VEMENLSSSQIAVLALLMFLGGNVLVSLLGLLFRRSQCNNRSEIVSNR----VDAIGIEL  148

Query  1317  VTNNEYHNDLNP----EDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
              + N   N L+     +D   S+          +L C+R L  VVL ++VV HVVG   +
Sbjct  149   DSMNYPANTLDTIELGQDVVGSSETSITDGKYLMLSCIRYLGFVVLGFVVVFHVVGCLAI  208

Query  1149  AMYIGFVPTAKQVLKQKG--LDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllil  976
              +YI  V +A+ VLK+KG  ++   F++FTT+S+F+N G +PTNENM++F  NPGL LI+
Sbjct  209   FLYIILVSSARNVLKRKGRGINFFLFSIFTTISSFANGGLIPTNENMLIFNNNPGLYLII  268

Query  975   ipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVF  796
             IPQIL GN L+P CLRL IW L + T+  EF  +L +P+ + +G L    ++ FL+ T  
Sbjct  269   IPQILAGNLLFPLCLRLVIWALRRFTKAEEFNYMLKNPSAIQFGDLRPKFQTAFLSLTCI  328

Query  795   GLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlali  616
             G I   + +F +++W S    GL  YEK+VG+LF+ VNSRH GE+ +D+SL +P+V+ L 
Sbjct  329   GFIAAMVALFCSMDWTSAVFHGLNSYEKIVGALFMAVNSRHAGENSIDISLASPSVIVLF  388

Query  615   vVMMYLPPDTTFFPIM-DENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
             ++MM LPP  +F P   DE++++  K    K+++ +E +LLS + ++ +FII+IC+TE +
Sbjct  389   ILMMCLPPSVSFLPFQEDESSSAGDKKEDKKRWSPVENLLLSQISSIVVFIIIICVTESK  448

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMG  265
              +  DPLNF+ LN++ EV S YGNVG S GYSC+R  ++ P+  C+D  + F G WS+ G
Sbjct  449   NLTRDPLNFSTLNVIFEVTSGYGNVGLSMGYSCSRFLRLHPDADCQDGSYSFSGAWSDEG  508

Query  264   KFILIIVMFFGRLKKYHMKGGKAWKL  187
             K IL IVM  GRLK +  + GKAWKL
Sbjct  509   KLILAIVMLCGRLKNFTKENGKAWKL  534



>ref|XP_003560515.1| PREDICTED: cation transporter HKT1-like [Brachypodium distachyon]
Length=532

 Score =   294 bits (752),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 198/517 (38%), Positives = 305/517 (59%), Gaps = 42/517 (8%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R     V+PF ++LSY + +S++    L   KP    F  + +D+ F + S+ TVS +ST
Sbjct  35    RFFTLNVHPFWIQLSYLLAISILSSVLLMSLKPSNPEFSPRYIDMLFLSTSALTVSGLST  94

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGL-----HFFQSKVSTT---------ERVLE  1360
             V+ME  S+ Q+V +T LMF+GGE F S LGL     H     +ST          E +  
Sbjct  95    VKMEDLSSPQIVVLTLLMFVGGEIFVSLLGLMLRVNHQDMPDISTVKISSVPVELEAIDS  154

Query  1359  KNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKL--LGCVRVLARvvlsy  1186
              + V   D  +L      E    + P++S      ++ +  +    L  + VL       
Sbjct  155   ASSVTFCDESKL-----EEATQAIPPKNSDLKRRSLKCLGYVVFGYLAVIHVL-------  202

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
                    GF LV +YI  VPTA+  L +KG++   F+V  TV++F+N G VPTNENM +F
Sbjct  203   -------GFLLVLLYITHVPTARIPLNKKGINAVLFSVSVTVASFANAGLVPTNENMTIF  255

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
              +N GLLL+L  Q L GNTL+P  LRL +WFL K T+  E   ++ +P  + +GH     
Sbjct  256   SKNSGLLLLLTGQSLAGNTLFPLFLRLLVWFLSKLTKVKELGFMIKNPEEVHFGHFLPRL  315

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              + FL++TV GL+   +T+  A++W S    GL+ Y+K+V + F+ VN+RH+GE+ +D S
Sbjct  316   PTVFLSSTVIGLVAATVTLLCAVDWNSSVFDGLSSYQKIVHAFFMAVNTRHSGENSIDCS  375

Query  645   llapavlalivVMMYLPPDTTFFPIMDENNNSKT--KGCSPKKFNIIEKILLSPLGNLSI  472
             L++PA+L + ++MMYLP   TF P    N ++KT       ++ ++++ +  SPL    +
Sbjct  376   LVSPAILVIFIIMMYLPSSATFAP---PNGDTKTTDDNMEHRRGSLVQNLAFSPLMCNIV  432

Query  471   FIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQ  298
             F+I++CITER +++ DPLNF+ LN++ EV+SAYGNVG STGYSC+R   + P+  C+D+ 
Sbjct  433   FVIVVCITERRRLRNDPLNFSTLNMIFEVVSAYGNVGLSTGYSCSRLQLLHPKSICQDRP  492

Query  297   FGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             + F G WS+ GK +L++VMF+GRLK + M  GK+WK+
Sbjct  493   YSFSGWWSDGGKLVLVLVMFYGRLKVFSMGTGKSWKV  529



>ref|XP_004967239.1| PREDICTED: LOW QUALITY PROTEIN: cation transporter HKT2-like 
[Setaria italica]
Length=535

 Score =   293 bits (749),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 215/507 (42%), Positives = 308/507 (61%), Gaps = 15/507 (3%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  V+P  ++L YF+ ++++G   L   KP    F  + LD+ F + S+ TVS +ST
Sbjct  33    RFVASHVHPVFIQLGYFLTIAMLGSVLLISLKPSNPEFSPQYLDMLFLSTSALTVSGLST  92

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVI--DHVEL  1324
             V ME  S+ Q+V +T LMF GGE F S+LGL                NKV+ I  D VE 
Sbjct  93    VTMEDLSSSQIVVLTLLMFAGGEVFVSFLGLMLRPPNHQANPTDPTGNKVVAIELDMVEP  152

Query  1323  GLVTNNEYHNDLNPEDSAKSNVQIEVVE----DIKLLGCVRVLARvvlsyivvihvVGFT  1156
               V  N    +L  E++      +        D+K    VR L  VV  Y+  IHV+GF 
Sbjct  153   ASVVAN-IGEELQLEEATHGAPTLSSRSSSSSDLKNNSSVRXLGFVVFGYLAAIHVLGFL  211

Query  1155  LVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllil  976
             LV  YI  VP+A+ +L +KG+++  F+   TVS+F+N G +PTNENM +F +N GLLL+L
Sbjct  212   LVX-YITHVPSARAILTKKGINVALFSASITVSSFANGGLIPTNENMAIFSKNAGLLLLL  270

Query  975   ipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVF  796
               QIL GN L+P  LRL +WFLG+ T+    + ++     L Y +L     + FL++ V 
Sbjct  271   TGQILAGNLLFPLFLRLFVWFLGRVTKLERLKLMIRDSKELQYSYLLPKLPTAFLSSXVV  330

Query  795   GLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlali  616
             GL+ + +T+F A++W S     L+ Y+K+V +LF  VN+RH+GE+ +D SL++PAVL L+
Sbjct  331   GLLAVAVTLFGAIDWNSPVFDVLSSYQKIVSALFTAVNARHSGENSIDCSLISPAVLVLL  390

Query  615   vVMMYLPPDTTFFPIMDENNNSKTKG--CSPKKFNIIEKILLSPLGNLSIFIILICITER  442
             + MMYLPP TTF P    N + KTK     PK   ++  +  S LG   IF+I+ CITER
Sbjct  391   IAMMYLPPWTTFAP---PNGDDKTKDEKMVPKHDXVVLTLAFSQLGCNVIFVIVACITER  447

Query  441   EKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNM  268
              +++ DPLNF+ LN++ EVISAYGNVG STGYSC+R  Q+ PE  C+DK + F G WS+ 
Sbjct  448   RRLRNDPLNFSTLNMIFEVISAYGNVGMSTGYSCSRLQQLHPESICQDKPYSFSGWWSDE  507

Query  267   GKFILIIVMFFGRLKKYHMKGGKAWKL  187
             GK +++++M +GRLK +    GKAWKL
Sbjct  508   GKLLIVLIMLYGRLKAFSTGTGKAWKL  534



>ref|XP_009113604.1| PREDICTED: sodium transporter HKT1-like [Brassica rapa]
Length=496

 Score =   291 bits (745),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 224/476 (47%), Positives = 306/476 (64%), Gaps = 15/476 (3%)
 Frame = -1

Query  1608  GFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGE  1429
             GF AL++SKPR  S +  DLD+FFT+VS+ TVSSMSTV+MEVFSN QL+ +T L+ LGGE
Sbjct  29    GFLALRISKPRTTS-RPHDLDLFFTSVSAITVSSMSTVDMEVFSNTQLIIITILILLGGE  87

Query  1428  CFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIE  1249
              FTS+L L+F              NK   + H+   L ++    +     ++  ++++  
Sbjct  88    IFTSFLHLYFSH----CANFGFPYNK---LRHLVCSLSSDTPIEDRCRDLENVTNHLKRP  140

Query  1248  VVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavf  1069
                + +   C   L  VVL Y +V ++VG  L+  Y+ F  + K VL  K +   TF+VF
Sbjct  141   SQINERASKC---LYSVVLGYHLVTNLVGSMLLLAYVSF--SVKDVLSSKDISPLTFSVF  195

Query  1068  ttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRI  889
             TTVSTFSNCGFVPTNENM++F++N GLL +LIPQ+ +GNTL+P  L   +W LGK T+R 
Sbjct  196   TTVSTFSNCGFVPTNENMVIFRKNSGLLWLLIPQVFMGNTLFPCFLVFILWGLGKITKRE  255

Query  888   EFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKV  709
             EF  IL +   +GY  L S R    L  T  GL+  Q  +F   EW S ++ G+  Y+K+
Sbjct  256   EFGYILKNHKKMGYSPLLSVRLCVLLCLTALGLVLTQFLLFCTSEWNSKSLGGMNSYQKL  315

Query  708   VGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSP  529
             V SLF VVNSRHTGE+I+DLS L+PA+L L + MMYLPP T F P   EN+    +  S 
Sbjct  316   VASLFQVVNSRHTGETIVDLSTLSPAILVLFIFMMYLPPYTLFMPFARENDKKDGEYDSK  375

Query  528   KKFNIIEK-ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFST  352
              +  + +  + +S L  L I ++LI ITE +K++ DPLNF++LNI +EVISAYGNVGFST
Sbjct  376   NEKKVKKNGVYVSQLAFLVICVLLISITESQKIRRDPLNFSILNITLEVISAYGNVGFST  435

Query  351   GYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
             GYSC R++   +G CKD  +GF GRWS +GK ILIIVMF+G+ K++  K G+ W L
Sbjct  436   GYSCKRRLDVRDGSCKDAGYGFAGRWSPVGKIILIIVMFYGKFKQFTAKSGRTWIL  491



>emb|CDX86865.1| BnaA09g22550D [Brassica napus]
Length=496

 Score =   290 bits (743),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 225/484 (46%), Positives = 302/484 (62%), Gaps = 31/484 (6%)
 Frame = -1

Query  1608  GFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGE  1429
             GF AL++SKPR  S +  DLD+FFT+VS+ TVSSMSTV+MEVFSN QL+ +T L+ LGGE
Sbjct  29    GFLALRISKPRTTS-RPHDLDLFFTSVSAITVSSMSTVDMEVFSNTQLIIITILILLGGE  87

Query  1428  CFTSWLGLHFFQ--------SKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDS  1273
              FTS+L L+F          +K+      L  +  I     +L  VTN+        E +
Sbjct  88    IFTSFLHLYFSHCANFGFPYNKLRYLVCSLSSDTPIEDRRRDLENVTNHLKRPSQINERA  147

Query  1272  AKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGL  1093
             +K    +       +LG   V            ++VG  L+  Y+ F  + K VL  K +
Sbjct  148   SKCLYSV-------VLGYHLV-----------TNLVGSMLLLAYVSF--SVKDVLSSKDI  187

Query  1092  DLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWF  913
                TF+VFTTVSTFSNCGFVPTNENM++F++N GLL +LIPQ+ +GNTL+P  L   +W 
Sbjct  188   SPLTFSVFTTVSTFSNCGFVPTNENMVIFRKNSGLLWLLIPQVFMGNTLFPCFLVFILWG  247

Query  912   LGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIA  733
             LGK T+R EF  IL +   +GY  L S R    L  T  GL+  Q  +F   EW S ++ 
Sbjct  248   LGKITKREEFGYILKNHKKMGYSPLLSVRLCVLLCLTALGLVLTQFLLFCTFEWNSKSLG  307

Query  732   GLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNN  553
             G+  Y+K+V SLF VVNSRHTGE+I+DLS L+PA+L L + MMYLPP T F P   EN+ 
Sbjct  308   GMNSYQKLVASLFQVVNSRHTGETIVDLSTLSPAILLLFIFMMYLPPYTLFMPFARENDK  367

Query  552   SKTKGCSPKKFNIIEK-ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISA  376
                +  S  +  + +  + +S L  L I ++LI ITE +K++ DPLNF++LNI +EVISA
Sbjct  368   KDGEYDSKNEKKVKKNGVYVSQLAFLVICVLLISITESQKIRRDPLNFSILNITLEVISA  427

Query  375   YGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGK  199
             YGNVGFSTGYSC R++   +G CKD  +GF GRWS +GK ILIIVMF+G+ K++  K G+
Sbjct  428   YGNVGFSTGYSCKRRLDVRDGSCKDAGYGFAGRWSPVGKIILIIVMFYGKFKQFTAKSGR  487

Query  198   AWKL  187
              W L
Sbjct  488   TWIL  491



>gb|AEM55592.1| high-affinity potassium transporter [Diplachne fusca]
Length=525

 Score =   291 bits (744),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 203/491 (41%), Positives = 309/491 (63%), Gaps = 4/491 (1%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  V+PF ++LSYF+ ++++G   L   KP    F    +D+ F + S+ TVS +ST
Sbjct  35    RFVALHVHPFWIQLSYFLAIAILGSVLLMSLKPSNPDFSPPYIDMLFLSTSALTVSGLST  94

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             + ME  S+ Q+V +T LM +GGE F S LGL    +     +    K   + ++  E+ L
Sbjct  95    ITMEDLSSAQIVVLTLLMLVGGEIFVSLLGLMLRVNHQDMPDLPRVKISSVPVELEEIDL  154

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
               N+   +D +  + A   +  +    +K    V+ L  VV  Y  VIH++GF LV +YI
Sbjct  155   -ANSMALSDESQLEEATHAITPKKCTGLKRSRSVKCLGYVVFGYFAVIHILGFLLVFLYI  213

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VPTA   L +KG+++  F++  TV++ +N G VPTNENM++F +N GLLL+L  QIL 
Sbjct  214   TRVPTASAPLNKKGINIVLFSLSVTVASIANGGLVPTNENMVIFSKNSGLLLLLSGQILA  273

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GN L+P  LRL +WFLG+ T+  E R ++ +P  + +G+L     + FL++T  GL+   
Sbjct  274   GNLLFPLFLRLLVWFLGRLTKVKELRLMIKNPEEVHFGNLLPRLPTVFLSSTAIGLVAAG  333

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
             +T+F A++W S    GL+ Y+K V + F+VVN+RH+GE+ +D SL++PA++ L +VMMYL
Sbjct  334   VTMFSAVDWNSSVFDGLSSYQKAVNAFFMVVNARHSGENSIDCSLMSPAIIVLFIVMMYL  393

Query  597   PPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPL  418
             PP  TF P  D +  +  +    K+ ++++K+  SPLG   IF+I+ CITER +++ DPL
Sbjct  394   PPSATFAP-PDGDIKTTNENTKAKRGSLVQKLAFSPLGFNIIFVIVACITERRRLRNDPL  452

Query  417   NFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMGKFILIIV  244
             NF+ LN++ EVISAYGNVG STGY C+R  Q+ PE  C+DK + F G WS+ GKF+LI+ 
Sbjct  453   NFSTLNMIFEVISAYGNVGLSTGYGCSRLHQLHPEIICQDKPYSFSGWWSDGGKFVLILA  512

Query  243   MFFGRLKKYHM  211
             M +GRLK + M
Sbjct  513   MLYGRLKAFTM  523



>ref|NP_001174084.1| Os04g0607500 [Oryza sativa Japonica Group]
 sp|Q7XPF8.2|HKT4_ORYSJ RecName: Full=Cation transporter HKT4; Short=OsHKT4 [Oryza sativa 
Japonica Group]
 emb|CAD37182.1| putative sodium transporter [Oryza sativa Japonica Group]
 emb|CAD37183.1| putative sodium transporter [Oryza sativa Japonica Group]
 dbj|BAH92812.1| Os04g0607500 [Oryza sativa Japonica Group]
Length=552

 Score =   288 bits (738),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 212/499 (42%), Positives = 300/499 (60%), Gaps = 23/499 (5%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPR----PISFKLKDLDvfftavssatvssm  1504
             L  + NP +++L YF+++S  GF ALK  KP+    P     KDLD+ FT+VS+ TVSSM
Sbjct  66    LVCKSNPLVVQLVYFVIISFAGFLALKNLKPQGKPGP-----KDLDLLFTSVSTLTVSSM  120

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
             +TVEME  S+ QL  +  LM +GGE FTS LGL+F  +  +  E        I +D +E 
Sbjct  121   ATVEMEDLSDRQLWVLILLMLMGGEVFTSMLGLYFNNANANRNENSQRSLPSISLD-IEF  179

Query  1323  GLVTNNEYH--NDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
                 NN  H   +    +   S  Q++  + I    C  VL R+V  Y V   +    ++
Sbjct  180   NSPANNGDHKITECGQSEETMSQNQVQQNKSITYNPCA-VLVRIVTGYFVATVISSSVII  238

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
              +Y      A+ VLK K +++ TF +FT VS+F+NCGF P N NM  F++N  LLL++IP
Sbjct  239   IIYFWIDSDARNVLKSKEINMYTFCIFTAVSSFANCGFTPLNSNMQPFRKNWVLLLLVIP  298

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             QIL GNTL+   LRL +W LGK + + E+  IL  P   GY HL   R S ++  +V GL
Sbjct  299   QILAGNTLFSPLLRLCVWVLGKVSGKAEYAYILQHPGETGYKHLHVRRNSVYIVLSVTGL  358

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             I LQ+    + EW S+++ G+   +K+VG LF  VN+R  GESILD+S L+P+ L L  V
Sbjct  359   ILLQVMFICSFEWNSESLEGMNWLQKLVGLLFQSVNTRQAGESILDISTLSPSTLLLFAV  418

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKIL-----LSPLGNLSIFIILICITE  445
             +MYLP D +F        N+  +  + KK N I + L     ++ L  L++F  L CITE
Sbjct  419   VMYLPSDASFL-----TANADNQPLTDKKTNSISRALWRNFTVNKLSCLAMFTFLACITE  473

Query  444   REKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMG  265
             R+ +  DPLNFN+ +IV E+ISA+GNVG+S GYSC + +KP+  CKD  +GFVGRW+  G
Sbjct  474   RKSISSDPLNFNIFSIVFEIISAFGNVGYSLGYSCQKLLKPDATCKDASYGFVGRWTEEG  533

Query  264   KFILIIVMFFGRLKKYHMK  208
             K I+I+VMF GRLK++ +K
Sbjct  534   KLIVILVMFLGRLKEFILK  552



>emb|CAH66785.1| OSIGBa0113I13.11 [Oryza sativa Indica Group]
Length=552

 Score =   287 bits (734),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 212/499 (42%), Positives = 299/499 (60%), Gaps = 23/499 (5%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPR----PISFKLKDLDvfftavssatvssm  1504
             L  + NP +++L YF+++S  GF ALK  KP+    P     KDLD+ FT+VS+ TVSSM
Sbjct  66    LVCKSNPLVVQLVYFVIISFAGFLALKNLKPQGKPGP-----KDLDLLFTSVSTLTVSSM  120

Query  1503  stVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL  1324
             +TVEME  S+ QL  +  LM +GGE FTS LGL+F  +  +  E        I +D +E 
Sbjct  121   ATVEMEDLSDRQLWVLILLMLMGGEVFTSMLGLYFNNANANRNENSQRSLPSISLD-IES  179

Query  1323  GLVTNNEYH--NDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
                 NN  H   +    +   S  Q++  + I    C  VL R+V  Y V   +    ++
Sbjct  180   NSPANNGDHKITECGQSEETMSQNQVQQNKSITYNPCA-VLVRIVTGYFVATVISSSVII  238

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
              +Y      A+ VLK K + + TF +FT VS+F+NCGF P N NM  F++N  LLL++IP
Sbjct  239   IIYFWIDSDARNVLKSKEISMYTFCIFTAVSSFANCGFTPLNSNMQPFRKNWVLLLLVIP  298

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             QIL GNTL+   LRL +W LGK + + E+  IL  P   GY HL   R S ++  +V GL
Sbjct  299   QILAGNTLFSPLLRLCVWVLGKVSGKAEYAYILQHPGETGYKHLHVRRNSVYIVLSVTGL  358

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             I LQ+    + EW S+++ G+   +K+VG LF  VN+R  GESILD+S L+P+ L L  V
Sbjct  359   ILLQVMFICSFEWNSESLEGMNWLQKLVGLLFQSVNTRQAGESILDISTLSPSTLLLFAV  418

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKIL-----LSPLGNLSIFIILICITE  445
             +MYLP D +F        N+  +  + KK N I + L     ++ L  L++F  L CITE
Sbjct  419   VMYLPSDASFL-----TANADNQPLTDKKTNSISRALWRNFTVNKLSCLAMFTFLACITE  473

Query  444   REKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMG  265
             R+ +  DPLNFN+ +IV E+ISA+GNVG+S GYSC + +KP+  CKD  +GFVGRW+  G
Sbjct  474   RKSISSDPLNFNIFSIVFEIISAFGNVGYSLGYSCQKLLKPDATCKDASYGFVGRWTEEG  533

Query  264   KFILIIVMFFGRLKKYHMK  208
             K I+I+VMF GRLK++ +K
Sbjct  534   KLIVILVMFLGRLKEFILK  552



>ref|XP_010263269.1| PREDICTED: probable cation transporter HKT6 isoform X2 [Nelumbo 
nucifera]
Length=472

 Score =   284 bits (727),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 223/504 (44%), Positives = 293/504 (58%), Gaps = 91/504 (18%)
 Frame = -1

Query  1656  NPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFS  1477
             NPF + + YF+ +S +GF  LK+  PR  SFK KDLD+FFT+VS+ TVSSMSTVEMEVFS
Sbjct  45    NPFYILVCYFVSVSFLGFLILKLLNPRTDSFKPKDLDIFFTSVSATTVSSMSTVEMEVFS  104

Query  1476  NLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIV----------IDHVE  1327
             N QLVF+T LMF+GGE F S  GL F + K+    R+       V          +D +E
Sbjct  105   NTQLVFITILMFVGGEVFVSMFGLLFTKYKLRNRARIHGSRVGSVSRESLSPTNPVDQIE  164

Query  1326  LGLVTNNEYHNDLNPED----SAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGF  1159
             LG+V  +E  +   P      SA  ++     ED++    +R L  V+L Y++V+H+ G 
Sbjct  165   LGMVILSETESR-KPSSVDLVSAVESILSSNEEDLRY-NSIRYLVFVILVYLLVVHIGGS  222

Query  1158  TLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGllli  979
              LVA+Y+  VP+A+ VL+ KGL + TF++FTTVSTF++CGFVPTNENMIVF +N GLLL+
Sbjct  223   ALVALYVSLVPSARNVLRNKGLQIPTFSIFTTVSTFASCGFVPTNENMIVFSKNSGLLLL  282

Query  978   lipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATV  799
             LIPQ+LLGNTLYP+CLR  IW LGK T+R EF  +L +   + Y HL     S  L  TV
Sbjct  283   LIPQVLLGNTLYPSCLRFLIWVLGKFTKRQEFNYMLMNTREMKYFHLLPSLHSSLLVVTV  342

Query  798   FGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlal  619
             FG I +Q  +F +LEW S+ + GL  ++K+V SLF  V                      
Sbjct  343   FGFIVVQFILFCSLEWNSEGLDGLNPFQKLVASLFQTV----------------------  380

Query  618   ivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
                                  NS+  G S     II+  +LSP   L +F+++I      
Sbjct  381   ---------------------NSRHTGES-----IIDLSILSP-AILVLFVLMI------  407

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKF  259
                                 AYGNVGF+ GYSC RQ+ P+G CKD  +GFVGRWSN GK 
Sbjct  408   --------------------AYGNVGFTAGYSCKRQLNPQGLCKDSWYGFVGRWSNKGKV  447

Query  258   ILIIVMFFGRLKKYHMKGGKAWKL  187
             ILI+VMFFGRLKK++M GG+ WKL
Sbjct  448   ILILVMFFGRLKKFNMDGGRGWKL  471



>ref|NP_001168576.1| uncharacterized protein LOC100382359 [Zea mays]
 gb|ACN28730.1| unknown [Zea mays]
 gb|AEK27028.1| K transporter [Zea mays]
Length=467

 Score =   283 bits (725),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 215/490 (44%), Positives = 292/490 (60%), Gaps = 55/490 (11%)
 Frame = -1

Query  1587  SKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLG  1408
             S PRP       LD+ FT+VS+ TVSSM  VEME FSN QL+ MT LM LGGE FTS LG
Sbjct  11    SVPRP-----SALDLLFTSVSATTVSSMIAVEMESFSNAQLLLMTLLMLLGGEVFTSMLG  65

Query  1407  LHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKL  1228
             LHF  +K+         N      H    L  +   H  +  E  A + VQ+E+    K 
Sbjct  66    LHFTCTKLRNKRETPHNNL-----HGN-SLEQSRRRHRPMEMEAQAAA-VQMELAGFNK-  117

Query  1227  LGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfS  1048
                                  G    A     V +A+ VL +K + L+TF+VFT VS+F+
Sbjct  118   --------------------DGHGDFASMASVVGSARAVLVRKRISLSTFSVFTVVSSFA  157

Query  1047  NCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQIL-  871
             NCGFVPTNE M+ FK  PG+LL+++P ILLGNTL+P  LRL+I  L + TR  +  ++L 
Sbjct  158   NCGFVPTNEGMVSFKSFPGMLLLVMPHILLGNTLFPIFLRLSITALERVTRWRDLCELLR  217

Query  870   -----------GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLT  724
                         +   +GY HL  G R+ FLA TV   + +QL ++ A+EW S  + GL 
Sbjct  218   DRGPGGGPAAAAAAAAIGYDHLLPGPRTWFLALTVAVFLAVQLVLYCAMEWGSGGLGGLN  277

Query  723   GYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKT  544
              ++K+V ++F+ VNSRH+GE ++DL+ ++ AV+ L V+MMYLPP TTF P+  E++  + 
Sbjct  278   AFQKLVAAVFMSVNSRHSGEMVVDLATVSSAVVVLYVLMMYLPPYTTFLPVAVEDDQQQQ  337

Query  543   KGCSPKK---------FNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVV  391
                 P            +I   +L+SPL  L+IFI++ICITER ++  DP+NF+VLNIVV
Sbjct  338   NEAQPHDNSTSKSSTSISIWHNLLMSPLSCLTIFIVVICITERRQIARDPINFSVLNIVV  397

Query  390   EVISAYGNVGFSTGYSCARQIKPEGQ-CKDKQFGFVGRWSNMGKFILIIVMFFGRLKKYH  214
             EVISAYGNVGFSTGYSC+RQ+ P G  CKD      G+WS  GK  L+ +MF+GRLKK+ 
Sbjct  398   EVISAYGNVGFSTGYSCSRQVTPGGGCCKDAWVSLSGKWSVEGKLTLMAIMFYGRLKKFS  457

Query  213   MKGGKAWKLS  184
             M GG+AW+L+
Sbjct  458   MLGGQAWRLN  467



>ref|XP_006653745.1| PREDICTED: probable cation transporter HKT7-like [Oryza brachyantha]
Length=540

 Score =   284 bits (727),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 234/517 (45%), Positives = 305/517 (59%), Gaps = 54/517 (10%)
 Frame = -1

Query  1725  PPISLR-NKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDL  1549
             PP +LR        S V  L     P  + ++YF+ +S +G+  L   K R      + +
Sbjct  75    PPPALRCGAGQAWRSAVTALPL-AGPLAVHVAYFLAISCLGYGLLGKLKVRDPGRAPRGV  133

Query  1548  DvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTER  1369
             D FFTAVS+ATVSSMSTVEMEVFSN QLV +T LMF+GGE F S + L    SK+   +R
Sbjct  134   DRFFTAVSAATVSSMSTVEMEVFSNGQLVVLTVLMFIGGEVFISLVELASKWSKMRR-QR  192

Query  1368  VLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL--GCVRVLARvv  1195
             + +  +V     + L      +  N  +   S  +        D   L    VR L  +V
Sbjct  193   IYKSRRVESHGEIALQAPAIADVENPASMITSTTTTEDATGTTDANTLRHNAVRALFYIV  252

Query  1194  lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENM  1015
             L+ +VV+HV+G   VA Y+   P A++ L+ K L+L TFAVFTTVSTFSNCGF+PTNENM
Sbjct  253   LAILVVVHVLGAVAVAAYVYASPGARRTLRGKSLNLWTFAVFTTVSTFSNCGFMPTNENM  312

Query  1014  IVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLF  835
              VFKR+                   A L+L                            L 
Sbjct  313   AVFKRD-------------------APLQL----------------------------LL  325

Query  834   SGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIl  655
               +R   LAATV   +  Q+ +   +EW    + G++ +EKVV +LF+ VNSRHTGES +
Sbjct  326   VPQRCWMLAATVTAFLAAQVALVCGMEW-GGTLQGMSPWEKVVNALFLAVNSRHTGESTV  384

Query  654   dlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLS  475
             DLS LAPA+L L V+MMYLPP TT+FP  +EN+N+K      +   +++  +LS L  L+
Sbjct  385   DLSTLAPAILVLFVLMMYLPPYTTWFPF-EENSNAKDNTAENQGIRLLKSTVLSQLSYLT  443

Query  474   IFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQF  295
             IF+I ICITER K+KEDPLNFNVL+I+VEV+SAYGNVGFS GYSC+RQI P+  C D+  
Sbjct  444   IFVIAICITERRKLKEDPLNFNVLSIIVEVVSAYGNVGFSMGYSCSRQINPDHLCTDRWT  503

Query  294   GFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             GFVGRWS+ GK I I VMFFGRLKK+ M+GGKAWKLS
Sbjct  504   GFVGRWSDSGKLIFIFVMFFGRLKKFSMEGGKAWKLS  540



>ref|XP_008453696.1| PREDICTED: probable cation transporter HKT7 [Cucumis melo]
Length=378

 Score =   279 bits (714),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 235/340 (69%), Gaps = 13/340 (4%)
 Frame = -1

Query  1164  GFTLVAMYIGFVPT-AKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGl  988
             G  ++ +Y  F+ + AK++L +KG++L TF+ FT VST ++CGFVPTNENMIVF +N GL
Sbjct  39    GIGMILIYFLFISSFAKEILNEKGINLVTFSFFTCVSTLASCGFVPTNENMIVFHKNSGL  98

Query  987   llilipqilLGNTLYPACLRLAIWFLGKTTR------RIEFRQILGSPNGLGYGHLFSGR  826
             LLILIPQ+L+GNTLY +CLR  IW +GK ++      R++   +L +   +GY HL    
Sbjct  99    LLILIPQVLVGNTLYSSCLRFCIWVIGKFSKDHNDEHRLKVDYLLTNSEEIGYIHLLPSL  158

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              S  L ATVFG I +Q  +  ++EW S+  + L  Y+KVV  LF+  NSRHTGE+I+D+S
Sbjct  159   HSCLLVATVFGFILIQFVLICSMEWDSNGFSDLNFYQKVVAILFLSTNSRHTGETIVDIS  218

Query  645   llapavlalivVMMYLPPDTTFFPI------MDENNNSKTKGCSPKKFNIIEKILLSPLG  484
             LL+ A+L L VVMMYLPP T+F P+       D     + +    +K   ++ +L S L 
Sbjct  219   LLSSAILILFVVMMYLPPYTSFLPLNEKEELEDHLQPLQRRKMKSRKTKTLQNLLFSQLS  278

Query  483   NLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKD  304
              L IFII+ICI E +KM EDP+NF+VLNIV+EVISAYGNVGFS GYSC RQ+ P+  C D
Sbjct  279   YLVIFIIIICIIEGKKMVEDPINFSVLNIVLEVISAYGNVGFSMGYSCKRQVHPQRDCVD  338

Query  303   KQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKLS  184
             K +GF  +WSN  K +LI+VM FGRLKK++M GGKAWKLS
Sbjct  339   KWYGFSAKWSNKAKIVLILVMIFGRLKKFNMDGGKAWKLS  378



>gb|EMS57034.1| Cation transporter HKT1 [Triticum urartu]
Length=458

 Score =   281 bits (719),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 185/443 (42%), Positives = 272/443 (61%), Gaps = 19/443 (4%)
 Frame = -1

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV-  1315
             ME  S+ Q+V +T  M +GGE F S LGL     +V+  +     N  I    VEL  + 
Sbjct  1     MEDLSSSQIVVLTLFMLVGGEIFVSLLGLML---RVNHQDMQDLPNVKISSVPVELEEID  57

Query  1314  -TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
               N+   +D +  + A   +  +   ++K    V+ L  VV  Y  VIHV+GF LV +YI
Sbjct  58    SANSAAQSDESQLEEAARAIPPKKCTELKRSRTVKCLGYVVFGYFAVIHVLGFLLVFLYI  117

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               VP+A   L +KG+++  F++  TV++ +N G VPTNENM++F +N GLLL+L  QIL 
Sbjct  118   THVPSASAPLNKKGINIVLFSLSVTVASCANAGLVPTNENMVIFSKNSGLLLLLSGQILA  177

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GNTL+P  LRL +WFL + T   E R ++ +P  + + +L     + FL++TV GL+  +
Sbjct  178   GNTLFPLFLRLLVWFLERLTEMKELRHMIKNPEEVHFANLLPRLPTAFLSSTVIGLVAAR  237

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGE-SIldlsllapavlalivVMMY  601
             +T+F A++  S    GL+ Y+K V + F+VVN+RH+GE SI    +    V+ + +VMMY
Sbjct  238   VTMFCAVDCNSSVFDGLSSYQKTVNAFFMVVNARHSGENSIDCSLMSPAIVVLIFIVMMY  297

Query  600   LPPDTTFFP------IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
             LP  TT  P        DEN    TKG   K+ ++++K+  SPLG  +IF+++ CITER 
Sbjct  298   LPSTTTLAPPNGDIKTTDEN----TKGKRGKRGSLVQKLAFSPLGFNAIFVVIACITERR  353

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCAR--QIKPEGQCKDKQFGFVGRWSNMG  265
             +++ DPLNF+ LN++ EVISAYGN G STGYSC+R  Q+ PE  C+DK + F G WS+ G
Sbjct  354   RLRNDPLNFSTLNMIFEVISAYGNAG-STGYSCSRLHQLHPEIICQDKPYSFSGWWSDRG  412

Query  264   KFILIIVMFFGRLKKYHMKGGKA  196
             KF+LI+VM +GRLK + M  G+A
Sbjct  413   KFVLILVMLYGRLKAFAMATGQA  435



>gb|EPS69224.1| hypothetical protein M569_05541, partial [Genlisea aurea]
Length=481

 Score =   280 bits (715),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 218/492 (44%), Positives = 314/492 (64%), Gaps = 17/492 (3%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEV  1483
             ++N F     Y   LS++GF  LK++KPR +  + ++L +FFTAVS+ +VSSMS VEME 
Sbjct  6     KINAFFAYTIYLSSLSVVGFGFLKLAKPR-VEQQPRNLHLFFTAVSAVSVSSMSVVEMED  64

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNE  1303
             FS  QL+ +  LMF GGE FTS + + FF++  +  +   E      I   +     ++E
Sbjct  65    FSGAQLLIIAALMFGGGEVFTSTVRV-FFENLRTKKKHASETRVSSSITPTDSANTPHDE  123

Query  1302  YHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPT  1123
                D+   DS ++ ++          G  R LA V++ Y+ VIH VG   V +Y+  VP+
Sbjct  124   VRTDVPESDSEETVIRN---------GSTRFLALVLVGYLSVIHFVGIACVLIYLTAVPS  174

Query  1122  AKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLY  943
             + +VL++KG+   TF++F  VSTF+NCGFVPTNE M VF  + GLLLILIPQI+LGNTL+
Sbjct  175   SGRVLRKKGIGNFTFSIFVVVSTFANCGFVPTNEGMTVFSGDSGLLLILIPQIVLGNTLF  234

Query  942   PACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFL  763
             PA LR+++W +GK  ++ E   +L       Y HL    ++ FLA T      +   +F 
Sbjct  235   PAFLRVSVWTVGKKMKKTESEYLLNRAPPSLYSHLLPRIQALFLAGTALLFAAIGFALFS  294

Query  762   ALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTT  583
             +LEW S A+ GL+ Y+KVV  +F  +N+RH+GE+++ L  LAPA+L   + MMYLPP T+
Sbjct  295   SLEWDSAALFGLSPYQKVVAVVFQCINARHSGENVVPLGDLAPAILVFFIAMMYLPPYTS  354

Query  582   FFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVL  403
             + P+       K  G   K+  ++E ++ S L  L+IFII+ICITER  + +DP+NF+VL
Sbjct  355   YMPL------KKIIGGEEKRHTLLENLIFSQLTYLTIFIIIICITERASLVDDPINFSVL  408

Query  402   NIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLK  223
             NIV EVISAYGNVGFS GYSC  +I+P+  C DK +GF G+WS+ GK +LI VM FGR+K
Sbjct  409   NIVFEVISAYGNVGFSIGYSCELRIRPDPTCVDKWYGFCGKWSDEGKIVLIFVMMFGRMK  468

Query  222   KYHMKGGKAWKL  187
             +++M GG+AW L
Sbjct  469   QFNMHGGQAWVL  480



>ref|XP_010910885.1| PREDICTED: cation transporter HKT8-like, partial [Elaeis guineensis]
Length=463

 Score =   279 bits (713),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 202/436 (46%), Positives = 283/436 (65%), Gaps = 6/436 (1%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISF-KLKDLDvfftavssatvs  1510
             S  + L F  NP  ++L YF  +S IGF  LK+   R  +  K KDLD+FF AVS+ TVS
Sbjct  33    SIYQFLLFHANPLWIQLCYFFFVSSIGFLLLKILPMRDAARNKPKDLDLFFMAVSANTVS  92

Query  1509  smstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHV  1330
             SM TVEME FSN QL+ +T LM LGGE F S +GL F + K+   E    K  + ++   
Sbjct  93    SMDTVEMEAFSNSQLMILTLLMQLGGEVFISMVGLQFTRIKLEKKETPYNKANIELMSSK  152

Query  1329  ELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLV  1150
             EL    N+    +L   DS    +  E          ++ L  VVL Y++ + +VG+ L+
Sbjct  153   ELA---NDSDQPELGTVDSGA--ISPESGSGYLRYSSIKQLGFVVLGYLLAVQIVGYVLI  207

Query  1149  AMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilip  970
               Y+  VP+A+ VL  KG+   TF++FTTVS+F+NCGF+PTNENM+VFK   GLLL++I 
Sbjct  208   LAYVSLVPSARAVLDGKGIHFQTFSIFTTVSSFTNCGFIPTNENMMVFKNGSGLLLLIIV  267

Query  969   qilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             QIL GNT++P+ LRL I    K + R+EF  +  +   +G+ HL  GRR+  LA TV G 
Sbjct  268   QILAGNTMFPSFLRLVILVFEKHSNRLEFDFMAKNQREIGFDHLLPGRRAVLLALTVLGF  327

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             + +QL +F  LEWRS+ + GL+ Y K++ SLF  VNSRH GE+I+DLS ++PA+L L VV
Sbjct  328   VMVQLILFCCLEWRSEGLDGLSPYRKILASLFQSVNSRHAGETIVDLSTISPAILVLYVV  387

Query  609   MMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMK  430
             MMYLPP T+F P+ D++  S+ K    K+ N+++ ++L  L  L+IF+I+ICITER+K+ 
Sbjct  388   MMYLPPYTSFIPLGDDDGPSERKEGGSKRKNLVQNLILPQLACLAIFVIIICITERKKLS  447

Query  429   EDPLNFNVLNIVVEVI  382
             EDPLNF+VLNIV+EV+
Sbjct  448   EDPLNFSVLNIVIEVV  463



>ref|XP_004978223.1| PREDICTED: cation transporter HKT4-like [Setaria italica]
Length=519

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 297/496 (60%), Gaps = 11/496 (2%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKP--RPISFKLKDLDvfftavssatvssmst  1498
             +  + NP L+ L YF+ +S  GF ALK   P  +PI    + LD+ FT+VS+ TVSSM+T
Sbjct  25    MVLQRNPLLVHLIYFMSISFTGFLALKSLTPQHKPIP---RSLDLAFTSVSTLTVSSMAT  81

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             VEME FS+ QL  +  LM LGGE FTS LGLH   ++ +T + +L+K        +E   
Sbjct  82    VEMEDFSDQQLWVLILLMLLGGEVFTSMLGLHLKNARANTYD-ILQKRLPSTCRDIEFVD  140

Query  1317  VTNNEYHN---DLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVA  1147
               N    N   D+NPE +  S+ Q++  + +    C  +LA VV  Y VV  +    ++ 
Sbjct  141   SVNRSCWNNMEDINPE-ATTSHKQVQESKSMNQNYC-NILAHVVAGYFVVCIICSCLVIT  198

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +YI     AK +LK K + + TF++FT VS+F NCGF P N+NM +F++N G+LL++IPQ
Sbjct  199   IYIWTDSEAKYLLKSKNIKIWTFSIFTAVSSFVNCGFTPVNDNMAIFRKNRGILLLVIPQ  258

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             I  GNTL+   LRL+IW LG+ +RR E+  IL  P   GY H+   +    L     G+I
Sbjct  259   IPAGNTLFTPLLRLSIWALGRISRREEYTYILQYPVETGYMHMQQKKNVINLVLAAVGII  318

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              LQ+       W S  + GL  ++K+V +LF  VN RH GE+++D+S L PA+L L  + 
Sbjct  319   LLQVMFLCYFGWDSKPMEGLKWFQKLVCTLFQSVNRRHAGETVIDISNLPPAILVLFALF  378

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLP D +  P   ++     KG       + +  ++S    L+ FIIL CITER+ M  
Sbjct  379   MYLPSDGSSLPNSVDDQTLTEKGEDKNSRTLWKNFIISKPTCLATFIILACITERKSMSL  438

Query  426   DPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILII  247
             DPLNFN+ +IV EV+SAYGNVG+S GYSC R +KP+  CK   +G VG+W++ GK I+I+
Sbjct  439   DPLNFNIFSIVFEVVSAYGNVGYSLGYSCERLLKPDATCKAVSYGLVGKWTDEGKLIIIL  498

Query  246   VMFFGRLKKYHMKGGK  199
             VMF GR K++ ++  K
Sbjct  499   VMFLGRFKRFGLRARK  514



>gb|KCW80827.1| hypothetical protein EUGRSUZ_C02191 [Eucalyptus grandis]
Length=450

 Score =   276 bits (706),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 200/444 (45%), Positives = 278/444 (63%), Gaps = 19/444 (4%)
 Frame = -1

Query  1713  LRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfft  1534
             L+++H +  S +R LA R N F  +L+YF ++S IG++ALK+ +P+  S+K +DLD+FFT
Sbjct  25    LQSRHPVASSLLRNLARRANSFWTQLAYFFLVSAIGYWALKLCEPKSPSYKPRDLDIFFT  84

Query  1533  avssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKN  1354
             +VS+ T SSMSTVEME FSN QL+ +  LM  GGE FTS LGL+  +S+ +  +    K 
Sbjct  85    SVSATTASSMSTVEMEAFSNSQLIIIILLMLFGGEVFTSMLGLYLSRSEFAGRDH--RKV  142

Query  1353  KVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvi  1174
                V DH      ++N     L P    K     +   ++K +                 
Sbjct  143   NSAVSDH------SDNNIELKLPPLYPVKEANTFKFDPEMKGIP----------LKPAPC  186

Query  1173  hvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNP  994
                G TL+++YI  VP+A++VL+ KGL +  F+VF TVSTF+NCGFVP NENM+ FK NP
Sbjct  187   GEGGSTLLSVYISVVPSARKVLRDKGLAVQMFSVFMTVSTFANCGFVPLNENMLAFKHNP  246

Query  993   GlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGF  814
             GLL +L+PQ+LLGNTLYP CL  AIW L   T R EF  +L +   +GY HL  G     
Sbjct  247   GLLWLLLPQVLLGNTLYPPCLMAAIWLLKWVTGRAEFDYMLRNSGEMGYAHLLPGFHCLC  306

Query  813   LAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllap  634
             LAATV   + +Q      +EW S A+ GL+ YEK+VG+LF   N+RH GES+ DLS+++P
Sbjct  307   LAATVCKFLLVQFVALCCMEWGSPAMEGLSPYEKLVGALFEAANTRHAGESVFDLSIISP  366

Query  633   avlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILIC  454
             A+L L V+MMYLP  T+F P+ +     K +   P++ +++ +++ S L  L IFIILIC
Sbjct  367   AILVLFVLMMYLPTHTSFLPVRNVKTAPKIQRDEPRR-HLLTRLMFSQLSYLVIFIILIC  425

Query  453   ITEREKMKEDPLNFNVLNIVVEVI  382
             ITERE +K DPLNFNV+NI +E I
Sbjct  426   ITEREYLKNDPLNFNVMNITIETI  449



>ref|XP_009406676.1| PREDICTED: cation transporter HKT2-like [Musa acuminata subsp. 
malaccensis]
Length=535

 Score =   278 bits (710),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 207/501 (41%), Positives = 310/501 (62%), Gaps = 15/501 (3%)
 Frame = -1

Query  1668  AFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEM  1489
             A R++ F + L YF+ L+L+G   + + KP   SF    +D+ F + S+ TVS + TVE 
Sbjct  42    ALRLSSFCIHLIYFVFLALLGSLIMVLLKPSDPSFSPSYVDMLFMSTSALTVSGLGTVET  101

Query  1488  EVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHV--ELGLV  1315
             E  S+ Q+  +T LMF+GGE F +            T+E    +   + +D V  EL  V
Sbjct  102   ERLSSAQIAVLTLLMFVGGEVFVT----LLGLLLRRTSEHDKREASAVGVDAVRSELEPV  157

Query  1314  TNNEYH--NDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMY  1141
              ++     + + P D + +  +    +D++L  CVR L  +V SYI   H+ G +L+ +Y
Sbjct  158   ASSRVVTIDSIEPVDGSAAMAE---EKDLRL-SCVRWLRYIVSSYIFTFHLFGTSLLLIY  213

Query  1140  IGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqil  961
             I  V  A+ +L++KG+++  F++ TTVS+F+N G + TNENM  F RNP +LL++I Q+L
Sbjct  214   IYRVSNARDILRKKGINVFLFSLSTTVSSFANGGLIATNENMAAFNRNPTMLLLMIAQVL  273

Query  960   LGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFL  781
              GN L+P  LRL IW L K T+R EFR +L S +   +  L   +++ FL+ TV GL+  
Sbjct  274   AGNLLFPLFLRLVIWTLKKITKREEFRHMLKSTSETRFSPLLPEKQTCFLSLTVVGLMTA  333

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
              L +F +++W      GLT +EK+V + F+  NSRH GE+ +D SL++PAVL  I+VMMY
Sbjct  334   LLVLFCSMDWDGAVFDGLTSFEKIVSAFFIAANSRHAGENSIDPSLISPAVLVFIIVMMY  393

Query  600   LPPDTTFFPIMDENNNSK-TKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKED  424
             LPP  TF+P  +++ +S   K  + KK + ++ +L+S L  + ++IILICI ER KM+ D
Sbjct  394   LPPSATFWPAEEDDTSSDGIKKQNKKKKSWVQNLLISQLSCIIVYIILICIIERRKMRRD  453

Query  423   PLNFNVLNIVVEVISAYGNVGFSTGYSCARQIK--PEGQCKDKQFGFVGRWSNMGKFILI  250
             PLNF+ LN++ EV SAYGNVG STGYSC+R +K  PE  C+DK +   G WS+  K IL 
Sbjct  454   PLNFSSLNMIFEVTSAYGNVGLSTGYSCSRLMKLHPEASCQDKPYSLAGWWSDESKIILS  513

Query  249   IVMFFGRLKKYHMKGGKAWKL  187
              VM +GRLKK+  + GKAW+L
Sbjct  514   SVMLYGRLKKFSAQDGKAWRL  534



>emb|CDX99538.1| BnaC09g24540D [Brassica napus]
Length=533

 Score =   265 bits (678),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 219/467 (47%), Positives = 294/467 (63%), Gaps = 24/467 (5%)
 Frame = -1

Query  1620  LSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMF  1441
             LS +GF AL++SKPR  S +  DLD+FF +VS+ TVSSMSTV+MEVFSN QL+ +T  + 
Sbjct  38    LSFLGFLALRISKPRTTS-RPHDLDLFFISVSAITVSSMSTVDMEVFSNTQLIIITIFIL  96

Query  1440  LGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNN---EYHNDL-NPEDS  1273
             LGGE FTS+L L+F              NK   + H+   L ++    +   DL N  + 
Sbjct  97    LGGEIFTSFLHLYFSH----CANFGFPYNK---LRHLVCSLSSDTPIEDRRRDLENVTNH  149

Query  1272  AKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGL  1093
              K   QI            + L  VVL Y +V ++VG  L+  Y+ F  + K VL  K +
Sbjct  150   LKRPSQINERAS-------KCLYSVVLGYHLVTNLVGSMLLLAYVSF--SVKDVLSSKDI  200

Query  1092  DLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWF  913
                TF+VFTTVSTFSNCGFVPTNENM++F++N GLLL+LIPQ+ +GNTL+P  L   IW 
Sbjct  201   SPLTFSVFTTVSTFSNCGFVPTNENMVIFRKNSGLLLLLIPQVFMGNTLFPCFLVFIIWG  260

Query  912   LGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIA  733
             LGK T+R EF  IL +   +GY  L S R    L  T  GL+ +Q  +F   EW S ++ 
Sbjct  261   LGKITKREEFGYILKNHKKMGYSPLLSVRLCVLLCLTALGLVLIQFLLFCTFEWNSKSLG  320

Query  732   GLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNN  553
             G+  Y+K+V SLF VVNSRHTGE+I+DLS L+PA+L L + MMYLPP T F P   EN+ 
Sbjct  321   GMNSYQKLVASLFQVVNSRHTGETIVDLSTLSPAILVLFIFMMYLPPYTLFMPFARENDK  380

Query  552   SKTKGCSPKKFNIIEK-ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISA  376
                +  S  +  + +  + +S L  L I ++LI ITE +K++ DPLNF++LNI +EVISA
Sbjct  381   KDGEYDSKNEKKVKKNGVYVSQLAFLVICVLLISITESKKIRRDPLNFSILNITLEVISA  440

Query  375   YGNVGFSTGYSCARQIK-PEGQCKDKQFGFVGRWSN-MGKFILIIVM  241
             YGNVGFSTGYSC R++   +G CKD  +GF GRWS  + K I++ V+
Sbjct  441   YGNVGFSTGYSCKRRLDVRDGSCKDAGYGFAGRWSPVVVKMIIVTVL  487



>gb|KDO61956.1| hypothetical protein CISIN_1g0458092mg, partial [Citrus sinensis]
Length=407

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 242/372 (65%), Gaps = 33/372 (9%)
 Frame = -1

Query  1695  MMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISF-KLKDLDvfftavssa  1519
             + +S++R L  +VNP  ++LSYFI +S +G+  L+VSKPR  SF   K++DVFFT+VS+ 
Sbjct  26    LFLSSIRFLVLKVNPLWIQLSYFISISSVGYLILRVSKPRDSSFINPKNIDVFFTSVSAM  85

Query  1518  tvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLE-------  1360
             T SSMSTVEMEVFSN QL+ MT LMF+GGE F S  GLH  +SK  +  ++ E       
Sbjct  86    TGSSMSTVEMEVFSNFQLIIMTILMFVGGEVFISMFGLHA-RSKFYSLNQLFENRINPNL  144

Query  1359  -------------KNKVIVIDHVELGLV-----TNNEYHNDLNPEDSAKSNVQIEVVEDI  1234
                          +N     D +ELG+V     TN E +N L  E    SN      +D 
Sbjct  145   TPSSSSSSSSSSSENSTEFTDQIELGIVSHSYITNEEPNNGLENEHRMSSN------DDN  198

Query  1233  KLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvst  1054
                  VRVL  VVL YI+V HVVG +LVA+Y    P+AKQ+LKQKGL + TF+VFTT ST
Sbjct  199   LKYNSVRVLVYVVLGYILVTHVVGSSLVALYTSLAPSAKQILKQKGLQIFTFSVFTTAST  258

Query  1053  fSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQI  874
             FSNCGFVPTNENM+VFK+N  LLLIL PQ LLGNTLYP+CLR  IW L K T R EF  I
Sbjct  259   FSNCGFVPTNENMMVFKKNALLLLILFPQGLLGNTLYPSCLRFVIWVLKKITNREEFDYI  318

Query  873   LGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLF  694
             L +   + Y HL S   S FLA TVFG IF+QL +F ALEW S+A  GL  +EK+V SLF
Sbjct  319   LRNSKEMIYRHLLSKAYSYFLAITVFGFIFVQLVLFCALEWDSEATDGLNFFEKLVASLF  378

Query  693   VVVNSRHTGESI  658
              VVNSRHTGES+
Sbjct  379   QVVNSRHTGESV  390



>ref|XP_006653744.1| PREDICTED: LOW QUALITY PROTEIN: cation transporter HKT4-like 
[Oryza brachyantha]
Length=553

 Score =   261 bits (667),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 198/492 (40%), Positives = 284/492 (58%), Gaps = 13/492 (3%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSKPR--PISFKLKDLDvfftavssatvssmstVE  1492
             F+  P +++L YF+ LS +GF  LK+ KPR  P     + LD+ FT+VS+ TVS M+TVE
Sbjct  67    FQSKPLIVQLLYFMTLSFVGFLDLKIHKPRHKPTP---RTLDLMFTSVSTVTVSRMATVE  123

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVT  1312
             ME FS+ QL  +  L  LGGE F S L LHF  + ++T E +L K        +E     
Sbjct  124   MEDFSDQQLWVLILLTLLGGEVFISMLALHFSNAGINTNE-ILPKRLSSTSRDIESFDAV  182

Query  1311  NNEYHNDLNPED-SAKSNVQIEVVEDIKLLG--CVRVLARvvlsyivvihvVGFTLVAMY  1141
             NN   N  N ED  +++      V++ K +   C  +LA +V  Y +      F +  ++
Sbjct  183   NNSTQN--NSEDCQSEATTSPNWVQESKTMKQKCRNILAHIVTGYFIAAVFCSFLVTIIF  240

Query  1140  IGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqil  961
             +      +  LK K + + TF++F  VS+F+NCGF P N+NM +F++N  LLL++IPQ+L
Sbjct  241   VQIDSYTRLPLKSKDIKIWTFSIFPAVSSFANCGFTPVNDNMAIFRKNTSLLLLVIPQVL  300

Query  960   LGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFL  781
              GNT+    LRL+IW LGK +RR E+  +L  P   GY +L   + S     TV GLI L
Sbjct  301   AGNTMLSPLLRLSIWALGKVSRRQEYAYMLQHPKDTGYRYLQPQKNSVDTVFTVGGLILL  360

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
             Q+      EW + A  GL   +K+V SLF   N+RH GE+I+D+S L+P +L L  ++MY
Sbjct  361   QVMFLSFFEWNTSAFDGLNWLQKLVCSLFQSANTRHAGEAIVDISTLSPPILLLFALVMY  420

Query  600   LPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDP  421
              P D    PI   N     +  +     I    +LS    L++F IL CITER+ +  DP
Sbjct  421   HPSDDAVCPINFYNQPLTERERNSNDQAIWMNYILSK-SCLAMFTILACITERKSISADP  479

Query  420   LNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVM  241
             LNF +  I  E+ISAY NVG+S GYSC + +KP+  CK   +GFVG+W++ GK I+I+VM
Sbjct  480   LNF-IFRIAFEIISAYANVGYSLGYSCEKLLKPDATCKATSYGFVGKWTDEGKLIIILVM  538

Query  240   FFGRLKKYHMKG  205
             F GR KK+ + G
Sbjct  539   FLGRFKKFTLTG  550



>gb|EMT13549.1| Cation transporter HKT4 [Aegilops tauschii]
Length=467

 Score =   257 bits (657),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 176/464 (38%), Positives = 260/464 (56%), Gaps = 20/464 (4%)
 Frame = -1

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV  1315
             EME FS  QL     LM LGGE FTS +GLHF  ++ + TE  L+     +   +E    
Sbjct  5     EMEDFSGQQLWVFIILMILGGEVFTSMVGLHFKNAR-ANTEDALQTRLAFISRDIESSDD  63

Query  1314  TNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVR-VLARvvlsyivvihvVGFTLVAMYI  1138
              NN   N +    S ++    +V E   +    R +LA VV  Y +   V    ++ +++
Sbjct  64    FNNSSQNYMEGIQSEETMPHNQVQESKGMNHKSRNILAHVVAGYFIAAIVCSSLVITIFL  123

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
                  A+ +LK K + + TF++FT VS+F+NCGF P N++M +FK NP  LL++ PQIL+
Sbjct  124   WIDSYARHLLKSKHIKMWTFSIFTAVSSFANCGFTPLNDSMAIFKHNPTFLLLVTPQILV  183

Query  957   GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             GNTL+   LRL+IW LGK + R E+  IL  P  +GY HL   + S  L  T   LI LQ
Sbjct  184   GNTLFAPLLRLSIWTLGKVSSREEYAYILQHPKEIGYRHLQPYKNSVKLVLTGVMLILLQ  243

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
               +    EW S ++ G+  ++K++GSLF   +SRH GE+++++S L+P ++ +  + MYL
Sbjct  244   AMLICYFEWDSKSLEGMGWFQKLIGSLFQSADSRHAGETVINISTLSPPIMVIFALAMYL  303

Query  597   PPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPL  418
             P  T+      +  +   K  +P      +K  ++    L IF +L CITER+ M  DPL
Sbjct  304   PSGTSILATYGDIRSLADKKENPNGRATWKKFAMTKRTCLVIFTVLACITERKSMTADPL  363

Query  417   NFNVLNIVVEVIS----------AYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNM  268
             NF++ ++V EVI           AYGNVG+S GY C + +KP+  C+D  +GFVGRWS+ 
Sbjct  364   NFSIFSVVFEVIRQVDILMRNFLAYGNVGYSLGYICDKLLKPDSACRDASYGFVGRWSDK  423

Query  267   GKFILIIVMFFGRLKKYHMKGGKAWKLS*VLTLIMSMCK*CDPH  136
             G+ I+I+VMF GR K Y +KG K        TL +  C+   PH
Sbjct  424   GRLIVILVMFLGRFKAYTLKGKK--------TLNVHPCRSGTPH  459



>gb|EPS63622.1| hypothetical protein M569_11162 [Genlisea aurea]
Length=966

 Score =   266 bits (680),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 278/441 (63%), Gaps = 42/441 (10%)
 Frame = -1

Query  1557  KDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVST  1378
             K++D++FT+VS+ T SSM+T+EME FSN QL+FMTF MF+GGE F+S   L+F  +K+  
Sbjct  95    KNIDLYFTSVSTVTDSSMATLEMETFSNSQLLFMTFFMFVGGEIFSSLPQLYFRLAKLKK  154

Query  1377  TERVLEKNKVIVIDHVELGLVTNNEYH-NDLNPEDSAKSNVQI------EVVEDIKLLGC  1219
               R+ E               + NE+   ++ P++  +    I      ++VE    +  
Sbjct  155   GRRIRE---------------SQNEFQLKEIVPDEKTEEQTTIVGGGSSKIVE----MKS  195

Query  1218  VRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCG  1039
             +  LA +V  Y++  +++GF  V  Y+  V +A+ VL+ KGL+  TF+VFT VSTF+NCG
Sbjct  196   IECLAFLVTFYVIFFNLLGFLAVLTYLKVVKSAEDVLRIKGLNAKTFSVFTAVSTFTNCG  255

Query  1038  FVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPN  859
             F+PTNE+M VF+ + GLLLILI Q L+GNTLYP  LR+ IW L K T + E   +L +  
Sbjct  256   FIPTNESMAVFREDSGLLLILIVQTLMGNTLYPVFLRILIWVLEKITGKTELVYLLRNSG  315

Query  858   G-LGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVN  682
             G +GY HL S  R  +L  T  G I +Q  V+  LEW+S    G + Y K+VGSLF VVN
Sbjct  316   GNIGYTHLMSRERCFYLLITAVGFIGVQFAVYCWLEWKS---VGGSFYRKIVGSLFQVVN  372

Query  681   SRHTGESIldlsllapavlalivVMMYLPPDTTFFPI--MDENNNSKTKGCSPKKFNIIE  508
             SRHTGES++DLS L  AVL LI++MMYLPP T++ P    +E  + K K          +
Sbjct  373   SRHTGESVVDLSTLNTAVLVLIILMMYLPPYTSYLPTSKQEEEEDGKMK----------K  422

Query  507   KILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQI  328
              ++ S    L+IFIIL+CITE+  +K DPLNFN+L+I +EVISAYGNVGFS GYSC R+I
Sbjct  423   NLVFSQPIYLTIFIILVCITEKRSIKNDPLNFNLLSIALEVISAYGNVGFSMGYSCGRRI  482

Query  327   KPEGQCKDKQFGFVGRWSNMG  265
                  C D  FGFVG+WS  G
Sbjct  483   NLRDGCIDGYFGFVGKWSYAG  503



>ref|XP_006657304.1| PREDICTED: LOW QUALITY PROTEIN: probable cation transporter HKT9-like 
[Oryza brachyantha]
Length=555

 Score =   258 bits (658),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 198/497 (40%), Positives = 294/497 (59%), Gaps = 28/497 (6%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +AF + P L+ L+YF+++ ++GF AL V +P    +  + +D+FF + S+ TV+ ++T
Sbjct  24    RFIAFHLRPLLIHLAYFLIIDVLGFVALVVLRPSNHRYNPRYVDMFFLSTSAVTVTGLAT  83

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHV--EL  1324
              +ME  S+ Q++ +T LMFLG E F S+LGL            V E  K    DH    +
Sbjct  84    TQMEDLSSSQILVLTLLMFLGSEMFLSFLGL------------VHESGKQNRHDHENRRV  131

Query  1323  GLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAM  1144
             G  T+ E     +  + A +       +DIK   C+R L  V+L+Y+++I V G  LV M
Sbjct  132   GSATSCEE----SQLEEATAQTPPTNSDDIKK-RCLRYLVFVMLAYMIIILVTGSLLVFM  186

Query  1143  YIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqi  964
             YI  V +A+ V+ +K ++   F+V  TVS+F+N G +PTNE+M VF  N GLLL+LI QI
Sbjct  187   YIAHVSSARDVVTRKSINKALFSVSVTVSSFTNGGLLPTNESMAVFSSNNGLLLLLISQI  246

Query  963   lLGNTLYPACLRLAIWFLG--KTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGL  790
             L G+TL+P  LRL IW L   +  R  E   I+ +   +G+ HL    ++  LAA    L
Sbjct  247   LAGSTLFPVFLRLVIWALRGLRLARAEEPGFIMSNTRAVGFNHLLPSMKTALLAAMEVAL  306

Query  789   IFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivV  610
             + + + +F  L W S   AGLT  +K++ +LF+ VN+R  GE+ +D SL+APAVL L + 
Sbjct  307   VAIAVMLFCCLNWGSAVFAGLTSLQKIINALFMAVNARQAGENSIDCSLVAPAVLVLFMA  366

Query  609   MMYLPPDTTFF-PIMDENNNSKTKGCSPKKFN-IIEKILLSPLGNLSIFIILICITEREK  436
             MMY P  TTFF    D   ++  +    +K N  ++++ LSPL   +   +L+CITER  
Sbjct  367   MMYTPSLTTFFSACQDHKQSNPEQDNKARKGNPFLKRMTLSPLAFNAALTMLVCITERRS  426

Query  435   MKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQI--KPEGQ---CKDKQFGFVGRWSN  271
             +  DPLNF+  NIV EVISAYGN+G STGYSC+R +  +PE +   C DK + F G WS+
Sbjct  427   LSTDPLNFSTFNIVFEVISAYGNIGLSTGYSCSRLLLMQPEKKGIACHDKPYSFSGWWSD  486

Query  270   MGKFILIIVMFFGRLKK  220
              GK +L+ VM +GR  +
Sbjct  487   SGKLVLVFVMLYGRXSE  503



>ref|XP_004951744.1| PREDICTED: probable cation transporter HKT6-like isoform X2 [Setaria 
italica]
Length=482

 Score =   251 bits (641),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 179/435 (41%), Positives = 267/435 (61%), Gaps = 19/435 (4%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEV  1483
             R NP  +++ YF  +S  G+ ALK+ KP+     LK LD+ FT++S++TVSSM+TVEME 
Sbjct  43    RSNPLFVQIIYFTSISFGGYAALKILKPQENPHALKYLDLLFTSISASTVSSMATVEMED  102

Query  1482  FSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVTNNE  1303
             FSN QL  +T LM +GGE FTS LGL+F ++K      V         +        + E
Sbjct  103   FSNSQLWMLTILMLIGGEVFTSMLGLYFMKAKFDAKGSV---------NKTGYSFYADVE  153

Query  1302  YHNDLNPEDSAKSNVQIEV-VEDIKLLGCVRV-------LARvvlsyivvihvVGFTLVA  1147
               +  NP  ++    ++ V + +++L    RV       L   ++ Y++V ++ G   + 
Sbjct  154   SASSENPGPNSTQGTKVMVPISELRLEDKDRVDHETMKSLGYALMVYLLVTNLGGSLAIY  213

Query  1146  MYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipq  967
             +Y+  VP A++VLK+K +    F++FT +S+  NCGF P NENM++F++N  LLL+LIP+
Sbjct  214   LYLILVPDAQEVLKRKDIGYVIFSIFTAISSIGNCGFTPVNENMVIFQKNTILLLLLIPK  273

Query  966   ilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLI  787
             ILLGNTL+  CLR  +W L K T + E+  IL  P  +GY HL +GR   +L  TV   I
Sbjct  274   ILLGNTLFAPCLRFMMWSLEKITTKKEYHFILQHPKAVGYKHLMNGRECVYLMVTVIVFI  333

Query  786   FLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVM  607
              +Q  +F +LEW S+A+  +  Y+K+VG+LF  VN+RH GE+I+DLS L+ ++L L  +M
Sbjct  334   IMQTILFCSLEWNSNALQEMNSYQKIVGALFQSVNARHAGENIVDLSSLSSSILVLYTIM  393

Query  606   MYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKE  427
             MYLP  T+F P   +N+    +G   K+ +  E  +LS L  L+IF++LICITE+E M  
Sbjct  394   MYLPSYTSFLP--KDNDQDSNEGMKYKRRSRCENWILSQLSYLAIFVLLICITEKEAMAT  451

Query  426   DPLNFNVLNIVVEVI  382
             DPLNFN+ +I  EVI
Sbjct  452   DPLNFNIFSITFEVI  466



>emb|CCH26449.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
Length=435

 Score =   248 bits (634),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 202/416 (49%), Positives = 273/416 (66%), Gaps = 33/416 (8%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRVLARvv-------lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++  R         LSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTTEKEG  379

Query  540   GCSPKKFNIIEK---ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
             G    +     K   +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVI
Sbjct  380   GDDDSENGKKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVI  435



>ref|XP_009415055.1| PREDICTED: sodium transporter HKT1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   251 bits (640),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 190/450 (42%), Positives = 279/450 (62%), Gaps = 27/450 (6%)
 Frame = -1

Query  1725  PPISLRNKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLD  1546
             PP S     T   +++  L  +VNPF ++  YF+  S+ GF  LK+   R  + +  ++D
Sbjct  2     PPPSTVMDITFHRNSLIHLLSQVNPFWIQFFYFLSSSITGFLLLKLLPTRDATSRPTNVD  61

Query  1545  vfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERV  1366
             + F +VS+ TVSSM T+EMEVFSN QL  +T LM +GGE F S L +HF  +K+++  R 
Sbjct  62    LLFMSVSANTVSSMDTMEMEVFSNYQLAVLTLLMVIGGEVFISMLSVHF--TKINSQMR-  118

Query  1365  LEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsy  1186
                +  +     EL  +++    +DL  + S++ ++   VV    L+G V          
Sbjct  119   ---DSALDAAGTELATLSDQRRSSDL--KFSSRKHL-FFVVLGYLLVGHV----------  162

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
                   VGF L+ +Y+  VP A  VL++KG++ + F++F TVSTF+NCGFVPTNENM+VF
Sbjct  163   ------VGFLLILVYLRLVPEAGAVLERKGINASLFSIFITVSTFANCGFVPTNENMVVF  216

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
             +   GLLLIL  Q+L+GNTLY +CL   IW L K T+R E+  +L +   +   HL  G 
Sbjct  217   RTYSGLLLILTVQVLVGNTLYASCLWAVIWLLKKLTKRREYDYLLTNYGEMECNHLLPGS  276

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldls  646
              S +LA TV GL+ +Q  +F  +EW S+ ++GL+ Y+KVVG +F  VNSR+ GE+I+DL+
Sbjct  277   HSLYLALTVAGLVLVQFGLFCCMEWTSEILSGLSTYQKVVGVVFQCVNSRYAGETIVDLA  336

Query  645   llapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFI  466
              +APA+L L VVMMY+PP T F P   +    K +  S KK  +   ++ SPL  ++IF 
Sbjct  337   AVAPAILVLFVVMMYIPPYTCFLPRKGDKQLLKGRERSRKKQGL--SLIFSPLSYIAIFT  394

Query  465   ILICITEREKMKEDPLNFNVLNIVVEVISA  376
             I+ CITER ++ EDP+NF+VLNIVVEV+S+
Sbjct  395   IIACITERRQISEDPINFSVLNIVVEVVSS  424



>emb|CDY05096.1| BnaC03g28940D [Brassica napus]
Length=445

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 203/439 (46%), Positives = 278/439 (63%), Gaps = 21/439 (5%)
 Frame = -1

Query  1680  VRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssms  1501
             +R   ++     L   YF+  S +GF A+KVS PR  S +  DLD+FFT+VS+ TVSSMS
Sbjct  12    IRSKLYKSRSCFLNFVYFLSFSFLGFLAVKVSNPRTTS-RPHDLDIFFTSVSAITVSSMS  70

Query  1500  tVEMEVFSNLQLVFMTFLMFLGGECFTSWLGL---HFFQSKVSTTERVLEKNKVIVIDHV  1330
             TV+MEVFSN QL+ +T LMF+GG  FTS+L +   HF       T+ V   +K   I H+
Sbjct  71    TVDMEVFSNTQLIIITILMFIGGPIFTSFLNIYLSHF-------TKFVFPHSK---IKHL  120

Query  1329  ELGLVTNNEYHNDLN-PEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTL  1153
              +G    +    DL   +++     +I    + K   C+ ++    + Y +V ++ G  L
Sbjct  121   -IGSFKADHTIEDLRLDQENITDRHEIPSQTNEKASKCLYLVV---IGYHLVTNIAGSML  176

Query  1152  VAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllili  973
             + +Y+ FV TA+ VL+ K +   TF++FTTVSTF+ CGFVPTNENMI+F++N GLL +LI
Sbjct  177   LLVYVSFVKTARDVLRSKEISALTFSIFTTVSTFATCGFVPTNENMIIFRKNSGLLWLLI  236

Query  972   pqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFG  793
             P +L+GNTL+P  LRL IW L KTT+R EF  IL +   +GY HL S R   FL  TV G
Sbjct  237   PLVLMGNTLFPCFLRLLIWGLSKTTKREEFGYILKNRKKMGYSHLLSVRLCVFLGLTVLG  296

Query  792   LIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlaliv  613
              I +QL +F    W S+++AG+  YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L +
Sbjct  297   FILIQLFLFCTFSWSSESLAGMNWYEKLVGSLFQVVNSRHTGETIVDLSTLSPAILILFI  356

Query  612   VMMYLPPDTTFFP--IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
             +MMYLPP T F P  +  +N   +      KK      +L+S L  L I I LI ITER+
Sbjct  357   LMMYLPPYTLFMPFTMKKKNKKEEENDSGYKKGGKKSGLLVSQLSFLVICIFLISITERQ  416

Query  438   KMKEDPLNFNVLNIVVEVI  382
             K++ DPLNFNVLNI +EV+
Sbjct  417   KLRRDPLNFNVLNITLEVV  435



>ref|XP_003563514.1| PREDICTED: probable cation transporter HKT9 [Brachypodium distachyon]
Length=508

 Score =   250 bits (638),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 194/510 (38%), Positives = 291/510 (57%), Gaps = 51/510 (10%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A  ++P L+ LSYF++  ++GF AL   KP   ++  + +D+ F + S+ TV+ ++T
Sbjct  24    RFIASHLSPLLIHLSYFVIFDILGFVALMALKPSNPNYTPRYIDMLFLSTSALTVTGLAT  83

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             ++ME  S+ Q++ +T LM LG E F S LGL            V E +K           
Sbjct  84    IKMEDLSSSQILVLTLLMLLGSEMFVSLLGL------------VHELSK-----------  120

Query  1317  VTNNEYHNDLNPEDSAKSNVQI----EVVEDIKLL----------GCVRVLARvvlsyiv  1180
                    N  +PEDS   +V +    +V E I              C++ L  V+++Y+V
Sbjct  121   ------QNKHDPEDSRVRSVTVLNESQVEEAIPATPSTNSNGLKKSCLKYLGFVLVAYMV  174

Query  1179  vihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKR  1000
              I +VG  LV MY+  V TA+ VL +K ++   F++  T S+F+N G +PTNE+M VF  
Sbjct  175   TILLVGSLLVFMYVTHVSTARDVLARKSINTVLFSISVTTSSFTNGGLLPTNESMAVFAS  234

Query  999   NPGlllilipqilLGNTLYPACLRLAIWFL-GKTTRRI---EFRQILGSPNGLGYGHLFS  832
             N GLLL+L  QIL G+ L P  LRL IW L G    ++   EF  ++ +   +G  HL  
Sbjct  235   NQGLLLLLTGQILAGSMLLPVILRLVIWALKGLRMTKVKPEEFEFMMHNTKAMGLNHLLP  294

Query  831   GRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIld  652
               ++ FLA TV  L  + +T+F  L W S    GLT  +K+  +LF+ VN+R  GE+ +D
Sbjct  295   NLQTVFLAVTVTALTAVAVTLFCCLNWYSAVFTGLTSSQKITNALFMAVNARQAGENSID  354

Query  651   lsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCS-PKKFNI-IEKILLSPLGNL  478
              SL+APA L L + MMY+P  TT F + D++    T+    PKK ++ +  +L SPL   
Sbjct  355   CSLVAPAALLLFMAMMYIPASTTVFSVQDDDARGDTEHKDGPKKRSLSLNNMLFSPLACN  414

Query  477   SIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQ--CKD  304
             +  I+++CITER  +  DPLNF+  N++ EVISAYGNVG S GYSC+R + PE +  C +
Sbjct  415   AAMIMIVCITERRLLFTDPLNFSTFNMIFEVISAYGNVGLSIGYSCSRLLHPEKESICHE  474

Query  303   KQFGFVGRWSNMGKFILIIVMFFGRLKKYH  214
             K + F G WS+ GK +L++VM +GRLK +H
Sbjct  475   KPYSFSGWWSDQGKVVLVLVMLYGRLKCFH  504



>emb|CAB39784.1| potassium uptake transporter-like protein [Arabidopsis thaliana]
 emb|CAB78154.1| potassium uptake transporter-like protein [Arabidopsis thaliana]
Length=489

 Score =   249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 203/424 (48%), Positives = 275/424 (65%), Gaps = 33/424 (8%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRVLARvv-------lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++  R         LSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  540   GCSPKKFNIIEK---ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYG  370
             G    +     K   +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVI    
Sbjct  380   GDDDSENGKKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVIRIIN  439

Query  369   NVGF  358
              + F
Sbjct  440   KISF  443



>emb|CCH26461.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26521.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
Length=435

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 204/416 (49%), Positives = 275/416 (66%), Gaps = 33/416 (8%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYISYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRV-------LARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++       L  VVLSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  540   GCSPKKFNIIEK---ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
             G    +     K   +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVI
Sbjct  380   GDDDSENGKKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVI  435



>emb|CCH26450.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26455.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
Length=435

 Score =   247 bits (630),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 202/416 (49%), Positives = 273/416 (66%), Gaps = 33/416 (8%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRVLARvv-------lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++  R         LSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  540   GCSPKKFNIIEK---ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
             G    +     K   +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVI
Sbjct  380   GDDDSENGKKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVI  435



>emb|CCH26452.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
Length=435

 Score =   247 bits (630),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 202/416 (49%), Positives = 273/416 (66%), Gaps = 33/416 (8%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRVLARvv-------lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++  R         LSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  540   GCSPKKFNIIEK---ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
             G    +     K   +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVI
Sbjct  380   GDDDSENGKKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVI  435



>emb|CCH26448.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26451.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26453.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26454.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26456.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26457.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26458.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26459.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26460.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26516.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26517.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26519.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
 emb|CCH26520.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
Length=435

 Score =   247 bits (630),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 204/416 (49%), Positives = 275/416 (66%), Gaps = 33/416 (8%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ TVSSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIEDRC----DVETVT  140

Query  1239  DIKLLGCVRV-------LARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++       L  VVLSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTK  541
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++    K  
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  540   GCSPKKFNIIEK---ILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
             G    +     K   +++S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVI
Sbjct  380   GDDDSENGKKVKKSGLIVSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVI  435



>emb|CCH26518.1| high-affinity K+ transporter 1, partial [Arabidopsis thaliana]
Length=435

 Score =   246 bits (628),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 202/420 (48%), Positives = 274/420 (65%), Gaps = 41/420 (10%)
 Frame = -1

Query  1593  KVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSW  1414
             K++KPR  S +  D D+FFT+VS+ T+SSMSTV+MEVFSN QL+F+T LMFLGGE FTS+
Sbjct  41    KITKPRTTS-RPHDFDLFFTSVSAITLSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTSF  99

Query  1413  LGLH--FFQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVE  1240
             L L+  +F      T+ V   NK   I H+ LG      Y++D + ED       +E V 
Sbjct  100   LNLYVSYF------TKFVFPHNK---IRHI-LG-----SYNSDSSIED----RYDVETVT  140

Query  1239  DIKLLGCVRVLARvv-------lsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLtt  1081
             D +  G +++  R         LSY +V ++VG  L+ +Y+ FV TA+ VL  K +   T
Sbjct  141   DYRE-GLIKIDERASKCLYSVVLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLT  199

Query  1080  favfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKT  901
             F+VFTTVSTF+NCGFVPTNENMI+F++N GL+ +LIPQ+L+GNTL+P  L L IW L K 
Sbjct  200   FSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLMGNTLFPCFLVLLIWGLYKI  259

Query  900   TRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTG  721
             T+R E+  IL + N +GY HL S R    L  TV G + +QL  F A EW S+++ G++ 
Sbjct  260   TKRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEGMSS  319

Query  720   YEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDEN------  559
             YEK+VGSLF VVNSRHTGE+I+DLS L+PA+L L ++MMYLPP T F P+ ++       
Sbjct  320   YEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMMYLPPYTLFMPLTEQKTIEKEG  379

Query  558   -NNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
              ++    G   KK  +I    +S L  L+I I LI ITER+ ++ DP+NFNVLNI +EVI
Sbjct  380   GDDDSGNGKKVKKSGLI----VSQLSFLTICIFLISITERQNLQRDPINFNVLNITLEVI  435



>ref|XP_006453201.1| hypothetical protein CICLE_v100106251mg, partial [Citrus clementina]
 gb|ESR66441.1| hypothetical protein CICLE_v100106251mg, partial [Citrus clementina]
Length=351

 Score =   238 bits (607),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 222/338 (66%), Gaps = 8/338 (2%)
 Frame = -1

Query  1659  VNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVF  1480
             +NP +L L YF  LSL+G+F L V+KPR  S   K  DVFFT+VS+AT SSM TVEMEVF
Sbjct  1     MNPLMLHLCYFTALSLLGYFLLSVTKPRTHSTTPKTFDVFFTSVSAATDSSMGTVEMEVF  60

Query  1479  SNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL----EKNKVIVIDHVELGLVT  1312
             SN QL+ MT LM  GGE F S L L F +SK+      L           ++ +EL  + 
Sbjct  61    SNCQLIIMTILMLAGGEVFMSMLELFFIKSKLPKHNDHLLITPSSKPTKSVEQIELNSIC  120

Query  1311  NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGF  1132
              +E  + ++ ++    N    +++       +R L  VVL Y +++HV G  LV  YI  
Sbjct  121   CSEKTDHISFDNKNNKNNNNTILKH----NSIRYLCYVVLGYFLIVHVGGSCLVLWYISL  176

Query  1131  VPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGN  952
             +P+AK VL+QKGL   TF++FT VSTFSNCGFVPTNENMIVFK N GLLL+LIPQ+LLGN
Sbjct  177   IPSAKHVLEQKGLQAETFSLFTIVSTFSNCGFVPTNENMIVFKENSGLLLLLIPQVLLGN  236

Query  951   TLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLT  772
             TLYPACLR AIW L K T+R E   +L +   +GY HL S  RS FLA TVFG I +QL 
Sbjct  237   TLYPACLRFAIWVLKKITKREECDYLLKNYREIGYDHLLSRSRSCFLAITVFGFIIVQLV  296

Query  771   VFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESI  658
             +F +LEW S+A+  L  Y+K+V SLF VVNSRHTGES+
Sbjct  297   IFCSLEWNSEAMDDLNFYQKLVASLFEVVNSRHTGESV  334



>ref|XP_010233891.1| PREDICTED: probable cation transporter HKT6 isoform X2 [Brachypodium 
distachyon]
Length=366

 Score =   238 bits (608),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 171/258 (66%), Gaps = 4/258 (2%)
 Frame = -1

Query  957  GNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
            GNTL+  CLR  +W   K T + E   IL  P  +G  HL S R+  +L  TV   I LQ
Sbjct  111  GNTLFAPCLRYMVWTFKKITGKEECHFILQHPKAIGCRHLMSTRKCVYLVVTVVSFIILQ  170

Query  777  LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
              +F +LEW S+A+  ++ YEK+VG+LF   N+RH GES++DLS ++ A+  L  VMMYL
Sbjct  171  TILFCSLEWSSEALQEMSSYEKIVGALFQSTNARHAGESVVDLSSVSSAITVLYTVMMYL  230

Query  597  PPDTTFFP-IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDP  421
            P  T+F     D  + ++ +  S +   +++  + S L  L+IF++LICITERE M  DP
Sbjct  231  PGYTSFLHNYEDPYSKARERDNSRR---LLKDWVFSQLSYLAIFLMLICITEREAMTTDP  287

Query  420  LNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVM  241
            LNFNV +I+ E++SAYGNVGFS GYSC R +K +  CKD  +GFVG+WS+ GK ILI+VM
Sbjct  288  LNFNVFSILFEIVSAYGNVGFSVGYSCKRLLKHDVYCKDASYGFVGKWSDKGKLILIVVM  347

Query  240  FFGRLKKYHMKGGKAWKL  187
             FGRLK +++KGG AWKL
Sbjct  348  VFGRLKTFNLKGGSAWKL  365


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEV  1483
             + NP  ++L+YF ++S  G+ ALKV K +  S  +KDLD+ FT+VS++TVSSM+TVEME 
Sbjct  30    QTNPLFIQLTYFTLISFAGYEALKVLKSQDKSNTMKDLDLLFTSVSASTVSSMATVEMED  89

Query  1482  FSNLQLVFMTFLMFLGGE  1429
             FS+ QL  +  LM +G E
Sbjct  90    FSSTQLWILAILMLIGSE  107



>ref|NP_001058485.1| Os06g0701600 [Oryza sativa Japonica Group]
 sp|Q8L4K5.1|HKT9_ORYSJ RecName: Full=Probable cation transporter HKT9; Short=OsHKT9 
[Oryza sativa Japonica Group]
 emb|CAD37198.1| putative sodium transporter [Oryza sativa Japonica Group]
 emb|CAD37199.1| putative sodium transporter [Oryza sativa Japonica Group]
 dbj|BAD53774.1| putative high-affinity potassium uptake transporter [Oryza sativa 
Japonica Group]
 dbj|BAF20399.1| Os06g0701600 [Oryza sativa Japonica Group]
 gb|EEE66306.1| hypothetical protein OsJ_22537 [Oryza sativa Japonica Group]
Length=509

 Score =   242 bits (618),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 190/497 (38%), Positives = 290/497 (58%), Gaps = 31/497 (6%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +AF ++P L+ LSYF+++ ++GF AL V +P    +  + +D+FF + S+ TV+ ++T
Sbjct  24    RFIAFHLSPLLIHLSYFLIIDVLGFVALVVLRPSNHKYNPRYIDMFFLSTSAVTVTGLAT  83

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
              +ME  S+ Q+  +T LMFLG E F S+LGL    SK +  +   E  +V  +       
Sbjct  84    TQMEDLSSSQIAVLTLLMFLGSEMFLSFLGLVLESSKQNKHDP--ENRRVSSVT------  135

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
             V    +  +  P+  + ++  I+         C + L  VVL+Y+++I V G  LV MYI
Sbjct  136   VCEQSHLEEAIPQTPSMNSTDIK-------RSCHKYLVFVVLAYMIIILVTGSLLVFMYI  188

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               V +A+ VL +K ++   F++  TVS+F+N G +PTNE+M VF  N GLLL+LI QIL 
Sbjct  189   AHVSSARDVLTRKSINKALFSISVTVSSFTNGGLLPTNESMAVFSSNNGLLLLLIGQILA  248

Query  957   GNTLYPACLRLAIWFLG--KTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIF  784
             G+TL P  LRL IW L   +  +  E   ++ + + +G+ HL    ++ FLAA     + 
Sbjct  249   GSTLLPMFLRLVIWALRGLRLAKAEEPDFMMNNSSSVGFSHLLPNLQTIFLAAVEVAFVG  308

Query  783   LQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMM  604
             + + +F  L W S   AGLT  +K+  +LF+ V++R  GE+ +D SL+APA L L +VMM
Sbjct  309   MTVILFCCLNWDSAVFAGLTSLQKITNALFMAVSARQAGENSIDCSLVAPAALVLFMVMM  368

Query  603   YLPPDTTFFP-------IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITE  445
             Y P  T  F        I  E+++  +KG   K F  ++ +  SPL   +  I+L+CITE
Sbjct  369   YTPSLTKLFSACQDHKQIGPESDDRTSKG---KPF--LKTMAFSPLAFNTTVIMLVCITE  423

Query  444   REKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEG--QCKDKQFGFVGRWSN  271
             R  +  DPLNF+  NI+ EVISAYGN+G STGYSC+RQ++ +    C +K + F G WS 
Sbjct  424   RRSISTDPLNFSTFNIIFEVISAYGNIGLSTGYSCSRQLQHQDGIACHEKPYSFSGWWSE  483

Query  270   MGKFILIIVMFFGRLKK  220
              GK IL++ M +GRL  
Sbjct  484   PGKLILVLAMLYGRLNS  500



>gb|KDO61997.1| hypothetical protein CISIN_1g0456322mg, partial [Citrus sinensis]
Length=389

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 228/356 (64%), Gaps = 9/356 (3%)
 Frame = -1

Query  1707  NKHTMMMSTVRRLAFR--VNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfft  1534
              K +  MST   LA +  +NP +L L YF  LSL+G+F L V+KPR  S   K  DVFFT
Sbjct  20    TKISCFMSTFIFLAVKYIMNPLMLHLCYFTALSLLGYFLLSVTKPRTHSTDPKTFDVFFT  79

Query  1533  avssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVL---  1363
             +VS+AT SSM TVEMEVFSN QL+ MT LM  GGE F S L L F +SK+      L   
Sbjct  80    SVSAATDSSMGTVEMEVFSNSQLIIMTILMLAGGEVFMSMLELFFIKSKLPKHNDHLLIT  139

Query  1362  -EKNKVIVIDHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsy  1186
                     ++ +EL  +  +E  + ++ ++    N     +        +R L  VVL Y
Sbjct  140   PSSKPTKSVEQIELNSICCSEKTDHISFDNKNNKNKNNNTILK---HNSIRYLCYVVLGY  196

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
              +++HV G  LV  YI  +P+AK VL+QKGL   TF++FT VSTFSNCGFVPTNENMIVF
Sbjct  197   FLIVHVGGLCLVLWYISLIPSAKHVLEQKGLQAETFSLFTIVSTFSNCGFVPTNENMIVF  256

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
             K N GLLL+LIPQ+LLGNTLYPACLR AIW L K T+R E   +L +   +GY HL S  
Sbjct  257   KENSGLLLLLIPQVLLGNTLYPACLRFAIWVLKKITKREECDYLLKNYREIGYDHLLSRS  316

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESI  658
             RS FLA TVFG I +QL +F +LEW S+A+  L  Y+K+V SLF VVNSRHTGES+
Sbjct  317   RSCFLAITVFGFIIVQLVIFCSLEWNSEAMDDLNFYQKLVASLFEVVNSRHTGESV  372



>ref|XP_004513110.1| PREDICTED: sodium transporter HKT1-like isoform X2 [Cicer arietinum]
Length=453

 Score =   236 bits (601),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 237/370 (64%), Gaps = 36/370 (10%)
 Frame = -1

Query  1707  NKHTMMMSTVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftav  1528
             N      S  R L+F++N F ++L YFI+LSL G+  LK SKPR   F+ KD D+F+T+V
Sbjct  17    NNFNFHRSLSRSLSFQLNSFFIQLFYFIILSLFGYLGLKFSKPRT-CFRPKDFDLFYTSV  75

Query  1527  ssatvssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKV  1348
             S++TVSSM+++EMEVFSN QL+ +TFLM  GGE FTS L L  F ++ S T+    KN+ 
Sbjct  76    SASTVSSMTSIEMEVFSNFQLILLTFLMLAGGEVFTSMLQL--FLARFSFTQNQCVKNEY  133

Query  1347  IV-------------IDHVELGLVT-------NNEYHNDLNPEDSAKSNVQIEVVEDIKL  1228
                            I+ +ELGLV+       + + H++ N +D  K N           
Sbjct  134   SSTTLSLKHDPSHNQINQIELGLVSIPHHSENHTQNHHNFNDKDKLKYN-----------  182

Query  1227  LGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfS  1048
                +R L+ VVL Y+++IH  GF+LV  Y+ ++P+AK VLK KG+ + TF++F  VSTF+
Sbjct  183   --SLRYLSYVVLGYLMLIHFFGFSLVTFYLTYIPSAKYVLKNKGIKIETFSLFLIVSTFA  240

Query  1047  NCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILG  868
             +CG+VPTNEN+IVFK+N GLLL+++P +L GNTLYP CLRL +  +   T+R EF  +L 
Sbjct  241   SCGYVPTNENLIVFKKNSGLLLLILPHVLFGNTLYPPCLRLFLKVMKSVTKREEFSYLLK  300

Query  867   SPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVV  688
             +   +GY HL SG    FL  TVFG I +QL +F ++EW S+ + GL  Y+K+V SLF V
Sbjct  301   NSKEIGYDHLLSGIHCWFLLVTVFGFIVIQLVLFCSMEWNSNIMEGLNPYQKLVASLFQV  360

Query  687   VNSRHTGESI  658
              N+RH+GES+
Sbjct  361   TNARHSGESV  370


 Score =   108 bits (269),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -1

Query  399  IVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKK  220
            ++  V+ AYGNVGFSTGYSC+RQ+     CKD   GF G+WS  GKFILI+VMFFGRLKK
Sbjct  382  VIFIVMIAYGNVGFSTGYSCSRQLNHNSMCKDSWIGFSGKWSTKGKFILILVMFFGRLKK  441

Query  219  YHMKGGKAWKLS  184
            ++M GGKAW LS
Sbjct  442  FNMNGGKAWHLS  453



>ref|NP_001043248.1| Os01g0532600 [Oryza sativa Japonica Group]
 sp|Q8L481.1|HKT3_ORYSJ RecName: Full=Probable cation transporter HKT3; Short=OsHKT3 
[Oryza sativa Japonica Group]
 emb|CAD37186.1| putative sodium transporter [Oryza sativa Japonica Group]
 emb|CAD37187.1| putative sodium transporter [Oryza sativa Japonica Group]
 dbj|BAD87687.1| putative high-affinity potassium uptake transporter [Oryza sativa 
Japonica Group]
 dbj|BAF05162.1| Os01g0532600 [Oryza sativa Japonica Group]
Length=509

 Score =   236 bits (603),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 187/497 (38%), Positives = 291/497 (59%), Gaps = 31/497 (6%)
 Frame = -1

Query  1677  RRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmst  1498
             R +A+ ++P L+ LSYF+++ ++GF +L V +P    +  + +D+FF + S+ TV  ++T
Sbjct  24    RFIAYHLSPLLIHLSYFLIIDILGFVSLVVLRPSNHKYNPRYVDMFFLSTSAVTVIGLAT  83

Query  1497  VEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGL  1318
             ++ME  S+ Q+  +T LMFL  + F S+LGL    SK +  +   E  +V  +       
Sbjct  84    IQMEDLSSSQIAILTLLMFLDSKMFLSFLGLVLESSKQNKHDP--ENRRVSSVT------  135

Query  1317  VTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYI  1138
             V       +  P+  + +++ I+         C++ L  VVL+Y+++I V G  LV MYI
Sbjct  136   VCKQSQLEEATPQTPSMNSIDIKK-------RCLKYLVFVVLAYMIIILVTGSLLVFMYI  188

Query  1137  GFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilL  958
               V +A+ VL +K ++   F++  TVS+F+N G +PTNE+M+VF  N GLLL+LI QIL 
Sbjct  189   AHVSSARDVLTRKSINKALFSISVTVSSFTNGGLLPTNESMVVFSSNNGLLLLLIGQILA  248

Query  957   GNTLYPACLRLAIWFLG--KTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIF  784
             G+TL+P  LRL IW L   +  +  E   ++ + + +G+ HL    ++ FLA      + 
Sbjct  249   GSTLFPVFLRLVIWALRGLRLAKAEEPDFMMNNSSAVGFSHLLPNLQTIFLAVVEVAFVA  308

Query  783   LQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMM  604
             + + +F  L W S   AGL+  +K+  +LF+ VN+R  GE+ +D SL+APA L L +VMM
Sbjct  309   MTVILFCCLNWDSVVFAGLSSLQKITNALFMAVNARQAGENSIDCSLVAPAALVLFMVMM  368

Query  603   YLPPDTTFFP-------IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITE  445
             Y P  T  F        I  E+++  +KG   K F  ++ +  SPLG  +  I+L+CITE
Sbjct  369   YTPSLTKLFSACQDHKRIGPESDDRTSKG---KPF--LKMMAFSPLGFNTTVIMLVCITE  423

Query  444   REKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEG-QCKDKQFGFVGRWSN  271
             R  +  DPLN +  NI+ EVISAYGN+G STGYSC+RQ++  EG  C +K + F G WS 
Sbjct  424   RRSLSTDPLNLSTFNIIFEVISAYGNIGLSTGYSCSRQLQHQEGIACHEKAYNFSGWWSE  483

Query  270   MGKFILIIVMFFGRLKK  220
              GK IL++ M  GRL  
Sbjct  484   PGKLILVLAMLCGRLNS  500



>ref|XP_004967240.1| PREDICTED: probable cation transporter HKT9-like [Setaria italica]
Length=537

 Score =   229 bits (584),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 200/501 (40%), Positives = 283/501 (56%), Gaps = 46/501 (9%)
 Frame = -1

Query  1632  YFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMT  1453
             YF+ + L+GF AL + KP    ++ + +DVFF + S+ATV+ ++TV+ME  S+ Q+V +T
Sbjct  53    YFLAIDLLGFLALVLLKPSSPGYRPRYVDVFFMSTSAATVTGLATVKMEDLSSSQVVVLT  112

Query  1452  FLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVEL--GLVTNNEYHNDLNPE  1279
              LM LG E F S LGL          E    + +    DH      +VT ++  N     
Sbjct  113   ILMLLGSEMFVSLLGL--------VLESRKRRRRGRDPDHGGRVRSVVTVSDESNLEAAN  164

Query  1278  DSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQK  1099
              SA S    E         C+  LA V+L Y+ ++ V+G  LV +Y+  VP+A+ VL +K
Sbjct  165   PSASSGDHKE--------SCLGSLALVMLVYMAMVLVLGSVLVFVYVAGVPSARDVLARK  216

Query  1098  GLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRLAI  919
             G+    F+   TVS+F+N G +PTNE+M VF  N GLLL+L  QIL GNTL P  LR AI
Sbjct  217   GISAALFSAVVTVSSFTNGGLLPTNESMAVFSANRGLLLLLAGQILAGNTLLPVILRPAI  276

Query  918   WFLGKTTRRIE--FRQILGSPN-----------GLGYGHLF-SGRRSGFLAATVFGLIFL  781
             W     TRR+E  F    GS               G+GHL   G ++ FLA TV  +   
Sbjct  277   W----ATRRLERVFAGRHGSEEEGLESMTKDAVAAGFGHLLLPGLQTVFLAVTVVAVAAA  332

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
               T+   L W S   AG+T  EKV  +LF+ VN R  GE+ +D SLLAPAVL L + MM 
Sbjct  333   TATLLCCLNWDSAVFAGITAGEKVTNALFMAVNVRQAGENSIDCSLLAPAVLVLFLAMMC  392

Query  600   LPPDTTFFPIMDENNNSKTKGCSPKKFN--------IIEKILLSPLGNLSIFIILICITE  445
             +P   TFF + D  +  +  G  P++ +         + ++LLSPL   +  ++L+C+TE
Sbjct  393   IPATATFFSVHDGGSVGEPSGGEPERKDGAAKRRRLTLNRMLLSPLAGNAAVVMLVCVTE  452

Query  444   REKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPE--GQCKDKQFGFVGRWSN  271
             R  +  DPLNF+  N++ EV+SAYGNVG STGYSC+R ++PE    C DK + F G WS+
Sbjct  453   RRSISGDPLNFSTFNMIFEVVSAYGNVGLSTGYSCSRLLRPEESSACHDKPYSFSGWWSD  512

Query  270   MGKFILIIVMFFGRLKKYHMK  208
              GK +L+++M +GRLK +H K
Sbjct  513   QGKLVLVLLMLYGRLKGFHRK  533



>gb|KHN32920.1| Sodium transporter HKT1 [Glycine soja]
Length=339

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 217/329 (66%), Gaps = 14/329 (4%)
 Frame = -1

Query  1626  IVLSLIGFFALKVSKPR-PISFKLKDLDvfftavssatvssmstVEMEVFSNLQLVFMTF  1450
             ++LSL+G+  LKVSKPR P+  +L DLD+F+T+VS++T SSM  VEMEVFSN QL+  T 
Sbjct  1     MILSLVGYLGLKVSKPRNPV--RLNDLDLFYTSVSASTASSMVAVEMEVFSNSQLILFTL  58

Query  1449  LMFLGGECFTSWLGLHF----FQSKVSTTERVLEKNKVIVIDHVELGLVTNNEYHNDLNP  1282
             LMFLGGE FTS L L F     Q+KVS        +     + +ELGLV +   H+D   
Sbjct  59    LMFLGGEVFTSMLDLLFAGYNLQNKVSINPFPPTNHA----NQIELGLVLSIP-HSDSEN  113

Query  1281  EDSAKSNVQIEVVEDIKL-LGCVRVLARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLK  1105
              +   SN+ I V    +L   C+  L   VL Y+V++  VGF+ V++Y+  VP+A+QVLK
Sbjct  114   HNPCDSNI-INVASCDRLKYNCLSYLTYAVLGYLVMVQFVGFSFVSLYMTLVPSARQVLK  172

Query  1104  QKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGNTLYPACLRL  925
              KG+ + TF++FT VSTF++CGFVPTNENMIVFK+N GLLL+++P + LGN LYP CLRL
Sbjct  173   NKGIKIVTFSLFTVVSTFASCGFVPTNENMIVFKKNSGLLLLILPHVFLGNALYPPCLRL  232

Query  924   AIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRS  745
              I  L K T++ EF  +L +   +GY HL S  R  FL ATV G   +Q  +  +LEW++
Sbjct  233   LIMVLKKVTKKEEFSYLLKNSVDVGYEHLLSDLRCCFLVATVLGFNLIQFVMLCSLEWKT  292

Query  744   DAIAGLTGYEKVVGSLFVVVNSRHTGESI  658
               + GL  YEKVV SLF V N+RH GES+
Sbjct  293   KIMEGLNVYEKVVASLFQVTNARHAGESV  321



>ref|XP_004968910.1| PREDICTED: cation transporter HKT8-like isoform X4 [Setaria italica]
Length=473

 Score =   223 bits (568),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 201/473 (42%), Positives = 284/473 (60%), Gaps = 64/473 (14%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKV------SKPRPISFKLKDLDvfftavssatvs  1510
             L F V+PF ++L YF+ +SL GF  LK       + P P       LD+ FT+VS+ TVS
Sbjct  20    LLFHVHPFWIQLVYFLSISLFGFMMLKALPMKTSAVPTP-----SGLDLIFTSVSATTVS  74

Query  1509  smstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHV  1330
             SM  VEME FSN QL+ +T LM LGGE FTS LGLHF  +K+        K +   I H 
Sbjct  75    SMVAVEMESFSNSQLLLVTLLMLLGGEVFTSMLGLHFTYTKL--------KKRETQIPHD  126

Query  1329  ELGLVTNNEYHNDLNPEDSAKSNVQ------------IEVVE-------DIKLLGCVRVL  1207
               G        N+ +P  S    ++            +E +E       D   +   R+L
Sbjct  127   LDG--------NNGSPPPSPSLELRTMGGGAPAAVAALEQMETRFKNNLDFTSIARTRML  178

Query  1206  ARvvlsyivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPT  1027
               VVL Y VV+H+ G+TL+ +Y+  V  A++VL  K ++ +TF++FT VSTF+NCGFVPT
Sbjct  179   MFVVLGYHVVVHLAGYTLMLIYLSAVTGAREVLIGKKINPSTFSIFTVVSTFANCGFVPT  238

Query  1026  NENMIVFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQIL--------  871
             NE M+ FK  PG+LL+ +P +LLGNTL+P  LRL+I  L + TRR +  ++L        
Sbjct  239   NEGMVSFKSYPGMLLLAMPHVLLGNTLFPVFLRLSIGALERVTRRRDLGELLVSGGGGGG  298

Query  870   ----GSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVG  703
                  + + +GY HL    R+  LA TV  L+  QL +F A+EW SD + GLT  +K+V 
Sbjct  299   PGRAAATSTIGYDHLLPAARTWHLAFTVAALVAAQLVLFCAMEWGSDGLRGLTASQKLVA  358

Query  702   SLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKK  523
             +LF+ VNSRH+GE  +DL+ ++ AV+ L VVMMYLPP TTF P+  E+++   +  S +K
Sbjct  359   ALFMSVNSRHSGEMAVDLAAVSSAVVVLYVVMMYLPPYTTFLPVPVEDDHQHREAQSDEK  418

Query  522   F------NIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVI  382
                    NI +K+L+SPL  L+IFII+ICITE+ ++ +DP+NF+V NIVVE+I
Sbjct  419   SKTTTSKNIWQKLLMSPLSCLAIFIIVICITEQRQIADDPINFSVRNIVVEII  471



>gb|KDP35913.1| hypothetical protein JCGZ_09885 [Jatropha curcas]
Length=193

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 141/193 (73%), Gaps = 1/193 (1%)
 Frame = -1

Query  759  LEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTF  580
            +EW S  + GL+ +EKV+G+LF+VVN+RH GES  D+SL++PA+L L VVMMYLPP  +F
Sbjct  1    MEWNSKVMDGLSAFEKVIGALFLVVNARHAGESAFDISLISPAILVLFVVMMYLPPYFSF  60

Query  579  FPIMDENNNSKT-KGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVL  403
             P   +    K  K        +++ +L S L    IFIILICI ERE+MK DPLNFNVL
Sbjct  61   IPTKLQTEVPKGGKESRSHGKTVVDCLLFSQLTYPVIFIILICIVERERMKTDPLNFNVL  120

Query  402  NIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLK  223
            NI +EVISAYGNVGFSTGYSC RQ+K E  CKD  +GF G+WSN+ KFILIIVMFFGRLK
Sbjct  121  NITLEVISAYGNVGFSTGYSCERQMKAESSCKDAWYGFAGKWSNLAKFILIIVMFFGRLK  180

Query  222  KYHMKGGKAWKLS  184
            KY    GKAWK++
Sbjct  181  KYSTDVGKAWKIT  193



>ref|XP_007152991.1| hypothetical protein PHAVU_004G177200g [Phaseolus vulgaris]
 gb|ESW24985.1| hypothetical protein PHAVU_004G177200g [Phaseolus vulgaris]
Length=390

 Score =   218 bits (556),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 235/351 (67%), Gaps = 18/351 (5%)
 Frame = -1

Query  1671  LAFRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVE  1492
             LAF  +PF ++LSYF +LSL+G+ ALK+S PR  + K KD D+F+T+VS++TVSSM  VE
Sbjct  21    LAFNAHPFFIQLSYFWILSLLGYLALKLSNPRT-TLKPKDFDLFYTSVSASTVSSMVAVE  79

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK--------VSTTERVLEKNKVIVID  1336
             MEVFSN QL+ +T LMFLGGE FTS L L F + K        V +T     +   I   
Sbjct  80    MEVFSNSQLLLLTLLMFLGGEVFTSMLDLLFARYKFTQSVPNRVRSTPFSSTEKPQIHAK  139

Query  1335  HVELGLVT-----NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvih  1171
             HVELGL++      +E HN   P+ +    V  +  E +K   C+  L  VVL Y+VV+ 
Sbjct  140   HVELGLISIIPHSESENHNLNLPKGTM---VPFKDSERLKY-NCLTYLIFVVLGYLVVVQ  195

Query  1170  vVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPG  991
             +VGF+LV++Y+  VP+A QVLK K + + TF++FT VSTF++CGFVPTNENM+VFK+N G
Sbjct  196   LVGFSLVSLYMSLVPSATQVLKNKDIKVATFSLFTIVSTFASCGFVPTNENMMVFKKNSG  255

Query  990   lllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFL  811
             LLL+++P ILLGNTLYP CLRL I  L K +RR EF  +L +   +GY H+ S      L
Sbjct  256   LLLLVLPHILLGNTLYPPCLRLVIMGLRKVSRREEFSYLLKNFKDVGYDHMLSAVHCWLL  315

Query  810   AATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESI  658
              ATV  L  +Q  +F A+EW++ ++ GL  YEKVVGSLF V N+RH+GES+
Sbjct  316   VATVLCLNVIQFVMFWAMEWKNKSMEGLNVYEKVVGSLFQVTNARHSGESV  366



>gb|EMS63266.1| putative cation transporter HKT7 [Triticum urartu]
Length=217

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -1

Query  780  QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMY  601
            ++ +   +EW S A+ G++ +EKV  ++F+ VNSRH GES LD+S LAPA+L L V+MMY
Sbjct  21   EVAMLCGMEW-SGALRGMSAWEKVSNAVFLAVNSRHAGESTLDISTLAPAILVLFVLMMY  79

Query  600  LPPDTTFFPIMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITEREKMKEDP  421
            LP  TT+FP    +  +       +   +I+   LS L  L+IF+I IC+TEREK+KEDP
Sbjct  80   LPSYTTWFPFAGSSGTTD-HAEETQGIRLIKSTALSQLSYLTIFVIAICVTEREKLKEDP  138

Query  420  LNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVM  241
            LNFN+L+IVVEV+SAYGNVGFS GYSC+RQI P+  C D+  GFVGRWS+ GK +LI+VM
Sbjct  139  LNFNLLSIVVEVVSAYGNVGFSMGYSCSRQISPDQLCTDRWTGFVGRWSDSGKLVLILVM  198

Query  240  FFGRLKKYHMKGGKAWKLS  184
             FGRLKK+ MKGG+AWKLS
Sbjct  199  LFGRLKKFSMKGGRAWKLS  217



>gb|EMT30072.1| Putative cation transporter HKT9 [Aegilops tauschii]
Length=595

 Score =   223 bits (567),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 172/438 (39%), Positives = 244/438 (56%), Gaps = 51/438 (12%)
 Frame = -1

Query  1494  EMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLV  1315
             +ME  S  Q+V +T LM LG E F S LG H  +         L K              
Sbjct  34    KMEDLSTSQVVILTLLMLLGSEMFVSLLG-HIHE---------LSK--------------  69

Query  1314  TNNEYHNDLNPEDSAKSNVQIEVVEDIKLL--------------GCVRVLARvvlsyivv  1177
                   N  +PEDS   +V ++    I+                GC + +  V+L+Y+V+
Sbjct  70    -----QNKHDPEDSRVRSVTVQDESQIEEAIPVTPSTNTTSLKKGCRKYIGFVLLAYMVL  124

Query  1176  ihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRN  997
             I +VG  LV +Y+  V TA+ VL +K ++   F++  TVS+F+N G +PTNE+M VF  N
Sbjct  125   ILLVGSLLVFLYVAHVSTARDVLTRKSINTMLFSISVTVSSFTNGGLIPTNESMAVFSSN  184

Query  996   PGlllilipqilLGNTLYPACLRLAIWFL-GKTTRRI---EFRQILGSPNGLGYGHLFSG  829
              GLLL+L  QIL GNTL P  LRL IW L G +  R    E   ++ +   LG  HL   
Sbjct  185   QGLLLLLTGQILAGNTLLPVFLRLVIWALRGLSITRAKPEELEFMMNNTKALGSNHLLPN  244

Query  828   RRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldl  649
             +++ FLAA+V  LI + +T F  L W S   AGLT  +K+  +LF+ VN+R  GE+ +D 
Sbjct  245   KQTVFLAASVAALIAVAVTFFCCLNWESAVFAGLTPNQKITNALFMAVNTRQAGENSIDC  304

Query  648   sllapavlalivVMMYLPPDTTFFPIMD--ENNNSKTKGCSPKKFNIIEKILLSPLGNLS  475
             SL+APAVL L + MM +P  T+F  + +  E   ++ K  + K+   + K+L SPL   +
Sbjct  305   SLVAPAVLILCIAMMCIPASTSFLSLHEHAERGITEHKDGANKRRLSLNKMLFSPLACTA  364

Query  474   IFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQ--CKDK  301
             + I+L+CITER  +  DPLNF+  N++ EVISAY NVG STGYSCAR   PE Q  C+D 
Sbjct  365   VLIMLVCITERRSLSADPLNFSTFNMIFEVISAYRNVGLSTGYSCARLPHPEKQSVCQDM  424

Query  300   QFGFVGRWSNMGKFILII  247
              + F G WS+ GK +L++
Sbjct  425   PYSFSGWWSDQGKVVLVL  442



>ref|XP_009630778.1| PREDICTED: sodium transporter HKT1-like [Nicotiana tomentosiformis]
Length=409

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 226/358 (63%), Gaps = 32/358 (9%)
 Frame = -1

Query  1662  RVNPFLLELSYFIVLSLIGFFALKVSKPRPIS--FKLKDLDvfftavssatvssmstVEM  1489
             RV+ F ++L YFI +SLIGF+ L++ K R  S  F  ++LD++FT+VS+ TVSSMSTVEM
Sbjct  43    RVHKFFVQLFYFIFISLIGFWILRILKSRSTSGDFAPRNLDLYFTSVSAVTVSSMSTVEM  102

Query  1488  EVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVI----------  1339
             EVFSN QL+ +TFLM +GGE FTS +GLH  + K     +  +   VI            
Sbjct  103   EVFSNSQLILITFLMLIGGEVFTSMVGLHLIRPKFKPWRKDSKIESVISSATTSPRNTNF  162

Query  1338  -DHVELGLVT----------NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvl  1192
              D +EL +V            +E+H D   +  + S+ Q      IK LG V ++     
Sbjct  163   NDDIELDIVVIPDSPKSNLEKDEFHQD---DFGSSSDTQTLKYISIKFLGVVVLV-----  214

Query  1191  syivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMI  1012
              Y +V+H++G + V +Y+  V + K VL+ KGL  +TFA+FT VSTF++CGFVPTNENM 
Sbjct  215   -YFLVMHILGISSVLVYLACVSSTKDVLRNKGLKTSTFAIFTVVSTFASCGFVPTNENMA  273

Query  1011  VFKRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFS  832
              F +N GLLLILIP IL GNTLYPACLR+++WF+GK  ++ E   +L +   +G+ HLF 
Sbjct  274   AFSKNSGLLLILIPSILFGNTLYPACLRVSVWFVGKFFKKREANFLLKNSREIGHLHLFP  333

Query  831   GRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESI  658
             G  S FL  TVFG I LQL +F   EW SD + GL  Y+K+VGS F VVN+R+ GES+
Sbjct  334   GLSSRFLVVTVFGFISLQLFLFCTYEWNSDTLNGLNSYQKIVGSFFQVVNTRYVGESV  391



>ref|XP_002524105.1| hypothetical protein RCOM_0422820 [Ricinus communis]
 gb|EEF38315.1| hypothetical protein RCOM_0422820 [Ricinus communis]
Length=348

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 150/221 (68%), Gaps = 26/221 (12%)
 Frame = -1

Query  780  QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMM-  604
            Q  +F +LEW S+A+ GL  ++K++G LF  VNSRHTGE+I+DLS ++PA+L      M 
Sbjct  130  QFVLFCSLEWNSEALNGLNSFQKIIGVLFQTVNSRHTGETIVDLSAISPAILYTKQWCMR  189

Query  603  ---------------------YLPPDTTFFPIMDENNNSKTKGCSPK-KFNIIEKILLSP  490
                                 YLPP T F PI D+   ++  G S + +  ++E I+ S 
Sbjct  190  EKLSRNARKVTFPVRTCKSSKYLPPYTAFLPIKDD---TEIDGRSKRWRGKLLENIIFSQ  246

Query  489  LGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIKPEGQC  310
            L  L IF+ILICITER KMK+DPLNFNVLNIV+EVISAYGNVGF+ GYSC RQI P+  C
Sbjct  247  LSYLVIFVILICITERHKMKQDPLNFNVLNIVLEVISAYGNVGFTAGYSCKRQIHPDSIC  306

Query  309  KDKQFGFVGRWSNMGKFILIIVMFFGRLKKYHMKGGKAWKL  187
            +DK +GF GRWS+ G+ ILI+VMFFGRLKK++M GG+AW L
Sbjct  307  QDKWYGFSGRWSDEGRVILIMVMFFGRLKKFNMNGGRAWIL  347


 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 87/167 (52%), Gaps = 45/167 (27%)
 Frame = -1

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVT  1312
             MEVFSN QLV +T LMF+GGE FTS +GL F +S++        + K I      +GLV+
Sbjct  1     MEVFSNSQLVILTVLMFVGGEVFTSLVGLLFRKSQL--------RRKWIS----NVGLVS  48

Query  1311  NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGF  1132
             +     D   +   K                                  G  LV +Y+  
Sbjct  49    SVRSDTDGTYKMQTKQ---------------------------------GILLVLVYLAS  75

Query  1131  VPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPG  991
             V +A+ VL+ KGL++ TF++FT VSTF++CGFVPTNENM+VF +N G
Sbjct  76    VKSARNVLETKGLNIFTFSLFTIVSTFASCGFVPTNENMMVFSKNSG  122



>ref|XP_009346679.1| PREDICTED: sodium transporter HKT1-like [Pyrus x bretschneideri]
Length=391

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 236/356 (66%), Gaps = 20/356 (6%)
 Frame = -1

Query  1686  STVRRLAFRVNPFLLELSYFIVLSLIGFFALKVSKPRP---ISFKLKDLDvfftavssat  1516
             S  R L F  N F  +L YF+ +SL G+ AL+V+K R     SF+ K+ D+FFT+VS+ T
Sbjct  25    SLFRVLLFHSNTFCFQLFYFLTVSLFGYLALRVTKARTSTNTSFRPKNYDIFFTSVSATT  84

Query  1515  vssmstVEMEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSK-VSTTERVLEKNKVIVI  1339
             VSSMSTVEMEVFSN QL+ +T LM LGGE FTS LGL   +SK    +    + N+V V+
Sbjct  85    VSSMSTVEMEVFSNTQLIILTILMLLGGEVFTSMLGLQIAKSKNFPKSLNHKDDNRVHVV  144

Query  1338  DHVELGLVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLL---------GCVRVLARvvlsy  1186
                    V N+ +H   +  +++    ++  V D   L           +R+L  VVL Y
Sbjct  145   -------VDNSRHHPPDSNNNTSFEQFELRFVNDRSHLENDEKNNIYKSIRILGYVVLGY  197

Query  1185  ivvihvVGFTLVAMYIGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVF  1006
             ++V+H+ G+ LV+MYI  VP+A+Q+L+ KG+++ TF++FTTVSTF+NCG+VPTNENMIVF
Sbjct  198   LLVVHIGGYILVSMYIALVPSARQILQSKGIEIQTFSIFTTVSTFANCGYVPTNENMIVF  257

Query  1005  KRNPGlllilipqilLGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGR  826
             K+N GLLL+L+PQ+L+GNTLYP+CLR  IW L K T+R EF  IL +   LGY HL S  
Sbjct  258   KKNSGLLLLLLPQLLIGNTLYPSCLRFLIWLLQKITKRAEFSYILKNYKELGYCHLLSSL  317

Query  825   RSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESI  658
              S  LA T+ G I  Q  +F  +EW+S+A+ GL+ YEK V S+F V NSRH+GES+
Sbjct  318   HSLHLALTILGFIVAQFILFCVMEWKSEAMDGLSAYEKFVASIFQVTNSRHSGESV  373



>gb|EAZ12198.1| hypothetical protein OsJ_02083 [Oryza sativa Japonica Group]
Length=424

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 167/433 (39%), Positives = 249/433 (58%), Gaps = 31/433 (7%)
 Frame = -1

Query  1491  MEVFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVIDHVELGLVT  1312
             ME  S+ Q+  +T LMFL  + F S+LGL    SK +  +   E  +V  +       V 
Sbjct  1     MEDLSSSQIAILTLLMFLDSKMFLSFLGLVLESSKQNKHDP--ENRRVSSVT------VC  52

Query  1311  NNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMYIGF  1132
                   +  P+  + +++ I+         C++ L  VVL+Y+++I V G  LV MYI  
Sbjct  53    KQSQLEEATPQTPSMNSIDIKK-------RCLKYLVFVVLAYMIIILVTGSLLVFMYIAH  105

Query  1131  VPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqilLGN  952
             V +A+ VL +K ++   F++  TVS+F+N G +PTNE+M+VF  N GLLL+LI QIL G+
Sbjct  106   VSSARDVLTRKSINKALFSISVTVSSFTNGGLLPTNESMVVFSSNNGLLLLLIGQILAGS  165

Query  951   TLYPACLRLAIWFLG--KTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQ  778
             TL+P  LRL IW L   +  +  E   ++ + + +G+ HL    ++ FLA      + + 
Sbjct  166   TLFPVFLRLVIWALRGLRLAKAEEPDFMMNNSSAVGFSHLLPNLQTIFLAVVEVAFVAMT  225

Query  777   LTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESIldlsllapavlalivVMMYL  598
             + +F  L W S   AGL+  +K+  +LF+ VN+R  GE+ +D SL+APA L L +VMMY 
Sbjct  226   VILFCCLNWDSVVFAGLSSLQKITNALFMAVNARQAGENSIDCSLVAPAALVLFMVMMYT  285

Query  597   PPDTTFFP-------IMDENNNSKTKGCSPKKFNIIEKILLSPLGNLSIFIILICITERE  439
             P  T  F        I  E+++  +KG   K F  ++ +  SPLG  +  I+L+CITER 
Sbjct  286   PSLTKLFSACQDHKRIGPESDDRTSKG---KPF--LKMMAFSPLGFNTTVIMLVCITERR  340

Query  438   KMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCARQIK-PEG-QCKDKQFGFVGRWSNMG  265
              +  DPLN +  NI+ EVISAYGN+G STGYSC+RQ++  EG  C +K + F G WS  G
Sbjct  341   SLSTDPLNLSTFNIIFEVISAYGNIGLSTGYSCSRQLQHQEGIACHEKAYNFSGWWSEPG  400

Query  264   KFILIIVMFFGRL  226
             K IL++ M  GRL
Sbjct  401   KLILVLAMLCGRL  413



>emb|CBI40140.3| unnamed protein product [Vitis vinifera]
Length=222

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 146/220 (66%), Gaps = 0/220 (0%)
 Frame = -1

Query  876  ILGSPNGLGYGHLFSGRRSGFLAATVFGLIFLQLTVFLALEWRSDAIAGLTGYEKVVGSL  697
            +L +   +GY +L     S  +A  V  LI  +   F ++EW S+A+ GL G EK V SL
Sbjct  1    MLNNSREIGYNYLLPSVHSFVMAIVVLVLIVFEFLFFCSMEWNSEALYGLDGNEKFVASL  60

Query  696  FVVVNSRHTGESIldlsllapavlalivVMMYLPPDTTFFPIMDENNNSKTKGCSPKKFN  517
            F VVN RHTGES+ DLS++ PAVL + +VMMYLP  T+FF I     + K      K+  
Sbjct  61   FQVVNLRHTGESVFDLSIVTPAVLVVFIVMMYLPARTSFFAIEGHETDVKNGEGKTKQKR  120

Query  516  IIEKILLSPLGNLSIFIILICITEREKMKEDPLNFNVLNIVVEVISAYGNVGFSTGYSCA  337
            ++     SPL  L  F+I IC+TER+K+KEDPLNFNVL+I +EVISAY NVG STGY CA
Sbjct  121  LMGHDTFSPLTFLVPFVIFICMTERDKLKEDPLNFNVLSIALEVISAYANVGLSTGYHCA  180

Query  336  RQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKKY  217
            RQ+KP+  CK   +GFVGRWS  GK +L+IVMF G+L+K+
Sbjct  181  RQLKPDPFCKPVWYGFVGRWSAGGKLLLVIVMFLGKLRKF  220



>gb|EEC72593.1| hypothetical protein OsI_06054 [Oryza sativa Indica Group]
 gb|EEE56416.1| hypothetical protein OsJ_05579 [Oryza sativa Japonica Group]
Length=458

 Score =   208 bits (530),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 150/341 (44%), Positives = 217/341 (64%), Gaps = 12/341 (4%)
 Frame = -1

Query  1665  FRVNPFLLELSYFIVLSLIGFFALKVSKPRPISFKLKDLDvfftavssatvssmstVEME  1486
             ++ NP  + ++YF ++S  G+ +LKV KPR  S  LKDLDV FT+VS++TVSSM+TVEME
Sbjct  42    YQNNPLFVHVAYFALISFAGYGSLKVLKPRDKSNTLKDLDVLFTSVSASTVSSMATVEME  101

Query  1485  VFSNLQLVFMTFLMFLGGECFTSWLGLHFFQSKVSTTERVLEKNKVIVID-----HVELG  1321
              FS+ QL  +T LM +GGE FTS LG+HF +++  T E V  ++    ID       + G
Sbjct  102   DFSSAQLWVLTILMLIGGEVFTSMLGIHFMRAEFGTKESVSTRDHSPCIDIESITSTKFG  161

Query  1320  LVTNNEYHNDLNPEDSAKSNVQIEVVEDIKLLGCVRVLARvvlsyivvihvVGFTLVAMY  1141
               T          E   ++   +E  + IK LG V      V+ Y+++ ++ G  L+ +Y
Sbjct  162   PSTQGTKVTVSFSELRMENGGHVEP-KTIKFLGFV------VMGYLLITNLGGSLLIYLY  214

Query  1140  IGFVPTAKQVLKQKGLDLttfavfttvstfSNCGFVPTNENMIVFKRNPGlllilipqil  961
             +  VP+A ++LK+KG+ +  F+VFT +S+  NCGF P NENMI+F++N  LLL+++PQIL
Sbjct  215   LNLVPSAHKILKRKGIGIIVFSVFTAISSVGNCGFTPVNENMIIFQKNSILLLLILPQIL  274

Query  960   LGNTLYPACLRLAIWFLGKTTRRIEFRQILGSPNGLGYGHLFSGRRSGFLAATVFGLIFL  781
              GNTL+  CLRL +W L K T + + R IL  P  +GY HL S R S +L  TV  LI L
Sbjct  275   AGNTLFAPCLRLMVWSLEKITGKKDCRYILEYPKAIGYKHLMSTRESVYLTLTVVSLIIL  334

Query  780   QLTVFLALEWRSDAIAGLTGYEKVVGSLFVVVNSRHTGESI  658
             Q  +FL+LEW S A+ G++ Y+K+V +LF  VN+RH GES+
Sbjct  335   QTVLFLSLEWSSVALDGMSNYQKIVSALFQSVNARHAGESV  375


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  399  IVVEVISAYGNVGFSTGYSCARQIKPEGQCKDKQFGFVGRWSNMGKFILIIVMFFGRLKK  220
            ++  ++ AYGNVGFS GYSC R +  + +CKD  +GF G+WS+ GK ILIIVM FGRLK 
Sbjct  387  VLYTIMIAYGNVGFSVGYSCKRLLNHDARCKDASYGFAGKWSDNGKAILIIVMLFGRLKT  446

Query  219  YHMKGGKAWKL  187
            ++MKGG+AWKL
Sbjct  447  FNMKGGRAWKL  457



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5027111451418