BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16288_g2_i1 len=1984 path=[5115:0-1573 3556:1574-1621
4200:1622-1983]

Length=1984
                                                                      Score     E

gb|EYU18566.1|  hypothetical protein MIMGU_mgv1a020825mg                800   0.0      
gb|EYU24743.1|  hypothetical protein MIMGU_mgv1a003354mg                798   0.0      
ref|XP_009613364.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       797   0.0      
ref|XP_009801608.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       788   0.0      
ref|XP_011070105.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       787   0.0      
ref|XP_006355480.1|  PREDICTED: nitrate transporter 1.1-like            782   0.0      
ref|XP_009611019.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       776   0.0      
ref|XP_006358355.1|  PREDICTED: nitrate transporter 1.1-like            773   0.0      
ref|XP_004245746.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       771   0.0      
ref|XP_004244572.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       770   0.0      
ref|XP_009798260.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       769   0.0      
ref|XP_010053448.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            769   0.0      
emb|CAC00544.1|  putative low-affinity nitrate transporter              769   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009800593.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    765   0.0      
ref|XP_011081220.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       765   0.0      
ref|XP_004147617.1|  PREDICTED: nitrate transporter 1.1-like            763   0.0      
dbj|BAC56916.1|  nitrate transporter                                    763   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009598780.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       763   0.0      
ref|XP_008437115.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    762   0.0      
emb|CAC00545.1|  putative low-affinity nitrate transporter              756   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002266951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            756   0.0      Vitis vinifera
ref|XP_006366745.1|  PREDICTED: nitrate transporter 1.1-like            755   0.0      
emb|CDP09929.1|  unnamed protein product                                752   0.0      
emb|CAN71417.1|  hypothetical protein VITISV_004658                     751   0.0      Vitis vinifera
ref|XP_004242006.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       751   0.0      
dbj|BAC56915.1|  nitrate transporter                                    748   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009763469.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       746   0.0      
ref|XP_002529778.1|  oligopeptide transporter, putative                 744   0.0      Ricinus communis
ref|XP_007039888.1|  Nitrate transporter 1.1 isoform 1                  743   0.0      
gb|KHG24776.1|  Uncharacterized protein F383_04224                      740   0.0      
ref|XP_007155635.1|  hypothetical protein PHAVU_003G218500g             741   0.0      
ref|XP_007039889.1|  Nitrate transporter 1.1 isoform 2                  739   0.0      
ref|XP_004298652.1|  PREDICTED: nitrate transporter 1.1-like            739   0.0      
gb|EYU30304.1|  hypothetical protein MIMGU_mgv1a003140mg                739   0.0      
gb|KHG27943.1|  Uncharacterized protein F383_15837                      736   0.0      
ref|XP_002303512.2|  nitrate transporter family protein                 734   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008367434.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    733   0.0      
ref|XP_011033950.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       732   0.0      
ref|XP_006440344.1|  hypothetical protein CICLE_v10019412mg             730   0.0      
ref|XP_010676154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       729   0.0      
gb|KDO61483.1|  hypothetical protein CISIN_1g007736mg                   728   0.0      
ref|XP_006477230.1|  PREDICTED: nitrate transporter 1.1-like            726   0.0      
gb|KDP25643.1|  hypothetical protein JCGZ_20799                         726   0.0      
gb|KHG00259.1|  Uncharacterized protein F383_18798                      722   0.0      
ref|XP_004516839.1|  PREDICTED: nitrate transporter 1.1-like            722   0.0      
dbj|BAD22820.1|  nitrate transporter                                    720   0.0      Prunus persica
dbj|BAC81420.1|  nitrate transporter                                    719   0.0      Prunus persica
ref|NP_001275529.1|  nitrate transporter 1.1-like                       718   0.0      
ref|XP_007210870.1|  hypothetical protein PRUPE_ppa003177mg             718   0.0      
ref|XP_010264234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       717   0.0      
ref|XP_009110669.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            716   0.0      
gb|KFK43476.1|  hypothetical protein AALP_AA1G129900                    716   0.0      
ref|XP_006417264.1|  hypothetical protein EUTSA_v10007157mg             715   0.0      
ref|XP_007157339.1|  hypothetical protein PHAVU_002G061900g             714   0.0      
gb|AEA35415.1|  nitrate transporter                                     714   0.0      
ref|XP_004511669.1|  PREDICTED: nitrate transporter 1.1-like isof...    714   0.0      
ref|XP_009118113.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       714   0.0      
ref|XP_008238567.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            711   0.0      
gb|AAA80582.1|  RCH2 protein                                            710   0.0      Brassica napus [oilseed rape]
ref|XP_003611286.1|  Nitrate transporter                                709   0.0      
ref|XP_003549905.1|  PREDICTED: nitrate transporter 1.1-like            709   0.0      
ref|XP_006307075.1|  hypothetical protein CARUB_v10008661mg             708   0.0      
ref|XP_008448872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       706   0.0      
gb|KHN42706.1|  Nitrate transporter 1.1                                 705   0.0      
emb|CAC07206.1|  nitrate transporter                                    705   0.0      Brassica napus [oilseed rape]
ref|XP_008358135.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       705   0.0      
ref|XP_003517427.1|  PREDICTED: nitrate transporter 1.1-like            704   0.0      
gb|KHN09796.1|  Nitrate transporter 1.1                                 704   0.0      
ref|XP_010676153.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       702   0.0      
ref|XP_010493752.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       701   0.0      
ref|XP_002889915.1|  NRT1.1                                             701   0.0      
ref|XP_010458634.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            701   0.0      
ref|XP_003608752.1|  Nitrate transporter                                701   0.0      
ref|XP_009376056.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       699   0.0      
ref|XP_009382411.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       698   0.0      
ref|NP_563899.1|  nitrate transporter 1.1                               696   0.0      Arabidopsis thaliana [mouse-ear cress]
pdb|4OH3|A  Chain A, Crystal Structure Of A Nitrate Transporter         696   0.0      
ref|XP_010933692.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       696   0.0      
ref|XP_010258991.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       694   0.0      
ref|XP_009333673.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       694   0.0      
ref|XP_009333599.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       693   0.0      
gb|KHG03840.1|  Uncharacterized protein F383_26454                      688   0.0      
ref|XP_010533775.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       691   0.0      
emb|CDY21035.1|  BnaA08g24900D                                          687   0.0      
ref|XP_009411557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       686   0.0      
ref|XP_010906609.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    686   0.0      
emb|CDY15967.1|  BnaC08g41560D                                          685   0.0      
ref|XP_010476167.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       685   0.0      
emb|CDY31242.1|  BnaC08g15370D                                          684   0.0      
ref|XP_009382412.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       684   0.0      
emb|CDY26539.1|  BnaA09g47380D                                          684   0.0      
ref|XP_010553465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       683   0.0      
ref|XP_003611284.1|  Nitrate transporter                                683   0.0      
ref|XP_003538742.1|  PREDICTED: nitrate transporter 1.1                 679   0.0      
gb|KHN34951.1|  Nitrate transporter 1.1                                 677   0.0      
ref|XP_009407160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       676   0.0      
ref|XP_008808741.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       675   0.0      
ref|XP_010919516.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    672   0.0      
ref|XP_008796822.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       669   0.0      
ref|XP_009411558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       665   0.0      
dbj|BAJ90348.1|  predicted protein                                      659   0.0      
ref|XP_002464959.1|  hypothetical protein SORBIDRAFT_01g029470          658   0.0      Sorghum bicolor [broomcorn]
gb|EMT10378.1|  Nitrate/chlorate transporter                            658   0.0      
ref|XP_002443879.1|  hypothetical protein SORBIDRAFT_07g003690          658   0.0      Sorghum bicolor [broomcorn]
ref|XP_003573480.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       657   0.0      
ref|XP_009411045.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       655   0.0      
ref|XP_004972811.1|  PREDICTED: nitrate transporter 1.1-like isof...    653   0.0      
ref|XP_008658431.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       652   0.0      
ref|NP_001145735.1|  uncharacterized protein LOC100279242               652   0.0      Zea mays [maize]
ref|XP_006662041.1|  PREDICTED: nitrate transporter 1.1-like            651   0.0      
ref|XP_004972812.1|  PREDICTED: nitrate transporter 1.1-like isof...    649   0.0      
ref|XP_009388204.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       650   0.0      
ref|XP_008794846.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       649   0.0      
ref|XP_004983702.1|  PREDICTED: nitrate transporter 1.1-like            647   0.0      
ref|XP_010906610.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    645   0.0      
ref|XP_002468692.1|  hypothetical protein SORBIDRAFT_01g050410          642   0.0      Sorghum bicolor [broomcorn]
ref|XP_008649786.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       640   0.0      
ref|XP_010941437.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       639   0.0      
ref|XP_003574312.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       639   0.0      
ref|XP_003572060.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       637   0.0      
gb|ABB47972.1|  Nitrate/chlorate transporter, putative, expressed       635   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFW57313.1|  hypothetical protein ZEAMMB73_359381                    636   0.0      
ref|XP_006650950.1|  PREDICTED: nitrate transporter 1.1-like            634   0.0      
gb|ACR34962.1|  unknown                                                 634   0.0      Zea mays [maize]
gb|AAK15441.1|AC037426_3  putative nitrate transporter                  635   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004983703.1|  PREDICTED: nitrate transporter 1.1-like            632   0.0      
ref|XP_008658424.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       629   0.0      
emb|CBI31901.3|  unnamed protein product                                627   0.0      
dbj|BAC99394.1|  putative nitrate transporter                           627   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT27347.1|  Nitrate/chlorate transporter                            621   0.0      
dbj|BAK05363.1|  predicted protein                                      617   0.0      
ref|XP_007155636.1|  hypothetical protein PHAVU_003G218500g             610   0.0      
gb|EAZ41557.1|  hypothetical protein OsJ_26080                          612   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006841166.1|  hypothetical protein AMTR_s00086p00160300          610   0.0      
gb|KHG28852.1|  Uncharacterized protein F383_16009                      605   0.0      
ref|XP_011033951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       593   0.0      
ref|XP_006440345.1|  hypothetical protein CICLE_v10019412mg             587   0.0      
gb|EEC67416.1|  hypothetical protein OsI_34598                          586   0.0      Oryza sativa Indica Group [Indian rice]
gb|ABF93501.1|  Nitrate/chlorate transporter, putative, expressed       587   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY88182.1|  hypothetical protein OsI_09629                          586   0.0      Oryza sativa Indica Group [Indian rice]
gb|EAZ16929.1|  hypothetical protein OsJ_32411                          582   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061020.1|  Os08g0155400                                       571   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ACF22756.1|  nitrate transporter                                     571   0.0      Brachypodium distachyon [annual false brome]
ref|XP_003562233.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            567   0.0      
gb|ABF46820.1|  putative nitrate chlorate transporter 1.1               560   0.0      Fagus sylvatica
ref|XP_006837800.1|  hypothetical protein AMTR_s00104p00113760          525   1e-175   
dbj|BAG91755.1|  unnamed protein product                                517   2e-174   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008457678.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            521   5e-174   
ref|XP_002986344.1|  hypothetical protein SELMODRAFT_425373             516   3e-172   
gb|AFR11354.1|  nitrate transporter                                     516   5e-172   
ref|XP_004159415.1|  PREDICTED: nitrate transporter 1.4-like            516   2e-171   
gb|KGN60671.1|  hypothetical protein Csa_2G006170                       512   1e-170   
ref|XP_002979108.1|  hypothetical protein SELMODRAFT_444106             512   2e-170   
ref|XP_004139418.1|  PREDICTED: nitrate transporter 1.4-like            513   4e-170   
gb|KDP32393.1|  hypothetical protein JCGZ_13318                         508   6e-169   
ref|XP_008784904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       507   2e-168   
ref|NP_001065341.2|  Os10g0554200                                       501   8e-168   Oryza sativa Japonica Group [Japonica rice]
emb|CDP10398.1|  unnamed protein product                                504   2e-167   
gb|EMT23542.1|  Nitrate/chlorate transporter                            504   1e-166   
ref|XP_006347704.1|  PREDICTED: nitrate transporter 1.4-like            501   3e-166   
gb|KDO61703.1|  hypothetical protein CISIN_1g008020mg                   499   1e-165   
ref|XP_004230062.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       498   2e-165   
ref|XP_010093242.1|  Nitrate transporter 1.4                            498   4e-165   
ref|XP_008792049.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    498   5e-165   
ref|XP_008792048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    498   6e-165   
ref|XP_006483348.1|  PREDICTED: nitrate transporter 1.4-like isof...    496   2e-164   
ref|XP_009407665.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       495   4e-164   
ref|XP_009591623.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    494   1e-163   
ref|XP_010656420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    494   2e-163   
ref|XP_002281975.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    493   2e-163   Vitis vinifera
ref|NP_850084.1|  nitrate transporter 1.4                               493   4e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968920.1|  PREDICTED: nitrate transporter 1.4-like isof...    493   4e-163   
ref|XP_009608737.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    493   4e-163   
ref|XP_009778211.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       493   5e-163   
gb|AAB95302.1|  putative nitrate transporter                            493   6e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204809.1|  hypothetical protein PRUPE_ppa021603mg             492   1e-162   
ref|XP_007013426.1|  Major facilitator superfamily protein isoform 2    491   2e-162   
gb|AAM20651.1|  putative nitrate transporter                            491   2e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006475796.1|  PREDICTED: nitrate transporter 1.4-like isof...    490   3e-162   
gb|AGA60121.1|  nitrate transporter NRT1.4B                             490   4e-162   
ref|XP_004150978.1|  PREDICTED: nitrate transporter 1.4-like            490   9e-162   
ref|XP_008352261.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       489   1e-161   
ref|XP_010914872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       489   1e-161   
ref|XP_009591624.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    488   2e-161   
ref|XP_010254380.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    488   2e-161   
ref|XP_010254379.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    488   2e-161   
ref|XP_006450986.1|  hypothetical protein CICLE_v10007850mg             488   2e-161   
ref|XP_010533169.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            488   3e-161   
ref|XP_008337300.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       488   4e-161   
ref|XP_006475799.1|  PREDICTED: nitrate transporter 1.4-like isof...    486   7e-161   
emb|CDX71495.1|  BnaC04g17300D                                          488   7e-161   
ref|XP_006408724.1|  hypothetical protein EUTSA_v10001943mg             486   1e-160   
ref|XP_009403461.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       486   1e-160   
ref|XP_008444009.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       486   1e-160   
ref|XP_009368838.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       486   1e-160   
ref|XP_004288806.1|  PREDICTED: nitrate transporter 1.4-like            487   2e-160   
ref|XP_009397479.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       486   2e-160   
ref|XP_006475798.1|  PREDICTED: nitrate transporter 1.4-like isof...    484   6e-160   
ref|XP_007013427.1|  Major facilitator superfamily protein, putative    484   8e-160   
ref|XP_006293915.1|  hypothetical protein CARUB_v10022906mg             483   2e-159   
ref|XP_003609313.1|  Nitrate transporter                                483   2e-159   
ref|XP_009103552.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            483   4e-159   
emb|CDY45207.1|  BnaA07g12830D                                          483   5e-159   
dbj|BAJ90833.1|  predicted protein                                      482   6e-159   
ref|XP_010473052.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       482   6e-159   
ref|XP_002524480.1|  oligopeptide transporter, putative                 482   9e-159   Ricinus communis
ref|XP_004508509.1|  PREDICTED: nitrate transporter 1.4-like            481   1e-158   
ref|XP_007011886.1|  Major facilitator superfamily protein, putat...    484   1e-158   
ref|XP_007013425.1|  Major facilitator superfamily protein isoform 1    481   1e-158   
ref|XP_010541927.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            481   2e-158   
ref|XP_010510873.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    481   2e-158   
emb|CDY30787.1|  BnaC07g16870D                                          481   5e-158   
ref|XP_010417814.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       479   7e-158   
ref|XP_007011887.1|  Major facilitator superfamily protein isoform 2    478   9e-158   
ref|XP_006356754.1|  PREDICTED: nitrate transporter 1.4-like            479   1e-157   
ref|XP_010510874.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    479   1e-157   
ref|XP_009781779.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       478   2e-157   
ref|XP_006483349.1|  PREDICTED: nitrate transporter 1.4-like isof...    476   3e-157   
gb|EAY74514.1|  hypothetical protein OsI_02405                          477   5e-157   Oryza sativa Indica Group [Indian rice]
gb|EPS59108.1|  hypothetical protein M569_15702                         475   6e-157   
ref|XP_007154995.1|  hypothetical protein PHAVU_003G164000g             476   1e-156   
ref|XP_009608738.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    474   1e-156   
gb|KFK32490.1|  hypothetical protein AALP_AA6G249500                    476   1e-156   
ref|XP_011093557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       476   2e-156   
ref|XP_010925226.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       476   2e-156   
ref|NP_001043326.1|  Os01g0556700                                       475   3e-156   Oryza sativa Japonica Group [Japonica rice]
gb|KHG05036.1|  Nitrate transporter 1.4 -like protein                   475   3e-156   
gb|EAZ12317.1|  hypothetical protein OsJ_02208                          474   4e-156   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002880817.1|  nitrate transporter                                474   5e-156   
dbj|BAD87491.1|  putative dicarboxylate transporter                     474   7e-156   Oryza sativa Japonica Group [Japonica rice]
emb|CBI28188.3|  unnamed protein product                                474   1e-155   
ref|XP_002282012.3|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            474   1e-155   Vitis vinifera
gb|EYU29790.1|  hypothetical protein MIMGU_mgv1a003653mg                473   2e-155   
ref|XP_010049997.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       473   2e-155   
gb|KCW82843.1|  hypothetical protein EUGRSUZ_C04214                     473   3e-155   
ref|XP_010049998.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    472   5e-155   
ref|XP_004243154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       471   1e-154   
gb|KHN47160.1|  Nitrate transporter 1.4                                 469   8e-154   
ref|XP_006361731.1|  PREDICTED: nitrate transporter 1.4-like            469   1e-153   
ref|XP_006600752.1|  PREDICTED: nitrate transporter 1.4-like            468   2e-153   
ref|XP_006408723.1|  hypothetical protein EUTSA_v10001943mg             466   2e-153   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176             468   2e-153   
gb|AFW80908.1|  hypothetical protein ZEAMMB73_061861                    468   3e-153   
ref|NP_001169613.1|  uncharacterized protein LOC100383494               468   3e-153   Zea mays [maize]
ref|XP_002975508.1|  hypothetical protein SELMODRAFT_103849             468   3e-153   
gb|EYU29794.1|  hypothetical protein MIMGU_mgv1a003534mg                466   1e-152   
ref|XP_004251535.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            466   1e-152   
gb|KHN15097.1|  Nitrate transporter 1.4                                 466   2e-152   
ref|XP_004245323.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    464   4e-152   
ref|XP_003566777.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            464   4e-151   
ref|XP_004243520.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            462   5e-151   
ref|XP_006352020.1|  PREDICTED: nitrate transporter 1.3-like            461   9e-151   
ref|XP_010324989.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    460   1e-150   
ref|XP_009606081.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       461   1e-150   
ref|XP_006357958.1|  PREDICTED: nitrate transporter 1.3-like            459   1e-149   
ref|XP_010688014.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            457   3e-149   
ref|XP_008675518.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       456   2e-148   
ref|XP_002452347.1|  hypothetical protein SORBIDRAFT_04g024090          454   7e-148   Sorghum bicolor [broomcorn]
ref|XP_002274227.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            456   8e-148   Vitis vinifera
ref|XP_009779307.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       454   1e-147   
emb|CAD32549.1|  dicarboxylate transporter                              453   2e-147   Alnus glutinosa
ref|XP_011093558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       452   2e-147   
ref|XP_009589428.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       450   3e-146   
ref|XP_010050000.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    448   3e-146   
ref|XP_011005904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like...    449   4e-146   
ref|XP_010035531.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            449   6e-146   
ref|XP_001771110.1|  predicted protein                                  449   8e-146   
gb|KDP30797.1|  hypothetical protein JCGZ_13740                         446   7e-145   
ref|XP_010670640.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    445   1e-144   
ref|XP_011005903.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like...    444   4e-144   
ref|XP_010670639.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    444   5e-144   
ref|XP_006447629.1|  hypothetical protein CICLE_v10014744mg             442   1e-143   
gb|KDO54284.1|  hypothetical protein CISIN_1g008231mg                   442   2e-143   
ref|XP_002984211.1|  hypothetical protein SELMODRAFT_119838             442   3e-143   
ref|XP_002972300.1|  hypothetical protein SELMODRAFT_97069              441   3e-143   
ref|XP_009785350.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       442   4e-143   
ref|XP_002301604.2|  hypothetical protein POPTR_0002s21630g             441   1e-142   Populus trichocarpa [western balsam poplar]
ref|XP_011047208.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       440   2e-142   
ref|XP_002525323.1|  oligopeptide transporter, putative                 439   4e-142   Ricinus communis
gb|ACG29230.1|  peptide transporter PTR2                                439   5e-142   
gb|KDO54285.1|  hypothetical protein CISIN_1g008231mg                   438   5e-142   
ref|XP_010110635.1|  Nitrate transporter 1.3                            439   7e-142   
ref|XP_004952902.1|  PREDICTED: nitrate transporter 1.3-like            439   7e-142   
ref|NP_001281186.1|  peptide transporter PTR2                           437   2e-141   
gb|KCW46954.1|  hypothetical protein EUGRSUZ_K00766                     435   3e-141   
dbj|BAJ98569.1|  predicted protein                                      436   9e-141   
emb|CBI28855.3|  unnamed protein product                                452   9e-141   
ref|XP_003575234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            432   2e-139   
ref|NP_001047240.1|  Os02g0580900                                       432   3e-139   
ref|XP_006447628.1|  hypothetical protein CICLE_v10014744mg             428   7e-139   
ref|XP_007049158.1|  Major facilitator superfamily protein isoform 1    430   1e-138   
ref|XP_006297285.1|  hypothetical protein CARUB_v10013300mg             430   2e-138   
ref|XP_008342128.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       429   3e-138   
emb|CDP11323.1|  unnamed protein product                                433   3e-138   
ref|XP_010669517.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            428   4e-138   
ref|XP_008798046.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...    428   6e-138   
ref|XP_004304094.1|  PREDICTED: nitrate transporter 1.3-like            428   7e-138   
ref|XP_009405847.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       427   1e-137   
ref|XP_011100362.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            427   2e-137   
gb|ACF86161.1|  unknown                                                 424   5e-137   
ref|XP_002321148.2|  nitrate transporter family protein                 424   9e-137   
ref|XP_007049159.1|  Major facilitator superfamily protein isoform 2    424   9e-137   
ref|XP_010466420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       425   2e-136   
ref|XP_010488187.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            424   3e-136   
ref|XP_010913451.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            423   5e-136   
ref|XP_002972518.1|  hypothetical protein SELMODRAFT_97812              422   6e-136   
ref|XP_010510466.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       423   9e-136   
ref|XP_002972318.1|  hypothetical protein SELMODRAFT_441824             422   1e-135   
ref|XP_010528782.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            420   4e-135   
ref|XP_003616931.1|  Nitrate transporter                                420   1e-134   
ref|XP_002992575.1|  hypothetical protein SELMODRAFT_135536             419   1e-134   
ref|XP_010244160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            419   2e-134   
ref|XP_004491123.1|  PREDICTED: nitrate transporter 1.3-like            419   2e-134   
ref|XP_002992551.1|  hypothetical protein SELMODRAFT_448814             419   3e-134   
gb|KFK39483.1|  hypothetical protein AALP_AA3G250100                    418   4e-134   
ref|XP_007214955.1|  hypothetical protein PRUPE_ppa003196mg             418   5e-134   
ref|XP_010548886.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            417   9e-134   
ref|XP_007141630.1|  hypothetical protein PHAVU_008G212300g             417   9e-134   
emb|CAB38706.1|  nitrate transporter                                    417   1e-133   
ref|XP_001781235.1|  predicted protein                                  418   1e-133   
ref|NP_188804.1|  nitrate transporter 1.3                               417   2e-133   
gb|EYU34037.1|  hypothetical protein MIMGU_mgv1a003180mg                417   2e-133   
ref|XP_008230007.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            417   2e-133   
ref|XP_010262765.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       415   4e-133   
ref|XP_006450457.1|  hypothetical protein CICLE_v10008198mg             411   6e-133   
ref|XP_010263529.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    415   7e-133   
ref|XP_003545571.1|  PREDICTED: nitrate transporter 1.3-like            415   7e-133   
gb|AAM61107.1|  nitrate transporter                                     415   9e-133   
ref|XP_009391232.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            415   9e-133   
ref|XP_002877959.1|  proton-dependent oligopeptide transport fami...    414   1e-132   
ref|XP_009392698.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       414   1e-132   
ref|XP_006406246.1|  hypothetical protein EUTSA_v10020360mg             414   1e-132   
gb|KGN63217.1|  Oligopeptide transporter                                414   2e-132   
gb|AFR11353.1|  nitrate transporter                                     414   2e-132   
ref|XP_008455932.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            414   2e-132   
ref|XP_009139262.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            413   3e-132   
ref|XP_002885459.1|  nitrate transporter                                413   5e-132   
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       412   6e-132   
ref|XP_009109414.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       412   1e-131   
ref|XP_008379664.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       412   2e-131   
gb|KHM99092.1|  Nitrate transporter 1.3                                 415   2e-131   
gb|EPS69660.1|  hypothetical protein M569_05105                         410   4e-131   
ref|XP_006292488.1|  hypothetical protein CARUB_v10018717mg             410   5e-131   
ref|XP_006403613.1|  hypothetical protein EUTSA_v10010246mg             409   9e-131   
ref|XP_010044085.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            409   9e-131   
ref|NP_190982.1|  peptide transporter PTR1                              409   1e-130   
ref|XP_010427083.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            408   3e-130   
ref|XP_010680055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       408   5e-130   
ref|XP_003519455.1|  PREDICTED: nitrate transporter 1.3                 407   6e-130   
ref|XP_010504206.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       407   7e-130   
ref|XP_004151945.1|  PREDICTED: nitrate transporter 1.3-like            413   1e-129   
ref|XP_006398647.1|  hypothetical protein EUTSA_v10013125mg             406   1e-129   
ref|XP_009795638.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       406   1e-129   
gb|KHN38482.1|  Nitrate transporter 1.3                                 406   2e-129   
ref|XP_010515930.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       406   2e-129   
ref|XP_008665380.1|  PREDICTED: hypothetical protein isoform X1         406   3e-129   
ref|XP_007026785.1|  Peptide transporter 1 isoform 1                    405   3e-129   
ref|XP_011003666.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       405   3e-129   
ref|XP_009624729.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       405   3e-129   
ref|XP_010265161.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       405   4e-129   
ref|XP_006344125.1|  PREDICTED: probable nitrite transporter At1g...    405   4e-129   
gb|ABK24723.1|  unknown                                                 405   4e-129   
ref|XP_001769410.1|  predicted protein                                  405   5e-129   
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       405   5e-129   
ref|XP_008775060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       405   5e-129   
ref|XP_009610945.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            405   6e-129   
ref|XP_004500227.1|  PREDICTED: peptide transporter PTR5-like iso...    403   2e-128   
ref|XP_004294248.1|  PREDICTED: peptide transporter PTR1-like           403   3e-128   
ref|XP_010033028.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       402   3e-128   
ref|XP_004137914.1|  PREDICTED: peptide transporter PTR5-like           402   4e-128   
gb|KHG25065.1|  Nitrate transporter 1.3 -like protein                   403   4e-128   
gb|ACG41138.1|  peptide transporter PTR2                                403   4e-128   
ref|XP_009145465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            402   5e-128   
ref|XP_004163862.1|  PREDICTED: LOW QUALITY PROTEIN: peptide tran...    402   6e-128   
ref|XP_002315835.1|  Peptide transporter PTR2-B family protein          402   8e-128   
ref|XP_008785424.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       401   1e-127   
ref|XP_002992553.1|  hypothetical protein SELMODRAFT_135522             400   2e-127   
ref|XP_002972320.1|  hypothetical protein SELMODRAFT_97239              400   2e-127   
ref|NP_001173970.1|  Os04g0464400                                       401   2e-127   
ref|XP_009780466.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       400   2e-127   
emb|CDY13185.1|  BnaC04g26500D                                          400   2e-127   
ref|XP_008442465.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    400   2e-127   
ref|XP_009757138.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            400   3e-127   
ref|XP_002976984.1|  hypothetical protein SELMODRAFT_21531              400   3e-127   
gb|EYU45753.1|  hypothetical protein MIMGU_mgv1a003661mg                400   3e-127   
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       400   3e-127   
ref|XP_010650937.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    400   4e-127   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       400   4e-127   
ref|XP_010650936.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    400   5e-127   
ref|XP_006425015.1|  hypothetical protein CICLE_v10028095mg             400   5e-127   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg             400   6e-127   
ref|XP_009803584.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    400   6e-127   
ref|XP_004985084.1|  PREDICTED: peptide transporter PTR2-like iso...    400   7e-127   
ref|XP_004985083.1|  PREDICTED: peptide transporter PTR2-like iso...    400   8e-127   
gb|ABR32183.1|  peptide transporter                                     399   8e-127   
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...    399   9e-127   
gb|EYU41841.1|  hypothetical protein MIMGU_mgv1a017650mg                399   9e-127   
ref|XP_004252286.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    399   1e-126   
gb|AIL30501.1|  oligopeptide transporter 1                              399   1e-126   
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like           399   1e-126   
ref|XP_010228918.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    398   1e-126   
ref|XP_011021701.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       399   1e-126   
ref|XP_004985076.1|  PREDICTED: peptide transporter PTR2-like iso...    397   1e-126   
ref|XP_004297798.1|  PREDICTED: peptide transporter PTR2-like           399   2e-126   
dbj|BAJ85008.1|  predicted protein                                      398   2e-126   
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       398   2e-126   
ref|XP_006363097.1|  PREDICTED: peptide transporter PTR1-like           397   3e-126   
ref|XP_010654188.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       397   4e-126   
ref|XP_009774291.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       397   4e-126   
ref|XP_011032155.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       397   5e-126   
ref|XP_006437676.1|  hypothetical protein CICLE_v10031055mg             397   5e-126   
ref|XP_003558415.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    397   5e-126   
ref|XP_010228917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    397   5e-126   
ref|XP_002978223.1|  hypothetical protein SELMODRAFT_417946             398   6e-126   
ref|XP_003604615.1|  Peptide transporter PTR1                           397   7e-126   
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           397   8e-126   
ref|XP_004238938.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            396   8e-126   
gb|KDP24486.1|  hypothetical protein JCGZ_25050                         396   1e-125   
ref|XP_009624728.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       396   1e-125   
ref|XP_006365835.1|  PREDICTED: peptide transporter PTR2-like           396   1e-125   
ref|XP_010263538.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    394   1e-125   
ref|XP_010647749.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            396   1e-125   
gb|EEE59822.1|  hypothetical protein OsJ_12376                          396   2e-125   
ref|NP_001051098.1|  Os03g0719900                                       396   2e-125   
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       396   2e-125   
gb|KEH23143.1|  proton-dependent oligopeptide transport family pr...    395   2e-125   
ref|XP_006591201.1|  PREDICTED: peptide transporter PTR1-like iso...    395   2e-125   
ref|XP_010246838.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       395   2e-125   
ref|XP_010654192.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       395   2e-125   
ref|XP_002521890.1|  peptide transporter, putative                      396   2e-125   
ref|XP_009591011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       395   3e-125   
ref|XP_002313394.1|  hypothetical protein POPTR_0009s04710g             395   4e-125   
ref|XP_010104684.1|  Peptide transporter                                395   4e-125   
ref|XP_010033021.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       394   5e-125   
ref|XP_002966337.1|  hypothetical protein SELMODRAFT_439656             395   5e-125   
ref|XP_004492413.1|  PREDICTED: peptide transporter PTR1-like iso...    394   5e-125   
ref|XP_003516940.1|  PREDICTED: peptide transporter PTR1-like iso...    394   6e-125   
gb|KHN02576.1|  Peptide transporter PTR1                                394   7e-125   
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    394   7e-125   
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    394   8e-125   
ref|XP_001784314.1|  predicted protein                                  394   9e-125   
ref|XP_011019153.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            393   1e-124   
gb|KHN42300.1|  Peptide transporter PTR1                                394   1e-124   
ref|XP_002298324.1|  hypothetical protein POPTR_0001s25570g             393   1e-124   
gb|KDO53228.1|  hypothetical protein CISIN_1g0083672mg                  393   2e-124   
ref|XP_006346628.1|  PREDICTED: peptide transporter PTR2-like           393   2e-124   
ref|XP_006429306.1|  hypothetical protein CICLE_v10011381mg             393   2e-124   
ref|XP_002323559.2|  proton-dependent oligopeptide transport fami...    393   2e-124   
gb|KDO53230.1|  hypothetical protein CISIN_1g0083672mg                  392   2e-124   
gb|EAY89168.1|  hypothetical protein OsI_10664                          393   2e-124   
ref|XP_006373974.1|  hypothetical protein POPTR_0016s11940g             392   2e-124   
ref|XP_002870939.1|  proton-dependent oligopeptide transport fami...    392   2e-124   
ref|XP_002967819.1|  hypothetical protein SELMODRAFT_88337              394   3e-124   
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            393   3e-124   
ref|XP_008220400.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       393   3e-124   
gb|ACJ85583.1|  unknown                                                 385   3e-124   
ref|XP_006363053.1|  PREDICTED: peptide transporter PTR1-like           392   3e-124   
ref|XP_004149470.1|  PREDICTED: peptide transporter PTR2-like           393   3e-124   
ref|XP_008381222.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       382   3e-124   
ref|NP_195738.1|  peptide transporter PTR5                              392   4e-124   
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            392   4e-124   
ref|XP_003551296.1|  PREDICTED: peptide transporter PTR1                392   4e-124   
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           392   7e-124   
ref|XP_010558361.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       391   8e-124   
ref|XP_008801151.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...    390   8e-124   
gb|KDP38199.1|  hypothetical protein JCGZ_04842                         392   8e-124   
ref|XP_010490600.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       391   9e-124   
ref|XP_011008009.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            391   9e-124   
ref|XP_002981698.1|  hypothetical protein SELMODRAFT_444972             392   1e-123   
ref|XP_002965429.1|  hypothetical protein SELMODRAFT_84173              391   1e-123   
ref|XP_009337310.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       391   1e-123   
gb|EYU26644.1|  hypothetical protein MIMGU_mgv1a003683mg                390   1e-123   
ref|XP_006849517.1|  hypothetical protein AMTR_s00024p00147790          391   1e-123   
ref|XP_010554364.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    391   2e-123   
gb|KDP38200.1|  hypothetical protein JCGZ_04843                         391   2e-123   
ref|XP_006287367.1|  hypothetical protein CARUB_v10000567mg             390   2e-123   
ref|XP_009405229.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       390   2e-123   
ref|XP_008787880.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       391   2e-123   
ref|XP_004299089.1|  PREDICTED: probable nitrite transporter At1g...    390   2e-123   
gb|KDP46546.1|  hypothetical protein JCGZ_08518                         390   2e-123   
ref|XP_001754642.1|  predicted protein                                  390   2e-123   
ref|XP_011003661.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    390   3e-123   
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like           390   3e-123   
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    390   3e-123   
ref|XP_011003660.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    390   3e-123   
emb|CBI27031.3|  unnamed protein product                                396   3e-123   
ref|XP_008242154.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       389   3e-123   
ref|XP_002309120.2|  proton-dependent oligopeptide transport fami...    389   4e-123   
ref|XP_007208292.1|  hypothetical protein PRUPE_ppa003364mg             390   4e-123   
emb|CDY30051.1|  BnaC05g09690D                                          381   5e-123   
gb|EMS53820.1|  Nitrate transporter 1.4                                 388   5e-123   
ref|XP_002459192.1|  hypothetical protein SORBIDRAFT_02g000260          389   6e-123   
ref|XP_001781231.1|  predicted protein                                  390   6e-123   
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       390   6e-123   
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       389   7e-123   
ref|XP_010423917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2            389   7e-123   
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like           389   7e-123   
dbj|BAJ95092.1|  predicted protein                                      389   8e-123   
ref|XP_006848107.1|  hypothetical protein AMTR_s00029p00214340          389   8e-123   
ref|NP_001233998.1|  oligopeptide transporter 1                         389   8e-123   



>gb|EYU18566.1| hypothetical protein MIMGU_mgv1a020825mg [Erythranthe guttata]
Length=590

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/550 (75%), Positives = 473/550 (86%), Gaps = 1/550 (0%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  35    SAAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNAMSANNVTNFLGTSFMLCLLGGFIA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTIGIF TVQA GVTILTIST+IPSL+PPKC+  S SC+PASG QL VL+ AL
Sbjct  95    DTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKCTAGSESCIPASGKQLMVLFAAL  154

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD+SD +ER +MVKFF+WF F IN+GSL AVTVLVYIQD
Sbjct  155   YLTALGTGGLKSSVSGFGSDQFDESDNKERKKMVKFFNWFFFCINIGSLGAVTVLVYIQD  214

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR+WGYG+CACAIV  L++FLSGTRRYRFKKLVGSPLTQIA V+VAAWRKR LELPSD
Sbjct  215   NLGRQWGYGICACAIVVGLLVFLSGTRRYRFKKLVGSPLTQIAVVFVAAWRKRHLELPSD  274

Query  1262  PELLYNVDDVVAAAGD-QEHKKIKMPHSKEFRFLDRAAIKEGVSEVNKWSISTLTDVEEV  1086
               LL+N+DD+    G   + KK ++PHSKEFRFLD+AAIK   +  NKW IST TDVEEV
Sbjct  275   SSLLFNLDDINGDGGQLSKKKKQQLPHSKEFRFLDKAAIKTPEAPANKWCISTSTDVEEV  334

Query  1085  KQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVT  906
             K +IRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDR + KSFE+PAAS+ VF+V  IL+T
Sbjct  335   KMVIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRRIGKSFEIPAASLTVFFVASILLT  394

Query  905   IMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTA  726
             + +YDRI+ PI RR+L NP GLSPLQRI VGL LS++ M+AAAL E+KRL+VA SHGLT 
Sbjct  395   VPIYDRIIFPICRRILKNPNGLSPLQRIGVGLVLSIIAMVAAALTEVKRLRVAESHGLTD  454

Query  725   DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLF  546
             DP AT+P+SVFWL  Q+L+VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F
Sbjct  455   DPTATIPLSVFWLIPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFF  514

Query  545   FSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKR  366
             FSS+LVTIV K+TG+  PWLAD+LNQGKLYDFYWLL ++S  NL+ F +C+R YVYKEKR
Sbjct  515   FSSILVTIVHKLTGDNNPWLADNLNQGKLYDFYWLLTILSVFNLVIFQYCARRYVYKEKR  574

Query  365   LAEMGIELEE  336
             LAE GI+L+E
Sbjct  575   LAEEGIQLDE  584



>gb|EYU24743.1| hypothetical protein MIMGU_mgv1a003354mg [Erythranthe guttata]
Length=590

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/550 (75%), Positives = 472/550 (86%), Gaps = 1/550 (0%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  35    SAAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNAMSANNVTNFLGTSFMLCLLGGFIA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTIGIF TVQA GVTILTIST+IPSL+PPKC+  S SC+PAS  QL VL+ AL
Sbjct  95    DTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKCTAGSESCIPASSKQLMVLFAAL  154

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD+SD +ER +MVKFF+WF F IN+GSL AVTVLVYIQD
Sbjct  155   YLTALGTGGLKSSVSGFGSDQFDESDNKERKKMVKFFNWFFFCINIGSLGAVTVLVYIQD  214

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR+WGYG+CACAIV  L++FLSGTRRYRFKKLVGSPLTQIA V+VAAWRKR LELPSD
Sbjct  215   NLGRQWGYGICACAIVVGLLVFLSGTRRYRFKKLVGSPLTQIAVVFVAAWRKRHLELPSD  274

Query  1262  PELLYNVDDVVAAAGD-QEHKKIKMPHSKEFRFLDRAAIKEGVSEVNKWSISTLTDVEEV  1086
               LL+N+DD+    G   + KK ++PHSKEFRFLD+AAIK   +  NKW IST TDVEEV
Sbjct  275   SSLLFNLDDINGDGGLLSKKKKQQLPHSKEFRFLDKAAIKIPEAPANKWCISTSTDVEEV  334

Query  1085  KQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVT  906
             K +IRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDR + KSFE+PAAS+ VF+V  IL+T
Sbjct  335   KMVIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRRIGKSFEIPAASLTVFFVASILLT  394

Query  905   IMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTA  726
             + +YDRI+ PI RR+L NP GLSPLQRI VGL LS++ M+AAAL E+KRL+VA SHGLT 
Sbjct  395   VPIYDRIIFPICRRILKNPNGLSPLQRIGVGLVLSIIAMVAAALTEVKRLRVAESHGLTD  454

Query  725   DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLF  546
             DP AT+P+SVFWL  Q+L+VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F
Sbjct  455   DPTATIPLSVFWLIPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFF  514

Query  545   FSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKR  366
             FSS+LVTIV K+TG+  PWLAD+LNQGKLYDFYWLL ++S  NL+ F +C+R YVYKEKR
Sbjct  515   FSSILVTIVHKLTGDNNPWLADNLNQGKLYDFYWLLTILSVFNLVIFQYCARRYVYKEKR  574

Query  365   LAEMGIELEE  336
             LAE GI+L+E
Sbjct  575   LAEEGIQLDE  584



>ref|XP_009613364.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=592

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/556 (73%), Positives = 474/556 (85%), Gaps = 8/556 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S+AMILGVEA ERL TLGI +NLV YLT TMHLGNA AAN+VTNF+G S++LTLLGG++A
Sbjct  34    SSAMILGVEAVERLVTLGIAVNLVVYLTKTMHLGNANAANIVTNFMGTSYILTLLGGYIA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTF+GRYLTIGIF TVQA GVTILTISTIIPSL+PPKC   S +C+PASG QL VLY AL
Sbjct  94    DTFIGRYLTIGIFATVQAIGVTILTISTIIPSLRPPKCELGSSTCIPASGKQLAVLYTAL  153

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSVSG G+DQFDDSDK+ERGQM+KFFSWF F INVG+L AVTVLVYIQD
Sbjct  154   YMTALGTGGLKSSVSGFGSDQFDDSDKKERGQMIKFFSWFFFLINVGALAAVTVLVYIQD  213

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR WGYG+CACAI+  L++FL+GT+ YRFKKLVGSPLTQIA+V+VAAWRKR L+LPSD
Sbjct  214   KVGREWGYGICACAIIVGLIVFLTGTKNYRFKKLVGSPLTQIASVFVAAWRKRHLKLPSD  273

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTLT  1101
                L  VDD++    D++  K ++PHSKEFRFLD+AAIKE  SE      +N W+++TLT
Sbjct  274   SSFLITVDDIIGE--DKKKNKQQLPHSKEFRFLDKAAIKEDDSEFSGTTILNNWNLATLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK +IRMLPTW TTIMFWTV+AQ+ TFSVSQA TM+RH+ KSFE+PAAS+  F+VG
Sbjct  332   DVEEVKLVIRMLPTWGTTIMFWTVYAQMTTFSVSQATTMNRHIGKSFEIPAASLTAFFVG  391

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+ I+ YDRIMVPI RR LNNP G +PLQRIA+GL  S+  M+AAAL E+KRLKVA+ 
Sbjct  392   SILLMIIFYDRIMVPICRRFLNNPHGFTPLQRIAIGLVSSIFAMIAAALTEVKRLKVAKL  451

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HGLT D  A +PMSVFWL  Q+L+VG GEA TY+GQLDFFLRECPKGMKTMSTGLF+ST+
Sbjct  452   HGLTNDQNAIIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLRECPKGMKTMSTGLFISTI  511

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG FFSS+LVTIV KVTG+ KPWLAD+LN+GKLYDFYWLLA++S LNLM FLFCSR YV
Sbjct  512   SLGFFFSSILVTIVDKVTGKTKPWLADNLNKGKLYDFYWLLAILSVLNLMVFLFCSRRYV  571

Query  380   YKEKRLAEMGIELEEE  333
             YKEKRLAE+GIE+EE 
Sbjct  572   YKEKRLAEVGIEMEES  587



>ref|XP_009801608.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=592

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/556 (72%), Positives = 472/556 (85%), Gaps = 8/556 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S+AMILGVEA ERL TLGI +NLV YLT TMHLGNA AAN+VTNF+G S++LTLLGG++A
Sbjct  34    SSAMILGVEAVERLVTLGIAVNLVVYLTKTMHLGNANAANIVTNFMGTSYILTLLGGYIA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTF+GRYLTIGIF TVQA GVTILTISTIIPSL+PPKC   S +C+PASG QL VLY AL
Sbjct  94    DTFIGRYLTIGIFATVQAIGVTILTISTIIPSLRPPKCELGSSTCIPASGEQLAVLYTAL  153

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSVSG GTDQFDDSDK+ERGQM+KFFSWF F INVG+L AVTVLVYIQD
Sbjct  154   YMTALGTGGLKSSVSGFGTDQFDDSDKKERGQMIKFFSWFFFLINVGALAAVTVLVYIQD  213

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR WGYG+CACAI+  LV+FL+GT++YRFKKLVGSPLTQIA+V+VAAWRKR L+LPSD
Sbjct  214   KVGREWGYGICACAIIVGLVVFLTGTKKYRFKKLVGSPLTQIASVFVAAWRKRHLKLPSD  273

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTLT  1101
                L++VDD++    D +  K ++PHSKEF FLD+AAIKE  SE      +N W+++TLT
Sbjct  274   SSFLFSVDDIIGE--DNKKNKQQLPHSKEFCFLDKAAIKEDNSEFSGTTILNNWNLATLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK +IRMLPTW TTIMFWTV+AQ+ TFSVSQA TM+RH+ K FE+PAAS+  F+VG
Sbjct  332   DVEEVKLVIRMLPTWGTTIMFWTVYAQMTTFSVSQATTMNRHIGKYFEIPAASLTAFFVG  391

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+ I+ YDRIMVPI RR LNNP G +PLQRIA+GL  S+  M+AAAL E+KRLKVA+ 
Sbjct  392   SILLMIIFYDRIMVPICRRFLNNPHGFTPLQRIAIGLVSSIFAMIAAALTEVKRLKVAKL  451

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HGL  D  A +PMSVFWL  Q+L+VG GEA TY+GQLDFFLRECPKGMKTMSTGLF+ST+
Sbjct  452   HGLANDQNAIIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLRECPKGMKTMSTGLFISTI  511

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG FFSS+LVTIV KVTG+ +PWLAD+LN+GKLYDFYWLLA++S LNLM FLFCS  YV
Sbjct  512   SLGFFFSSILVTIVDKVTGKTRPWLADNLNKGKLYDFYWLLAILSVLNLMLFLFCSSRYV  571

Query  380   YKEKRLAEMGIELEEE  333
             YKEKRLAE+GIE+E+ 
Sbjct  572   YKEKRLAEVGIEMEDS  587



>ref|XP_011070105.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/544 (77%), Positives = 478/544 (88%), Gaps = 4/544 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACER+TTLGI +NLVTYLT TMHLGNA AAN VTNFLG +FML LLGGFVA
Sbjct  37    SAAMILGVEACERMTTLGIVVNLVTYLTGTMHLGNATAANDVTNFLGTAFMLCLLGGFVA  96

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTIGIFTT+QA G+TILTIST++P L+PPKC+  S SC+PA+G QLGVLYLAL
Sbjct  97    DTFLGRYLTIGIFTTIQATGITILTISTVVPGLRPPKCTAGSPSCIPANGKQLGVLYLAL  156

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFDD+DKRE  QM+KFF+WF FFINVGSL+AVTVLVYIQD
Sbjct  157   YLTALGTGGLKSSVSGFGSDQFDDTDKRETKQMIKFFNWFFFFINVGSLVAVTVLVYIQD  216

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             N+GR WGYG+CACAIV AL +FL+GTRRYRFKKLVGSPLTQIA V+VAAWRKR L++PSD
Sbjct  217   NVGREWGYGICACAIVVALAVFLAGTRRYRFKKLVGSPLTQIATVFVAAWRKRHLDVPSD  276

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE---GVSEVNKWSISTLTDVE  1092
             P LL++ DD+VA  G ++ KK K+PHSKEFRFLD+AA+K+   G +  NKW +STLTDVE
Sbjct  277   PSLLFDDDDIVAGEGQRKKKKQKLPHSKEFRFLDKAAVKDSQAGAASTNKWYLSTLTDVE  336

Query  1091  EVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGIL  912
             EVK +IRMLPTWATTIMFWTV+AQ+ TFSVSQA T++RH+  SFE+PA S+ VF+VG IL
Sbjct  337   EVKLVIRMLPTWATTIMFWTVYAQMTTFSVSQATTLNRHIG-SFEIPAGSLTVFFVGSIL  395

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             +T+ +YDRI+VPI RRVL NP GLSPLQRIAVGL LS+V M+AAAL EIKRL VARSHGL
Sbjct  396   LTVPIYDRIIVPIARRVLKNPHGLSPLQRIAVGLVLSIVAMVAAALTEIKRLNVARSHGL  455

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
             T +  ATVPMSVFWL  Q+L+VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG
Sbjct  456   THNETATVPMSVFWLVPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLG  515

Query  551   LFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE  372
              FFSS+LVTIV KVTG + PWLAD+LN+GKLYDFYWLL V+S  NLM FLFC+R YVYKE
Sbjct  516   FFFSSILVTIVHKVTGHQHPWLADNLNEGKLYDFYWLLTVLSIFNLMIFLFCARRYVYKE  575

Query  371   KRLA  360
             KRLA
Sbjct  576   KRLA  579



>ref|XP_006355480.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/561 (75%), Positives = 484/561 (86%), Gaps = 14/561 (2%)
 Frame = -3

Query  1973  MILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTF  1794
             MILG+EA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFMLTLLGGFVADTF
Sbjct  37    MILGIEAVERLTTLGIAVNLVTYLTGTMHLGNANSANNVTNFLGTSFMLTLLGGFVADTF  96

Query  1793  LGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalylt  1614
             LGRYLTIGIFTT+QA GVTILTISTIIPSL+PPKC P S +C+PASG QL VLY+ALY+T
Sbjct  97    LGRYLTIGIFTTIQAMGVTILTISTIIPSLRPPKCEPGSSTCIPASGKQLMVLYIALYMT  156

Query  1613  algtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLG  1434
             ALGTGGLKSSVSG G+DQFD++DK+ERGQM+KFF+WF FFINVGSL AVT+LVYIQDNLG
Sbjct  157   ALGTGGLKSSVSGFGSDQFDETDKKERGQMIKFFNWFFFFINVGSLGAVTILVYIQDNLG  216

Query  1433  RRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPEL  1254
             R WGYG+CACAIV  LV+FLSGTR+YRFKKLVGSPLTQIA+V+VAA RK+ LELPSDP L
Sbjct  217   REWGYGICACAIVIGLVIFLSGTRKYRFKKLVGSPLTQIASVFVAALRKKHLELPSDPSL  276

Query  1253  LYNVDDVVAAAGDQEHK-KIKMPHSKEFRFLDRAAIK------EGVSEVNKWSISTLTDV  1095
             L+N+DD+    GD   K K ++PHSKE+RFLD+AAIK       G + VNKW++STLTDV
Sbjct  277   LFNIDDI---PGDGNKKAKQRLPHSKEYRFLDKAAIKVNDLESAGFTVVNKWNLSTLTDV  333

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGI  915
             EEVK ++RMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+ K FE+P AS+ +F+VG I
Sbjct  334   EEVKLVVRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIGK-FEIPPASLTLFFVGSI  392

Query  914   LVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHG  735
             LVT + YDR++VPI +RVLNNPQGLSPLQRIAVGL LS++ M+AAAL E+KRL VA  HG
Sbjct  393   LVTCVFYDRVVVPIAKRVLNNPQGLSPLQRIAVGLVLSIIAMIAAALTEVKRLNVAHLHG  452

Query  734   LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVAL  555
             LT D  A +P+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++L
Sbjct  453   LTNDANAMIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSL  512

Query  554   GLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             G FFSS+LVTIV KVTG KKPWLAD+LNQGKLYDFYWLLA++S  NLM FLF SR YVYK
Sbjct  513   GFFFSSILVTIVHKVTG-KKPWLADNLNQGKLYDFYWLLAILSVFNLMIFLFFSRRYVYK  571

Query  374   EKRLAEMGIELEEETHIPGGH  312
             EKRLAE+GIE+E+    P  H
Sbjct  572   EKRLAEVGIEMEDSE--PACH  590



>ref|XP_009611019.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
 dbj|BAC56914.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/561 (74%), Positives = 479/561 (85%), Gaps = 14/561 (2%)
 Frame = -3

Query  1973  MILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTF  1794
             MILG+EA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFMLTLLGGFVADTF
Sbjct  37    MILGIEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTF  96

Query  1793  LGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalylt  1614
             LGRYLTIGIFTT+QA GVTILTISTIIPSL+PPKCSP S +C+PAS  QL VLY+ALY+T
Sbjct  97    LGRYLTIGIFTTIQAMGVTILTISTIIPSLRPPKCSPGSSTCIPASSKQLMVLYIALYMT  156

Query  1613  algtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLG  1434
             ALGTGGLKSSVSG G+DQFD++DK+ERGQM+KFF+WF FFINVGSL AVTVLVYIQDNLG
Sbjct  157   ALGTGGLKSSVSGFGSDQFDETDKKERGQMIKFFNWFFFFINVGSLGAVTVLVYIQDNLG  216

Query  1433  RRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPEL  1254
             R +GYG+CACAIV  LV+FLSGTR+YRFKKLVGSPLTQIA+V+VAAW KR +ELPSD  L
Sbjct  217   REYGYGICACAIVIGLVIFLSGTRKYRFKKLVGSPLTQIASVFVAAWNKRHMELPSDSSL  276

Query  1253  LYNVDDVVAAAGDQEHK-KIKMPHSKEFRFLDRAAIK------EGVSEVNKWSISTLTDV  1095
             LYN+DD+    GD   K K ++PHSKEFRFLD+AAIK       G++ VNKW++STLTDV
Sbjct  277   LYNIDDI---PGDGNKKAKQRLPHSKEFRFLDKAAIKVQDPESAGITVVNKWNLSTLTDV  333

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGI  915
             EEVK ++RMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  +FE+P AS+ +F+VG I
Sbjct  334   EEVKLVVRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIG-NFEIPPASLTLFFVGSI  392

Query  914   LVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHG  735
             L+T + YDR +VP+ RRVLNNP G SPLQRIAVGL LS++ M+AAAL E+KRL VA  HG
Sbjct  393   LLTCIFYDRAVVPVCRRVLNNPHGTSPLQRIAVGLILSIIAMIAAALTEVKRLNVAHLHG  452

Query  734   LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVAL  555
             LT D  A VP+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++L
Sbjct  453   LTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSL  512

Query  554   GLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             G FFSS+LVTIV KVTG K PWLAD+LNQG+LYDFYWLLA +S LNLM FLF SR YVYK
Sbjct  513   GFFFSSILVTIVHKVTG-KNPWLADNLNQGRLYDFYWLLATLSVLNLMIFLFISRRYVYK  571

Query  374   EKRLAEMGIELEEETHIPGGH  312
             EKRLAE GIE+E+    P  H
Sbjct  572   EKRLAECGIEMEDSE--PACH  590



>ref|XP_006358355.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/553 (74%), Positives = 472/553 (85%), Gaps = 4/553 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S AMILGVEA ERLTTLGI +NLVTYLT TMHLGNA AAN VTNFLG SFMLTLLGGF+A
Sbjct  34    SGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANNVTNFLGTSFMLTLLGGFIA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTIGIF TVQA GVTILTISTIIPSL+PPKC   S SC+PASG QL VLY+AL
Sbjct  94    DTFLGRYLTIGIFATVQAIGVTILTISTIIPSLRPPKCEQGSSSCIPASGKQLMVLYIAL  153

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSVSG GTDQFDDS+++E+GQM+KFF WF FFINVGSL AVT+LVY+QD
Sbjct  154   YMTALGTGGLKSSVSGFGTDQFDDSNEKEKGQMIKFFDWFFFFINVGSLGAVTILVYVQD  213

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG+CACAIV ALVLFL GTR+YRFKKLVGSPLTQIA+V+VAAWR R +ELPSD
Sbjct  214   NLGREWGYGICACAIVIALVLFLFGTRKYRFKKLVGSPLTQIASVFVAAWRNRHMELPSD  273

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE---VNKWSISTLTDVE  1092
               LLY +DD V   G ++ K+ K+PHSKE+RFLD+AAIKE   E   VNKW +STLTDVE
Sbjct  274   SSLLYEIDDNVFGEGHKKRKQ-KLPHSKEYRFLDKAAIKEDGLESNVVNKWKLSTLTDVE  332

Query  1091  EVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGIL  912
             EVK L RMLPTWATTIMFWT +AQ+ TFSVSQA TMDRH+ KSFE+P AS+  F+VG IL
Sbjct  333   EVKLLFRMLPTWATTIMFWTTYAQMTTFSVSQATTMDRHIGKSFEIPPASLTAFFVGAIL  392

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             +T++ YDR++VPI RRV N   GL+PLQRI +GL LS++ M+A+AL E+KRL  A  +GL
Sbjct  393   LTVIFYDRVIVPICRRVANKRHGLTPLQRIFIGLILSIIAMVASALTEVKRLNTAHLNGL  452

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
             T DP AT+P+SVFWL  Q+L++G+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST+ALG
Sbjct  453   TNDPNATIPLSVFWLIPQFLLIGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLALG  512

Query  551   LFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE  372
              FFSS+LVTIV  VTG   PW+AD+LNQGKL+DFYWLLA++S LNLM FL+ S+ YVYKE
Sbjct  513   FFFSSILVTIVHMVTGTTHPWIADNLNQGKLHDFYWLLAILSVLNLMVFLYTSKTYVYKE  572

Query  371   KRLAEMGIELEEE  333
             KRLAEMGIELE+ 
Sbjct  573   KRLAEMGIELEDS  585



>ref|XP_004245746.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/554 (74%), Positives = 480/554 (87%), Gaps = 12/554 (2%)
 Frame = -3

Query  1973  MILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTF  1794
             MILG+EA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFMLTLLGGFVADTF
Sbjct  37    MILGIEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTF  96

Query  1793  LGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalylt  1614
             LGRYLTIGIFTT+QA GVTILTISTIIPSLQPPKC   S +C+PASG QL VLY+ALY+T
Sbjct  97    LGRYLTIGIFTTIQAMGVTILTISTIIPSLQPPKCELGSSTCIPASGKQLMVLYIALYMT  156

Query  1613  algtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLG  1434
             ALGTGGLKSSVSG G+DQFD++DK+ERGQM+KFF+WF FFINVGSL AVT+LVYIQDNLG
Sbjct  157   ALGTGGLKSSVSGFGSDQFDETDKKERGQMIKFFNWFFFFINVGSLGAVTILVYIQDNLG  216

Query  1433  RRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPEL  1254
             R WGYG+CACAIV  LV+FL GTR+YRFKKLVGSPLTQIA+V+VAA RK+ LELPSDP L
Sbjct  217   REWGYGICACAIVIGLVIFLLGTRKYRFKKLVGSPLTQIASVFVAALRKKHLELPSDPSL  276

Query  1253  LYNVDDVVAAAGDQEHK-KIKMPHSKEFRFLDRAAIK------EGVSEVNKWSISTLTDV  1095
             L+N+DD+    GD   K K ++PHSKE+RFLD+AAIK       G + VNKW++STLTDV
Sbjct  277   LFNIDDI---PGDGNKKAKQRLPHSKEYRFLDKAAIKVNDVESAGFTVVNKWNLSTLTDV  333

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGI  915
             EEVK ++RMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+ K FE+P AS+ +F+VG I
Sbjct  334   EEVKLVLRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIGK-FEIPPASLTLFFVGSI  392

Query  914   LVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHG  735
             L+T + YDR+++PI +RVLNNPQGLSPLQRIAVGL LS++ M+AAAL E+KRL VA  HG
Sbjct  393   LLTCVFYDRVVIPITKRVLNNPQGLSPLQRIAVGLVLSIIAMIAAALTEVKRLNVAHMHG  452

Query  734   LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVAL  555
             LT D  A +P+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++L
Sbjct  453   LTNDANAMIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSL  512

Query  554   GLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             G F SS+LVTIV KVTG+ KPWLAD+LNQG+LYDFYWLLA++S LNLM FLF SR YVYK
Sbjct  513   GFFVSSILVTIVHKVTGD-KPWLADNLNQGRLYDFYWLLAILSVLNLMIFLFFSRRYVYK  571

Query  374   EKRLAEMGIELEEE  333
             EKRLA++GIE+E+ 
Sbjct  572   EKRLADVGIEMEDS  585



>ref|XP_004244572.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/553 (74%), Positives = 471/553 (85%), Gaps = 4/553 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S AMILGVEA ERLTTLGI +NLVTYLT TMHLGNA AAN VTNFLG SFMLTLLGGF+A
Sbjct  34    SGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANNVTNFLGTSFMLTLLGGFIA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTIGIF TVQA GVTILTISTI+PSL+PPKC   S SC+PA+G QL VLY+AL
Sbjct  94    DTFLGRYLTIGIFATVQAIGVTILTISTIVPSLRPPKCEQGSSSCIPANGKQLMVLYIAL  153

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSVSG GTDQFDDS+++E+GQM+KFF WF FFINVGSL AVT+LVY+QD
Sbjct  154   YMTALGTGGLKSSVSGFGTDQFDDSNEKEKGQMIKFFDWFFFFINVGSLGAVTILVYVQD  213

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG+CACAIV ALVLFL GTR+YRFKKLVGSPLTQIA+V+VAAWR R +ELPSD
Sbjct  214   NLGREWGYGICACAIVIALVLFLFGTRKYRFKKLVGSPLTQIASVFVAAWRNRHMELPSD  273

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE---VNKWSISTLTDVE  1092
               LLY +DD V   G ++ K+ K+PHSKE+ FLD+AAIKE   E   VNKW +STLTDVE
Sbjct  274   SSLLYEIDDNVFGEGHKKRKQ-KLPHSKEYLFLDKAAIKEDGLESNVVNKWKVSTLTDVE  332

Query  1091  EVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGIL  912
             EVK L RMLPTWATTIMFWT +AQ+ TFSVSQA TMDRH+ KSFE+P AS+  F+VG IL
Sbjct  333   EVKLLFRMLPTWATTIMFWTTYAQMTTFSVSQATTMDRHIGKSFEIPPASLTAFFVGAIL  392

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             +T++ YDR++VPI RR  N   GL+PLQRI +GL LS++ M+A+AL E+KRL  A  +GL
Sbjct  393   LTVIFYDRVIVPICRRFANKRHGLTPLQRIFIGLILSIIAMIASALTEVKRLNTAHLNGL  452

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
             T DP AT+P+SVFWL  Q+L++G+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST+ALG
Sbjct  453   TNDPNATIPLSVFWLIPQFLLIGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLALG  512

Query  551   LFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE  372
              FFSS+LVTIV  VTG K PW+AD+LNQGKL+DFYWLLA++S LNLM FL+ S+ YVYKE
Sbjct  513   FFFSSILVTIVHMVTGTKHPWIADNLNQGKLHDFYWLLAILSVLNLMVFLYTSKTYVYKE  572

Query  371   KRLAEMGIELEEE  333
             KRLAEMGIELE+ 
Sbjct  573   KRLAEMGIELEDS  585



>ref|XP_009798260.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
 dbj|BAC56913.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/561 (74%), Positives = 478/561 (85%), Gaps = 14/561 (2%)
 Frame = -3

Query  1973  MILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTF  1794
             MILG+EA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFMLTLLGGFVADTF
Sbjct  37    MILGIEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTF  96

Query  1793  LGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalylt  1614
             LGRYLTIGIFTT+QA GVTILTISTIIPSL+PPKCSP S +C+PAS  QL VLY+ALY+T
Sbjct  97    LGRYLTIGIFTTIQAMGVTILTISTIIPSLRPPKCSPGSSTCIPASSKQLMVLYIALYMT  156

Query  1613  algtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLG  1434
             ALGTGGLKSSVSG G+DQFD++DK+ERGQM+KFF+WF FFINVGSL AVTVLVYIQDNLG
Sbjct  157   ALGTGGLKSSVSGFGSDQFDETDKKERGQMIKFFNWFFFFINVGSLGAVTVLVYIQDNLG  216

Query  1433  RRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPEL  1254
             R +GYG+CACAIV  LV+FLSGTR+YRFKKLVGSPLTQIA+V+VAAW KR ++LPSD  L
Sbjct  217   REYGYGICACAIVIGLVIFLSGTRKYRFKKLVGSPLTQIASVFVAAWNKRHMDLPSDSYL  276

Query  1253  LYNVDDVVAAAGDQEHK-KIKMPHSKEFRFLDRAAIK------EGVSEVNKWSISTLTDV  1095
             LYN+DD+    GD   K K ++PHSKEFRFLD+AAIK       G++ VNKW++STLTDV
Sbjct  277   LYNIDDI---PGDGNKKAKQRLPHSKEFRFLDKAAIKVQDPESAGITVVNKWNLSTLTDV  333

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGI  915
             EEVK ++RMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  +FE+P AS+ +F+VG I
Sbjct  334   EEVKLVVRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIG-NFEIPPASLTLFFVGSI  392

Query  914   LVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHG  735
             L+T + YDR +VP+ RRVLNNP G +PLQRIAVGL LS++ M+AAAL E+KRL VA  HG
Sbjct  393   LLTCIFYDRAVVPVCRRVLNNPHGTTPLQRIAVGLILSIIAMVAAALTEVKRLNVAHLHG  452

Query  734   LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVAL  555
             LT D  A VP+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++L
Sbjct  453   LTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSL  512

Query  554   GLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             G FFSS+LVTIV KVT  K PWLAD+LNQG+LYDFYWLLA +S LNLM FLF SR YVYK
Sbjct  513   GFFFSSILVTIVHKVT-VKNPWLADNLNQGRLYDFYWLLATLSVLNLMIFLFISRRYVYK  571

Query  374   EKRLAEMGIELEEETHIPGGH  312
             EKRLAE GIE+E+    P  H
Sbjct  572   EKRLAECGIEMEDSE--PACH  590



>ref|XP_010053448.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Eucalyptus grandis]
 gb|KCW77743.1| hypothetical protein EUGRSUZ_D02037 [Eucalyptus grandis]
Length=593

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/556 (72%), Positives = 475/556 (85%), Gaps = 6/556 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EACERLTTLG+ +NLVTYLT TMHLG+A +AN+VTNF+G SFML LLGGFVA
Sbjct  32    SAAMILGGEACERLTTLGVAVNLVTYLTGTMHLGSATSANIVTNFMGTSFMLCLLGGFVA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF T+QA GVTIL ISTIIPSL+PP C+  +   C PA+  Q+ VLYLA
Sbjct  92    DTFLGRYLTIAIFATIQATGVTILAISTIIPSLRPPTCTASNDQLCTPATDTQMTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY  ALGTGGLKSSVSG G+DQFD+SD +E+ QMV FF+WF FFI++GSLLAVTVLVYIQ
Sbjct  152   LYTLALGTGGLKSSVSGFGSDQFDESDPKEQSQMVNFFNWFFFFISIGSLLAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN GR+WGYG+CACAIV ALV+FLSGT+RYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS
Sbjct  212   DNQGRQWGYGICACAIVIALVVFLSGTKRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK-----EGVSEVNKWSISTLT  1101
             D  LL+NVDD+      ++ KK K+PHSK+FRFLD+AAIK       V+ VNKW++STLT
Sbjct  272   DASLLFNVDDLPGDGSAEKKKKQKLPHSKQFRFLDKAAIKPSEMPNDVTVVNKWNLSTLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK +IRMLP WAT IMFWTV+AQ+ TFSVSQA TMDRH+ KSF++PAAS+ VF+VG
Sbjct  332   DVEEVKLVIRMLPIWATNIMFWTVYAQMTTFSVSQATTMDRHIGKSFQIPAASLTVFFVG  391

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDR++VP+ RR+L NP GL+PLQRI VGL LS++ M+AAAL EIKRL+ AR 
Sbjct  392   SILLTVPVYDRVVVPLTRRLLKNPHGLTPLQRIGVGLVLSILAMVAAALTEIKRLRAARH  451

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             +GLT DP A +P+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST+
Sbjct  452   YGLTNDPNAVIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  511

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG FFSS+LVT+V KVTG KKPWLA++LNQGKL+DFYWLLA++SALN + FL C++ YV
Sbjct  512   SLGFFFSSLLVTVVHKVTGNKKPWLANNLNQGKLHDFYWLLAILSALNFLIFLVCAKWYV  571

Query  380   YKEKRLAEMGIELEEE  333
             YK+KRLA+ GIELEEE
Sbjct  572   YKDKRLADEGIELEEE  587



>emb|CAC00544.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=590

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/561 (74%), Positives = 477/561 (85%), Gaps = 14/561 (2%)
 Frame = -3

Query  1973  MILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTF  1794
             MILG+EA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFMLTLLGGFVADTF
Sbjct  37    MILGIEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTF  96

Query  1793  LGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalylt  1614
             LGRYLTIGIFTT+QA GVTILTISTIIPSL+PPKCSP S +C+PAS  QL VLY+ALY+T
Sbjct  97    LGRYLTIGIFTTIQAMGVTILTISTIIPSLRPPKCSPGSSTCIPASSKQLMVLYIALYMT  156

Query  1613  algtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLG  1434
             ALGTGGLKSSVSG G+DQFD++DK+ERGQM+KFF+WF FFINVGSL AVTVLVYIQDNLG
Sbjct  157   ALGTGGLKSSVSGFGSDQFDETDKKERGQMIKFFNWFFFFINVGSLGAVTVLVYIQDNLG  216

Query  1433  RRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPEL  1254
             R +GYG+CACAIV  LV+FLSGTR+YRFKKLVGSPLTQIA+V+VAAW KR ++LPSD  L
Sbjct  217   REYGYGICACAIVIGLVIFLSGTRKYRFKKLVGSPLTQIASVFVAAWNKRHMDLPSDSTL  276

Query  1253  LYNVDDVVAAAGDQEHK-KIKMPHSKEFRFLDRAAIK------EGVSEVNKWSISTLTDV  1095
             LYN+DD+    GD   K K ++PHSKEFRFLD+AAIK       G++ VNKW++STLTDV
Sbjct  277   LYNIDDI---PGDGNKKAKQRLPHSKEFRFLDKAAIKVQDTESAGITVVNKWNLSTLTDV  333

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGI  915
             EEVK ++RMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  +FE+P AS+ +F+VG I
Sbjct  334   EEVKLVVRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIG-NFEIPPASLTLFFVGSI  392

Query  914   LVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHG  735
             L+T + YDR +VP+ RRVLNNP G +PLQRIAVGL LS++ M+AAAL E+KRL VA  HG
Sbjct  393   LLTCIFYDRAVVPVCRRVLNNPHGTTPLQRIAVGLILSIIAMVAAALTEVKRLNVAHLHG  452

Query  734   LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVAL  555
             LT D  A VP+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++L
Sbjct  453   LTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSL  512

Query  554   GLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             G F SS+LVTIV KVT  K PWLAD+LNQG+LYDFYWLLA +S LNLM FLF SR YVYK
Sbjct  513   GFFVSSILVTIVHKVT-VKNPWLADNLNQGRLYDFYWLLATLSVLNLMVFLFISRRYVYK  571

Query  374   EKRLAEMGIELEEETHIPGGH  312
             EKRLAE GIE+E+    P  H
Sbjct  572   EKRLAECGIEMEDSE--PACH  590



>ref|XP_009800593.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800594.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Nicotiana 
sylvestris]
Length=594

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/559 (74%), Positives = 475/559 (85%), Gaps = 12/559 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S AMILGVEA ERLTTLGI +NLVTYLT TMHLGNA AAN VTNFLG SFMLTLLGGFVA
Sbjct  34    SGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANNVTNFLGTSFMLTLLGGFVA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRYLTIGIF TVQA GVTILTISTIIPSL+PPKC    S SC+PA+  QL VLY+A
Sbjct  94    DTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSSSCIPANSKQLMVLYIA  153

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG GTDQFDDSDK+E+GQM+KFF WF FFINVGSL AVTVLVYIQ
Sbjct  154   LYMTALGTGGLKSSVSGFGTDQFDDSDKKEKGQMIKFFDWFFFFINVGSLGAVTVLVYIQ  213

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGTR+YRFKKLVGSPLTQIA+V VAAW+KR LELPS
Sbjct  214   DNLGREWGYGICACAIVIGLVVFLSGTRKYRFKKLVGSPLTQIASVIVAAWKKRHLELPS  273

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-------GVSEV-NKWSIS  1110
             D  LL+ +DD+    G+++ K+ K+PHSKE+RFLD+AAIKE       G + V NKW ++
Sbjct  274   DSSLLFEIDDIFGE-GNKKSKQ-KLPHSKEYRFLDKAAIKEDHDLESNGTNVVINKWKLA  331

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK LIRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  +FE+P AS+ VF
Sbjct  332   TLTDVEEVKLLIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIG-TFEIPPASLTVF  390

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T++ YDR++VPI RR +N P GL+PLQRI  GL LS++ M+AAAL E+KRLKV
Sbjct  391   FVGSILLTVIFYDRVIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKV  450

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A  HGL  D  AT+P++VFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  451   AHLHGLANDENATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  510

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST+ALG F SS+LVTIV  VTG K PWLAD+LNQG+LYDFYWLLA++S  NLM FL+ SR
Sbjct  511   STLALGFFVSSILVTIVHIVTGTKNPWLADNLNQGRLYDFYWLLAILSVFNLMFFLYSSR  570

Query  389   GYVYKEKRLAEMGIELEEE  333
              YVYKEKRLAEMGIELE++
Sbjct  571   KYVYKEKRLAEMGIELEDD  589



>ref|XP_011081220.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/545 (75%), Positives = 471/545 (86%), Gaps = 4/545 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE CERLTTLGI +NLVTYLT TMHLGNAG+AN VTNFLG SFML LLGGF+A
Sbjct  36    SAAMILGVEVCERLTTLGIAVNLVTYLTGTMHLGNAGSANTVTNFLGTSFMLCLLGGFIA  95

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DT+LGRYLTIGIF TVQA GVTILTISTIIPSL+PPKCSP S SC+PAS  QL VLY AL
Sbjct  96    DTYLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCSPGSKSCIPASNKQLMVLYAAL  155

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD+SDK+E+ QM KFF+WF FFI++GSL AVTVLVYIQD
Sbjct  156   YLTALGTGGLKSSVSGFGSDQFDESDKKEKKQMTKFFNWFFFFISIGSLAAVTVLVYIQD  215

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG+CACAIV  L++FLSGTRRYRFKKLVGSPLTQIA+V+VAAWRKR LE PSD
Sbjct  216   NLGREWGYGICACAIVVGLLVFLSGTRRYRFKKLVGSPLTQIASVFVAAWRKRDLEPPSD  275

Query  1262  PELLYNVDDVVAAAGDQEHKKIK-MPHSKEFRFLDRAAIKEG---VSEVNKWSISTLTDV  1095
             P LL+++DD+V   G  + KK + +PHSKEFRFLD+AAIK+    ++  +KW +STLTDV
Sbjct  276   PSLLFDIDDIVGDEGQSKKKKKQKLPHSKEFRFLDKAAIKDSEVPITVASKWHLSTLTDV  335

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGI  915
             EEVK +IRM+PTWATT+MFWTV+AQ+ TFSVSQA TMDRH+SKSF++PAAS+ VF+V  I
Sbjct  336   EEVKLVIRMVPTWATTVMFWTVYAQMTTFSVSQATTMDRHISKSFQIPAASLTVFFVASI  395

Query  914   LVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHG  735
             L+T+ +YDRI+VPI R++  NPQGL+PLQRI VGL LS+  M+AAAL EIKRL VARSHG
Sbjct  396   LLTVPIYDRIIVPICRKIFKNPQGLTPLQRIGVGLVLSIFAMVAAALSEIKRLHVARSHG  455

Query  734   LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVAL  555
             LT D AA VP+SVFWL  Q+L+VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST++L
Sbjct  456   LTHDRAAIVPLSVFWLVPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSL  515

Query  554   GLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             G F SS+LV IV KVTGEKKPWLAD+LN+G+LY+FYWLL ++S LNL  FL  +R YVYK
Sbjct  516   GFFVSSILVAIVHKVTGEKKPWLADNLNEGRLYNFYWLLTILSILNLAVFLVSARWYVYK  575

Query  374   EKRLA  360
             E RLA
Sbjct  576   ENRLA  580



>ref|XP_004147617.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004171170.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|KGN50229.1| hypothetical protein Csa_5G161290 [Cucumis sativus]
Length=591

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/554 (72%), Positives = 464/554 (84%), Gaps = 8/554 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EA ERLTTLGI +NLVTYLT+TMHLGNA AAN VTNFLG SFML L GGFVA
Sbjct  35    AAAMILGPEAVERLTTLGIAVNLVTYLTETMHLGNATAANNVTNFLGTSFMLCLFGGFVA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP--ESGSCVPASggqlgvlyl  1629
             DTFLGRYLTI IF TVQAAGVTILTISTIIPSL+PPKCSP   +  C+ A   QL VL+ 
Sbjct  95    DTFLGRYLTISIFATVQAAGVTILTISTIIPSLRPPKCSPGVSTTPCIMADSKQLAVLHT  154

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALYLTALGTGGLKSSVSG G+DQFDDSDK ER +M KFF+WF F I++GSL AVT+LVYI
Sbjct  155   ALYLTALGTGGLKSSVSGFGSDQFDDSDKEERAKMSKFFNWFFFIISIGSLGAVTILVYI  214

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN GR+WGYG+CACAIV  LV FL GTR+YRFKKLVGSPLTQI AV+ AAWRKR+L+LP
Sbjct  215   QDNWGRQWGYGICACAIVLGLVAFLLGTRKYRFKKLVGSPLTQIVAVFYAAWRKRKLDLP  274

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGV---SEVNKWSISTLTD  1098
             SDP  LY ++D V  +G    KK K+P +K+FRFLD+AAIK+     + VNKW ISTLTD
Sbjct  275   SDPFSLYQIEDAVDGSG---KKKQKLPRTKQFRFLDKAAIKDEEVVGNVVNKWKISTLTD  331

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             +EEVK ++RMLP WATTI+FWTV+AQ+ TFSVSQA TM+RHM KSFE+PAAS+ VF+V  
Sbjct  332   IEEVKLVLRMLPIWATTIIFWTVYAQMTTFSVSQATTMNRHMGKSFEIPAASLTVFFVAS  391

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR ++PI  R+L NPQGLSPLQR+ VGL LS++ M+AAAL EIKRLKV   +
Sbjct  392   ILLTVPIYDRFIIPIASRILKNPQGLSPLQRVGVGLVLSIIAMVAAALTEIKRLKVVEEN  451

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GLT  P A VP+SVFWLA Q+L+VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST+A
Sbjct  452   GLTYKPTAEVPLSVFWLAPQFLLVGSGEAFTYMGQLDFFLRECPKGMKTMSTGLFLSTLA  511

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFSS+LVTIVGKVT   +PW+ D+LN+GKLYDFYWLLA++S LNLM FL C++ YVY
Sbjct  512   LGFFFSSLLVTIVGKVTEHGRPWIPDNLNEGKLYDFYWLLAILSVLNLMVFLVCAKWYVY  571

Query  377   KEKRLAEMGIELEE  336
             KEKRLA+ GIELE+
Sbjct  572   KEKRLADEGIELED  585



>dbj|BAC56916.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/559 (74%), Positives = 475/559 (85%), Gaps = 12/559 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S AMILGVEA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFMLTLLGGFVA
Sbjct  34    SGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRYLTIGIF TVQA GVTILTISTIIPSL+PPKC    S SC+PA+  QL VLY+A
Sbjct  94    DTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSSSCIPANSKQLMVLYIA  153

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG GTDQFDDSDK+E+GQM+KFF WF FFINVGSL AVTVLVYIQ
Sbjct  154   LYMTALGTGGLKSSVSGFGTDQFDDSDKKEKGQMIKFFDWFFFFINVGSLGAVTVLVYIQ  213

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV ALV+FL GTR+YRFKKL GSPLTQIA+V VAAW+KR LELPS
Sbjct  214   DNLGREWGYGICACAIVIALVVFLFGTRKYRFKKLGGSPLTQIASVIVAAWKKRHLELPS  273

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-------GVSEV-NKWSIS  1110
             D  LL+ +DD+    G+++ K+ K+PHSKE+RFLD+AAIKE       G + V NKW ++
Sbjct  274   DSSLLFEIDDIFGE-GNKKSKQ-KLPHSKEYRFLDKAAIKEDDDLESNGTNVVINKWKLA  331

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK LIRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  +FE+P A++ VF
Sbjct  332   TLTDVEEVKILIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIG-TFEIPPATLTVF  390

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T++ YDRI+VPI RR +N P GL+PLQRI  GL LS++ M+AAAL E+KRLKV
Sbjct  391   FVGSILLTVIFYDRIIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKV  450

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A  HGLT D  AT+P++VFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  451   AHLHGLTNDANATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  510

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST+ALG FFSS+LVTIV  VTG   PWLAD+LNQG+LYDFYWLLA++S  NLM FL+ SR
Sbjct  511   STLALGFFFSSILVTIVHVVTGTTNPWLADNLNQGRLYDFYWLLAILSVFNLMFFLYSSR  570

Query  389   GYVYKEKRLAEMGIELEEE  333
              YVYKEKRLAEMGIELE++
Sbjct  571   KYVYKEKRLAEMGIELEDD  589



>ref|XP_009598780.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=594

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/559 (74%), Positives = 475/559 (85%), Gaps = 12/559 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S AMILGVEA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFMLTLLGGFVA
Sbjct  34    SGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRYLTIGIF TVQA GVTILTISTIIPSL+PPKC    S SC+PA+  QL VLY+A
Sbjct  94    DTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSSSCIPANSKQLMVLYIA  153

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG GTDQFDDSDK+E+GQM+KFF WF FFINVGSL AVTVLVYIQ
Sbjct  154   LYMTALGTGGLKSSVSGFGTDQFDDSDKKEKGQMIKFFDWFFFFINVGSLGAVTVLVYIQ  213

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV ALV+FL GTR+YRFKKL GSPLTQIA+V VAAW+KR LELPS
Sbjct  214   DNLGREWGYGICACAIVIALVVFLFGTRKYRFKKLGGSPLTQIASVIVAAWKKRHLELPS  273

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-------GVSEV-NKWSIS  1110
             D  LL+ +DD+    G+++ K+ K+PHSKE+RFLD+AAIKE       G + V NKW ++
Sbjct  274   DSSLLFEIDDIFGE-GNKKSKQ-KLPHSKEYRFLDKAAIKEDDDLESNGTNVVINKWKLA  331

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK LIRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  +FE+P A++ VF
Sbjct  332   TLTDVEEVKLLIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIG-TFEIPPATLTVF  390

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T++ YDRI+VPI RR +N P GL+PLQRI  GL LS++ M+AAAL E+KRLKV
Sbjct  391   FVGSILLTVIFYDRIIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKV  450

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A  HGLT D  AT+P++VFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  451   AHLHGLTNDANATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  510

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST+ALG FFSS+LVTIV  VTG   PWLAD+LNQG+LYDFYWLLA++S  NLM FL+ SR
Sbjct  511   STLALGFFFSSILVTIVHVVTGTTNPWLADNLNQGRLYDFYWLLAILSVFNLMFFLYSSR  570

Query  389   GYVYKEKRLAEMGIELEEE  333
              YVYKEKRLAEMGIELE++
Sbjct  571   KYVYKEKRLAEMGIELEDD  589



>ref|XP_008437115.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Cucumis melo]
Length=591

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/554 (72%), Positives = 464/554 (84%), Gaps = 8/554 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EA ERLTTLGI +NLVTYLT+TMHLGNA AAN VTNFLG SFML L GGFVA
Sbjct  35    AAAMILGPEAVERLTTLGIAVNLVTYLTETMHLGNATAANNVTNFLGTSFMLCLFGGFVA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP--ESGSCVPASggqlgvlyl  1629
             DTFLGRYLTI IF TVQA GVT+LTISTIIPSL+PPKCSP   +  C+ A   QL VL+ 
Sbjct  95    DTFLGRYLTISIFATVQATGVTLLTISTIIPSLRPPKCSPGVSTTPCIMADSKQLAVLHT  154

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALYLTALGTGGLKSSVSG G+DQFDDSDK ER +M  FF+WF F I++GSL AVT+LVYI
Sbjct  155   ALYLTALGTGGLKSSVSGFGSDQFDDSDKEERVKMSNFFNWFFFLISIGSLGAVTILVYI  214

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN GR+WGYG+CACAIV  LV+FL GTR+YRFKKLVGSPLTQIAAV  AAWRKR+L+LP
Sbjct  215   QDNWGRQWGYGICACAIVMGLVVFLLGTRKYRFKKLVGSPLTQIAAVIYAAWRKRKLDLP  274

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGV---SEVNKWSISTLTD  1098
             SDP  LY ++D V  +G    KK K+P +K+FRFLD+AAIK+     + VNKW ISTLTD
Sbjct  275   SDPFSLYQIEDAVDGSG---KKKQKLPRTKQFRFLDKAAIKDEEVVGNVVNKWKISTLTD  331

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             +EEVK ++RMLP WATTI+FWTV+AQ+ TFSVSQA+TM+RHM KSFE+PAAS+ VF+V  
Sbjct  332   IEEVKLVLRMLPIWATTIIFWTVYAQMTTFSVSQASTMNRHMGKSFEIPAASLTVFFVAS  391

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR +VPI  R+L NPQGLSPLQR+ VGL LS++ M+AAAL EIKRLKV   +
Sbjct  392   ILLTVPIYDRFIVPIASRILKNPQGLSPLQRVGVGLVLSIIAMIAAALTEIKRLKVVEEN  451

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GLT  P A VP+SVFWLA Q+L+VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST+A
Sbjct  452   GLTYKPTAEVPLSVFWLAPQFLLVGSGEAFTYMGQLDFFLRECPKGMKTMSTGLFLSTLA  511

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFSS+LVTIVGKVT   KPW+ D+LN+GKLYDFYWLLAV+S LNLM FL C++ YVY
Sbjct  512   LGXFFSSLLVTIVGKVTEHGKPWIPDNLNEGKLYDFYWLLAVLSVLNLMVFLVCAKWYVY  571

Query  377   KEKRLAEMGIELEE  336
             KEKRLA+ GIELE+
Sbjct  572   KEKRLADEGIELED  585



>emb|CAC00545.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=594

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/559 (73%), Positives = 471/559 (84%), Gaps = 12/559 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S AMILGVEA ERLTTLGI +NLVTYLT TMHLGNA AAN VTNFLG SFMLTLLGGFVA
Sbjct  34    SGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANNVTNFLGTSFMLTLLGGFVA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRYLTIGIF TVQA GVTILTISTIIPSL+PPKC    S SC+PA+  QL VLY+A
Sbjct  94    DTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSSSCIPANSKQLMVLYIA  153

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG GTDQFDD DK+E+GQM+KFF WF FFINVGSL AVTVLVYIQ
Sbjct  154   LYMTALGTGGLKSSVSGFGTDQFDDGDKKEKGQMIKFFDWFFFFINVGSLGAVTVLVYIQ  213

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGTR+YRFKKLVGSPLTQIA+V VAAW+K  LELPS
Sbjct  214   DNLGREWGYGICACAIVIGLVVFLSGTRKYRFKKLVGSPLTQIASVIVAAWKKTHLELPS  273

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS--------EVNKWSIS  1110
             +  LL+ +D++    G+++ K+ K+PHSKE+RFLD+AAIKE            +NKW ++
Sbjct  274   NSSLLFEIDNIFGE-GNKKSKQ-KLPHSKEYRFLDKAAIKEDNDLESNGTKVVINKWKLA  331

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK LIRMLPTWATTIMFWTV+AQ+ TFSVS+A TMDRH+  +FE+P AS+ VF
Sbjct  332   TLTDVEEVKLLIRMLPTWATTIMFWTVYAQMTTFSVSKATTMDRHIG-TFEIPPASLTVF  390

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T++ YDRI+VPI RR +N P GL+PL RI  GL LS++ M+AAAL E+KRLKV
Sbjct  391   FVGSILLTVIFYDRIIVPICRRFMNKPHGLTPLHRIFTGLVLSILAMIAAALTEVKRLKV  450

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A  HGLT D  AT+P++VFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  451   AHLHGLTNDANATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  510

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST+ALG F SS+LVTIV  VTG K PWLAD+LNQG+LYDFYWLLA++S  NLM FL+ SR
Sbjct  511   STLALGFFVSSILVTIVHVVTGTKNPWLADNLNQGRLYDFYWLLAILSVFNLMFFLYSSR  570

Query  389   GYVYKEKRLAEMGIELEEE  333
              YVYKEKRLAEMGIELE++
Sbjct  571   KYVYKEKRLAEMGIELEDD  589



>ref|XP_002266951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Vitis vinifera]
Length=591

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/556 (73%), Positives = 476/556 (86%), Gaps = 9/556 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  32    SAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASSANTVTNFLGTSFMLCLLGGFVA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF TVQA GVTILTIST IPSL+PPKC+ E+G  C PASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKCAMETGPLCTPASGMQLVVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDS+K ER QM  FF+WF FFI++GSL AVT+LVYIQ
Sbjct  152   LYLTALGTGGLKSSVSGFGSDQFDDSNKEERNQMTNFFNWFFFFISIGSLAAVTILVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+CACAI   LV+FLSGTR+YRFKKLVGSPLTQIA V+VAAW+KR LELP+
Sbjct  212   DNLGRKWGYGICACAIAIGLVVFLSGTRKYRFKKLVGSPLTQIATVFVAAWKKRNLELPT  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEV-NKWSISTL  1104
             D   L+++D   AAA  Q+ KK ++PHSK+FRFLDRAAIK+     G++ V NKW +STL
Sbjct  272   DSSFLFDID--YAAAEGQKKKKQRLPHSKQFRFLDRAAIKDPQMGNGINAVVNKWQLSTL  329

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK ++RMLPTWATTI+FWTV+AQ+ TFSVSQA TMDRH+ KSF++P AS+ VF+V
Sbjct  330   TDVEEVKLVLRMLPTWATTILFWTVYAQMTTFSVSQATTMDRHIGKSFQIPPASLTVFFV  389

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDRI+VPI  R+L NPQGL+PLQRI VGL LS++ M+AAAL E+KRL VAR
Sbjct  390   GAILLTVPVYDRILVPIAARILKNPQGLTPLQRIGVGLVLSILAMVAAALTELKRLHVAR  449

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             SHGLT DP A VP+ VFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  450   SHGLTDDPTAVVPLGVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  509

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG F SS+LV+IV K+TG++KPWLAD+LNQGKLY+FYWLLA++S  NL  +L  ++ Y
Sbjct  510   LSLGFFLSSLLVSIVHKLTGDRKPWLADNLNQGKLYNFYWLLAILSVFNLGFYLIGAKWY  569

Query  383   VYKEKRLAEMGIELEE  336
             VYK+KRLA+ GIELE+
Sbjct  570   VYKDKRLADEGIELED  585



>ref|XP_006366745.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=592

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/556 (68%), Positives = 468/556 (84%), Gaps = 10/556 (2%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILGVEA ERL TLGI +NLV YLT TMHLGNA AAN+VTNF+G S++LTLLGG+VAD
Sbjct  35    AAMILGVEAVERLVTLGIAVNLVVYLTKTMHLGNASAANIVTNFMGTSYILTLLGGYVAD  94

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             TFLGRYLT+GI  TVQA GVTILTISTIIPSLQPPKC+  S SC+PA+G QL VL+ ALY
Sbjct  95    TFLGRYLTVGIGATVQAIGVTILTISTIIPSLQPPKCNLGSPSCIPANGKQLAVLFTALY  154

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             +TALGTG LKSSVSG GTDQFD+SD +E+G+M+KFFSWF F INVG+L AVT+LVYIQD 
Sbjct  155   MTALGTGFLKSSVSGFGTDQFDESDPKEKGRMIKFFSWFFFLINVGALTAVTILVYIQDK  214

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR++GYG+CACAI+  LV FLSGT+RYRFKKLVGSPL Q A+V++AAWRKR ++LP+D 
Sbjct  215   VGRKFGYGICACAILIGLVFFLSGTKRYRFKKLVGSPLAQFASVFIAAWRKRHMKLPADS  274

Query  1259  ELLYNVDDVVAAAGDQEHK-KIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTLT  1101
              +L+N+DD++   GD+  K K K+PHSKEFRFLD+AAIK+  SE      +N W+++TLT
Sbjct  275   TVLFNIDDII---GDENLKDKQKLPHSKEFRFLDKAAIKDSSSEFSGTAILNNWNLATLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK +IRMLPTW T+IMFWTV+AQ+ TFSVSQA TMDRH+ KSFE+P AS+  F+V 
Sbjct  332   DVEEVKLVIRMLPTWGTSIMFWTVYAQMTTFSVSQATTMDRHIGKSFEIPPASLTAFFVA  391

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              ++V I+ YDR++VP+  R LN+P G +PL RIA+GL  S+  M+AAAL EIKRL VA+S
Sbjct  392   SVMVVIIFYDRVIVPLCARYLNSPHGFTPLTRIAIGLVTSIFAMIAAALTEIKRLNVAQS  451

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HGLT +P A +PMSVFWL  Q+L+VG GEA TY+GQLDFFLRECPKGMKTMSTGLF+ST+
Sbjct  452   HGLTNNPNAVIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLRECPKGMKTMSTGLFISTI  511

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG FFSS+LV+IV KVT + +PWLAD+LNQGKL +FYWLLA++S LN++ F +C++ YV
Sbjct  512   SLGFFFSSILVSIVDKVTAKSRPWLADNLNQGKLSNFYWLLAILSVLNVILFFYCAKRYV  571

Query  380   YKEKRLAEMGIELEEE  333
             YKEKRLAE+GI++E+ 
Sbjct  572   YKEKRLAEVGIQMEDS  587



>emb|CDP09929.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/550 (72%), Positives = 471/550 (86%), Gaps = 4/550 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILGVEACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  34    AAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFIA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DT+LGRYLTI IF  VQA GV +LTIST IPSL+PPKC+  S SCV ASG QL VLY AL
Sbjct  94    DTYLGRYLTIAIFAAVQATGVALLTISTTIPSLRPPKCAQGSRSCVQASGNQLLVLYAAL  153

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFDDSD++ER +M+KFF+WF FFI+VGSL AVT+LVYIQD
Sbjct  154   YLTALGTGGLKSSVSGFGSDQFDDSDEKERKKMIKFFNWFFFFISVGSLCAVTILVYIQD  213

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             N+GRRWGYG+CACAIV  L++FL+GTRRYRFKKLVGSPLTQIA+V VAAWRKR L+LPSD
Sbjct  214   NVGRRWGYGICACAIVVGLLVFLAGTRRYRFKKLVGSPLTQIASVIVAAWRKRHLDLPSD  273

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEVNKWSISTLTDVEEVK  1083
               LL+NVDD+     +   KK ++PHSK+FRFLD+AAIK+    +NKW +STLTDVEEVK
Sbjct  274   SSLLFNVDDIPI---EGRKKKQRLPHSKQFRFLDKAAIKDHEMTMNKWCLSTLTDVEEVK  330

Query  1082  QLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTI  903
              +IRMLP WATTIMFW+VHAQ+ TFSVSQA+TM R ++ +FE+P+A+M  F+VG  L+T+
Sbjct  331   LVIRMLPIWATTIMFWSVHAQMTTFSVSQASTMHRKIN-NFEIPSAAMTGFFVGSTLLTV  389

Query  902   MMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTAD  723
             ++YDRI++PI +R+L NP GL+PLQRI +GL LS+VGM+AAA VEIKRL VA+SHGL  +
Sbjct  390   VIYDRIIMPICKRLLKNPYGLTPLQRIGIGLFLSIVGMVAAAAVEIKRLHVAKSHGLANN  449

Query  722   PAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFF  543
             P   VPM+VFWL  Q+ IVG+GEA  YVGQLDFFLRECPKGMKT+STGLFLST++LG FF
Sbjct  450   PVTPVPMTVFWLIPQFAIVGAGEAFIYVGQLDFFLRECPKGMKTISTGLFLSTLSLGFFF  509

Query  542   SSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRL  363
             SSVLVTIV KVTG +KPWLAD+LNQGKL DFYWLL ++SALNLM FL C++ YVYKE+RL
Sbjct  510   SSVLVTIVHKVTGNRKPWLADNLNQGKLNDFYWLLGILSALNLMFFLICAKWYVYKERRL  569

Query  362   AEMGIELEEE  333
             A++GIELEE 
Sbjct  570   ADVGIELEES  579



>emb|CAN71417.1| hypothetical protein VITISV_004658 [Vitis vinifera]
Length=591

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/556 (73%), Positives = 475/556 (85%), Gaps = 9/556 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  32    SAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASSANTVTNFLGTSFMLCLLGGFVA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF TVQA GVTILTIST IPSL+PPKC+ E+G  C PASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKCAMETGPLCTPASGMQLVVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDS+K ER QM  FF+WF FFI++GSL AVT+LVYIQ
Sbjct  152   LYLTALGTGGLKSSVSGFGSDQFDDSNKEERNQMTNFFNWFFFFISIGSLAAVTILVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+CACAI   LV+FLSGTR+YRFKKLVGSPLTQIA V+VAAW+KR LELP+
Sbjct  212   DNLGRKWGYGICACAIAIGLVVFLSGTRKYRFKKLVGSPLTQIATVFVAAWKKRNLELPT  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEV-NKWSISTL  1104
             D   L+++D   AAA  Q+ KK ++PHSK+FRFLDRAAIK+     G++ V NK  +STL
Sbjct  272   DSSFLFDID--YAAAEGQKKKKQRLPHSKQFRFLDRAAIKDPQMGNGINAVVNKXQLSTL  329

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK ++RMLPTWATTI+FWTV+AQ+ TFSVSQA TMDRH+ KSF++P AS+ VF+V
Sbjct  330   TDVEEVKLVLRMLPTWATTILFWTVYAQMTTFSVSQATTMDRHIGKSFQIPPASLTVFFV  389

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDRI+VPI  R+L NPQGL+PLQRI VGL LS++ M+AAAL E+KRL VAR
Sbjct  390   GAILLTVPVYDRILVPIAARILKNPQGLTPLQRIGVGLVLSILAMVAAALTELKRLHVAR  449

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             SHGLT DP A VP+ VFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  450   SHGLTDDPTAVVPLGVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  509

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG F SS+LV+IV K+TG++KPWLAD+LNQGKLY+FYWLLA++S  NL  +L  ++ Y
Sbjct  510   LSLGFFLSSLLVSIVHKLTGDRKPWLADNLNQGKLYNFYWLLAILSVFNLGFYLIGAKWY  569

Query  383   VYKEKRLAEMGIELEE  336
             VYK+KRLA+ GIELE+
Sbjct  570   VYKDKRLADEGIELED  585



>ref|XP_004242006.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=592

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/556 (68%), Positives = 465/556 (84%), Gaps = 10/556 (2%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILGVEA ERL TLGI +NLV YLT TMHLGNA AAN+VTNF+G S++LTLLGG+VAD
Sbjct  35    AAMILGVEAVERLVTLGIAVNLVVYLTKTMHLGNASAANIVTNFMGTSYILTLLGGYVAD  94

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             TFLGRYLT+GI  TVQA GVTILTISTI+PSL+PPKC   S SC+PA G QL VL++ALY
Sbjct  95    TFLGRYLTVGIGATVQAIGVTILTISTIVPSLRPPKCDLGSPSCIPADGKQLAVLFIALY  154

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             +TALGTG LKSSVSG GTDQFD+SD +E+G+M+KFFSWF F INVG+L AVTVLVYIQD 
Sbjct  155   MTALGTGFLKSSVSGFGTDQFDESDPKEKGRMIKFFSWFFFLINVGALTAVTVLVYIQDK  214

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR++GYG+CACAI+  LV FL GT+RYRFKKLVGSPL+Q A+V++AAWRKR + LPSD 
Sbjct  215   VGRKFGYGICACAILVGLVFFLCGTKRYRFKKLVGSPLSQFASVFIAAWRKRHMNLPSDS  274

Query  1259  ELLYNVDDVVAAAGDQEHK-KIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTLT  1101
              +L+N+DD++   GD+  K K K+PHSKEFRFLD+AAIK+  SE      +N W ++TLT
Sbjct  275   SVLFNIDDII---GDENVKDKQKLPHSKEFRFLDKAAIKDCSSEFSGTAILNNWKLATLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK +IRMLPTW T+IMFWTV+AQ+ TFSVSQA TMDRH+ KSFE+P AS+  F+V 
Sbjct  332   DVEEVKLVIRMLPTWGTSIMFWTVYAQMTTFSVSQATTMDRHIGKSFEIPPASLTAFFVA  391

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              +++ I+ YDR++VP+  R +N+P G +PL RIA+GL  S+  M+AAAL EIKRL VA+S
Sbjct  392   SVMLVIIFYDRVIVPLCARYMNSPHGFTPLTRIAIGLVTSIFAMIAAALTEIKRLNVAKS  451

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HGL  +P A +PMSVFWL  Q+L+VG GEA TY+GQLDFFLRECPKGMKTMSTGLF+ST+
Sbjct  452   HGLINNPNAVIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLRECPKGMKTMSTGLFISTI  511

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG FFSS+LV+IV KVT + +PWLAD+LNQGKLY+FYWLLA++S LN++ F +C++ YV
Sbjct  512   SLGFFFSSILVSIVDKVTAKSRPWLADNLNQGKLYNFYWLLAILSVLNVILFFYCAKRYV  571

Query  380   YKEKRLAEMGIELEEE  333
             YKEKRLAE+GI++E+ 
Sbjct  572   YKEKRLAEVGIQMEDS  587



>dbj|BAC56915.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/559 (74%), Positives = 476/559 (85%), Gaps = 12/559 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S AMILGVEA ERLTTLGI +NLVTYLT TMHLGNA AAN VTNFLG SFMLTL GGFVA
Sbjct  34    SGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANNVTNFLGTSFMLTLFGGFVA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRYLTIGIF TVQA GVTILTISTIIPSL+PPKC    S SC+PA+  QL VLY+A
Sbjct  94    DTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSSSCIPANSKQLMVLYIA  153

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG GTDQFDD+DK+E+GQM+KFF WF FFINVGSL AVTVLVYIQ
Sbjct  154   LYMTALGTGGLKSSVSGFGTDQFDDADKKEKGQMIKFFDWFFFFINVGSLGAVTVLVYIQ  213

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGTR+YRFKKLVGSPLTQIA+V VAAW+KR LEL S
Sbjct  214   DNLGREWGYGICACAIVIGLVVFLSGTRKYRFKKLVGSPLTQIASVIVAAWKKRHLELLS  273

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-------GVSEV-NKWSIS  1110
             D  LL+ +DD+    G++++K+ K+PHSKE+RFLD+AAIKE       G + V NKW ++
Sbjct  274   DSSLLFEIDDIFGE-GNKKNKQ-KLPHSKEYRFLDKAAIKEDHDLESNGTNVVINKWKLA  331

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK LIRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  +FE+P AS+ VF
Sbjct  332   TLTDVEEVKLLIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIG-TFEIPPASLTVF  390

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T++ YDR++VPI RR +N P GL+PLQRI  GL LS++ M+AAAL E+KRLKV
Sbjct  391   FVGSILLTVIFYDRVIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKV  450

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A  HGLT D  AT+P+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  451   AHLHGLTNDANATIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  510

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST+ALG FFSS+LVTIV  VTG   PWLAD+LNQG+LYDFYWLLA++S LNLM FL+ SR
Sbjct  511   STLALGFFFSSILVTIVHVVTGTTNPWLADNLNQGRLYDFYWLLAILSVLNLMFFLYFSR  570

Query  389   GYVYKEKRLAEMGIELEEE  333
              YVYKEKRLAEMGIELE++
Sbjct  571   KYVYKEKRLAEMGIELEDD  589



>ref|XP_009763469.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=594

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/559 (74%), Positives = 475/559 (85%), Gaps = 12/559 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S AMILGVEA ERLTTLGI +NLVTYLT TMHLGNA AAN VTNFLG SFMLTL GGFVA
Sbjct  34    SGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANNVTNFLGTSFMLTLFGGFVA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRYLTIGIF TVQA GVTILTISTIIPSL+PPKC    S SC+PA+  QL VLY+A
Sbjct  94    DTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSSSCIPANSKQLMVLYIA  153

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG GTDQFDD+DK+E+GQM+KFF WF FFINVGSL AVTVLVYIQ
Sbjct  154   LYMTALGTGGLKSSVSGFGTDQFDDADKKEKGQMIKFFDWFFFFINVGSLGAVTVLVYIQ  213

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGTR+YRFKKLVGSPLTQIA+V V AW+KR LEL S
Sbjct  214   DNLGREWGYGICACAIVIGLVVFLSGTRKYRFKKLVGSPLTQIASVIVVAWKKRHLELLS  273

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-------GVSEV-NKWSIS  1110
             D  LL+ +DD+    G++++K+ K+PHSKE+RFLD+AAIKE       G + V NKW ++
Sbjct  274   DSSLLFEIDDIFGE-GNKKNKQ-KLPHSKEYRFLDKAAIKEDHDLESNGTNVVINKWKLA  331

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK LIRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  +FE+P AS+ VF
Sbjct  332   TLTDVEEVKLLIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIG-TFEIPPASLTVF  390

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T++ YDR++VPI RR +N P GL+PLQRI  GL LS++ M+AAAL E+KRLKV
Sbjct  391   FVGSILLTVIFYDRVIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKV  450

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A  HGLT D  AT+P+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  451   AHLHGLTNDANATIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  510

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST+ALG FFSS+LVTIV  VTG   PWLAD+LNQG+LYDFYWLLA++S LNLM FL+ SR
Sbjct  511   STLALGFFFSSILVTIVHVVTGTTNPWLADNLNQGRLYDFYWLLAILSVLNLMFFLYFSR  570

Query  389   GYVYKEKRLAEMGIELEEE  333
              YVYKEKRLAEMGIELE++
Sbjct  571   KYVYKEKRLAEMGIELEDD  589



>ref|XP_002529778.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF32592.1| oligopeptide transporter, putative [Ricinus communis]
Length=584

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/550 (71%), Positives = 464/550 (84%), Gaps = 7/550 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S+AMILGVEA ERLTTLGI +NLVTYLT TMHL NA +AN VTNFLG SFMLTLLGGFVA
Sbjct  34    SSAMILGVEAIERLTTLGIAVNLVTYLTGTMHLANATSANTVTNFLGTSFMLTLLGGFVA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTI IF TVQA G+TILTISTIIPSL+PPKC   + +C+PASG QL VLYLAL
Sbjct  94    DTFLGRYLTIAIFATVQAMGITILTISTIIPSLRPPKCHNNT-ACIPASGTQLNVLYLAL  152

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFDD+D++ER QM  FF WF F IN+G+L AVT+LVYIQD
Sbjct  153   YLTALGTGGLKSSVSGFGSDQFDDTDEKERKQMSSFFGWFFFLINIGALCAVTILVYIQD  212

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG+CACAIV  L++FLSGTRRYRFKKLVGSPLTQIA V V AW KR LELPSD
Sbjct  213   NLGREWGYGICACAIVLGLIVFLSGTRRYRFKKLVGSPLTQIATVLVGAWSKRNLELPSD  272

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-GVSEVNKWSISTLTDVEEV  1086
             P  L+++D+    +   + KK K+PHS +FRFLD+AAIK+  V+ V KW++STLTDVEEV
Sbjct  273   PSFLHDIDNFDEGS---KKKKQKLPHSDQFRFLDKAAIKDPKVTVVTKWNLSTLTDVEEV  329

Query  1085  KQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVT  906
             K ++RMLP WATTIMFWTV+AQ+ TFSVSQA T+DRH+  +F++PAAS+ VF+VG IL+T
Sbjct  330   KMVVRMLPIWATTIMFWTVYAQMTTFSVSQATTLDRHIG-NFQIPAASLTVFFVGSILLT  388

Query  905   IMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTA  726
             + +YDRI+VP+ R V     GL+PLQRI VGL  S++ M+AAAL EIKRL+ A SHGLT 
Sbjct  389   VPIYDRIIVPVLRNVFKKSNGLTPLQRIGVGLIFSIIAMIAAALTEIKRLRTAESHGLTH  448

Query  725   DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLF  546
             DP A +P +VFWL  Q+++VGSGEALTYVGQLDFFL+ECPKGMKTMSTGLFLST++LG F
Sbjct  449   DPTAEIPTTVFWLIPQFILVGSGEALTYVGQLDFFLKECPKGMKTMSTGLFLSTLSLGFF  508

Query  545   FSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKR  366
             FSS+LVTIV KVTG   PW+AD++N+GKLYDFYWLLA+++ LNL+ FL C++ YVYK+KR
Sbjct  509   FSSLLVTIVHKVTGN-SPWIADNINEGKLYDFYWLLAILAGLNLVLFLGCAKWYVYKDKR  567

Query  365   LAEMGIELEE  336
             LAE+GIELEE
Sbjct  568   LAEVGIELEE  577



>ref|XP_007039888.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
 gb|EOY24389.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
Length=583

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/551 (73%), Positives = 471/551 (85%), Gaps = 7/551 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACERLTTLGI +NLVTYLT TMHLGNA +A  VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNATSATTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTFLGRYLTIGIF TVQA GVTILTIST+IPSL+PPKCS ++  +C  ASG QL +LYLA
Sbjct  92    DTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKCSMDNPTTCTQASGIQLIILYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDSD  ER QM  FF+WF FFIN+GSL +VT+LVYIQ
Sbjct  152   LYLTALGTGGLKSSVSGFGSDQFDDSDPEERYQMTNFFNWFFFFINIGSLGSVTILVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGTRRYRFKKLVGSPLTQIAAV+VAAW+KR LELPS
Sbjct  212   DNLGREWGYGICACAIVIGLVVFLSGTRRYRFKKLVGSPLTQIAAVFVAAWKKRHLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS-EVNKWSISTLTDVEE  1089
             DP LL+N+DD    A +   KK K+PHSK+FRFLDRAAI++  + E NKW+++TLTDVEE
Sbjct  272   DPSLLFNIDD----AAEGLKKKQKLPHSKQFRFLDRAAIQDSSAPEANKWNLATLTDVEE  327

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VK +IRMLP WATTI+FWTV+AQ+ TFSVSQA TMDRH+   F++P AS+ VF+V  ILV
Sbjct  328   VKLVIRMLPIWATTIIFWTVYAQMTTFSVSQATTMDRHIG-IFQIPPASLTVFFVASILV  386

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
             T+ +YDR++ PI R+VL NPQGL+PLQRI VGL LS++ M+AAA+ EIKRL+VARSHGLT
Sbjct  387   TVPIYDRLIAPIARKVLKNPQGLTPLQRIGVGLVLSIIAMIAAAMTEIKRLRVARSHGLT  446

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
              D A  +P+SVFWL  Q+L VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG 
Sbjct  447   NDRAVEIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGF  506

Query  548   FFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEK  369
             F SS+LVTIV KVTG KKPWL D+LNQG+LYDFYWLLA++S+LNL  +L  ++ YVYK+K
Sbjct  507   FVSSLLVTIVHKVTGNKKPWLPDNLNQGRLYDFYWLLAILSSLNLAIYLVFAKWYVYKDK  566

Query  368   RLAEMGIELEE  336
             RLA+ GIELEE
Sbjct  567   RLADEGIELEE  577



>gb|KHG24776.1| Uncharacterized protein F383_04224 [Gossypium arboreum]
Length=585

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/552 (72%), Positives = 475/552 (86%), Gaps = 5/552 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACERLTTLGI +NLVTYLT+TMHLGNA +A  VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATSATTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTIGIF TVQA GVT+LTISTIIPSL+PPKC+ ++ + C PASG QL VLYLA
Sbjct  92    DTFLGRYLTIGIFATVQATGVTVLTISTIIPSLRPPKCTRDNATICTPASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDSD  E+ QM  FF+WF FFIN+GSL +VT+LVYIQ
Sbjct  152   LYLTALGTGGLKSSVSGFGSDQFDDSDPEEKSQMTNFFNWFFFFINIGSLGSVTILVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGT+RYRFKKLVGSPLTQIA V+VAAW+K+ LE P 
Sbjct  212   DNLGREWGYGICACAIVIGLVVFLSGTKRYRFKKLVGSPLTQIATVFVAAWKKKHLEFPL  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-GVSEVNKWSISTLTDVEE  1089
             DP LL+N+DD  AA G +  KK K+PH+K+FRFLDRAAIK+  ++E NKW+++TLTDVEE
Sbjct  272   DPSLLFNIDD--AAEGLKMKKKQKLPHTKQFRFLDRAAIKDPSLNEANKWNLATLTDVEE  329

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VK ++RMLP WATT++FWTV+AQ+ TFSVSQA TM+RH+ K F++P AS+ VF+VG IL+
Sbjct  330   VKLVLRMLPIWATTVIFWTVYAQMTTFSVSQATTMNRHIGK-FQIPPASLTVFFVGSILL  388

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
             T+ +YDR++VPI R++L NPQGL+PLQRIAVGL LS++ M+AAAL EIKRL+ A ++GL 
Sbjct  389   TVPIYDRLIVPIARKLLKNPQGLTPLQRIAVGLVLSIIAMVAAALTEIKRLRAATTNGLA  448

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
              +P+A +P+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG 
Sbjct  449   NNPSAQIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGF  508

Query  548   FFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEK  369
             F SS+LVTIV KVTG K PWL D+LNQG+LYDFYWLLA++S LNL  +L  ++ YVYK+K
Sbjct  509   FVSSLLVTIVHKVTGNKHPWLPDNLNQGRLYDFYWLLAILSCLNLAIYLVFAKWYVYKDK  568

Query  368   RLAEMGIELEEE  333
             RLA+ GIELEE 
Sbjct  569   RLADEGIELEES  580



>ref|XP_007155635.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
 gb|ESW27629.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
Length=620

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/558 (69%), Positives = 460/558 (82%), Gaps = 13/558 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILGVEA ERLTT+G+ +NLVTYLT TMHLG+A +AN VTNF+G SFML LLGGFVA
Sbjct  60    AAAMILGVEASERLTTMGVAVNLVTYLTGTMHLGSANSANTVTNFMGTSFMLCLLGGFVA  119

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlyla  1626
             DTF+GRYLTI IF TVQA GVTILTISTIIP L PPKC    +  C PAS  QL VLYLA
Sbjct  120   DTFIGRYLTIAIFATVQATGVTILTISTIIPGLHPPKCVRSATRRCEPASNMQLLVLYLA  179

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+T+LG GGLKSSVSG GTDQFD+SDK E+ QM+KFF+WF+FFI++G+L AVTVLVYIQ
Sbjct  180   LYITSLGIGGLKSSVSGFGTDQFDESDKVEKNQMIKFFNWFVFFISLGTLTAVTVLVYIQ  239

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR WGYG+  CAI+ AL++FLSGTRRYRFKKLVGSPLTQIA V VAAWRKR LELPS
Sbjct  240   DHIGRYWGYGISVCAILVALMVFLSGTRRYRFKKLVGSPLTQIAMVLVAAWRKRHLELPS  299

Query  1265  DPELLYNVDDVVAAAGDQEHKKIK--MPHSKEFRFLDRAAIKEGVSEVN------KWSIS  1110
             D  LL+N+DDV     D+  +K K  +PHS++FRFLD+AAIK+  ++        KW +S
Sbjct  300   DASLLFNLDDV----ADETLRKQKQMLPHSRQFRFLDKAAIKDPKTDSQEITMERKWYLS  355

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK + RMLP WATTIMFWT++AQ+ TFSVSQA TMDRH+  SF++PAAS+ VF
Sbjct  356   TLTDVEEVKMVQRMLPVWATTIMFWTIYAQMTTFSVSQATTMDRHIGNSFQIPAASLTVF  415

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR++ PI ++V  NPQGL+PLQRI VGL LS+  M+AAAL EIKRL+V
Sbjct  416   FVASILLTVPIYDRVIAPIAKKVTKNPQGLTPLQRIGVGLVLSIFAMVAAALTEIKRLRV  475

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             AR+HGLT    A VP+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  476   ARAHGLTHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  535

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LG F SS+LVT+V K T   +PWLAD+LN+GKL+ FYWLLAV+S +NL+ +LFC++
Sbjct  536   STLSLGFFLSSMLVTLVHKATRHSEPWLADNLNEGKLHHFYWLLAVLSGVNLVVYLFCAK  595

Query  389   GYVYKEKRLAEMGIELEE  336
             GYVYK+KRLAE GIELEE
Sbjct  596   GYVYKDKRLAEAGIELEE  613



>ref|XP_007039889.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
 gb|EOY24390.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
Length=584

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/552 (73%), Positives = 471/552 (85%), Gaps = 8/552 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACERLTTLGI +NLVTYLT TMHLGNA +A  VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNATSATTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLG-RYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyl  1629
             DTFLG RYLTIGIF TVQA GVTILTIST+IPSL+PPKCS ++  +C  ASG QL +LYL
Sbjct  92    DTFLGSRYLTIGIFATVQATGVTILTISTVIPSLRPPKCSMDNPTTCTQASGIQLIILYL  151

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALYLTALGTGGLKSSVSG G+DQFDDSD  ER QM  FF+WF FFIN+GSL +VT+LVYI
Sbjct  152   ALYLTALGTGGLKSSVSGFGSDQFDDSDPEERYQMTNFFNWFFFFINIGSLGSVTILVYI  211

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDNLGR WGYG+CACAIV  LV+FLSGTRRYRFKKLVGSPLTQIAAV+VAAW+KR LELP
Sbjct  212   QDNLGREWGYGICACAIVIGLVVFLSGTRRYRFKKLVGSPLTQIAAVFVAAWKKRHLELP  271

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS-EVNKWSISTLTDVE  1092
             SDP LL+N+DD    A +   KK K+PHSK+FRFLDRAAI++  + E NKW+++TLTDVE
Sbjct  272   SDPSLLFNIDD----AAEGLKKKQKLPHSKQFRFLDRAAIQDSSAPEANKWNLATLTDVE  327

Query  1091  EVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGIL  912
             EVK +IRMLP WATTI+FWTV+AQ+ TFSVSQA TMDRH+   F++P AS+ VF+V  IL
Sbjct  328   EVKLVIRMLPIWATTIIFWTVYAQMTTFSVSQATTMDRHIG-IFQIPPASLTVFFVASIL  386

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             VT+ +YDR++ PI R+VL NPQGL+PLQRI VGL LS++ M+AAA+ EIKRL+VARSHGL
Sbjct  387   VTVPIYDRLIAPIARKVLKNPQGLTPLQRIGVGLVLSIIAMIAAAMTEIKRLRVARSHGL  446

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
             T D A  +P+SVFWL  Q+L VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG
Sbjct  447   TNDRAVEIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLG  506

Query  551   LFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE  372
              F SS+LVTIV KVTG KKPWL D+LNQG+LYDFYWLLA++S+LNL  +L  ++ YVYK+
Sbjct  507   FFVSSLLVTIVHKVTGNKKPWLPDNLNQGRLYDFYWLLAILSSLNLAIYLVFAKWYVYKD  566

Query  371   KRLAEMGIELEE  336
             KRLA+ GIELEE
Sbjct  567   KRLADEGIELEE  578



>ref|XP_004298652.1| PREDICTED: nitrate transporter 1.1-like [Fragaria vesca subsp. 
vesca]
Length=591

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/551 (72%), Positives = 469/551 (85%), Gaps = 16/551 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  33    SAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFVA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF TVQA GVTILTIST+IPSL+PPKC+  S S C+PASG QL VLYLA
Sbjct  93    DTFLGRYLTIAIFATVQATGVTILTISTVIPSLRPPKCTAGSDSPCIPASGKQLMVLYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDS+K ER QM  FF+WF FFI++GSL AVT+LVYI+
Sbjct  153   LYLTALGTGGLKSSVSGFGSDQFDDSNKVERKQMTNFFNWFFFFISIGSLAAVTILVYIE  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+CACAIV  LV+FLSGTRRYRFKKL GSPLTQIAAV+VAAW+KR ++LPS
Sbjct  213   DNLGRQWGYGICACAIVLGLVVFLSGTRRYRFKKLAGSPLTQIAAVFVAAWKKRNIDLPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE---------VNKWSI  1113
             D  LLYNVDD     G ++ +K K+PHSK+FRFLD+AAIK   S          +NKWS+
Sbjct  273   DLSLLYNVDD-----GQKKMQKQKLPHSKQFRFLDKAAIKIPESARPASSTRMMINKWSL  327

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
             STLTDVEEVK +I MLP WATTI+FWTV+AQ+ TFSVSQA +MDR +  SF++P AS+ V
Sbjct  328   STLTDVEEVKMIIGMLPIWATTILFWTVYAQMTTFSVSQATSMDRKIG-SFQIPPASLTV  386

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+VG IL+T+ +YDR++VP+ R++L NPQGL+PLQRI VGL LS+  M+AAAL E+KRL+
Sbjct  387   FFVGSILLTVPVYDRVIVPVARKLLKNPQGLTPLQRIGVGLVLSIFAMVAAALTELKRLR  446

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
              ARSHGLT +P A +P+SVFWL  Q+ +VGSGEA TY+GQLDFFLRECPKGMKTMSTGLF
Sbjct  447   AARSHGLTDNPTAEIPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLF  506

Query  572   LSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             LST++LG FFSS+LVTIV KVTG++KPWLAD+LNQGKLYDFYWLLA++SALNL+ +L C+
Sbjct  507   LSTLSLGFFFSSLLVTIVHKVTGDRKPWLADNLNQGKLYDFYWLLAILSALNLLIYLACA  566

Query  392   RGYVYKEKRLA  360
             + YVYK+KRLA
Sbjct  567   KWYVYKDKRLA  577



>gb|EYU30304.1| hypothetical protein MIMGU_mgv1a003140mg [Erythranthe guttata]
Length=605

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/557 (71%), Positives = 466/557 (84%), Gaps = 16/557 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE CERLTTLGI +NL+TYLT TMHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  35    SAAMILGVETCERLTTLGIAVNLLTYLTATMHLGNATSANTVTNFLGTSFMLCLLGGFIA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DT+LGRYLTIGIF  VQA GV +LT+STIIP L+PPKC+    SC+PA+G QL VLY AL
Sbjct  95    DTYLGRYLTIGIFAAVQAMGVALLTVSTIIPGLRPPKCAAGGESCIPATGKQLMVLYAAL  154

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSVSG G+DQFD+S+K E+ QM+ FF+WF FFI++G+LLAVTVLVYIQD
Sbjct  155   YITALGTGGLKSSVSGFGSDQFDESEKEEKKQMIAFFNWFFFFISIGALLAVTVLVYIQD  214

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             +LGR WGYG+CACAI+  L++FLSGT+RYRFKKLVGSPLTQIA+V VAAWRKR LE PSD
Sbjct  215   HLGRDWGYGICACAILVGLLIFLSGTKRYRFKKLVGSPLTQIASVVVAAWRKRSLEPPSD  274

Query  1262  PELLYNVDDVVAAAGD---------QEHKKIKMPHSKEFRFLDRAAIKEGVSEV----NK  1122
               LL++VDDVV A             + KK K+PHSKEFRFLDRAAIK+    +    NK
Sbjct  275   SSLLFDVDDVVLAGAGGGGGEEGQVSKKKKQKLPHSKEFRFLDRAAIKDPKVAITTLSNK  334

Query  1121  WSISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAAS  942
             W +STLTDVEEVK +IRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH++ SF++PAAS
Sbjct  335   WQLSTLTDVEEVKLVIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHITASFQIPAAS  394

Query  941   MAVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIK  762
             + VF+V  IL+T+  YDR++VP+FR+VL NPQGL+PLQRI VGL LS++ M+AAAL E+K
Sbjct  395   LTVFFVATILLTVAFYDRLLVPLFRKVLKNPQGLTPLQRIGVGLVLSILAMVAAALTEVK  454

Query  761   RLKVARSHGLTADP---AATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKT  591
             RL VARS+GLT      AA VP+SVFWL  Q+ +VGSGEA TY+GQLDFFLRECPKGMKT
Sbjct  455   RLGVARSYGLTTSSGTAAAVVPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKT  514

Query  590   MSTGLFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLM  411
             MSTGLFLST++LG F SS+LV+IV KVT +KKPWLAD+LNQGKLY+FYWLLA++S LNL+
Sbjct  515   MSTGLFLSTLSLGFFVSSILVSIVHKVTRQKKPWLADNLNQGKLYNFYWLLAILSTLNLV  574

Query  410   AFLFCSRGYVYKEKRLA  360
              FL  ++GYVYKEKRLA
Sbjct  575   VFLAIAKGYVYKEKRLA  591



>gb|KHG27943.1| Uncharacterized protein F383_15837 [Gossypium arboreum]
Length=586

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/551 (73%), Positives = 471/551 (85%), Gaps = 4/551 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EACERLTTLGI +NLVTYLT+TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILGGEACERLTTLGIAVNLVTYLTETMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF TVQA GVTILTISTIIPSL+PPKC+ ++ + C PASG QL +LYLA
Sbjct  92    DTFLGRYLTIAIFATVQATGVTILTISTIIPSLRPPKCTRDNATTCTPASGIQLIILYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SD  E+ QM  FF+WF FFIN+GSL +VTVLVYIQ
Sbjct  152   LYLTALGTGGLKSSVSGFGSDQFDESDPEEKSQMTNFFNWFFFFINIGSLGSVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGT+RYRFKKLVGSPLTQIAAV+V AW+KR LELP 
Sbjct  212   DNLGREWGYGICACAIVIGLVVFLSGTKRYRFKKLVGSPLTQIAAVFVVAWKKRHLELPF  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-GVSEVNKWSISTLTDVEE  1089
             D  LL+ +DD V    + + KK K+PHSK+FRFLDRAAIK+  V E NKW+++TLTDVEE
Sbjct  272   DSSLLFEIDDAVEGL-NNKKKKQKLPHSKQFRFLDRAAIKDPSVPEANKWNLATLTDVEE  330

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VK ++RMLP WATTI+FWTV+AQ+ TFSVSQA TMDRH+  +F++P AS+ VF+VG IL+
Sbjct  331   VKLVVRMLPIWATTIIFWTVYAQMTTFSVSQATTMDRHIG-TFQIPPASLTVFFVGSILL  389

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
             T+ +YD+I+ PI R+VL NPQGL+PLQRI VGL LS++ M+AAAL EIKRL+ A SHGLT
Sbjct  390   TVPIYDKIIAPIARKVLKNPQGLTPLQRIGVGLVLSIIAMIAAALTEIKRLRSASSHGLT  449

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
              DP+A +PMSVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG 
Sbjct  450   NDPSAQIPMSVFWLIPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGF  509

Query  548   FFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEK  369
             F SSVLVTIV KVTG K PWL D+LNQG+LYDFYWLLA++S LNL+ +L  +R YVYK+K
Sbjct  510   FVSSVLVTIVHKVTGTKHPWLPDNLNQGRLYDFYWLLAILSCLNLVIYLVFARWYVYKDK  569

Query  368   RLAEMGIELEE  336
             RLA+ GIELEE
Sbjct  570   RLADEGIELEE  580



>ref|XP_002303512.2| nitrate transporter family protein [Populus trichocarpa]
 gb|EEE78491.2| nitrate transporter family protein [Populus trichocarpa]
Length=583

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/550 (72%), Positives = 468/550 (85%), Gaps = 6/550 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILGGEAMERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTI IF TVQA GVTILTIST++PSL+PPKC  ++  C+PA+G QL VLYLAL
Sbjct  92    DTFLGRYLTIAIFATVQATGVTILTISTVVPSLRPPKCV-DNTDCIPANGEQLTVLYLAL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFDD+D +ER QM+ FF+WF F I++G+L AVTVLVYIQD
Sbjct  151   YLTALGTGGLKSSVSGFGSDQFDDTDPKERKQMLNFFNWFFFLISLGALCAVTVLVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG+CACAIV  L++FLSGTRRYRF+KLVGSPLTQIA V+V+AWRKR +ELPSD
Sbjct  211   NLGREWGYGICACAIVLGLIVFLSGTRRYRFRKLVGSPLTQIATVFVSAWRKRHMELPSD  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-GVSEVNKWSISTLTDVEEV  1086
               LLYNVDDV    G +E KK K+PH+K+FRFLD+AAIK   V +VNKW+++ LTDVEEV
Sbjct  271   VSLLYNVDDV--EEGSKE-KKQKLPHTKQFRFLDKAAIKGLEVGKVNKWNLANLTDVEEV  327

Query  1085  KQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVT  906
             K +IRMLP WATT++FWTV+AQ+ TFSVSQA TMDR + KSF++PAAS+ VF+VG IL+T
Sbjct  328   KMVIRMLPIWATTVIFWTVYAQMTTFSVSQATTMDRRIGKSFQIPAASLTVFFVGSILLT  387

Query  905   IMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTA  726
             + +YDRI+VP+ RRVL +PQGL+PL+RI VGL LS+V M+AAAL E KRL+ AR HGL  
Sbjct  388   VPVYDRIIVPVARRVLKHPQGLTPLRRIGVGLVLSIVAMIAAALTEKKRLRAARLHGLAN  447

Query  725   DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLF  546
             DP A +P+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F
Sbjct  448   DPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFF  507

Query  545   FSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKR  366
              SS LVTIV KVT   KPWLAD+LNQG+L+DFYWLLA++SALN + +L C+R YVYK+KR
Sbjct  508   VSSSLVTIVHKVT-INKPWLADNLNQGRLHDFYWLLAILSALNFVIYLICARWYVYKDKR  566

Query  365   LAEMGIELEE  336
             LA+ GIEL+E
Sbjct  567   LADEGIELDE  576



>ref|XP_008367434.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Malus domestica]
Length=598

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/559 (71%), Positives = 464/559 (83%), Gaps = 13/559 (2%)
 Frame = -3

Query  1982  SAAMILGV---EACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGG  1812
             +AAMILG+   EACERLTTLGI +NLVTYLT T HLG+A AAN VTNFLG SFML LLGG
Sbjct  37    AAAMILGITSGEACERLTTLGIAVNLVTYLTGTTHLGSATAANTVTNFLGTSFMLCLLGG  96

Query  1811  FVADTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvl  1635
             FVADTFLGRYLTI IF T+QA GVTILTIST +PSLQPPKC+  +GS C+PASG QL +L
Sbjct  97    FVADTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQPPKCTAGTGSQCLPASGKQLTIL  156

Query  1634  ylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLV  1455
             Y ALYLTALGTGGLKSSVSG G+DQFD+SDK+ER  M  FF+WF FFI++GSL AVTVLV
Sbjct  157   YTALYLTALGTGGLKSSVSGFGSDQFDESDKQERKXMTNFFNWF-FFISIGSLAAVTVLV  215

Query  1454  YIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLE  1275
             YIQDNLGR+WGYG+C CAIV  L++FLSGTRRYRF KLVGSPLTQIA V V  W+KR +E
Sbjct  216   YIQDNLGRQWGYGICVCAIVLGLIVFLSGTRRYRFXKLVGSPLTQIAVVXVNTWKKRNME  275

Query  1274  LPSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEV-NKWSI  1113
             LP D  LLYNV D+    G  E KK  +PHSK+FRFLD+AAIKE     G + + NKWS+
Sbjct  276   LPLDLTLLYNVGDI--DDGLTEKKKQMLPHSKQFRFLDKAAIKEPKIEGGKTTIGNKWSL  333

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
             +TLTDVEEVK +IRMLP WATTI+FWTV+AQ+ TFSVSQA +MDRH+ KSF++P AS+  
Sbjct  334   TTLTDVEEVKLIIRMLPIWATTIIFWTVYAQMTTFSVSQATSMDRHIGKSFQIPPASLTA  393

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+VG IL+T+ +YDRI+VP+ R+VLNNPQGL+PLQRI VGL  S+  M+AAAL E+KRL 
Sbjct  394   FFVGSILLTVPVYDRIIVPVARKVLNNPQGLTPLQRIGVGLVFSIFAMVAAALTEVKRLN  453

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
              ARSHGLT +P A +P+SVFWL  Q+  VG+GEA TY+GQLDFFLRECPKGMKTMSTGLF
Sbjct  454   AARSHGLTGNPTAEIPLSVFWLVPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLF  513

Query  572   LSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             LST++LG F SS+LV+IV KVTG  +PW AD+LNQGKLYDFYWLLA++SALNL+ +LFC+
Sbjct  514   LSTLSLGFFVSSLLVSIVHKVTGGHEPWPADNLNQGKLYDFYWLLALLSALNLVVYLFCA  573

Query  392   RGYVYKEKRLAEMGIELEE  336
               YVYK+KR A+ GIELEE
Sbjct  574   NWYVYKDKRFADEGIELEE  592



>ref|XP_011033950.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Populus euphratica]
Length=583

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/551 (71%), Positives = 467/551 (85%), Gaps = 8/551 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAM+LG EA ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMVLGGEAMERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTI IF TVQA GVTILTIST++PSL+PPKC   +G C+PA+G QL VLYLAL
Sbjct  92    DTFLGRYLTIAIFATVQATGVTILTISTVVPSLRPPKCVDSTG-CIPANGEQLTVLYLAL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD++D +ER QM+ FF+WF F IN+G+L AVTVLVYIQD
Sbjct  151   YLTALGTGGLKSSVSGFGSDQFDEADPKERKQMLNFFNWFFFLINIGALCAVTVLVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG+CACAIV  L++FLSGTRRYRF+KL GSPLTQIA V+V+AWRKR +ELPSD
Sbjct  211   NLGREWGYGICACAIVLGLIVFLSGTRRYRFRKLAGSPLTQIATVFVSAWRKRHMELPSD  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK--EGVSEVNKWSISTLTDVEE  1089
               LLYN+DDV   + D   KK K+PH+K+FRFLD+AAI+  EG  +VNKW+++TLTDVEE
Sbjct  271   VSLLYNIDDVEEGSKD---KKQKLPHTKQFRFLDKAAIRGLEG-GKVNKWNLATLTDVEE  326

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VK +IRM+P WATT++FWTV+AQ+ TFSVSQA TMDR + KSF++PAAS+ VF+VG IL+
Sbjct  327   VKMVIRMMPIWATTVIFWTVYAQMTTFSVSQATTMDRRIGKSFQIPAASLTVFFVGSILL  386

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
             T+ +YDRI+VP+ RRVL +PQGL+PL+RI VGL LS+VGM+AAAL E KR +VAR HGL 
Sbjct  387   TVPVYDRIIVPVARRVLKHPQGLTPLRRIGVGLVLSIVGMIAAALTEKKRRRVARLHGLA  446

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
              DP A +P++VFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG 
Sbjct  447   TDPTAEIPLTVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGF  506

Query  548   FFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEK  369
             F SS LVTIV KVT   KPWLAD+LNQG+L+DFYWL+A++SALN + +L C+R YVYK+K
Sbjct  507   FVSSSLVTIVHKVT-RNKPWLADNLNQGRLHDFYWLVAILSALNFVIYLICARWYVYKDK  565

Query  368   RLAEMGIELEE  336
              LA  GIEL+E
Sbjct  566   MLAAEGIELDE  576



>ref|XP_006440344.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53584.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=591

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/549 (72%), Positives = 462/549 (84%), Gaps = 12/549 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EACERLTTLGI +NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  33    SAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNASAANTVTNFLGTSFMLCLLGGFIA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-SCVPASggqlgvlyla  1626
             DTFLGRYLTI IF TVQAAGVTILTISTIIPSL+PPKC+   G SC+ ASG QL VLY+A
Sbjct  93    DTFLGRYLTIAIFATVQAAGVTILTISTIIPSLRPPKCNLNHGQSCIQASGMQLVVLYIA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDSD +ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  153   LYLTALGTGGLKSSVSGFGSDQFDDSDPQERNQMTNFFNWFFFFISIGSLAAVTVLVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGTRRYRFKKLVGSPLTQIA+V+VAAWRKR L+LPS
Sbjct  213   DNLGREWGYGICACAIVFGLVVFLSGTRRYRFKKLVGSPLTQIASVFVAAWRKRHLDLPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSIST  1107
             DP + +N+DD+     + +  K ++PH+K+FRFLD+AAI             +NKW+++T
Sbjct  273   DPSMFFNIDDIPV---EGKKTKQRLPHTKQFRFLDKAAIFKDSDMSNSTTVVINKWNLAT  329

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             LTDVEEVK +IRMLP WATTI+FWTV+AQ+ TFSVSQA TM+RH+  SFE+P AS+  F+
Sbjct  330   LTDVEEVKMVIRMLPIWATTIIFWTVYAQMTTFSVSQATTMNRHIG-SFEIPGASLTFFF  388

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+T+ +YDRI+VPI R+V   PQGL+PLQRI VGL LS+  M+AAAL EIKRL+ A
Sbjct  389   VGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAA  448

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             RSHGLT DP A +P+SVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  449   RSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  566   TVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             T++LG F SS+LV++V KVTG+KKPWLAD+LNQG+LYDFYWLLA++SALN + +L  +R 
Sbjct  509   TLSLGFFVSSLLVSLVHKVTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAFARW  568

Query  386   YVYKEKRLA  360
             YVYK+KRLA
Sbjct  569   YVYKDKRLA  577



>ref|XP_010676154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/562 (69%), Positives = 471/562 (84%), Gaps = 9/562 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EACERLTTLGI +NLVTYLT  MHLGNA +AN VTNF+G SFML LLGGF+A
Sbjct  42    SAAMILGGEACERLTTLGIAVNLVTYLTGVMHLGNAASANTVTNFMGTSFMLCLLGGFIA  101

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTI IF TVQA GVT+LTISTIIPSL+PP C PE GSC PAS  QLGVLYLAL
Sbjct  102   DTFLGRYLTIAIFATVQALGVTVLTISTIIPSLRPPACKPEFGSCTPASDTQLGVLYLAL  161

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGG+K+SVSG GTDQFD+++K E+GQM+KFF+WF FFI++GSL AVTVLVYIQD
Sbjct  162   YLTALGTGGVKASVSGFGTDQFDETNKGEKGQMIKFFNWFFFFISLGSLAAVTVLVYIQD  221

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             N+GR+WGYG+CACAI+ ALV+FL GTRRYRFKKLVGSPLTQIAAV+VAAWRKR +ELPSD
Sbjct  222   NMGRQWGYGICACAIMLALVVFLCGTRRYRFKKLVGSPLTQIAAVFVAAWRKRHMELPSD  281

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEG-----VSEVNKWSISTLTD  1098
               LL+N+DD+   A   +HKK ++PHSKE+RFLD+AAIK+      V++VNKW + T TD
Sbjct  282   SSLLFNIDDL---ADGGKHKKQRLPHSKEYRFLDKAAIKDPQMPIVVTKVNKWYLLTSTD  338

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK +IRMLP WATTI+FWT++AQ+ TFSVSQA TMDRH+ KSF++PAAS+ VF+VG 
Sbjct  339   VEEVKLVIRMLPIWATTIIFWTIYAQMSTFSVSQATTMDRHIGKSFQIPAASLTVFFVGS  398

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR++VPI  R+L+N QGL+PLQRIAVGL  S++ M++AALVEI+RLKVA+  
Sbjct  399   ILITVPIYDRVVVPIASRLLHNRQGLTPLQRIAVGLVFSIISMVSAALVEIRRLKVAKDA  458

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GL  +P   VP+SVFWL  Q+  VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL+T++
Sbjct  459   GLVNNPYEVVPISVFWLIPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLTTLS  518

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG F SS LVT+V  +TG+K PW+AD+LNQG+L  FYWLLA +S +N + +L  ++ Y+Y
Sbjct  519   LGFFVSSALVTVVHNITGDKHPWIADNLNQGRLDYFYWLLAGLSVVNFLVYLVFAKWYIY  578

Query  377   KEKRLAEMGIELEEETHIPGGH  312
             KE RLAE G E+EE+   P  H
Sbjct  579   KETRLAEEGYEVEEDDG-PACH  599



>gb|KDO61483.1| hypothetical protein CISIN_1g007736mg [Citrus sinensis]
Length=591

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/549 (71%), Positives = 461/549 (84%), Gaps = 12/549 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EACERLTTLGI +NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  33    SAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNASAANTVTNFLGTSFMLCLLGGFIA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-SCVPASggqlgvlyla  1626
             DTFLGRYLTI IF TVQAAGVTILTISTIIPSL+PPKC+   G SC+ ASG QL VLY+A
Sbjct  93    DTFLGRYLTIAIFATVQAAGVTILTISTIIPSLRPPKCNLNHGQSCIQASGMQLVVLYIA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDSD +ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  153   LYLTALGTGGLKSSVSGFGSDQFDDSDPQERNQMTNFFNWFFFFISIGSLAAVTVLVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGTRRYRFKKLVGSPLTQIA+V+V AWRKR L+LPS
Sbjct  213   DNLGREWGYGICACAIVFGLVVFLSGTRRYRFKKLVGSPLTQIASVFVVAWRKRHLDLPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSIST  1107
             DP + +N+DD+     + +  K ++PH+K+FRFLD+AAI             +NKW+++T
Sbjct  273   DPSMFFNIDDIPV---EGKKTKQRLPHTKQFRFLDKAAIFKDSDMSNSTTVVINKWNLAT  329

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             LTDVEEVK +IRMLP WATTI+FWTV+AQ+ TFSVSQA TM+RH+  SFE+P AS+  F+
Sbjct  330   LTDVEEVKMVIRMLPIWATTIIFWTVYAQMTTFSVSQATTMNRHIG-SFEIPGASLTFFF  388

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+T+ +YDRI+VPI R+V   PQGL+PLQRI VGL LS+  M+AAAL EIKRL+ A
Sbjct  389   VGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAA  448

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             RSHGLT DP A +P+SVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  449   RSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  566   TVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             T++LG F SS+LV++V KVTG+KKPWLAD+LNQG+LYDFYWLLA++SALN + +L  +R 
Sbjct  509   TLSLGFFVSSLLVSLVHKVTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAFARW  568

Query  386   YVYKEKRLA  360
             YVYK+KRLA
Sbjct  569   YVYKDKRLA  577



>ref|XP_006477230.1| PREDICTED: nitrate transporter 1.1-like [Citrus sinensis]
Length=591

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/549 (71%), Positives = 460/549 (84%), Gaps = 12/549 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EACERLTTLGI +N+VTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  33    SAAMILGGEACERLTTLGIAVNMVTYLTGTMHLGNASAANTVTNFLGTSFMLCLLGGFIA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-SCVPASggqlgvlyla  1626
             DTFLGRYLTI IF TVQAAGVTILTISTIIPSL+PPKC+   G SC+ ASG QL VLY+A
Sbjct  93    DTFLGRYLTIAIFATVQAAGVTILTISTIIPSLRPPKCNLNHGQSCIQASGMQLVVLYIA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDSD +ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  153   LYLTALGTGGLKSSVSGFGSDQFDDSDPQERNQMTNFFNWFFFFISIGSLAAVTVLVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAIV  LV+FLSGTRRYRFKKLVGSPLTQIA+V+V AWRKR L+LPS
Sbjct  213   DNLGREWGYGICACAIVFGLVVFLSGTRRYRFKKLVGSPLTQIASVFVVAWRKRHLDLPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSIST  1107
             DP + +N+DD+     + +  K ++PH+K+FRFLD+AAI             +NKW+++T
Sbjct  273   DPSMFFNIDDIPV---EGKKTKQRLPHTKQFRFLDKAAIFKDSDMSNSTTVVINKWNLAT  329

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             LTDVEEVK +IRMLP WATTI+FWTV+AQ+ TFSVSQA TM+RH+  SFE+P AS+  F+
Sbjct  330   LTDVEEVKMVIRMLPIWATTIIFWTVYAQMTTFSVSQATTMNRHIG-SFEIPGASLTFFF  388

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+T+ +YDRI+VPI R+V   PQGL+PLQRI VGL LS+  M+AAAL EIKRL+ A
Sbjct  389   VGSILLTVPVYDRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAA  448

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             RSHGLT DP A +P+SVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  449   RSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  508

Query  566   TVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             T++LG F SS+LV++V KVTG KKPWLAD+LNQG+LYDFYWLLA++SALN + +L  +R 
Sbjct  509   TLSLGFFVSSLLVSLVHKVTGVKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAFARW  568

Query  386   YVYKEKRLA  360
             YVYK+KRLA
Sbjct  569   YVYKDKRLA  577



>gb|KDP25643.1| hypothetical protein JCGZ_20799 [Jatropha curcas]
Length=583

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/550 (70%), Positives = 458/550 (83%), Gaps = 6/550 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILG EA ERLTTLGI +NLVTY+TDTMHLGNA AAN  TNFLG +FML LLGGFVA
Sbjct  32    SAAMILGGEAVERLTTLGIVVNLVTYMTDTMHLGNATAANTTTNFLGTTFMLCLLGGFVA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTI IF TVQA G+TILTIST +PSL+PPKC   +G C+PASG QL +LYLAL
Sbjct  92    DTFLGRYLTIAIFATVQAMGITILTISTALPSLRPPKCENNTG-CIPASGKQLTILYLAL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+ ALGTGG+KSSVSG  +DQFD++D  ER +M +FF WF F IN+GSL AVTVLVY+QD
Sbjct  151   YMYALGTGGIKSSVSGFASDQFDETDVNERKKMNRFFHWFFFLINLGSLGAVTVLVYVQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             N+GR+WGYG+C CAIV  L+LFLSGTRRYRFKKLVGSPLTQIAAV+V AW+KR LELPSD
Sbjct  211   NVGRKWGYGICGCAIVLGLILFLSGTRRYRFKKLVGSPLTQIAAVFVCAWKKRNLELPSD  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-NKWSISTLTDVEEV  1086
             P  L+NV+D+      ++ KK K+PHSK+FRFLDRAAIK   S V NKW++STLTDVEEV
Sbjct  271   PSFLHNVEDIEEG---KKSKKQKLPHSKQFRFLDRAAIKNQESTVVNKWNLSTLTDVEEV  327

Query  1085  KQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVT  906
             K ++RMLP WAT IMFWTV+AQ+ TFSVSQA TMDRH+ KSFE+PAAS+  F+V  ILVT
Sbjct  328   KMVVRMLPIWATCIMFWTVYAQMTTFSVSQATTMDRHIGKSFEIPAASLTFFFVISILVT  387

Query  905   IMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTA  726
             + +YDRI++PI + +     GL+PLQRI VGL  S++ M+AAAL E+KRL+ ARS+GL+ 
Sbjct  388   VPIYDRIILPIAKNIFKKKNGLTPLQRIGVGLVFSIIAMVAAALTELKRLRAARSNGLSN  447

Query  725   DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLF  546
             D  A +P+SVFWL  Q+L+VG+GEA+TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F
Sbjct  448   DATAQIPLSVFWLIPQFLLVGAGEAVTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFF  507

Query  545   FSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKR  366
              SS+LVTIV KVT   KPWLAD+LNQG+LYDFYWLLA++SALN + F   S+ YVYK+KR
Sbjct  508   VSSILVTIVHKVT-RNKPWLADNLNQGRLYDFYWLLAILSALNFVIFFASSKWYVYKDKR  566

Query  365   LAEMGIELEE  336
             L E+GIE+EE
Sbjct  567   LGEVGIEMEE  576



>gb|KHG00259.1| Uncharacterized protein F383_18798 [Gossypium arboreum]
Length=585

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/552 (71%), Positives = 466/552 (84%), Gaps = 7/552 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACERLTTLGI +N+VTYLT TMHLGNA +A  VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILGVEACERLTTLGIAVNMVTYLTGTMHLGNATSATTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTFLGRYLTI +F  VQA GVTILTIST+IPSL+PPKCS +S  +C PASG QL VLYLA
Sbjct  92    DTFLGRYLTIVLFAAVQATGVTILTISTVIPSLRPPKCSRDSVTTCTPASGIQLVVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDSD  ER QM  FF+WF FFIN+GSL +VT+LVYIQ
Sbjct  152   LYLTALGTGGLKSSVSGFGSDQFDDSDPEERSQMTNFFNWFFFFINIGSLGSVTILVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR WGYG+CACAI+  LV+FLSGT+RYRFKKLVGSPLTQIAAV+VAAW+KR LELPS
Sbjct  212   DNLGREWGYGICACAILMGLVVFLSGTKRYRFKKLVGSPLTQIAAVFVAAWKKRHLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI--KEGVSEVNKWSISTLTDVE  1092
             D  LL+N+DDV    G  + KK K+PHSK+FRFLDRAAI  + G+ E NKWS++TLTDVE
Sbjct  272   DSSLLFNIDDVTE--GSMKKKKQKLPHSKQFRFLDRAAIMNQPGL-EANKWSLATLTDVE  328

Query  1091  EVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGIL  912
             EVK ++RMLP WATT++FWTV+AQ+ TFSVSQA TMDRH+ K F++P AS+ VF+V  IL
Sbjct  329   EVKMVLRMLPIWATTVIFWTVYAQMTTFSVSQATTMDRHIGK-FQIPPASLTVFFVAAIL  387

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             +T+ +YD+++ PI ++VLNNPQGL+PLQRI VGL LS++ M+AAAL EIKRL+ A S GL
Sbjct  388   LTVPVYDKLIAPIAKKVLNNPQGLTPLQRIGVGLVLSIIAMIAAALTEIKRLRTASSRGL  447

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
             T +P A +P+SVFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMK MSTGLFLST++LG
Sbjct  448   TNNPMAKIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKAMSTGLFLSTLSLG  507

Query  551   LFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE  372
              F SS+LVT+V KVTG  KPWL ++LNQG+LY+FYWLL ++S  NL  +L  ++ Y+YK+
Sbjct  508   FFVSSLLVTVVHKVTGNNKPWLPNNLNQGRLYNFYWLLTILSCFNLGIYLVFAKWYMYKD  567

Query  371   KRLAEMGIELEE  336
             KRLA+ GIELEE
Sbjct  568   KRLADEGIELEE  579



>ref|XP_004516839.1| PREDICTED: nitrate transporter 1.1-like [Cicer arietinum]
Length=592

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/559 (68%), Positives = 460/559 (82%), Gaps = 14/559 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S+AMILGVEACERLTT+GI +NLVTYLT TMHLGNA +AN+VTNF+G  FML LLGGFVA
Sbjct  33    SSAMILGVEACERLTTMGIAVNLVTYLTGTMHLGNASSANIVTNFMGTCFMLCLLGGFVA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTF+GRYLTI IF TV+A GVT+LTISTIIPSL PPKC+  S   C  A+  QL VLY+A
Sbjct  93    DTFIGRYLTIAIFATVEAIGVTMLTISTIIPSLHPPKCTQNSVKHCEAANNIQLTVLYIA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALG GGLKSSVSG G+DQFDDS++ ER QMVKFF+WF FFI++GSL AVT+LVYIQ
Sbjct  153   LYVTALGIGGLKSSVSGFGSDQFDDSNEGERKQMVKFFNWFFFFISIGSLTAVTILVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR WGYG+C CAIV AL +FL GT+RYRFKKLVGSPLTQIA V+VAAWRKR+LELP 
Sbjct  213   DHVGRDWGYGICVCAIVVALFVFLWGTQRYRFKKLVGSPLTQIAVVFVAAWRKRKLELPF  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK----EGVSEVN----KWSIS  1110
             D  LL+NVDD +     Q      +PH+K+FRFLD+AAIK    +   E+N    KW +S
Sbjct  273   DSSLLFNVDDQILNKNKQ-----MLPHTKQFRFLDKAAIKGPKRDNGDEMNNVERKWYLS  327

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA T++RH+ KSF++P AS+  F
Sbjct  328   TLTDVEEVKLVIRMLPIWATTIMFWTVYAQMTTFSVSQAKTLNRHIGKSFKIPPASLTAF  387

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             ++G IL+TI +YDRI+VPI R++ NNPQGL+PLQRI VGL  S+  M+AAAL E+KR++V
Sbjct  388   FIGSILLTIPIYDRIIVPITRKIFNNPQGLTPLQRIGVGLVFSIFAMVAAALTELKRMRV  447

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
                H LT +P + +PMSVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  448   THLHNLTHNPNSEIPMSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  507

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LG FFSS+LVT+V +VTG  KPWLAD+LNQGKLYDFYWLLA++S  NL+ +LFC++
Sbjct  508   STLSLGFFFSSLLVTVVHRVTGHHKPWLADNLNQGKLYDFYWLLALLSGFNLVIYLFCAK  567

Query  389   GYVYKEKRLAEMGIELEEE  333
              YVYK+KRLA+ GIELE+ 
Sbjct  568   WYVYKDKRLADEGIELEDS  586



>dbj|BAD22820.1| nitrate transporter [Prunus persica]
Length=594

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/548 (72%), Positives = 464/548 (85%), Gaps = 9/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  36    AAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFVA  95

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF T QA GVTILTIST IPSL+PPKC+ ++ + C+PASG QL VLY+A
Sbjct  96    DTFLGRYLTIAIFATFQAMGVTILTISTTIPSLRPPKCTSDTSTPCIPASGKQLMVLYIA  155

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SDK+ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  156   LYLTALGTGGLKSSVSGFGSDQFDESDKQERRQMTNFFNWFFFFISIGSLAAVTVLVYIQ  215

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+C CAIV  L++FLSGTRRYRFKKLVGSPLTQI+ V VAAWRKR +ELPS
Sbjct  216   DNLGRQWGYGICVCAIVLGLIVFLSGTRRYRFKKLVGSPLTQISGVCVAAWRKRNMELPS  275

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTL  1104
             D   LYNVDD+    G ++ KK K+PHSK+FRFLD+AAIKE  +       +NKWS+STL
Sbjct  276   DMSFLYNVDDI--DDGLKKKKKQKLPHSKQFRFLDKAAIKEPKTTSGTAMIINKWSLSTL  333

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA +MDRH+ KSF++P AS+  F+V
Sbjct  334   TDVEEVKLIIRMLPIWATTIMFWTVYAQMTTFSVSQATSMDRHIGKSFQIPPASLTAFFV  393

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDR++VP+ R+ L NPQGL+PLQR+ VGL  S+  M+AAAL E+KRL +AR
Sbjct  394   GSILLTVPVYDRLIVPMARKALENPQGLTPLQRMGVGLVFSIFAMVAAALTEVKRLNIAR  453

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             SHGLT +P A +P+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  454   SHGLTDNPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  513

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG FFSS+LVTIV K TG  KPWLAD+LNQGKLYDFYWLLA++SALNL+ +LFC+  Y
Sbjct  514   LSLGFFFSSLLVTIVHKTTGHNKPWLADNLNQGKLYDFYWLLALLSALNLVIYLFCANWY  573

Query  383   VYKEKRLA  360
             VYK+KRLA
Sbjct  574   VYKDKRLA  581



>dbj|BAC81420.1| nitrate transporter [Prunus persica]
Length=596

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/548 (72%), Positives = 464/548 (85%), Gaps = 9/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  36    AAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFVA  95

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF T QA GVTILTIST IPSL+PPKC+ ++ + C+PASG QL VLY+A
Sbjct  96    DTFLGRYLTIAIFATFQAMGVTILTISTTIPSLRPPKCTSDTSTPCIPASGKQLMVLYIA  155

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SDK+ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  156   LYLTALGTGGLKSSVSGFGSDQFDESDKQERRQMTNFFNWFFFFISIGSLAAVTVLVYIQ  215

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+C CAIV  L++FLSGTRRYRFKKLVGSPLTQI+ V VAAWRKR +ELPS
Sbjct  216   DNLGRQWGYGICVCAIVLGLIVFLSGTRRYRFKKLVGSPLTQISGVCVAAWRKRNMELPS  275

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTL  1104
             D   LYNVDD+    G ++ KK K+PHSK+FRFLD+AAIKE  +       +NKWS+STL
Sbjct  276   DMSFLYNVDDI--DDGLKKKKKQKLPHSKQFRFLDKAAIKEPKTTSGTAMIINKWSLSTL  333

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA +MDRH+ KSF++P AS+  F+V
Sbjct  334   TDVEEVKLIIRMLPIWATTIMFWTVYAQMTTFSVSQATSMDRHIGKSFQIPPASLTAFFV  393

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDR++VP+ R+ L NPQGL+PLQR+ VGL  S+  M+AAAL E+KRL +AR
Sbjct  394   GSILLTVPVYDRLIVPMARKALENPQGLTPLQRMGVGLVFSIFAMVAAALTEVKRLNIAR  453

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             SHGLT +P A +P+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  454   SHGLTDNPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  513

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG FFSS+LVTIV K TG  KPWLAD+LNQGKLYDFYWLLA++SALNL+ +LFC+  Y
Sbjct  514   LSLGFFFSSLLVTIVHKTTGHNKPWLADNLNQGKLYDFYWLLALLSALNLVIYLFCANWY  573

Query  383   VYKEKRLA  360
             VYK+KRLA
Sbjct  574   VYKDKRLA  581



>ref|NP_001275529.1| nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004163647.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|ADQ74763.1| nitrate transporter 1.1 [Cucumis sativus]
 gb|KGN55889.1| hypothetical protein Csa_3G027720 [Cucumis sativus]
Length=593

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/547 (70%), Positives = 457/547 (84%), Gaps = 8/547 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EA ERLTTLGI +NLVTY+T TMHLGNA +AN+VTNFLG SFML LLGGF+A
Sbjct  34    AAAMILGGEAVERLTTLGIAVNLVTYMTGTMHLGNAVSANIVTNFLGTSFMLCLLGGFIA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GVTILTISTIIPSL+PP+C+ ES S C PA+  QL +LY+A
Sbjct  94    DTFLGRYLTIAIFAAIQATGVTILTISTIIPSLRPPRCTVESSSHCAPATDFQLTILYIA  153

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY TALGTGGLKSSVSG G+DQFD+SDK ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  154   LYTTALGTGGLKSSVSGFGSDQFDESDKEERAQMTAFFNWFFFFISIGSLAAVTVLVYIQ  213

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+CACAIV  LV+F+SGT++YRFKKLVGSPLTQIA V VAAWRKR ++LP+
Sbjct  214   DNLGRQWGYGICACAIVAGLVVFVSGTKKYRFKKLVGSPLTQIATVIVAAWRKRHMDLPT  273

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEVNKWSISTLT  1101
             D   L ++DD      + + KK K+P SK+FRFLD+AAI+E      ++ +NKW+ISTLT
Sbjct  274   DSSFLLDIDDFEDERKNGKMKKQKLPRSKQFRFLDKAAIREPEKGADIALMNKWNISTLT  333

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK +IRMLP WAT IMFWTV+AQ+ TFSVSQA TMDRH+ KSFE+PAAS+ VF+VG
Sbjct  334   DVEEVKMVIRMLPIWATNIMFWTVYAQMTTFSVSQATTMDRHIGKSFEIPAASLTVFFVG  393

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDR++VPI R++L NPQGL+PLQRI VGL LS+  M+AAAL E+KRL+VA S
Sbjct  394   SILLTVPIYDRLIVPIARKILKNPQGLTPLQRIGVGLVLSIFAMVAAALAELKRLRVATS  453

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             H +  +    +P+SVFWL  Q+ +VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST+
Sbjct  454   HHM-VNETTELPLSVFWLIPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  512

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG FFSS LVTIV K+TG  KPWLAD+LNQGKLYDFYWLLA++SALN   +L C++ YV
Sbjct  513   SLGFFFSSFLVTIVHKITGN-KPWLADNLNQGKLYDFYWLLAILSALNFGIYLVCAKWYV  571

Query  380   YKEKRLA  360
             YK+KRLA
Sbjct  572   YKDKRLA  578



>ref|XP_007210870.1| hypothetical protein PRUPE_ppa003177mg [Prunus persica]
 gb|EMJ12069.1| hypothetical protein PRUPE_ppa003177mg [Prunus persica]
Length=596

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/548 (72%), Positives = 464/548 (85%), Gaps = 9/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  36    AAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFVA  95

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF T QA GVTILTIST IPSL+P KC+ ++G+ C+PASG QL VLY+A
Sbjct  96    DTFLGRYLTIAIFATFQAMGVTILTISTTIPSLRPRKCTSDTGTPCIPASGKQLMVLYIA  155

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SDK+ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  156   LYLTALGTGGLKSSVSGFGSDQFDESDKQERRQMTNFFNWFFFFISIGSLAAVTVLVYIQ  215

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+C CAIV  L++FLSGTRRYRFKKLVGSPLTQI+ V VAAWRKR +ELPS
Sbjct  216   DNLGRQWGYGICVCAIVLGLIVFLSGTRRYRFKKLVGSPLTQISGVCVAAWRKRNMELPS  275

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTL  1104
             D   LYNVDD+    G ++ KK K+PHSK+FRFLD+AAIKE  +       +NKWS+STL
Sbjct  276   DMSFLYNVDDI--DDGLKKKKKQKLPHSKQFRFLDKAAIKEPKTTSGTAMIINKWSLSTL  333

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA +MDRH+ KSF++P AS+  F+V
Sbjct  334   TDVEEVKLIIRMLPIWATTIMFWTVYAQMTTFSVSQATSMDRHIGKSFQIPPASLTAFFV  393

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDR++VP+ R+ L NPQGL+PLQR+ VGL  S+  M+AAAL E+KRL +AR
Sbjct  394   GSILLTVPVYDRLIVPMARKALENPQGLTPLQRMGVGLVFSIFAMVAAALTEVKRLNIAR  453

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             SHGLT +P A +P+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  454   SHGLTDNPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  513

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG FFSS+LVTIV K TG  KPWLAD+LNQGKLYDFYWLLA++SALNL+ +LFC+  Y
Sbjct  514   LSLGFFFSSLLVTIVHKTTGHNKPWLADNLNQGKLYDFYWLLALLSALNLVIYLFCANWY  573

Query  383   VYKEKRLA  360
             VYK+KRLA
Sbjct  574   VYKDKRLA  581



>ref|XP_010264234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=593

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/559 (68%), Positives = 465/559 (83%), Gaps = 12/559 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE CERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATSANNVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLT+ IF TVQA GVTILTISTI+PSL+PPKC+     CV ASG QL VLYL L
Sbjct  92    DTFLGRYLTVAIFATVQATGVTILTISTIVPSLRPPKCTAGE-VCVQASGLQLTVLYLGL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSGLG+DQFD+SD +ER QM  FF+WF FFI++GSL AVT+LVYIQD
Sbjct  151   YLTALGTGGLKSSVSGLGSDQFDESDPKERAQMTNFFNWFFFFISIGSLAAVTILVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG+C  AI+  L++FLSGTRRYRFKKL  SPLTQ+A V+VAAWRKR++ELPSD
Sbjct  211   NLGRHWGYGICVSAILLGLLVFLSGTRRYRFKKLASSPLTQVATVFVAAWRKRKMELPSD  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV---------NKWSIS  1110
             P LLY+V + V     Q+ KK ++PHSK+FRFLD+AAIK+   +          N+WS+S
Sbjct  271   PSLLYDVGNSVNDG--QKRKKQRLPHSKQFRFLDKAAIKDPNGQTQSGSWNTVENRWSLS  328

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK +IRM+P WATTIMFWTV+AQ+ TFSVSQA T++RH+ +SF +PAAS+ VF
Sbjct  329   TLTDVEEVKIVIRMMPIWATTIMFWTVYAQMTTFSVSQATTLNRHLGRSFLIPAASLTVF  388

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T+++YDR++VP+ RR+ NNP+GL+PLQRI +GL +S + M+AAAL E+KRL+ 
Sbjct  389   FVGSILLTVIVYDRVIVPVTRRLFNNPRGLTPLQRIGIGLVMSALAMVAAALTELKRLRA  448

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             ARS+GLT +P A +P+SVF L  Q+ +VG GEA TY+GQLDFFLRECPKGMKT+STGLFL
Sbjct  449   ARSNGLTDNPTAEIPLSVFCLIPQFFLVGCGEAFTYIGQLDFFLRECPKGMKTISTGLFL  508

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LGLFFSS LV++V K+TG  +PWL+D+LNQGKLY+FYWLLA +S LN   +L C+R
Sbjct  509   STISLGLFFSSFLVSLVHKLTGNGRPWLSDNLNQGKLYNFYWLLAGLSLLNFGLYLVCAR  568

Query  389   GYVYKEKRLAEMGIELEEE  333
              YVYK+ RLA+ GIELEE+
Sbjct  569   WYVYKDTRLAQEGIELEEK  587



>ref|XP_009110669.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Brassica rapa]
 gb|AFK74856.1| low-affinity nitrate transporter [Brassica rapa subsp. oleifera]
Length=590

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/563 (68%), Positives = 458/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S CV ASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCVQASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +E+ QM  FF+ F F INVGSL AVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKEQSQMTYFFNRFFFCINVGSLCAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA +IV AL +FL+GT RYRFKKL+GSP+TQ+A V VAAWR RRLELPS
Sbjct  212   DDVGRKWGYGICALSIVLALSVFLAGTNRYRFKKLIGSPMTQVATVIVAAWRNRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+AA G  + K+ K+PH+K+FR LD+AAIK   + +     NKW++STLT
Sbjct  272   DPSFLYDLDDVIAAEGAMKSKQ-KLPHTKQFRSLDKAAIKNQETAMTQNVFNKWTLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P ASMAVFYVG
Sbjct  331   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPASMAVFYVG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N P GL PLQRI +GL L+ VGM  AALVEIKRL+ A S
Sbjct  390   GLLLTTAVYDRVAIPLCKKLFNYPHGLRPLQRIGLGLILAAVGMAVAALVEIKRLRTAHS  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  450   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K T +  PW+AD LN+G+LY+FYWL+AV+  LN + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKFTDKAHPWIADDLNKGRLYNFYWLVAVVVFLNFLIFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YK+KRLAE+GIELE+ET IP GH
Sbjct  567   YKDKRLAELGIELEDETDIPMGH  589



>gb|KFK43476.1| hypothetical protein AALP_AA1G129900 [Arabis alpina]
Length=591

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/563 (68%), Positives = 457/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  33    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S CV ASG QL VLYLA
Sbjct  93    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSNCVQASGIQLTVLYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER QM  FF+ F F INVGSLLAVTVLVYIQ
Sbjct  153   LYLTALGTGGVKASVSGFGSDQFDETEPKERSQMTYFFNRFFFCINVGSLLAVTVLVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYGLCA AIV AL +FL+GT RYRFKKL+GSP+TQ+AAV VAAWR RRLELPS
Sbjct  213   DDVGRKWGYGLCAFAIVLALSVFLAGTNRYRFKKLIGSPMTQVAAVIVAAWRNRRLELPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK-----EGVSEVNKWSISTLT  1101
             DP  LY++DD++AA G  + K+ K+PH+K+FR LD+AAIK        +  NKW++STLT
Sbjct  273   DPSYLYDLDDIIAAEGSMKSKQ-KLPHTKQFRSLDKAAIKGQDTVATQNAFNKWTLSTLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P ASMAVFYVG
Sbjct  332   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPASMAVFYVG  390

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ + + +++ N PQGL PLQRI +GL L+ + M  AALVEIKRL+ A S
Sbjct  391   GLLLTTALYDRVAIKLCKKLFNYPQGLRPLQRIGLGLLLASMAMAVAALVEIKRLRTAHS  450

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  451   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  507

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG   PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  508   ALGFFFSSVLVTIVEKFTGTTHPWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYV  567

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YK+KRLAE+GIELE+E  IP  H
Sbjct  568   YKDKRLAEVGIELEDEPEIPMCH  590



>ref|XP_006417264.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
 gb|ESQ35617.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
Length=590

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/563 (67%), Positives = 460/563 (82%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S CV ASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCVQASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER QM  FF+ F F INVGSL AVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKERSQMTYFFNRFFFCINVGSLCAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYGLCA +IV AL +FL+GT RYRFKKL+GSP+TQ+AAV VAAWR RRLELP+
Sbjct  212   DDVGRKWGYGLCAFSIVLALSVFLAGTNRYRFKKLIGSPMTQVAAVIVAAWRNRRLELPA  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+AA G  + K+ K+PH+K+FR LD+AAIK+  + +     NKW++STLT
Sbjct  272   DPSYLYDLDDVIAAEGSMKSKQ-KLPHTKQFRSLDKAAIKDQETAMTQNVFNKWTLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P A+MAVFYVG
Sbjct  331   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPAAMAVFYVG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N PQGL PLQRI +GL  + + M  AALVEIKRL+ A S
Sbjct  390   GLLLTTALYDRVAIPLCKKLFNYPQGLRPLQRIGLGLVFASMAMAVAALVEIKRLRTAHS  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  450   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG+  PW+A+ LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKFTGKTHPWIANDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YK+KRLAE+GIEL++E  IP GH
Sbjct  567   YKDKRLAEVGIELDDELDIPMGH  589



>ref|XP_007157339.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
 gb|ESW29333.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
Length=586

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/554 (68%), Positives = 446/554 (81%), Gaps = 14/554 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             ++AMILG E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNFLG SFML LLGGF+A
Sbjct  33    ASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFMLCLLGGFLA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTFLGRY TI +F  VQA GV IL ISTI+PSL PPKC  ++   CV A+  QL VLYLA
Sbjct  93    DTFLGRYRTIAVFAAVQATGVAILAISTIVPSLHPPKCREDTVPPCVRANEKQLMVLYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG G+DQFDD+DK E+ QM+KFF+WF FF++ GSL AVTVLVY+Q
Sbjct  153   LYITALGTGGLKSSVSGFGSDQFDDTDKDEKSQMIKFFNWFYFFVSTGSLAAVTVLVYVQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+GR WGYG+CA AIV AL++FL GTR+YRFKKLVGSPLTQIA V VAA RKR+LELPS
Sbjct  213   DNVGRGWGYGICAGAIVVALLVFLWGTRKYRFKKLVGSPLTQIAEVLVAAMRKRKLELPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE----GVSEVNKWSISTLTD  1098
             D  +L+N         D + KK  MPHSK+FRFLD+AAI +    G     KW + TLTD
Sbjct  273   DSSMLFN---------DYDTKKQTMPHSKQFRFLDKAAIVDSSVSGGGMKRKWYLCTLTD  323

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK +IRMLP WATTIMFWT+HAQ+ TFSVSQA TMD H+ K+FE+PAASM VF +G 
Sbjct  324   VEEVKLVIRMLPIWATTIMFWTIHAQMTTFSVSQATTMDLHIGKTFEIPAASMTVFLIGT  383

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+  YDR +VP+ R+VL NP G +PLQRI VGL LSV  M+A AL+EIKRL+ A+SH
Sbjct  384   ILLTVPFYDRFIVPVARKVLKNPHGFTPLQRIGVGLVLSVFSMVAGALIEIKRLRYAQSH  443

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GL   P A +PM+VFWL  Q   VG+GEA  Y+GQLDFFLRECPKGMKTMSTGLFLST++
Sbjct  444   GLVDKPEAKIPMTVFWLIPQNFFVGAGEAFMYMGQLDFFLRECPKGMKTMSTGLFLSTLS  503

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFS++LV++V K+T   +PWLAD+LN+G+LYDFYWLLA++SA+N+M +L C++ YVY
Sbjct  504   LGFFFSTLLVSVVNKMTAHGRPWLADNLNKGRLYDFYWLLAILSAINVMLYLVCAKWYVY  563

Query  377   KEKRLAEMGIELEE  336
             KEKRLAE GIELEE
Sbjct  564   KEKRLAEEGIELEE  577



>gb|AEA35415.1| nitrate transporter [Brassica rapa subsp. chinensis]
Length=589

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/563 (67%), Positives = 457/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C P + S CV ASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCDPTTSSHCVQASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFDD++ +ER QM  FF+ F F INVGSL+AVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDDTEPKERSQMTYFFNRFFFCINVGSLMAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV +L +FL+GT RYRFKKL+GSP+TQ+A V VAAWR RRLELPS
Sbjct  212   DDVGRKWGYGICALAIVLSLSIFLAGTNRYRFKKLIGSPMTQVATVLVAAWRNRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+AA G  + K+ K+PH+ +FR LD+AAIK+    +     NKW++ST+T
Sbjct  272   DPSFLYDLDDVIAAEGSMKSKQ-KLPHTNQFRSLDKAAIKDQEMAMTQNVYNKWTLSTVT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             D+EEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P A+MAVFY+G
Sbjct  331   DIEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPAAMAVFYIG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N P GL PLQRI +GL L+ +GM  AALVEIKRL+ A +
Sbjct  390   GLLLTTAVYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTAHA  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+    L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  450   HGPTVK---TLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV KVT +  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKVTDKAHPWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLA++GIELE+E  IP GH
Sbjct  567   YKEKRLADLGIELEDEPDIPMGH  589



>ref|XP_004511669.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Cicer arietinum]
 ref|XP_004511670.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Cicer arietinum]
Length=593

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/555 (68%), Positives = 451/555 (81%), Gaps = 8/555 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNFLG SFML LLGGF+A
Sbjct  33    AAAMILGGEIMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFMLCLLGGFLA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GVTILTISTIIPSL PPKC+ +S + CV AS  QL VL LA
Sbjct  93    DTFLGRYLTIAIFAAIQAMGVTILTISTIIPSLHPPKCTKDSTTPCVEASNKQLLVLNLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG G+DQFDDS K E+  M+KFFSWF FF+++GSL AVT+LVYIQ
Sbjct  153   LYVTALGTGGLKSSVSGFGSDQFDDSHKEEKKGMIKFFSWFYFFVSIGSLAAVTILVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN GR WGYG+CA AIV ALV++LSGT +YR K LVGSPLTQI  V+VAAW+KR  +LPS
Sbjct  213   DNQGRGWGYGICAVAIVVALVVYLSGTSKYRIKPLVGSPLTQIVLVFVAAWKKRHFQLPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK-----EGVSEVNKWSISTLT  1101
             D  LLY  DD+        +KK ++PHSK+FRFLD+AAIK      G++   KW +STLT
Sbjct  273   DSSLLYEEDDI--QHEQPRNKKQRLPHSKQFRFLDKAAIKGLESTNGITMKEKWHLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK ++RMLP WATTIMFWT+HAQ+ TFSVSQA TMD H+ KSF++PAASM VF +G
Sbjct  331   DVEEVKLILRMLPIWATTIMFWTIHAQMTTFSVSQATTMDCHIGKSFQIPAASMTVFLIG  390

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDR++ P+ + +L N  G +PLQRI VGL LSV+ M+AAAL+EIKRLK A+S
Sbjct  391   TILLTVPLYDRLIRPVAKNILKNSNGFTPLQRIGVGLVLSVLSMVAAALIEIKRLKFAKS  450

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG   DP A +P+SVFWL  Q+  VGSGEA  Y+GQLDFFLRECPKGMKTMSTGLFLST+
Sbjct  451   HGFVNDPTAKMPLSVFWLVPQFFFVGSGEAFMYMGQLDFFLRECPKGMKTMSTGLFLSTL  510

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG FFSS+LVTIV  VTG  KPW+A++LNQG+LYDFYWLLA++SA+N++ +L C++ YV
Sbjct  511   SLGFFFSSLLVTIVNNVTGPNKPWIANNLNQGRLYDFYWLLAMLSAINVVIYLACAKWYV  570

Query  380   YKEKRLAEMGIELEE  336
             YKE RLAE GIELEE
Sbjct  571   YKENRLAEEGIELEE  585



>ref|XP_009118113.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brassica rapa]
Length=589

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/563 (67%), Positives = 457/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C P + S CV ASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCDPTTSSHCVQASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFDD++ +ER QM  FF+ F F INVGSL+AVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDDTEPKERSQMTYFFNRFFFCINVGSLMAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV +L +FL+GT RYRFKKL+GSP+TQ+A V VAAWR RRLELPS
Sbjct  212   DDVGRKWGYGICALAIVLSLSIFLAGTNRYRFKKLIGSPMTQVATVLVAAWRNRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+AA G  + K+ K+PH+ +FR LD+AAIK+    +     NKW++ST+T
Sbjct  272   DPSFLYDLDDVIAAEGSMKSKQ-KLPHTNQFRSLDKAAIKDQEMAMTQNVYNKWTLSTVT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             D+EEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P A+MAVFY+G
Sbjct  331   DIEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPAAMAVFYIG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N P GL PLQRI +GL L+ +GM  AALVEIKRL+ A +
Sbjct  390   GLLLTTAVYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTAHA  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+    L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  450   HGPTVK---TLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV KVT +  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKVTDKAHPWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLA++GIELE+E  IP GH
Sbjct  567   YKEKRLADLGIELEDELDIPMGH  589



>ref|XP_008238567.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Prunus mume]
Length=599

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/549 (72%), Positives = 466/549 (85%), Gaps = 8/549 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  36    AAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFVA  95

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF ++QA GVTILTIST +PSL+PPKC+ ++G+ C+PASG QL VLY+A
Sbjct  96    DTFLGRYLTIAIFASIQAMGVTILTISTTVPSLRPPKCTADTGTPCIPASGKQLMVLYIA  155

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SDK+ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  156   LYLTALGTGGLKSSVSGFGSDQFDESDKQERRQMTNFFNWFFFFISIGSLAAVTVLVYIQ  215

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D+LGRRWGYG+C CAIV  L++FLSGTRRYRFKKLVGSPLTQI+ V+VAAWRKR +ELPS
Sbjct  216   DSLGRRWGYGICVCAIVLGLIVFLSGTRRYRFKKLVGSPLTQISGVFVAAWRKRNMELPS  275

Query  1265  DPELLYNVDDVVAAA-GDQEHKKIKMPHSKEFRFLDRAAIKEGVSE------VNKWSIST  1107
             D   LYN+DD+     G ++ KK K+PHSK+FRFLD+AAIK+  +       +NKWS+ST
Sbjct  276   DMSFLYNIDDIDDIDDGLKKKKKQKLPHSKQFRFLDKAAIKDPKTTSGTTMIINKWSLST  335

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             LTDVEEVK +IRMLP WATTI+FWTV+AQ+ TFSVSQA +MDRH+ KSF++P AS+  F+
Sbjct  336   LTDVEEVKLIIRMLPIWATTIIFWTVYAQMTTFSVSQATSMDRHIGKSFQIPPASLTAFF  395

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+T+ +YDR++VP  R+ L NPQGL+PLQRI VGL  S+  M+AAAL E+KRL  A
Sbjct  396   VGSILLTVPVYDRLIVPNARKALKNPQGLTPLQRIGVGLVFSIFAMVAAALTEVKRLNTA  455

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             RSHGLT +P A +P+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  456   RSHGLTDNPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  515

Query  566   TVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             T++LG FFSS+LVTIV K+TG  KPWLAD+LNQGKLYDFYWLLA++SALNL+ +LFC+  
Sbjct  516   TLSLGFFFSSLLVTIVHKITGHSKPWLADNLNQGKLYDFYWLLALLSALNLVIYLFCANW  575

Query  386   YVYKEKRLA  360
             YVYK+KRLA
Sbjct  576   YVYKDKRLA  584



>gb|AAA80582.1| RCH2 protein [Brassica napus]
Length=589

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/563 (67%), Positives = 456/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C P + S CV A+G QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCDPTTSSHCVQANGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFDD++ +ER QM  FF+ F F INVGSL+AVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDDTEPKERSQMTYFFNRFFFCINVGSLMAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV +L +FL+GT RYRFKKL+GSP+TQ+  V VAAWR RRLELPS
Sbjct  212   DDVGRKWGYGICALAIVLSLSIFLAGTNRYRFKKLIGSPMTQVGTVLVAAWRNRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+AA G  + K+ K+PH+ +FR LD+AAIK+    +     NKW++ST+T
Sbjct  272   DPSFLYDLDDVIAAEGSMKSKQ-KLPHTNQFRSLDKAAIKDQEMAMTQNVYNKWTLSTVT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             D+EEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P A+MAVFY+G
Sbjct  331   DIEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPAAMAVFYIG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N P GL PLQRI +GL L+ +GM  AALVEIKRL+ A +
Sbjct  390   GLLLTTAVYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTAHA  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+    L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  450   HGPTVK---TLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV KVT +  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKVTDKAHPWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLA++GIELE+E  IP GH
Sbjct  567   YKEKRLADLGIELEDEPDIPMGH  589



>ref|XP_003611286.1| Nitrate transporter [Medicago truncatula]
 gb|AES94244.1| peptide/nitrate transporter [Medicago truncatula]
Length=591

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/554 (69%), Positives = 454/554 (82%), Gaps = 8/554 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNFLG SFML LLGGF+A
Sbjct  33    AAAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFMLCLLGGFLA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTI IF  VQA GVTILTISTIIPSL PPKC  +S SC+ A   QL V+YLAL
Sbjct  93    DTFLGRYLTIAIFAAVQAIGVTILTISTIIPSLHPPKCKEDSKSCIQADSKQLLVMYLAL  152

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSVSG G+DQFDDSD +E+  M+KFFSWF FF+++GSL AVTVLVYIQD
Sbjct  153   YITALGTGGLKSSVSGFGSDQFDDSDDQEKKGMIKFFSWFYFFVSIGSLAAVTVLVYIQD  212

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             N GR WGYG+CA AIV AL++FLSGTR+YR K+LVGSPLTQIA V+VAAWRKR ++LPSD
Sbjct  213   NQGRGWGYGICAVAIVVALLVFLSGTRKYRIKQLVGSPLTQIAVVFVAAWRKRHMQLPSD  272

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEVNKWSISTLTD  1098
               LLY  DD++      + KK +MPHSK+FRFLD+AAIK       ++   KW ISTLTD
Sbjct  273   SSLLYEEDDILCET--PKTKKQRMPHSKQFRFLDKAAIKGIESGGTITIKEKWYISTLTD  330

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK +IRMLP WATTIMFWT+HAQ+ TFSVSQA TMD  +  +F++PAASM VF +G 
Sbjct  331   VEEVKMVIRMLPIWATTIMFWTIHAQMTTFSVSQATTMDCQIG-TFQIPAASMTVFLIGT  389

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+  YDR + P+ ++VLNN  G +PLQRI VGL LSV+ M+AAAL+E+KRLK ARSH
Sbjct  390   ILLTVPFYDRFIRPVAKKVLNNSHGFTPLQRIGVGLVLSVISMVAAALIEMKRLKFARSH  449

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             G   DP A +P+SVFWL  Q+  VGSGEA  Y+GQLDFFLRECPKGMKTMSTGLFLST++
Sbjct  450   GFVDDPTAKMPLSVFWLVPQFFFVGSGEAFMYMGQLDFFLRECPKGMKTMSTGLFLSTLS  509

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             +G FFSS+LVT+V  VTG  KPW+AD+L+QG+LYDFYWLLA++SA+N++ +L C++ YVY
Sbjct  510   IGFFFSSLLVTLVNNVTGPNKPWIADNLDQGRLYDFYWLLAMLSAINVVIYLACAKWYVY  569

Query  377   KEKRLAEMGIELEE  336
             K+KRLAE GIELEE
Sbjct  570   KDKRLAEAGIELEE  583



>ref|XP_003549905.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=594

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/559 (67%), Positives = 461/559 (82%), Gaps = 14/559 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILGVEACERLTT+G+ +NLVTYLT TMHLG+A +AN VTNF+G SFML L GGFVA
Sbjct  33    AAAMILGVEACERLTTMGVAVNLVTYLTGTMHLGSANSANTVTNFMGTSFMLCLFGGFVA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTF+GRYLTI IF TVQA GVTILTISTIIPSL PPKC  ++   C+PA+  QL VLY+A
Sbjct  93    DTFIGRYLTIAIFATVQATGVTILTISTIIPSLHPPKCIRDATRRCMPANNMQLMVLYIA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY T+LG GGLKSSVSG GTDQFD+SDK E+ QM+KFF+WF+FFI++G+L AVTVLVYIQ
Sbjct  153   LYTTSLGIGGLKSSVSGFGTDQFDESDKGEKKQMLKFFNWFVFFISLGTLTAVTVLVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR WGYG+  CA++ AL++ LSGTRRYR+K+LVGSPL QIA V+VAAWRKR LE PS
Sbjct  213   DHIGRYWGYGISVCAMLVALLVLLSGTRRYRYKRLVGSPLAQIAMVFVAAWRKRHLEFPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIK--MPHSKEFRFLDRAAIK------EGVSEVNKWSIS  1110
             D  LL+N+DDV     D+  +K K  +PHSK+FRFLD+AAIK      E ++   KW +S
Sbjct  273   DSSLLFNLDDV----ADETLRKNKQMLPHSKQFRFLDKAAIKDPKTDGEEITMERKWYLS  328

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHM-SKSFEVPAASMAV  933
             TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSV QA TMDR +   SF++PAAS+ V
Sbjct  329   TLTDVEEVKMVQRMLPVWATTIMFWTVYAQMTTFSVQQATTMDRRIIGNSFQIPAASLTV  388

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+VG +L+T+ +YDR++ PI +++ +NPQGL+PLQRI VGL  S++ M++AAL+EIKRL+
Sbjct  389   FFVGSVLLTVPVYDRVITPIAKKLSHNPQGLTPLQRIGVGLVFSILAMVSAALIEIKRLR  448

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             +AR++GL     A VP+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLF
Sbjct  449   MARANGLAHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLF  508

Query  572   LSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             LST++LG F SS+LVT+V K T  ++PWLAD+LN GKL+ FYWLLA++S +NL+A+LFC+
Sbjct  509   LSTLSLGFFLSSLLVTLVHKATRHREPWLADNLNHGKLHYFYWLLALLSGVNLVAYLFCA  568

Query  392   RGYVYKEKRLAEMGIELEE  336
             +GYVYK+KRLAE GIELEE
Sbjct  569   KGYVYKDKRLAEAGIELEE  587



>ref|XP_006307075.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
 gb|EOA39973.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
Length=590

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 458/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  33    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  VQA GV+ILT+STIIP L+PP+C+P + S C  A+G QL VLYLA
Sbjct  93    DTFLGRYLTIAIFAAVQATGVSILTLSTIIPGLRPPRCNPTTSSHCEQATGIQLTVLYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER QM  FF+ F F INVGSLLAVTVLVYIQ
Sbjct  153   LYLTALGTGGVKASVSGFGSDQFDETEPKERSQMTYFFNRFFFCINVGSLLAVTVLVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV AL +FL+GT RYRFKKLVGSP+TQ AAV VAAWR R+LELP+
Sbjct  213   DDVGRKWGYGICAFAIVLALSIFLAGTNRYRFKKLVGSPMTQFAAVIVAAWRNRKLELPA  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE---GVSE--VNKWSISTLT  1101
             DP  LY+VDD++AA G  + K+ K+PH+K++R LD+AAI++   GV+    NKW++STLT
Sbjct  273   DPSYLYDVDDIIAAEGAMKGKQ-KLPHTKQYRSLDKAAIRDQEAGVTSNVFNKWTLSTLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP W T I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P ASMAVFYVG
Sbjct  332   DVEEVKQIVRMLPIWLTCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPASMAVFYVG  390

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N P GL PLQRI +GL L+ +GM  AAL+EIKRL+ A +
Sbjct  391   GLLLTTAVYDRVAIPLCKKLFNYPHGLRPLQRIGLGLILACMGMAVAALIEIKRLRTAHA  450

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMK MSTGL LST+
Sbjct  451   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTL  507

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG+  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  508   ALGFFFSSVLVTIVEKFTGKAHPWIADDLNKGRLYNFYWLVAVLVALNFLVFLVFSKRYV  567

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLA+ GIEL++E  IP GH
Sbjct  568   YKEKRLADAGIELDDEPSIPMGH  590



>ref|XP_008448872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Cucumis melo]
Length=593

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/547 (69%), Positives = 454/547 (83%), Gaps = 8/547 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EA ERLTTLGI +NLVTY+T TMHLGNA +AN+VTNFLG SFML LLGGF+A
Sbjct  34    AAAMILGGEAVERLTTLGIAVNLVTYMTGTMHLGNAVSANIVTNFLGTSFMLCLLGGFIA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GVTILTISTIIPSL+PP+C+ ES S C PA+  QL +LY+A
Sbjct  94    DTFLGRYLTIAIFAAIQATGVTILTISTIIPSLRPPRCTVESSSHCAPATDFQLTILYIA  153

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY TALGTGGLKSSVSG G+DQFD+SDK ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  154   LYTTALGTGGLKSSVSGFGSDQFDESDKEERAQMSAFFNWFFFFISIGSLAAVTVLVYIQ  213

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+CACAIV  LV+F+SGT++YRFKKLVGSPLTQIA V VAAWRKR ++LP+
Sbjct  214   DNLGRQWGYGICACAIVAGLVVFVSGTKKYRFKKLVGSPLTQIATVIVAAWRKRNMDLPT  273

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEVNKWSISTLT  1101
             D   L+++DD      + + KK K+P SK+FRFLD+AAI+E      ++ +NKW +STLT
Sbjct  274   DSSFLFDIDDFEDERRNGKMKKQKLPRSKQFRFLDKAAIREPEKGADITLMNKWYMSTLT  333

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK +IRMLP WAT IMFWTV+AQ+ TFSVSQA TMDR + KSF +PAAS+ VF+VG
Sbjct  334   DVEEVKMVIRMLPIWATNIMFWTVYAQMTTFSVSQATTMDRRIGKSFYIPAASLTVFFVG  393

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDRI+VPI R++L NPQGL+PLQRI VGL +S++ M+AAAL E+KRL+VA S
Sbjct  394   SILLTVPIYDRIIVPIARKILKNPQGLTPLQRIGVGLVMSILAMVAAALTELKRLRVATS  453

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             H L  +    VP+SVFWL  Q+ +VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST+
Sbjct  454   HHLI-NGTTEVPLSVFWLIPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  512

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG F SS LVTIV K+TG  KPWLAD+LNQGKLY+FYWLLA++S LN   +L C++ YV
Sbjct  513   SLGFFLSSFLVTIVHKITGN-KPWLADNLNQGKLYNFYWLLAILSTLNFGIYLVCAKWYV  571

Query  380   YKEKRLA  360
             YK+KRLA
Sbjct  572   YKDKRLA  578



>gb|KHN42706.1| Nitrate transporter 1.1 [Glycine soja]
Length=575

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/554 (67%), Positives = 446/554 (81%), Gaps = 14/554 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             ++AMILG E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNFLG SFML LLGGF+A
Sbjct  22    ASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFMLCLLGGFLA  81

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTFLGRY TI IF  VQA GVTILTISTIIPSL PPKC+ ++   CV A+  QL  LYLA
Sbjct  82    DTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCNGDTVPPCVRANEKQLTALYLA  141

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG G+DQFDDSD  E+ QM+KFF+WF FF+++GSL A TVLVY+Q
Sbjct  142   LYVTALGTGGLKSSVSGFGSDQFDDSDNDEKKQMIKFFNWFYFFVSIGSLAATTVLVYVQ  201

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+GR WGYG+CA AIV AL++FLSGTR+YRFKK VGSPLTQ A V+VAA RKR +ELPS
Sbjct  202   DNIGRGWGYGICAGAIVVALLVFLSGTRKYRFKKRVGSPLTQFAEVFVAALRKRNMELPS  261

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE----GVSEVNKWSISTLTD  1098
             D  LL+N         D + KK  +PHSK+FRFLD+AAI +    G     KW +  LTD
Sbjct  262   DSSLLFN---------DYDPKKQTLPHSKQFRFLDKAAIMDSSECGGGMKRKWYLCNLTD  312

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK ++RMLP WATTIMFWT+HAQ+ TFSV+QA TMDRH+ K+F++PAASM VF +G 
Sbjct  313   VEEVKMVLRMLPIWATTIMFWTIHAQMTTFSVAQATTMDRHIGKTFQIPAASMTVFLIGT  372

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+  YDR +VP+ ++VL NP G +PLQRI VGL LSV+ M+  AL+EIKRL+ A+SH
Sbjct  373   ILLTVPFYDRFIVPVAKKVLKNPHGFTPLQRIGVGLVLSVISMVVGALIEIKRLRYAQSH  432

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GL   P A +PM+VFWL  Q  IVG+GEA  Y+GQL+FFLRECPKGMKTMSTGLFLST++
Sbjct  433   GLVDKPEAKIPMTVFWLIPQNFIVGAGEAFMYMGQLNFFLRECPKGMKTMSTGLFLSTLS  492

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFS++LV+IV K+T   +PWLAD+LNQG+LYDFYWLLA++SA+N++ +L C++ YVY
Sbjct  493   LGFFFSTLLVSIVNKMTAHGRPWLADNLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVY  552

Query  377   KEKRLAEMGIELEE  336
             KEKRLA+ GI LEE
Sbjct  553   KEKRLADEGIVLEE  566



>emb|CAC07206.1| nitrate transporter [Brassica napus]
Length=588

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/562 (66%), Positives = 452/562 (80%), Gaps = 10/562 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
              TFLGRYLTI IF  +QA GV+ILT+STIIP  QPP+C   S  CV  SG QL VLYLAL
Sbjct  92    HTFLGRYLTIAIFAAIQATGVSILTLSTIIPGFQPPRCPTTSSHCVQPSGIQLTVLYLAL  151

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGG+K+SVSG G+DQFD+++ +E+ QM  FF+ F F INVGSLLAVTVLVY+QD
Sbjct  152   YLTALGTGGVKASVSGFGSDQFDETEPKEQSQMTYFFNRFFFCINVGSLLAVTVLVYMQD  211

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             ++GR+WGYGLCA AIV +L +FL+GT RYRFKKL+GSP+TQ+AAV VAAW  RRLELPSD
Sbjct  212   DVGRKWGYGLCALAIVLSLSIFLAGTNRYRFKKLIGSPMTQVAAVIVAAWWNRRLELPSD  271

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLTD  1098
             P  LY++DDV+AA G  + K+ K+PH+ +FR LD+AAIK+    +     NKW++ST+TD
Sbjct  272   PSFLYDLDDVIAAEGSMKSKQ-KLPHTNQFRSLDKAAIKDQEMAMTQNVYNKWTLSTVTD  330

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             +EEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P A+MAVFY+GG
Sbjct  331   IEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPAAMAVFYIGG  389

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             +L+T  +YDR+ +P+ +++ N P GL PLQRI +GL L+ +GM  AALVEIKRL+ A +H
Sbjct  390   LLLTTAVYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTAHAH  449

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             G T     T+P+    L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+A
Sbjct  450   GPTVK---TLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLA  506

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFSSVLVTIV KVT +  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YVY
Sbjct  507   LGFFFSSVLVTIVEKVTDKAHPWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYVY  566

Query  377   KEKRLAEMGIELEEETHIPGGH  312
             KEKRLA++GIELE+E  IP GH
Sbjct  567   KEKRLADLGIELEDEPDIPMGH  588



>ref|XP_008358135.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Malus domestica]
Length=595

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/548 (70%), Positives = 461/548 (84%), Gaps = 10/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILG EACERLTTLGI +NLV YLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  37    AAAMILGGEACERLTTLGIAVNLVNYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFVA  96

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-SCVPASggqlgvlyla  1626
             DTFLGRYLTI IF T+QA GVT+LTISTI+PSL+PPKC+  +   C+ ASG QL VLY+A
Sbjct  97    DTFLGRYLTIAIFATIQATGVTVLTISTIVPSLRPPKCTDGTDLPCITASGKQLTVLYIA  156

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKS VSG G+DQFDDSDK+ER QM  FF+WF FFI++GSL AVTVLVYI+
Sbjct  157   LYLTALGTGGLKSGVSGFGSDQFDDSDKQERKQMTNFFNWFFFFISIGSLAAVTVLVYIE  216

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+C CAIV  L++FLSGTR+YRFKKLVGSPLTQ AAV+VAAW+KR +ELP+
Sbjct  217   DNLGRQWGYGICVCAIVLGLIVFLSGTRQYRFKKLVGSPLTQTAAVFVAAWKKRNMELPT  276

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTL  1104
             D  LLYNVDD+      +++KK ++PHS +FRFLD+AAIK+  +E      VNKWS+STL
Sbjct  277   DLTLLYNVDDI---DDGKKNKKQELPHSYQFRFLDKAAIKDPKTEGGKTAIVNKWSLSTL  333

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK +IRMLP WATTIMFWT++AQ+ TFSVSQA TM+RH+ KSF +P AS+  F+V
Sbjct  334   TDVEEVKMIIRMLPIWATTIMFWTIYAQMTTFSVSQATTMNRHIGKSFRIPPASLTAFFV  393

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDRI+VP+ R +L NPQGL+PLQRI VGL  S+  M+AAAL E+KR+  AR
Sbjct  394   GSILLTVPVYDRIIVPVARNLLKNPQGLTPLQRIGVGLVFSIFSMVAAALTEVKRMNAAR  453

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             +HGLT +P A +P+SVFWL  Q+  VGSGEA  Y+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  454   AHGLTGNPKAEIPLSVFWLVPQFFFVGSGEAFVYIGQLDFFLRECPKGMKTMSTGLFLST  513

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG F SS+LV++V KVTG++KPW A+++N+GKLYDFYWLLA++SALNL+ +LFC+  Y
Sbjct  514   LSLGFFVSSLLVSLVHKVTGDRKPWFANNINRGKLYDFYWLLALLSALNLVVYLFCANWY  573

Query  383   VYKEKRLA  360
             VYK+KRLA
Sbjct  574   VYKDKRLA  581



>ref|XP_003517427.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=586

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/554 (67%), Positives = 446/554 (81%), Gaps = 14/554 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             ++AMILG E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNFLG SFML LLGGF+A
Sbjct  33    ASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFMLCLLGGFLA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTFLGRY TI IF  VQA GVTILTISTIIPSL PPKC+ ++   CV A+  QL  LYLA
Sbjct  93    DTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCNGDTVPPCVRANEKQLTALYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG G+DQFDDSD  E+ QM+KFF+WF FF+++GSL A TVLVY+Q
Sbjct  153   LYVTALGTGGLKSSVSGFGSDQFDDSDNDEKKQMIKFFNWFYFFVSIGSLAATTVLVYVQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+GR WGYG+CA AIV AL++FLSGTR+YRFKK VGSPLTQ A V+VAA RKR +ELPS
Sbjct  213   DNIGRGWGYGICAGAIVVALLVFLSGTRKYRFKKRVGSPLTQFAEVFVAALRKRNMELPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE----GVSEVNKWSISTLTD  1098
             D  LL+N         D + KK  +PHSK+FRFLD+AAI +    G     KW +  LTD
Sbjct  273   DSSLLFN---------DYDPKKQTLPHSKQFRFLDKAAIMDSSECGGGMKRKWYLCNLTD  323

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK ++RMLP WATTIMFWT+HAQ+ TFSV+QA TMDRH+ K+F++PAASM VF +G 
Sbjct  324   VEEVKMVLRMLPIWATTIMFWTIHAQMTTFSVAQATTMDRHIGKTFQIPAASMTVFLIGT  383

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+  YDR +VP+ ++VL NP G +PLQRI VGL LSV+ M+  AL+EIKRL+ A+SH
Sbjct  384   ILLTVPFYDRFIVPVAKKVLKNPHGFTPLQRIGVGLVLSVISMVVGALIEIKRLRYAQSH  443

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GL   P A +PM+VFWL  Q  IVG+GEA  Y+GQL+FFLRECPKGMKTMSTGLFLST++
Sbjct  444   GLVDKPEAKIPMTVFWLIPQNFIVGAGEAFMYMGQLNFFLRECPKGMKTMSTGLFLSTLS  503

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFS++LV+IV K+T   +PWLAD+LNQG+LYDFYWLLA++SA+N++ +L C++ YVY
Sbjct  504   LGFFFSTLLVSIVNKMTAHGRPWLADNLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVY  563

Query  377   KEKRLAEMGIELEE  336
             KEKRLA+ GI LEE
Sbjct  564   KEKRLADEGIVLEE  577



>gb|KHN09796.1| Nitrate transporter 1.1 [Glycine soja]
Length=593

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/559 (67%), Positives = 461/559 (82%), Gaps = 15/559 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMILGVEACERLTT+G+ +NLVTYLT TMHLG+A +AN VTNF+G SFML L GGFVA
Sbjct  33    AAAMILGVEACERLTTMGVAVNLVTYLTGTMHLGSANSANTVTNFMGTSFMLCLFGGFVA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTF+GRYLTI IF TVQA GVTILTISTIIPSL PPKC  ++   C+PA+  QL VLY+A
Sbjct  93    DTFIGRYLTIAIFATVQATGVTILTISTIIPSLHPPKCIRDATRRCMPANNMQLMVLYIA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY T+LG GGLKSSVSG GTDQFD+SDK E+ QM+KFF+WF+FFI++G+L AVTVLVYIQ
Sbjct  153   LYTTSLGIGGLKSSVSGFGTDQFDESDKGEKKQMLKFFNWFVFFISLGTLTAVTVLVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR WGYG+  CA++ AL++ LSGTRRYR+K+LVGSPL QIA V+VAAWRKR LE PS
Sbjct  213   DHIGRYWGYGISVCAMLVALLVLLSGTRRYRYKRLVGSPLAQIAMVFVAAWRKRHLEFPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIK--MPHSKEFRFLDRAAIK------EGVSEVNKWSIS  1110
             D  LL+N+DDV     D+  +K K  +PHSK+FRFLD+AAIK      E ++   KW +S
Sbjct  273   DSSLLFNLDDV----ADETLRKNKQMLPHSKQFRFLDKAAIKDPKTDGEEITMERKWYLS  328

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHM-SKSFEVPAASMAV  933
             TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSV QA TMDR +   SF++PAAS+ V
Sbjct  329   TLTDVEEVKMVQRMLPVWATTIMFWTVYAQMTTFSVQQATTMDRRIIGNSFQIPAASLTV  388

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+VG +L+T+ +YDR++ PI +++ +NPQGL+PLQRI VGL  S++ M++AAL+EIKRL+
Sbjct  389   FFVGSVLLTVPVYDRVITPIAKKLSHNPQGLTPLQRIGVGLVFSILAMVSAALIEIKRLR  448

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             +AR++GL     A VP+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLF
Sbjct  449   MARANGLAHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLF  508

Query  572   LSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             LST++LG F SS+LVT+V K T  ++PWLAD+LN GKL+ FYWLLA++S +NL+A+LFC+
Sbjct  509   LSTLSLGFFLSSLLVTLVHKAT-RREPWLADNLNHGKLHYFYWLLALLSGVNLVAYLFCA  567

Query  392   RGYVYKEKRLAEMGIELEE  336
             +GYVYK+KRLAE GIELEE
Sbjct  568   KGYVYKDKRLAEAGIELEE  586



>ref|XP_010676153.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=593

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/563 (64%), Positives = 451/563 (80%), Gaps = 9/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S+AMILGVE CERL TLGI  NLVTYLT  MHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  34    SSAMILGVETCERLITLGIAFNLVTYLTGVMHLGNATSANTVTNFLGTSFMLCLLGGFIA  93

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTI IF TVQA GVT+LTISTIIP+L+PP C+  S +CV A+G QLG+L+LAL
Sbjct  94    DTFLGRYLTIAIFATVQALGVTVLTISTIIPNLRPPPCAEHSSTCVQANGTQLGILHLAL  153

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQ+DD +K ER  M  FF+WF F ++ GSL AVTVLVYI+D
Sbjct  154   YLTALGTGGLKSSVSGFGSDQYDDKNKEERAMMTTFFNWFYFIVSFGSLAAVTVLVYIED  213

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR+WGYG+CACA+V  L++FL GT+RYR+KKL GSPL+QI+AV+VAAW+KR++ELP+D
Sbjct  214   NLGRQWGYGICACAVVVCLMVFLFGTKRYRYKKLAGSPLSQISAVFVAAWKKRKMELPAD  273

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK-----EGVSEVNKWSISTLTD  1098
                L+N+DD+   A      K K+PHSK+FRFLD+AAIK     E ++ V+KW ++TLTD
Sbjct  274   SSQLFNIDDM---AETSVKNKQKLPHSKQFRFLDKAAIKTPEMGEDLASVSKWDLATLTD  330

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK ++RMLP WATTI FWT+HAQ+ TFSVSQA TMDRH+   F++P ASM  F +  
Sbjct  331   VEEVKMIVRMLPIWATTIEFWTIHAQMTTFSVSQAVTMDRHIGSKFQIPPASMTAFLIAS  390

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR++ PI  R+  NPQGLSPL+R+ VGL L+ V M+ AAL EIKRL+VA SH
Sbjct  391   ILLTVPIYDRLVAPIAARLFKNPQGLSPLRRVGVGLFLATVAMVVAALTEIKRLQVAESH  450

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GL  D  A +P++VFWL  Q+++ G+GEA+ Y GQLDFFLRECPKGMKT+STGLFLST++
Sbjct  451   GLVHDQNAVLPITVFWLIPQFILTGAGEAMIYAGQLDFFLRECPKGMKTISTGLFLSTLS  510

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             +G FFS+++V+IV  +T   KPWLAD+LN+G+LY+FYWLL ++S +N + F+FC++ YVY
Sbjct  511   IGFFFSTLVVSIVNSLTAHSKPWLADNLNEGRLYNFYWLLGIISLVNFVLFMFCAKWYVY  570

Query  377   KEKRLAEMGIELE-EETHIPGGH  312
             K+K LA  G E+E EET  P  H
Sbjct  571   KDKWLAAEGFEVEMEETPGPACH  593



>ref|XP_010493752.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/563 (66%), Positives = 455/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S C  A+G QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCEQATGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER QM  FF+ F F INVGSLLAVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKERSQMTYFFNRFFFCINVGSLLAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV AL +FL+GT RYRFKKLVGSP+TQ+AAV VAAWR R+LELP+
Sbjct  212   DDVGRKWGYGICAFAIVLALSVFLAGTNRYRFKKLVGSPMTQVAAVIVAAWRNRKLELPA  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY+VDD++AA G  + K+ K+PH+K++R LD+AAI++  + V     NKW++STLT
Sbjct  272   DPSYLYDVDDIIAAEGAMKGKQ-KLPHTKQYRALDKAAIRDQEAAVTSNVFNKWTLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP W T I+FWTVHAQL T SV+Q+ TMDRHM  SFE+P A+MA FYVG
Sbjct  331   DVEEVKQIVRMLPIWLTCILFWTVHAQLTTLSVAQSETMDRHMG-SFEIPPAAMAAFYVG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ + + +++ N P GL PLQRI +GL L+ + M  AALVEIKRL+ A +
Sbjct  390   GLLLTTAIYDRVAIRLCKKLFNYPHGLRPLQRIGLGLLLASMAMAVAALVEIKRLRTAHA  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMK MSTGL LST+
Sbjct  450   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG+  PW+AD LN+G+LY+FYWL+AV+ A+N + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKFTGKAHPWIADDLNKGRLYNFYWLVAVLVAINFLIFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLAE GIE+++E  IP GH
Sbjct  567   YKEKRLAEAGIEMDDEPSIPMGH  589



>ref|XP_002889915.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66174.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
Length=589

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/563 (66%), Positives = 457/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S C  ASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCEQASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER +M  FF+ F F INVGSLLAVTVLVY+Q
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKERSKMTYFFNRFFFCINVGSLLAVTVLVYVQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV AL +FL+GT RYRFKKL+GSP+TQ+AAV VAAWR R+LELP+
Sbjct  212   DDVGRKWGYGICAFAIVLALSVFLAGTNRYRFKKLIGSPMTQVAAVIVAAWRNRKLELPA  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE---GVSE--VNKWSISTLT  1101
             DP  LY+VDD++AA G  + K+ K+PH+++FR LD+AAI++   GV+    NKW++STLT
Sbjct  272   DPSYLYDVDDIIAAEGSMKGKQ-KLPHTEQFRSLDKAAIRDQEAGVTSNIFNKWTLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P ASMAVFYVG
Sbjct  331   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPASMAVFYVG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ + + +++ N P GL PLQRI +GL    + M  AALVE+KRL+ A S
Sbjct  390   GLLLTTALYDRVAIRLCKKLFNYPHGLRPLQRIGLGLLFGSMAMAVAALVELKRLRTANS  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMK MSTGL LST+
Sbjct  450   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG+  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKFTGKAHPWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLA++GIEL++E  IP GH
Sbjct  567   YKEKRLADVGIELDDEPSIPMGH  589



>ref|XP_010458634.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Camelina sativa]
Length=589

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/563 (66%), Positives = 455/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S C  A+G QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCEQATGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER QM  FF+ F F INVGSLLAVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKERSQMTYFFNRFFFCINVGSLLAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV AL +FL+GT RYRFKKLVGSP+TQ+AAV VAAWR R+LELP+
Sbjct  212   DDVGRKWGYGICAFAIVLALSVFLAGTNRYRFKKLVGSPMTQVAAVIVAAWRNRKLELPA  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY+VDD++AA G  + K+ K+PH+K++R LD+AAI++  + V     NKW++STLT
Sbjct  272   DPSYLYDVDDIIAAEGAMKGKQ-KLPHTKQYRALDKAAIRDQEAAVTSNVFNKWTLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP W T I+FWTVHAQL T SV+Q+ TMDRHM  SFE+P A+MA FYVG
Sbjct  331   DVEEVKQIVRMLPIWLTCILFWTVHAQLTTLSVAQSETMDRHMG-SFEIPPAAMAAFYVG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ + + +++ N P GL PLQRI +GL L+ + M  AALVEIKRL+ A +
Sbjct  390   GLLLTTAIYDRVAIRLCKKLFNYPHGLRPLQRIGLGLLLASMAMAVAALVEIKRLRTAHA  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMK MSTGL LST+
Sbjct  450   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG+  PW+AD LN+G+LY+FYWL+AV+ A+N + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKFTGKAHPWIADDLNKGRLYNFYWLVAVLVAINFLIFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLAE GIE+++E  IP GH
Sbjct  567   YKEKRLAEAGIEMDDEPSIPMGH  589



>ref|XP_003608752.1| Nitrate transporter [Medicago truncatula]
 gb|AES90949.1| peptide/nitrate transporter [Medicago truncatula]
Length=593

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/558 (68%), Positives = 461/558 (83%), Gaps = 13/558 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S+AMILGVEACERLTT+GI +NLVTYLT TMHLGNA +AN+VTNF+G  FML LLGGFVA
Sbjct  33    SSAMILGVEACERLTTMGIAVNLVTYLTGTMHLGNASSANIVTNFMGTCFMLCLLGGFVA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTF+GRYLTI IF TV+A GVTILTISTIIPSL PPKC+  +  SC PA+  QL VLY+A
Sbjct  93    DTFIGRYLTIAIFATVEAIGVTILTISTIIPSLHPPKCTKSNLKSCEPANNIQLTVLYIA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALG GGLKSSVSG G+DQFD++++ E+  MVKFF+WF FFI++GSL AVT+LVYIQ
Sbjct  153   LYVTALGIGGLKSSVSGFGSDQFDETNEVEKNHMVKFFNWFFFFISIGSLTAVTILVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR WGYG+C CAIV AL +FL GT+RYRFKKL GSPLTQIA VYVAAWRKR +ELP 
Sbjct  213   DHVGRDWGYGMCVCAIVVALCVFLYGTKRYRFKKLAGSPLTQIAVVYVAAWRKRNMELPY  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIK--MPHSKEFRFLDRAAIKEGVSE------VNKWSIS  1110
             D  LL+NVDD+     D+  +K K  +PHSK+FRFLD+AAIK+  ++      V KW +S
Sbjct  273   DSSLLFNVDDI----EDEMLRKKKQVLPHSKQFRFLDKAAIKDPKTDGNEINVVRKWYLS  328

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK ++RMLP WATTIMFWTV+AQ+ TFSVSQA T++RH+ KSF++P AS+  F
Sbjct  329   TLTDVEEVKLVLRMLPIWATTIMFWTVYAQMTTFSVSQATTLNRHIGKSFQIPPASLTAF  388

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             ++G IL+TI +YDR++VPI R++  NPQGL+PLQRI VGL  S+  M+AAAL E+KR+++
Sbjct  389   FIGSILLTIPIYDRVIVPITRKIFKNPQGLTPLQRIGVGLVFSIFAMVAAALTELKRMRM  448

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A  H LT +P + +PMSVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  449   AHLHNLTHNPNSEIPMSVFWLIPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  508

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LG FFSS+LVT+V KVT + KPWLAD+LN+ KLY+FYWLLA++S LNL+ +L C+ 
Sbjct  509   STLSLGFFFSSLLVTLVHKVTSQHKPWLADNLNEAKLYNFYWLLALLSVLNLVIYLLCAN  568

Query  389   GYVYKEKRLAEMGIELEE  336
              YVYK+KRLAE GIELEE
Sbjct  569   WYVYKDKRLAEEGIELEE  586



>ref|XP_009376056.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=597

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/548 (69%), Positives = 460/548 (84%), Gaps = 8/548 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +A MILG EACERLTTLGI +NLV YLT TMHLGNA +AN VTNFLG SF+L LLGGFVA
Sbjct  37    AATMILGGEACERLTTLGIAVNLVNYLTGTMHLGNATSANTVTNFLGTSFILCLLGGFVA  96

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-SCVPASggqlgvlyla  1626
             DTFLGRYLTI IF T+QA GVT+LTISTI+PSL+PPKC+  +   C+ +SG QL VLY+A
Sbjct  97    DTFLGRYLTIAIFATIQATGVTVLTISTIVPSLRPPKCTDGTVLPCITSSGKQLTVLYIA  156

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKS VSG G+DQFDDSDK+ER QM  FF+WF FFI++GSL AVTVLVYI+
Sbjct  157   LYLTALGTGGLKSGVSGFGSDQFDDSDKQERKQMANFFNWFFFFISIGSLAAVTVLVYIE  216

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+CACAIV  L++FLSGTRRYRFKKLVGSPLTQIA V+V AW+KR  ELP+
Sbjct  217   DNLGRQWGYGICACAIVLGLIVFLSGTRRYRFKKLVGSPLTQIAGVFVGAWKKRNKELPT  276

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE------VNKWSISTL  1104
             D  LLYNVDD+      ++ K+ ++PHS +FRFLD+AAIK+  +E      VNKWS+STL
Sbjct  277   DLTLLYNVDDIDDGKKKKKKKQ-ELPHSNQFRFLDKAAIKDPKTEGGKTAIVNKWSLSTL  335

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK +IRMLP WATTIMFWT++AQ+ TFSVSQA TM+RH+ KSF++P AS+  F+V
Sbjct  336   TDVEEVKMIIRMLPIWATTIMFWTIYAQMTTFSVSQATTMNRHIGKSFQIPPASLTAFFV  395

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDRI+VP+ R +LNNPQGL+PLQRI VGL  S+  M+AAAL E+KR+  AR
Sbjct  396   GSILLTVPVYDRIIVPVARNLLNNPQGLTPLQRIGVGLVFSIFSMVAAALTEVKRMNAAR  455

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             +HGL  +P A +P+SVFWL  Q+  VGSGEA  Y+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  456   AHGLAGNPKAEIPLSVFWLVPQFFFVGSGEAFMYIGQLDFFLRECPKGMKTMSTGLFLST  515

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG F SS+LV++V KVTG++KPWLA+++NQGKLYDFYWLLA++SALNL+ +LFC+  Y
Sbjct  516   LSLGFFVSSLLVSLVHKVTGDRKPWLANNINQGKLYDFYWLLALLSALNLVVYLFCANWY  575

Query  383   VYKEKRLA  360
             VYK+KRLA
Sbjct  576   VYKDKRLA  583



>ref|XP_009382411.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/560 (69%), Positives = 461/560 (82%), Gaps = 16/560 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE CER+TTLGI +NLVTYLT TMHLGNA +ANVVTNFLG SFML LLGGFVA
Sbjct  35    SAAMILGVELCERMTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFMLCLLGGFVA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlyla  1626
             DT+LGRYLTI IFT +QA+GVTILTIST  P L+PP+CS P  G CV A+G QLGVLYL 
Sbjct  95    DTYLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPECSNPLGGGCVTANGTQLGVLYLG  154

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+ D+ E+ QM++FFSWF FFI++G+L+AVTVLVYIQ
Sbjct  155   LYLTALGTGGLKSSVSGFGSDQFDEGDRAEKKQMMRFFSWFFFFISIGALMAVTVLVYIQ  214

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+GRRWGYG+CA AIV  L +FLSGT RYRFK+LVGSPL+QIA+V V+AWRKRRL++P 
Sbjct  215   DNVGRRWGYGICAVAIVAGLAVFLSGTSRYRFKRLVGSPLSQIASVVVSAWRKRRLDVP-  273

Query  1265  DPELLYNVDDVVAAAGD-QEHKKIKMPHSKEFRFLDRAAIKEGVSEVN--KWSISTLTDV  1095
             D  +L+++D     +      KK ++ H+K+FRFLDRAAI EG + V+  KW +STLTDV
Sbjct  274   DSSMLHDIDTAEGCSAPYSNKKKQRLLHTKQFRFLDRAAIVEGDATVDQTKWRLSTLTDV  333

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGI  915
             EEVKQ+IRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  SFE+PA S+ VF+VG I
Sbjct  334   EEVKQVIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIGPSFEIPAGSLTVFFVGSI  393

Query  914   LVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHG  735
             L+T+ +YDR++VP  RR+  NPQG++PLQRIAVGL LS+V M AAAL E KRL+ AR+  
Sbjct  394   LITVPIYDRLIVPAARRLTGNPQGVTPLQRIAVGLVLSIVAMCAAALTERKRLRAART--  451

Query  734   LTADP-AATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
                DP AA VP++VFWL  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++
Sbjct  452   ---DPTAAVVPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLS  508

Query  557   LGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             LG F SS LVTIV KVTGE  K  WL D+LN+GKLYDFYWLLAV+S LNL+ F   +RGY
Sbjct  509   LGFFLSSTLVTIVHKVTGESGKGAWLPDNLNKGKLYDFYWLLAVLSVLNLVVFAAAARGY  568

Query  383   VYKEKRLAE---MGIELEEE  333
             VYKEKR+ +    G+EL EE
Sbjct  569   VYKEKRMGDESVNGVELAEE  588



>ref|NP_563899.1| nitrate transporter 1.1 [Arabidopsis thaliana]
 sp|Q05085.1|PTR7_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.3; Short=AtNPF6.3; AltName: 
Full=Nitrate transporter 1.1; Short=AtNRT1; AltName: 
Full=Nitrate/chlorate transporter; AltName: Full=Protein CHLORINA 
1 [Arabidopsis thaliana]
 pdb|4CL4|A Chain A, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana.
 pdb|4CL4|B Chain B, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana.
 pdb|4CL5|A Chain A, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana In Complex With Nitrate.
 pdb|4CL5|B Chain B, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana In Complex With Nitrate.
 gb|AAA32770.1| CHL1 [Arabidopsis thaliana]
 gb|AAC17604.1| Identical to nitrate/chlorate transporter cDNA gb|L10357 from 
A. thaliana. ESTs gb|H37533 and gb|R29790, gb|T46117, gb|T46068, 
gb|T75688, gb|R29817, gb|R29862, gb|Z34634 and gb|Z34258 
come from this gene [Arabidopsis thaliana]
 gb|AAN72027.1| putative NPK1-related protein kinase 2 [Arabidopsis thaliana]
 gb|AAP68222.1| At1g12110 [Arabidopsis thaliana]
 dbj|BAH20163.1| AT1G12110 [Arabidopsis thaliana]
 gb|AEE28838.1| nitrate transporter 1.1 [Arabidopsis thaliana]
Length=590

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/563 (66%), Positives = 456/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  33    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S C  ASG QL VLYLA
Sbjct  93    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCEQASGIQLTVLYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER +M  FF+ F F INVGSLLAVTVLVY+Q
Sbjct  153   LYLTALGTGGVKASVSGFGSDQFDETEPKERSKMTYFFNRFFFCINVGSLLAVTVLVYVQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV AL +FL+GT RYRFKKL+GSP+TQ+AAV VAAWR R+LELP+
Sbjct  213   DDVGRKWGYGICAFAIVLALSVFLAGTNRYRFKKLIGSPMTQVAAVIVAAWRNRKLELPA  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE---GVSE--VNKWSISTLT  1101
             DP  LY+VDD++AA G  + K+ K+PH+++FR LD+AAI++   GV+    NKW++STLT
Sbjct  273   DPSYLYDVDDIIAAEGSMKGKQ-KLPHTEQFRSLDKAAIRDQEAGVTSNVFNKWTLSTLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ T+DR +  SFE+P ASMAVFYVG
Sbjct  332   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETLDRSIG-SFEIPPASMAVFYVG  390

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ + + +++ N P GL PLQRI +GL    + M  AALVE+KRL+ A +
Sbjct  391   GLLLTTAVYDRVAIRLCKKLFNYPHGLRPLQRIGLGLFFGSMAMAVAALVELKRLRTAHA  450

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMK MSTGL LST+
Sbjct  451   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTL  507

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG+  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  508   ALGFFFSSVLVTIVEKFTGKAHPWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYV  567

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLAE+GIEL++E  IP GH
Sbjct  568   YKEKRLAEVGIELDDEPSIPMGH  590



>pdb|4OH3|A Chain A, Crystal Structure Of A Nitrate Transporter
 pdb|4OH3|B Chain B, Crystal Structure Of A Nitrate Transporter
Length=599

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/563 (66%), Positives = 456/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  33    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S C  ASG QL VLYLA
Sbjct  93    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCEQASGIQLTVLYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER +M  FF+ F F INVGSLLAVTVLVY+Q
Sbjct  153   LYLTALGTGGVKASVSGFGSDQFDETEPKERSKMTYFFNRFFFCINVGSLLAVTVLVYVQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV AL +FL+GT RYRFKKL+GSP+TQ+AAV VAAWR R+LELP+
Sbjct  213   DDVGRKWGYGICAFAIVLALSVFLAGTNRYRFKKLIGSPMTQVAAVIVAAWRNRKLELPA  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE---GVSE--VNKWSISTLT  1101
             DP  LY+VDD++AA G  + K+ K+PH+++FR LD+AAI++   GV+    NKW++STLT
Sbjct  273   DPSYLYDVDDIIAAEGSMKGKQ-KLPHTEQFRSLDKAAIRDQEAGVTSNVFNKWTLSTLT  331

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ T+DR +  SFE+P ASMAVFYVG
Sbjct  332   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETLDRSIG-SFEIPPASMAVFYVG  390

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ + + +++ N P GL PLQRI +GL    + M  AALVE+KRL+ A +
Sbjct  391   GLLLTTAVYDRVAIRLCKKLFNYPHGLRPLQRIGLGLFFGSMAMAVAALVELKRLRTAHA  450

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMK MSTGL LST+
Sbjct  451   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTL  507

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG+  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  508   ALGFFFSSVLVTIVEKFTGKAHPWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYV  567

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLAE+GIEL++E  IP GH
Sbjct  568   YKEKRLAEVGIELDDEPSIPMGH  590



>ref|XP_010933692.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=600

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/561 (69%), Positives = 456/561 (81%), Gaps = 11/561 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE CERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG+SFML LLGGF+A
Sbjct  35    SAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATSANTVTNFLGSSFMLCLLGGFLA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlyla  1626
             D+FLGRYLTI IFT VQA+G TILTIST  P L+PP C+ P +G CV ASG QLGVLYLA
Sbjct  95    DSFLGRYLTIAIFTAVQASGTTILTISTAAPGLRPPACADPSAGGCVRASGAQLGVLYLA  154

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SD+ E+ QM++FFSWF FFI++GSLLAVTVLVYIQ
Sbjct  155   LYLTALGTGGLKSSVSGFGSDQFDESDRGEKRQMMRFFSWFFFFISLGSLLAVTVLVYIQ  214

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGRRWGYG+CA AI+  L +FLSGT RYRFKKLVGSPLTQIAAV VAAW+KR L+LPS
Sbjct  215   DNLGRRWGYGICAAAIMAGLAVFLSGTNRYRFKKLVGSPLTQIAAVVVAAWKKRHLDLPS  274

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS-EVNKWSISTLTDVEE  1089
             DP  L++VD  V     +  +K ++PHS++FRFLDRAAI E  + E +KW +STLTDVEE
Sbjct  275   DPSFLHDVDAAVDGGKGESKEKQRLPHSQQFRFLDRAAITEDPAIEQSKWRLSTLTDVEE  334

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VKQ+IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDR +  SF++PA S+ VF+VG IL+
Sbjct  335   VKQVIRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRIGSSFQIPAGSLTVFFVGSILL  394

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV--ARSHG  735
             T+ +YDR++VP  RR+  N QGL+P QRIAVGL LS+  M+AAAL E KRL    A    
Sbjct  395   TVPVYDRLVVPSARRLTGNRQGLTPFQRIAVGLVLSIFAMVAAALTERKRLHAAWATDRS  454

Query  734   LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVAL  555
              +    ATVP+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST++L
Sbjct  455   SSVGRGATVPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSL  514

Query  554   GLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             G FFSS LV+IV KVTGE  +  WLAD+LN+G+LY+FYWLLAV+S +NL  FL  ++GYV
Sbjct  515   GFFFSSALVSIVHKVTGESGRGAWLADNLNEGRLYNFYWLLAVLSVVNLGVFLVSAKGYV  574

Query  380   YKEKRL-AEMG----IELEEE  333
             YKEKR+ AE G    +EL EE
Sbjct  575   YKEKRIEAEDGSVAAVELAEE  595



>ref|XP_010258991.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=592

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/550 (69%), Positives = 456/550 (83%), Gaps = 12/550 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE CERLTTLGI +NLVTYLT TMH GNA +AN VTNFLG SF+L LLGGFVA
Sbjct  32    SAAMILGVELCERLTTLGIAVNLVTYLTGTMHFGNASSANTVTNFLGTSFILCLLGGFVA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DTFLGRYLTI IF TVQA GVT+LTIST++PSL+PPKC+     C PA+  QL VLYLAL
Sbjct  92    DTFLGRYLTIAIFATVQATGVTLLTISTVVPSLRPPKCT-AGEPCTPANRLQLAVLYLAL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD+SDK+ER QM  FF+WF FFI++GSL AVT+LVY+QD
Sbjct  151   YLTALGTGGLKSSVSGFGSDQFDESDKKERTQMTNFFNWFFFFISIGSLAAVTLLVYVQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGRRWGYG+CA AI+  L++FL GTRRYRFK LVGSPLTQIA V+VAAWRKR ++LP D
Sbjct  211   NLGRRWGYGICATAILLGLIIFLCGTRRYRFKNLVGSPLTQIAKVFVAAWRKRHMDLPPD  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMP-HSKEFRFLDRAAIKE------GVSEVNK-WSIST  1107
             P LLY++ D V     ++ +K ++P HSK+FRFLD+AAIK+      G++E N+ W +ST
Sbjct  271   PSLLYDISDNVV--NHKQKRKQRLPRHSKQFRFLDKAAIKDPDVETRGLNEPNRRWWLST  328

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             LTDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++P AS+ VF+
Sbjct  329   LTDVEEVKIVIRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRHIGNSFQIPPASLTVFF  388

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+T+ +YDR++VP+ R++  NPQGL+PLQRI VGL +S   M AAAL E+KRL+ A
Sbjct  389   VGSILLTVPVYDRVIVPVARKLFKNPQGLTPLQRIGVGLVMSATAMAAAALTELKRLRAA  448

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             RS+GL  DP+A +P+SVFWL  Q+ +VGSGEA TY+GQL FFLRECP+GMKTMSTG+FLS
Sbjct  449   RSNGLADDPSAQIPLSVFWLVPQFFLVGSGEAFTYIGQLGFFLRECPEGMKTMSTGMFLS  508

Query  566   TVALGLFFSSVLVTIVGKVTGEKK-PWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             T++LG F SS+LV+IV KVTGE++ PWL+D+LNQGKLY+FYWLLAV+S LN   +L C+R
Sbjct  509   TLSLGFFLSSLLVSIVHKVTGERRPPWLSDNLNQGKLYNFYWLLAVLSVLNFGLYLVCAR  568

Query  389   GYVYKEKRLA  360
              YVYKE RLA
Sbjct  569   WYVYKESRLA  578



>ref|XP_009333673.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=596

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/548 (72%), Positives = 457/548 (83%), Gaps = 9/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +A MILG EACERLTTLGI +NLVTYLT TMHLG+A +AN VTNFLG SFML LLGGFVA
Sbjct  37    AATMILGGEACERLTTLGIAVNLVTYLTGTMHLGSATSANTVTNFLGTSFMLCLLGGFVA  96

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF T+QA GVTILTIST +PSLQPPKC+  +GS C+PASG QL VLY A
Sbjct  97    DTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQPPKCTAGTGSQCLPASGKQLTVLYTA  156

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SDK+ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  157   LYLTALGTGGLKSSVSGFGSDQFDESDKQERKQMTNFFNWFFFFISIGSLAAVTVLVYIQ  216

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+C CAIV  L++FLSGTRRYRFKKLVGSPLTQIA V+V AW+KR LELP 
Sbjct  217   DNLGRQWGYGICVCAIVLGLIVFLSGTRRYRFKKLVGSPLTQIAVVFVNAWKKRNLELPL  276

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEV-NKWSISTL  1104
             D  LLYNV D+    G  E KK  +PHSK+FRFLD+AAIKE     G + + NKWS+STL
Sbjct  277   DLTLLYNVGDI--DDGLTEKKKQMLPHSKQFRFLDKAAIKEPNIEGGKTTIGNKWSLSTL  334

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK +IRMLP WAT I+FWTV+AQ+ TFSVSQA +MDRH+ KS ++P AS+  F+V
Sbjct  335   TDVEEVKLIIRMLPIWATNIIFWTVYAQMTTFSVSQATSMDRHIGKSSQIPPASLTAFFV  394

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDRI+VP+ R+VLNNPQGL+PLQRI VGL  S   M+AAAL E+KRL  AR
Sbjct  395   GSILLTVPVYDRIIVPVARKVLNNPQGLTPLQRIGVGLVFSTFAMVAAALTEVKRLNAAR  454

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S GLT +P A +P+SVFWL  Q+  VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  455   SLGLTGNPTAEIPLSVFWLVPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  514

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG F SS+LV+IV  VTG+  PWLAD+LNQGKLYDFYWLLA++SALNL+ +LFC+  Y
Sbjct  515   LSLGFFVSSLLVSIVHNVTGDTNPWLADNLNQGKLYDFYWLLALLSALNLVVYLFCANWY  574

Query  383   VYKEKRLA  360
             VYK+KRLA
Sbjct  575   VYKDKRLA  582



>ref|XP_009333599.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=596

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/548 (72%), Positives = 457/548 (83%), Gaps = 9/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +A MILG EACERLTTLGI +NLVTYLT TMHLG+A +AN VTNFLG SFML LLGGFVA
Sbjct  37    AATMILGGEACERLTTLGIAVNLVTYLTGTMHLGSATSANTVTNFLGTSFMLCLLGGFVA  96

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF T+QA GVTILTIST +PSLQPPKC+  +GS C+PASG QL VLY A
Sbjct  97    DTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQPPKCTAGTGSQCLPASGKQLTVLYTA  156

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDSDK+ER QM  FF+WF FFI++GSL AVTVLVYIQ
Sbjct  157   LYLTALGTGGLKSSVSGFGSDQFDDSDKQERKQMTNFFNWFFFFISIGSLAAVTVLVYIQ  216

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYG+C CAIV  L++FLSGTRRYRFKKLVGSPLTQIA V+V AW+KR LELP 
Sbjct  217   DNLGRQWGYGICVCAIVLGLIVFLSGTRRYRFKKLVGSPLTQIAVVFVNAWKKRNLELPL  276

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEV-NKWSISTL  1104
             D  LLY+V D+    G  E KK  +PHSK+FRFLD+AAIKE     G + + NKWS+STL
Sbjct  277   DLTLLYDVGDI--DDGLTEKKKQMLPHSKQFRFLDKAAIKEPNIEGGKTTIGNKWSLSTL  334

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK +IRMLP WAT I+FWTV+AQ+ TFSVSQA +MDRH+ KS ++P AS+  F+V
Sbjct  335   TDVEEVKLIIRMLPIWATNIIFWTVYAQMTTFSVSQATSMDRHIGKSSQIPPASLTAFFV  394

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDRI+VP+ R+VLNNPQGL+PLQRI VGL  S   M+AAAL E+KRL  AR
Sbjct  395   GSILLTVPVYDRIIVPVARKVLNNPQGLTPLQRIGVGLVFSTFAMVAAALTEVKRLNAAR  454

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             SHGLT +P A +P+SVF L  Q+  VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  455   SHGLTGNPTAEIPLSVFSLVPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  514

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             ++LG F SS+LV+IV  VTG+  PWLAD+LNQGKLYDFYWLLA++SALNL+ +LFC+  Y
Sbjct  515   LSLGFFVSSLLVSIVHNVTGDTNPWLADNLNQGKLYDFYWLLALLSALNLVVYLFCANWY  574

Query  383   VYKEKRLA  360
             VYK+KRLA
Sbjct  575   VYKDKRLA  582



>gb|KHG03840.1| Uncharacterized protein F383_26454 [Gossypium arboreum]
Length=525

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/522 (70%), Positives = 445/522 (85%), Gaps = 6/522 (1%)
 Frame = -3

Query  1892  MHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRYLTIGIFTTVQAAGVtiltistii  1713
             MHLGNA +AN+VTNF G SFML LLGGF+ADTFLGRY TIGIFT VQA GVTILT+STII
Sbjct  1     MHLGNATSANIVTNFFGTSFMLCLLGGFIADTFLGRYFTIGIFTAVQATGVTILTVSTII  60

Query  1712  psLQPPKCSPESGS--CVPASggqlgvlylalyltalgtggLKSSVSGLGTDQFDDSDKR  1539
             P+L+PPKC+ E  +  C PASG QL VLYLALYLTALGTGGLKSSVSG G+DQFDD+D  
Sbjct  61    PTLRPPKCNREDITTICTPASGIQLSVLYLALYLTALGTGGLKSSVSGFGSDQFDDTDPE  120

Query  1538  ERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGLCACAIVGALVLFLSGTRR  1359
             ER QM  FF+WF FFI++GSL +VT+LVYIQDNLGR WGYG+ ACAIV  L++FLSGT+R
Sbjct  121   ERSQMSNFFNWFFFFISLGSLCSVTILVYIQDNLGRDWGYGIIACAIVIGLMVFLSGTKR  180

Query  1358  YRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDVVAAAGDQEHKKIKMPHSK  1179
             YRFKKLVGSPLTQIA+V+VAAWRK+ LELPSDP LL+N+DDV  A G +   K K+PH++
Sbjct  181   YRFKKLVGSPLTQIASVFVAAWRKKHLELPSDPSLLFNIDDV--AEGLKMKTKQKLPHTE  238

Query  1178  EFRFLDRAAIKE-GVSEVNKWSISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSV  1002
             +FRFLDRAAIK+  V + NKW+++TLTDVEEVK ++RMLP WATTI+FWTV+AQ+ TFSV
Sbjct  239   QFRFLDRAAIKDPSVIKANKWNLATLTDVEEVKLVLRMLPIWATTIIFWTVYAQMSTFSV  298

Query  1001  SQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRI  822
             SQA TMDRH+ K F++P AS+ VF+VG IL+T+ +YDR++VPI R+VL NPQGL+PLQRI
Sbjct  299   SQATTMDRHIGK-FQIPPASLTVFFVGAILLTVPIYDRLIVPIARKVLKNPQGLTPLQRI  357

Query  821   AVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTY  642
             AVGL LS++ M+AAAL+EIKR++VA ++GLT +P A +P+SVFWL  Q+L VG+GEA TY
Sbjct  358   AVGLVLSIIAMVAAALIEIKRMRVATTNGLTNNPTAQIPLSVFWLVPQFLFVGAGEAFTY  417

Query  641   VGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGK  462
             +GQLDFFLRECPKGMKTMSTGLFLST++LG F SS+LVTIV KV+G K PWL D+LNQG+
Sbjct  418   IGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFLSSLLVTIVDKVSGNKHPWLPDNLNQGR  477

Query  461   LYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLAEMGIELEE  336
             LYDFYWLLA++  LNL  +L  ++ YVYK+KRLA+ GIELEE
Sbjct  478   LYDFYWLLAILCCLNLAIYLVFAKWYVYKDKRLADEGIELEE  519



>ref|XP_010533775.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=642

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/556 (67%), Positives = 449/556 (81%), Gaps = 11/556 (2%)
 Frame = -3

Query  1961  VEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRY  1782
             +EA ERLTTLGIG+NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGF+ADTFLGRY
Sbjct  91    IEAVERLTTLGIGVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFIADTFLGRY  150

Query  1781  LTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlylalyltalg  1605
             LTI +F  VQA GVTILT+STIIP L+PPKC P  S SC  ASG QL VLYLALYLTALG
Sbjct  151   LTIAVFAAVQATGVTILTLSTIIPGLRPPKCDPTSSNSCEQASGVQLLVLYLALYLTALG  210

Query  1604  tggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRW  1425
             TGG+K+SVSG G+DQFD++D +ER QM  FF+ F F INVGSL AVTVLVYIQD++GR+W
Sbjct  211   TGGVKASVSGFGSDQFDETDPKERSQMTYFFNRFFFCINVGSLGAVTVLVYIQDDVGRKW  270

Query  1424  GYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYN  1245
             GYG+CA AIV AL++FLSGT+RYRFKKL GSPLTQIAAV VAAWRKRRL+LP+DP +L++
Sbjct  271   GYGVCAFAIVIALLVFLSGTKRYRFKKLSGSPLTQIAAVLVAAWRKRRLDLPADPSMLFD  330

Query  1244  VDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEVNKWSISTLTDVEEVKQ  1080
             +DD+V A G ++ K+ ++PHS++FR LD+AAIKE     G +  NKW++STLTDVEEVKQ
Sbjct  331   LDDIVMAEGSKKMKQ-RLPHSEQFRSLDKAAIKEQQDTIGPNLYNKWTLSTLTDVEEVKQ  389

Query  1079  LIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIM  900
             ++RMLP W+T I+FWTVHAQL T SV+Q+ TMDR +  SF++P ASMAVFYVGG+L T  
Sbjct  390   IVRMLPIWSTCILFWTVHAQLTTLSVAQSETMDRRIG-SFQIPPASMAVFYVGGLLFTTA  448

Query  899   MYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADP  720
             +YDR ++P  +  L  P GL+PLQRI +GL L+ + M+ AALVEIKRL+ A +H  T   
Sbjct  449   VYDRFVIPFTKNFLKKPNGLTPLQRIGLGLFLAFMAMVVAALVEIKRLRTAHAHDQTVK-  507

Query  719   AATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFS  540
               T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMS GL LST+ALG FFS
Sbjct  508   --TLPLGFYLLIPQYLIVGIGEALLYTGQLDFFLRECPKGMKTMSAGLLLSTLALGFFFS  565

Query  539   SVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLA  360
             SVLVTIV KVTG    W+AD+LN+G+LY+FYWL++V+ ALN + FL  S+ YVYK+KRLA
Sbjct  566   SVLVTIVHKVTGTTHAWIADNLNKGRLYNFYWLVSVLCALNFIVFLVFSKWYVYKDKRLA  625

Query  359   EMGIELEEETHIPGGH  312
             E+GIEL++E  IP  H
Sbjct  626   EVGIELDDEPDIPTCH  641



>emb|CDY21035.1| BnaA08g24900D [Brassica napus]
Length=575

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/563 (66%), Positives = 446/563 (79%), Gaps = 26/563 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S CV ASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCVQASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +E+ QM  FF+ F F INVGSL AVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKEQSQMTYFFNRFFFCINVGSLCAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA +IV AL +FL+GT RYRFKKL+GSP+TQ+A V VAAWR RRLELPS
Sbjct  212   DDVGRKWGYGICALSIVLALSVFLAGTNRYRFKKLIGSPMTQVATVIVAAWRNRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+AA G  + K+ K+PH+K+FR LD+AAIK   + +     NKW++STLT
Sbjct  272   DPSFLYDLDDVIAAEGAMKSKQ-KLPHTKQFRSLDKAAIKNQETAMTQNVFNKWTLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P ASMAVFYVG
Sbjct  331   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPASMAVFYVG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N P                 VGM  AALVEIKRL+ A S
Sbjct  390   GLLLTTAVYDRVAIPLCKKLFNYPHA---------------VGMAVAALVEIKRLRTAHS  434

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  435   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  491

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K T +  PW+AD LN+G+LY+FYWL+AV+  LN + FL  S+ YV
Sbjct  492   ALGFFFSSVLVTIVEKFTDKAHPWIADDLNKGRLYNFYWLVAVVVFLNFLIFLVFSKWYV  551

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YK+KRLAE+GIELE+ET IP GH
Sbjct  552   YKDKRLAELGIELEDETDIPMGH  574



>ref|XP_009411557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=595

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/558 (70%), Positives = 448/558 (80%), Gaps = 12/558 (2%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA ILGVE CERLTTLGI +NLVTYLT TMHLG+A +AN+VTNFLG SFML LLGGF+AD
Sbjct  36    AATILGVELCERLTTLGIAVNLVTYLTGTMHLGSAASANIVTNFLGTSFMLCLLGGFIAD  95

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlylal  1623
             T+LGRYLTI IFT VQA+GVTILTIST  P L+PP C    SG C  ASG QLGVLYL L
Sbjct  96    TYLGRYLTIAIFTAVQASGVTILTISTAAPGLRPPACDGSYSGGCARASGLQLGVLYLGL  155

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD++D  E+ QM KFFSWF FFI++GSL+AVTVLVYIQD
Sbjct  156   YLTALGTGGLKSSVSGFGSDQFDETDGAEKKQMTKFFSWFFFFISLGSLMAVTVLVYIQD  215

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG+CA AIV  LV+ LSGTRRYRFK+LVGSPLTQ+A V  +AWRKRRL LP+D
Sbjct  216   NLGRPWGYGICAVAIVFGLVVLLSGTRRYRFKRLVGSPLTQVAVVVASAWRKRRLALPAD  275

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE--GVSEVNKWSISTLTDVEE  1089
             P +LY++D  V    +   KK K+ HSK+FRFLDRAAI E    +E +K  +STLTDVEE
Sbjct  276   PSMLYDLDSNVGGV-ENNKKKQKLLHSKQFRFLDRAAIVEDDAATEQSKRRLSTLTDVEE  334

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VKQ+IRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDR +  SFE+PA S+ VF+VG IL+
Sbjct  335   VKQVIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRRIGPSFEIPAGSLTVFFVGSILL  394

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
             T+ +YDR++VP  RRV  NP GL+PLQRIAVGLALSV+ M AAAL E KRL  A +    
Sbjct  395   TVPVYDRLVVPAARRVTGNPHGLTPLQRIAVGLALSVLAMCAAALTERKRLAAAWTD--P  452

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
              D A  VP+SVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG 
Sbjct  453   TDTAGVVPLSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGF  512

Query  548   FFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF-CSRGYVY  378
             F SS LVTIV KVTGE  K  WL D LN+GKLYDFYWLLAV+S LNL+ F+   +RGYVY
Sbjct  513   FVSSALVTIVHKVTGESGKGAWLPDDLNKGKLYDFYWLLAVLSTLNLVVFVVAAARGYVY  572

Query  377   KEKRLAE---MGIELEEE  333
             KEKR A+    G+ELEEE
Sbjct  573   KEKRTADDSVDGVELEEE  590



>ref|XP_010906609.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=603

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/566 (68%), Positives = 453/566 (80%), Gaps = 20/566 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ERLTTLGI +NLVTYLT TMHLGNA AAN VTNF+G SFML LLGGFVA
Sbjct  35    SAAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAAAANTVTNFMGTSFMLCLLGGFVA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlyla  1626
             DTF+GRYLTI IF  VQA+GVTILTIST +P L+PPKC +  SG+C+ AS  QLGVLYLA
Sbjct  95    DTFIGRYLTIAIFAAVQASGVTILTISTAVPGLRPPKCPNMASGNCMKASPAQLGVLYLA  154

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+ +K E+ QM+KFF+WF FFI++GSLLAVTVLVYIQ
Sbjct  155   LYLTALGTGGLKSSVSGFGSDQFDEKNKEEKHQMMKFFNWFFFFISLGSLLAVTVLVYIQ  214

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+GRRWGYGLCA AIV  LV+FLSGTRRYRFKKLVGSPLTQIAAV VAAWRKR LELPS
Sbjct  215   DNIGRRWGYGLCAAAIVAGLVVFLSGTRRYRFKKLVGSPLTQIAAVVVAAWRKRGLELPS  274

Query  1265  DPELLYNVDDVVAAAGDQEHK--------KIKMPHSKEFRFLDRAAIK-EGVSEVNKWSI  1113
             DP +LY++D    ++G  E K        K ++PH+K+FRFLD AAI     +E +KW +
Sbjct  275   DPSMLYDID---GSSGQGEEKTSKKSTGEKQRLPHTKQFRFLDHAAITVNPTTEQSKWQL  331

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
             STLTDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDR++  SF++P  S+ V
Sbjct  332   STLTDVEEVKIVIRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRYIGPSFQIPPGSLTV  391

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+VG IL+T+ +YDRI+VP+ RR   NP GL+PLQRI VGL LS++ M AAAL EIKRL 
Sbjct  392   FFVGSILLTVPIYDRIVVPVSRRFTGNPHGLTPLQRIGVGLVLSILAMAAAALTEIKRLH  451

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             VARS+  T    ATVP+SVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLF
Sbjct  452   VARSNPNTIHKGATVPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLF  511

Query  572   LSTVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LST++LG F SS LVTIV KVTG+     WLAD+LN+GKLY+FYWLLAV+  +NL  +L 
Sbjct  512   LSTLSLGFFVSSALVTIVHKVTGKSGHGAWLADNLNRGKLYNFYWLLAVLCLVNLGLYLV  571

Query  398   CSRGYVYKEKRLAE-----MGIELEE  336
              ++ YVYKE R A       G+EL E
Sbjct  572   AAKWYVYKEGRTAAEDDSMAGVELTE  597



>emb|CDY15967.1| BnaC08g41560D [Brassica napus]
Length=574

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/563 (65%), Positives = 445/563 (79%), Gaps = 26/563 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C P + S CV ASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCDPTTSSHCVQASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER QM  FF+ F F INVGSLLAVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKERSQMTYFFNRFFFCINVGSLLAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV +L +FL+GT RYRFKKL+GSP+TQ+A V VAAWR RRLELPS
Sbjct  212   DDVGRKWGYGICALAIVLSLSIFLAGTNRYRFKKLIGSPMTQVATVLVAAWRNRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+AA G  + K+ K+PH+K+FR LD+AAIK+    +     NKW++ST+T
Sbjct  272   DPSFLYDLDDVIAAEGSMKSKQ-KLPHTKQFRSLDKAAIKDQEMAMTQNVHNKWTLSTVT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             D+EEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P A+MAVFY+G
Sbjct  331   DIEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPAAMAVFYIG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N P                  GM  AALVEIKRL+ A +
Sbjct  390   GLLLTTAVYDRLAIPLCKKLFNYPHA---------------TGMAVAALVEIKRLRTAHA  434

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+    L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  435   HGPTVK---TLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  491

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV KVT +  PW+AD LN+G+LY+FYWL+A++ ALN + FL  S+ YV
Sbjct  492   ALGFFFSSVLVTIVEKVTDKAHPWIADDLNKGRLYNFYWLVAIIVALNFLVFLVFSKWYV  551

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLA++GIELE+E  IP GH
Sbjct  552   YKEKRLADLGIELEDEPDIPMGH  574



>ref|XP_010476167.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/563 (66%), Positives = 454/563 (81%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S C  A+G QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCEQATGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +ER QM  FF+ F F INVGSLLAVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKERSQMTYFFNRFFFCINVGSLLAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV AL +FL+GT RYRFKKLVGSP+TQ+AAV VAAWR R+LELP+
Sbjct  212   DDVGRKWGYGICAFAIVLALSVFLAGTNRYRFKKLVGSPMTQVAAVIVAAWRNRKLELPA  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY+VDD++AA G  + K+ K+PH+K++R LD+AAI++  + V     NKW++STLT
Sbjct  272   DPSYLYDVDDIIAAEGAMKGKQ-KLPHTKQYRALDKAAIRDQEAAVTSNVFNKWTLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP W T I+FWTVHAQL T SV+QA TMDRHM  SFE+P A+MA FYVG
Sbjct  331   DVEEVKQIVRMLPIWLTCILFWTVHAQLTTLSVAQAETMDRHMG-SFEIPPAAMAAFYVG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ + + +++ N P GL PLQRI +GL L+ + M  AAL+EIKRL+ A +
Sbjct  390   GLLLTTALYDRVAIRLCKKLFNYPHGLRPLQRIGLGLLLASLAMAVAALIEIKRLRTAHA  449

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMK MSTGL LST+
Sbjct  450   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTL  506

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K TG   PW+AD LN+G+LY+FYWL+AV+ A+N + FL  S+ YV
Sbjct  507   ALGFFFSSVLVTIVEKFTGTAHPWIADDLNKGRLYNFYWLVAVLVAINFLIFLVFSKWYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLAE GIE+++E  IP GH
Sbjct  567   YKEKRLAEAGIEMDDEPSIPMGH  589



>emb|CDY31242.1| BnaC08g15370D [Brassica napus]
Length=575

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/563 (66%), Positives = 445/563 (79%), Gaps = 26/563 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C+P + S CV ASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCVQASGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD+++ +E+ QM  FF+ F F INVGSL AVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDETEPKEQSQMTYFFNRFFFCINVGSLCAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA +IV AL +FL+GT RYRFKKL+GSP+TQ+A V VAAWR RRLELPS
Sbjct  212   DDVGRKWGYGICALSIVLALSVFLAGTNRYRFKKLIGSPMTQVATVIVAAWRNRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+A  G  + K+ K+PH+K+FR LD+AAIK   + +     NKW++STLT
Sbjct  272   DPSFLYDLDDVIAGEGAMKSKQ-KLPHTKQFRSLDKAAIKNQETAMTQNVFNKWTLSTLT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P ASMAVFYVG
Sbjct  331   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPASMAVFYVG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N PQ +               GM  AALVEIKRL+ A S
Sbjct  390   GLLLTTALYDRVAIPLCKKLFNYPQAM---------------GMAVAALVEIKRLRTAHS  434

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  435   HGPTVK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  491

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV K T +  PW+AD LN+G+LY+FYWL+AV+  LN + FL  S+ YV
Sbjct  492   ALGFFFSSVLVTIVEKFTDKAHPWIADDLNKGRLYNFYWLVAVVVFLNFLIFLVFSKWYV  551

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YK+KRLAE+GIELE+E  IP GH
Sbjct  552   YKDKRLAELGIELEDERDIPMGH  574



>ref|XP_009382412.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/557 (67%), Positives = 441/557 (79%), Gaps = 14/557 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA ILGVE  ERLTTLGI +NLVTY T TMHLG A +AN++TNFLG SF+L L GGF+AD
Sbjct  36    AAAILGVEMGERLTTLGIAVNLVTYPTGTMHLGGADSANIITNFLGTSFILCLFGGFIAD  95

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlylal  1623
             TFLGRYLTI +FT VQA GV ILTIST+ P L+PP C+ P SG CVPA+G Q+G+LYL L
Sbjct  96    TFLGRYLTIAVFTAVQACGVIILTISTVAPGLRPPACAGPSSGGCVPANGLQMGMLYLGL  155

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             + TALGTGGLKSSVSG G+DQFD+SD+ E+ QM+KFF +F FFINVGS+LAVTV+VYIQD
Sbjct  156   FTTALGTGGLKSSVSGFGSDQFDESDRIEKKQMMKFFRYFFFFINVGSILAVTVMVYIQD  215

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             + GRRWGYG+CA AI+  L LFLS T RYRFKKLVGSPLTQ AAV   AWRKRRL LP D
Sbjct  216   HFGRRWGYGICAVAIIAGLALFLSKTNRYRFKKLVGSPLTQFAAVVACAWRKRRLALPED  275

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEG--VSEVNKWSISTLTDVEE  1089
             P +LY++D  VA  G  + KK K+PHS++FRFLDRAAI EG   +E +KW +STLTDVEE
Sbjct  276   PSILYDIDTGVARKG--KSKKEKVPHSQQFRFLDRAAIIEGDAPTEQSKWRLSTLTDVEE  333

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VKQ+IRMLPTWATTIMFWTV+AQ+ TFSVSQA TMDRH+  SFE+PA S+ VF+VG ILV
Sbjct  334   VKQVIRMLPTWATTIMFWTVYAQMTTFSVSQATTMDRHIGPSFEIPAGSLTVFFVGSILV  393

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
             T+  YDRI+VP+ RR+  NPQGLS LQRIAVGL  S++GM AA+L E KRL  A    L 
Sbjct  394   TVPFYDRIVVPVTRRITGNPQGLSSLQRIAVGLVFSILGMCAASLTERKRLSTA----LA  449

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
                AA VP+ VFWL  Q+ +VG+G A  Y+GQLDFFLRECPKGMKTMSTGLFLST++LG 
Sbjct  450   NPTAAVVPLVVFWLIPQFFLVGAGVAFMYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGF  509

Query  548   FFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             F S+ LVTIV KVTG   K  WL D LN+GKLY+FYWLL  +S LNL+AF+  SRGYVYK
Sbjct  510   FLSTALVTIVHKVTGSGGKGAWLTDDLNKGKLYNFYWLLVALSTLNLVAFVAASRGYVYK  569

Query  374   EKRLA---EMGIELEEE  333
             E R +     G+ELE++
Sbjct  570   ETRTSVDDAQGVELEQQ  586



>emb|CDY26539.1| BnaA09g47380D [Brassica napus]
Length=574

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/563 (65%), Positives = 445/563 (79%), Gaps = 26/563 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNFLG SFML LLGGF+A
Sbjct  32    SAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF  +QA GV+ILT+STIIP L+PP+C P + S CV A+G QL VLYLA
Sbjct  92    DTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCDPTTSSHCVQANGIQLTVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFDD++ +ER QM  FF+ F F INVGSL+AVTVLVYIQ
Sbjct  152   LYLTALGTGGVKASVSGFGSDQFDDTEPKERSQMTYFFNRFFFCINVGSLMAVTVLVYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV +L +FL+GT RYRFKKL+GSP+TQ+A V VAAWR RRLELPS
Sbjct  212   DDVGRKWGYGICALAIVLSLSIFLAGTNRYRFKKLIGSPMTQVATVLVAAWRNRRLELPS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV-----NKWSISTLT  1101
             DP  LY++DDV+AA G  + K+ K+PH+ +FR LD+AAIK+    +     NKW++ST+T
Sbjct  272   DPSFLYDLDDVIAAEGSMKSKQ-KLPHTNQFRSLDKAAIKDQEMAMTQNVYNKWTLSTVT  330

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             D+EEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDRH+  SFE+P A+MAVFY+G
Sbjct  331   DIEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRHIG-SFEIPPAAMAVFYIG  389

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR+ +P+ +++ N P  +               GM  AALVEIKRL+ A +
Sbjct  390   GLLLTTAVYDRLAIPLCKKLFNYPHAM---------------GMAVAALVEIKRLRTAHA  434

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T     T+P+    L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  435   HGPTVK---TLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  491

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG FFSSVLVTIV KVT +  PW+AD LN+G+LY+FYWL+AV+ ALN + FL  S+ YV
Sbjct  492   ALGFFFSSVLVTIVEKVTDKAHPWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYV  551

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLA++GIELE+E  IP GH
Sbjct  552   YKEKRLADLGIELEDEPDIPMGH  574



>ref|XP_010553465.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=589

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/563 (66%), Positives = 453/563 (80%), Gaps = 11/563 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL +EA ERLTTLGIG+NLVTYL  TMHLGNA +AN VTNF+G SFML LLGGFVA
Sbjct  31    SAAMILCIEAVERLTTLGIGVNLVTYLKGTMHLGNATSANTVTNFIGTSFMLCLLGGFVA  90

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRY+TI IF T+QA GVTILT+STIIP L+PPKC P  S SCV ASG QL VLY+A
Sbjct  91    DTFLGRYMTIAIFATIQATGVTILTLSTIIPGLRPPKCDPTSSNSCVQASGMQLLVLYIA  150

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGG+K+SVSG G+DQFD++D +ER QM  FF+ F FFINVGSL AVTVLVYIQ
Sbjct  151   LYLTALGTGGVKASVSGFGSDQFDETDPKERSQMTYFFNRFFFFINVGSLGAVTVLVYIQ  210

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR+WGYG+CA AIV AL++FLSGT+RYRFKKL+GSPLTQIAAV++AAW+KRRLELP+
Sbjct  211   DDVGRKWGYGVCAFAIVFALLVFLSGTKRYRFKKLIGSPLTQIAAVFIAAWQKRRLELPA  270

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEVNKWSISTLT  1101
             DP L +++DD+V +   ++ K+ ++PH+++FR LD+AAIKE     G +  NKW++STLT
Sbjct  271   DPSLFFDLDDIVTSEVSKKMKQ-RLPHTEQFRSLDKAAIKEQQDTIGPNLYNKWTLSTLT  329

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVKQ++RMLP WAT I+FWTVHAQL T SV+Q+ TMDR +  SF++P ASMAVFYVG
Sbjct  330   DVEEVKQIVRMLPIWATCILFWTVHAQLTTLSVAQSETMDRRVG-SFQIPPASMAVFYVG  388

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             G+L+T  +YDR ++P  ++ L  P GL+PLQRI +GL  +   M  AALVEIKRL+ A S
Sbjct  389   GLLLTTAVYDRFVIPFTKKFLKKPNGLTPLQRIGIGLLFASFAMAVAALVEIKRLRTAHS  448

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             H  T     T+P+  + L  QYLIVG GEAL Y GQLDFFLRECPKGMKTMSTGL LST+
Sbjct  449   HSPTDK---TLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTL  505

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             ALG F SSVLV IV KVTG    W+A+ LN+G+LY+FYWL+AV+ ALN   FL  ++ YV
Sbjct  506   ALGFFLSSVLVAIVHKVTGTAHAWIANDLNKGRLYNFYWLVAVLCALNFAVFLVFAKWYV  565

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YK+KRLAE+GIEL++E  IP  H
Sbjct  566   YKDKRLAEVGIELDDEPEIPTCH  588



>ref|XP_003611284.1| Nitrate transporter [Medicago truncatula]
 gb|AES94242.1| peptide/nitrate transporter [Medicago truncatula]
Length=583

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/551 (64%), Positives = 439/551 (80%), Gaps = 8/551 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SA+MILG E  ERLTTLGI +NLVTYLT TMHLGNA +AN+VTNF+G SFML L GGF+ 
Sbjct  35    SASMILGGEVMERLTTLGITVNLVTYLTGTMHLGNASSANIVTNFVGTSFMLCLFGGFLG  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DT++GRYL I +F  VQA GV +L ISTIIPSL PP C  E  +CV A+  QL VL+LAL
Sbjct  95    DTYIGRYLNIAVFAAVQATGVALLMISTIIPSLSPPTCK-EHTTCVKANNTQLTVLFLAL  153

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSV G G+DQFD +DK E+  MVKF +W+ F +N+GSL+AVTVLVYIQD
Sbjct  154   YVTALGTGGLKSSVPGFGSDQFDATDKEEKKHMVKFLNWYYFIVNLGSLMAVTVLVYIQD  213

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             + GR WGYG+CAC+IV ALV+FL GT +YR+KK VGSPLTQIA V+VAAWRKR L+LPSD
Sbjct  214   HQGRDWGYGICACSIVLALVVFLFGTCKYRYKKPVGSPLTQIAVVFVAAWRKRHLQLPSD  273

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEVNKWSISTLTD  1098
               LL+N D ++        KK ++PHSK+FRFLD+AAIK+     G+ +++KW +STLTD
Sbjct  274   SALLFNDDAILHEP--PRIKKQRLPHSKQFRFLDKAAIKDYESAGGIVKISKWCLSTLTD  331

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             +EEVK ++RMLP WA+TI+FWTV  Q+MT SVSQA TMDRH+ KSF++PAASM  F +G 
Sbjct  332   IEEVKLVLRMLPIWASTIVFWTVQVQMMTLSVSQATTMDRHIGKSFQIPAASMTSFLIGT  391

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+ +  YDR++ PI R+VL NPQGL+PLQ   VGL LS++ M+AAALVE KRL  A+SH
Sbjct  392   ILLNVPFYDRVICPIARKVLKNPQGLTPLQHTGVGLVLSILSMVAAALVEEKRLIFAQSH  451

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GL  DP A +P+SVFWL  Q+ IVGSGE+  Y+GQLDFFLRECP GMKTMS GLFLS+ +
Sbjct  452   GLVNDPTAKIPLSVFWLIPQFFIVGSGESFMYMGQLDFFLRECPDGMKTMSMGLFLSSRS  511

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFSS+LV+ V K+TG  KPW+AD+LNQG+L  +YWLLA++SA+NLM +L C++ YVY
Sbjct  512   LGFFFSSLLVSTVNKITGPSKPWIADNLNQGRLNYYYWLLAMLSAINLMIYLACAKWYVY  571

Query  377   KEKRLAEMGIE  345
             K+K++AE G+E
Sbjct  572   KDKKVAEEGME  582



>ref|XP_003538742.1| PREDICTED: nitrate transporter 1.1 [Glycine max]
Length=586

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/554 (68%), Positives = 449/554 (81%), Gaps = 14/554 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             ++AMILG E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNFLG SFML LLGGF+A
Sbjct  33    ASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFMLCLLGGFLA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTFLGRY TI IF  VQA GVTILTISTIIPSL PPKC+ ++   CV A+  QL VLYLA
Sbjct  93    DTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCNGDTVPPCVRANEKQLTVLYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG G+DQFDDSD  E+ QM+KFF+WF FF+++GSL A TVLVY+Q
Sbjct  153   LYVTALGTGGLKSSVSGFGSDQFDDSDDDEKKQMIKFFNWFYFFVSIGSLAATTVLVYVQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+GR WGYG+CA AIV AL++FLSGTR+YRFKKLVGSPLTQ A V+VAA RKR +ELPS
Sbjct  213   DNIGRGWGYGICAGAIVVALLVFLSGTRKYRFKKLVGSPLTQFAEVFVAALRKRNMELPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE----GVSEVNKWSISTLTD  1098
             D  LL+N         D + KK  +PHSK+FRFLD+AAI +    G     KW + TLTD
Sbjct  273   DSSLLFN---------DYDPKKQTLPHSKQFRFLDKAAIMDSSECGGGMKRKWYLCTLTD  323

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK ++RMLP WATTIMFWT+HAQ+ TFSVSQA TMDRH+ K+F++PAASM VF +G 
Sbjct  324   VEEVKMILRMLPIWATTIMFWTIHAQMTTFSVSQATTMDRHIGKTFQMPAASMTVFLIGT  383

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+  YDR +VP+ ++VL NP G +PLQRI VGL LSVV M+  AL+EIKRL+ A+SH
Sbjct  384   ILLTVPFYDRFIVPVAKKVLKNPHGFTPLQRIGVGLVLSVVSMVVGALIEIKRLRYAQSH  443

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GL   P A +PM+VFWL  Q L VG+GEA  Y+GQLDFFLRECPKGMKTMSTGLFLST++
Sbjct  444   GLVDKPEAKIPMTVFWLIPQNLFVGAGEAFMYMGQLDFFLRECPKGMKTMSTGLFLSTLS  503

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFS++LV+IV K+T   +PWLAD+LNQG+LYDFYWLLA++SA+N++ +L C++ YVY
Sbjct  504   LGFFFSTLLVSIVNKMTAHGRPWLADNLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVY  563

Query  377   KEKRLAEMGIELEE  336
             KEKRLAE  IELEE
Sbjct  564   KEKRLAEECIELEE  577



>gb|KHN34951.1| Nitrate transporter 1.1 [Glycine soja]
Length=586

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/554 (68%), Positives = 449/554 (81%), Gaps = 14/554 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             ++AMILG E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNFLG SFML LLGGF+A
Sbjct  33    ASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFMLCLLGGFLA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlyla  1626
             DTFLGRY TI IF  VQA GVTILTISTIIPSL PPKC+ ++   CV A+  QL VLYLA
Sbjct  93    DTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCNGDTVPPCVRANEKQLTVLYLA  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY+TALGTGGLKSSVSG G+DQFDDSD  E+ QM+KFF+WF FF+++GSL A TVLVY+Q
Sbjct  153   LYVTALGTGGLKSSVSGFGSDQFDDSDDDEKKQMIKFFNWFYFFVSIGSLAATTVLVYVQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+GR WGYG+CA AIV AL++FLSGTR+YRFKKLVGSPLTQ A V+VAA RKR +ELPS
Sbjct  213   DNIGRGWGYGICAGAIVVALLVFLSGTRKYRFKKLVGSPLTQFAEVFVAALRKRNMELPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE----GVSEVNKWSISTLTD  1098
             D  LL+N         D + KK  +PHSK+FRFLD+AAI +    G     KW + TLTD
Sbjct  273   DSSLLFN---------DYDPKKQTLPHSKQFRFLDKAAIMDSSECGGGMKRKWYLCTLTD  323

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK ++RMLP WATTIMFWT+HAQ+ TFSVSQA TMDRH+ K+F++PAASM VF +G 
Sbjct  324   VEEVKMILRMLPIWATTIMFWTIHAQMTTFSVSQATTMDRHIGKTFQMPAASMTVFLIGT  383

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+  YDR +VP+ ++VL NP G +PLQRI VGL LSVV M+  AL+EIKRL+ A+SH
Sbjct  384   ILLTVPFYDRFIVPVAKKVLKNPHGFTPLQRIGVGLVLSVVSMVVGALIEIKRLRYAQSH  443

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GL   P A +PM+VFWL  Q L VG+GEA  Y+GQL+FFLRECPKGMKTMSTGLFLST++
Sbjct  444   GLVDKPEAKIPMTVFWLIPQNLFVGAGEAFMYMGQLNFFLRECPKGMKTMSTGLFLSTLS  503

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             LG FFS++LV+IV K+T   +PWLAD+LNQG+LYDFYWLLA++SA+N++ +L C++ YVY
Sbjct  504   LGFFFSTLLVSIVNKMTAHGRPWLADNLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVY  563

Query  377   KEKRLAEMGIELEE  336
             KEKRLAE  IELEE
Sbjct  564   KEKRLAEECIELEE  577



>ref|XP_009407160.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/564 (68%), Positives = 450/564 (80%), Gaps = 16/564 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMIL VE  ERLTTLGI +NLVTYLT TMHLGNA +AN VTNF+G SFML LLGGFVAD
Sbjct  33    AAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAASANTVTNFMGTSFMLCLLGGFVAD  92

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlylal  1623
             TFLGRYLTI IF  VQA+GV+ILTIST +P L+PP C+ P SG CV ASG QLGVLYLAL
Sbjct  93    TFLGRYLTIAIFAAVQASGVSILTISTAVPGLRPPACADPASGGCVKASGAQLGVLYLAL  152

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD++D+ E+ QM+KFF+WF FFI++GSLLAVTVLVYIQD
Sbjct  153   YLTALGTGGLKSSVSGFGSDQFDETDRGEKAQMMKFFNWFFFFISLGSLLAVTVLVYIQD  212

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR+WGYG+CA AI   LV+FLSGTRRYRFKKLVGSPLTQIAAV  AAWRKR LELPSD
Sbjct  213   NLGRQWGYGVCATAIALGLVVFLSGTRRYRFKKLVGSPLTQIAAVVAAAWRKRGLELPSD  272

Query  1262  PELLYNVD----DVVAAAGDQEHK-KIKMPHSKEFRFLDRAAIK--EGVSEVNKWSISTL  1104
             P LL+++D    D  A  G +  K K ++PH+K+FRFLD+AAI    G  +  +W + TL
Sbjct  273   PSLLHDIDEKQADADAEKGSKRSKAKQRVPHTKQFRFLDKAAIDVDPGAKQGKRW-LPTL  331

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDR +  SF +P  S+ VF+V
Sbjct  332   TDVEEVKIVIRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRIGPSFRIPPGSLTVFFV  391

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDR++VP+ RR+  NP GL+PLQRI  GL LS++ M AAAL EIKRL VAR
Sbjct  392   GSILLTVPVYDRVVVPVSRRLTGNPHGLTPLQRIGAGLVLSILAMSAAALTEIKRLGVAR  451

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S     +  ATVPMSVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  452   STPAALENGATVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  511

Query  563   VALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LVT+V KVTGE     WLAD+LN+GKLY+FYWLLAV+  +NL+A+L  +R
Sbjct  512   LSLGFFVSSALVTVVHKVTGESGHGAWLADNLNRGKLYNFYWLLAVLCLVNLVAYLVVAR  571

Query  389   GYVYKEKRLA-----EMGIELEEE  333
              Y YKE+R A       G+EL E+
Sbjct  572   WYAYKEQRAAVDDDSNAGVELTED  595



>ref|XP_008808741.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=604

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/566 (69%), Positives = 453/566 (80%), Gaps = 20/566 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ERLTTLGI +NLVTYLT TMHLGNA AAN VTNF+G SFML LLGGFVA
Sbjct  35    SAAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAAAANTVTNFMGTSFMLCLLGGFVA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRYLTI IF  VQA+GVTILTIST +P L+PP C+   SG+CV AS  QLGVLYLA
Sbjct  95    DTFLGRYLTIAIFAAVQASGVTILTISTAVPGLRPPACTDVGSGNCVKASAAQLGVLYLA  154

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD++D+ E+ QM+KFF+WF FFI++GSLLAVTVLVYIQ
Sbjct  155   LYLTALGTGGLKSSVSGFGSDQFDETDRGEKHQMMKFFNWFFFFISLGSLLAVTVLVYIQ  214

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGRRWGYGLCA AIV  L++FLSGTRRYRFKKLVGSPLTQIAAV  AAW+KR LELP 
Sbjct  215   DNLGRRWGYGLCAAAIVAGLLVFLSGTRRYRFKKLVGSPLTQIAAVVAAAWKKRALELPL  274

Query  1265  DPELLYNVDDVVAAAGDQEH--------KKIKMPHSKEFRFLDRAAIKEGVS-EVNKWSI  1113
             DP +L+++D    ++G +E         +K ++PH+K+FRFLD AAI    S E +KW +
Sbjct  275   DPSMLHDID---GSSGQREKNLSKQSHGEKQRLPHTKQFRFLDHAAIVVNQSTEQSKWRL  331

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
             STLTDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDR +  SF++P  S+ V
Sbjct  332   STLTDVEEVKIVIRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRIGPSFQIPPGSLTV  391

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+VG IL+T+ +YDRI+VPI RR   NP GL+PLQRI VGL LS++ M AAALVEIKRL 
Sbjct  392   FFVGSILLTVPVYDRIIVPISRRFNGNPHGLTPLQRIGVGLVLSILAMAAAALVEIKRLN  451

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             VARS+ +T    ATVP+SVFWL  Q+ +VGSGEA TY+GQLDFFLRECPKGMKTMSTGLF
Sbjct  452   VARSNPVTMQKGATVPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLF  511

Query  572   LSTVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LST++LG F SS LVTIV KVTGE     WLAD+LN+GKLY+FYWLLAV+  +NL  +L 
Sbjct  512   LSTLSLGFFVSSALVTIVHKVTGESGHGAWLADNLNRGKLYNFYWLLAVLCLVNLGVYLV  571

Query  398   CSRGYVYKEKRLAE-----MGIELEE  336
              +R YVYK+ R A       G+EL E
Sbjct  572   AARWYVYKDGRAAAEDESMAGVELTE  597



>ref|XP_010919516.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=592

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/560 (69%), Positives = 451/560 (81%), Gaps = 17/560 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE CERLTTLGI +NLVTYLT TMHLGNA +AN+VTNFLG SFML LLGGF+A
Sbjct  35    SAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATSANIVTNFLGTSFMLCLLGGFLA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlyla  1626
             D+FLGRYLTI IFT VQA G+TILTIST+ P L+PP C+ P +G CV A G QLGVLYLA
Sbjct  95    DSFLGRYLTIAIFTAVQALGITILTISTVAPGLRPPACADPSAGGCVQAKGAQLGVLYLA  154

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             L LTALGTGGLKSSVSG G+DQFD+SD+ E+ QM++FFSWF FFI++GSLLAVTVLVYIQ
Sbjct  155   LNLTALGTGGLKSSVSGFGSDQFDESDRGEKRQMMRFFSWFFFFISLGSLLAVTVLVYIQ  214

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D +GR WGYG+CA AIV  L +FL+GT RYRFKKLVGSPLTQIAAV VAAWRKR L+LPS
Sbjct  215   DYVGREWGYGICAAAIVSGLAVFLAGTTRYRFKKLVGSPLTQIAAVVVAAWRKRALDLPS  274

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS-EVNKWSISTLTDVEE  1089
             D  LL+   DV AA    +  K K+PHSK+FR+LDRAAI E  + E +KW +STLTDVEE
Sbjct  275   DLSLLH---DVGAADKADDRGKQKLPHSKQFRYLDRAAIIEDPAVEQSKWRLSTLTDVEE  331

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VKQ+IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PA S+ VF+VG IL+
Sbjct  332   VKQVIRMLPVWATTIMFWTVYAQMTTFSVSQATTMDRHIGPSFQIPAGSLTVFFVGSILL  391

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
              + +YDR++VP  RR+  NPQGL+PLQRIAVGL LS+  M AAAL E+KRL  A +    
Sbjct  392   MVPIYDRVVVPAARRLTGNPQGLTPLQRIAVGLTLSIFAMAAAALTELKRLHAASA----  447

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
              D  +TVP+SVFWL  Q+   G+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG 
Sbjct  448   VDAGSTVPLSVFWLVPQFFFTGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGF  507

Query  548   FFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             FFSS LVTIV KVTGE  +  WL D+LNQG+LYDFYWLLA +S LNL  FL  ++GYVYK
Sbjct  508   FFSSALVTIVDKVTGETGRGAWLPDNLNQGRLYDFYWLLAALSVLNLGLFLLSAKGYVYK  567

Query  374   EKRLAE------MGIELEEE  333
             EKR+A       + +EL +E
Sbjct  568   EKRMASGEQGSVVAVELADE  587



>ref|XP_008796822.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=600

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/565 (68%), Positives = 450/565 (80%), Gaps = 19/565 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE CERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGF+A
Sbjct  35    SAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNAASANTVTNFLGTSFMLCLLGGFLA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlyla  1626
             D+FLGRYLTI IFT VQA G TILT+ST  P L+PP C+ P +G C  ASG QLGVLYLA
Sbjct  95    DSFLGRYLTIAIFTAVQATGTTILTVSTAAPGLRPPACADPPAGGCARASGAQLGVLYLA  154

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SD+ E+ QM++FFSWF FFI++GSL AVTVLVYIQ
Sbjct  155   LYLTALGTGGLKSSVSGFGSDQFDESDRGEKRQMMRFFSWFFFFISLGSLQAVTVLVYIQ  214

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGRRWGYG+CA AIV  L +FLSGT RYRFKKLVGSPLTQIAAV  AAW+KR L+LPS
Sbjct  215   DNLGRRWGYGICAAAIVAGLAVFLSGTPRYRFKKLVGSPLTQIAAVVAAAWKKRDLDLPS  274

Query  1265  DPELLYNVDDVVAAAGDQEHK---KIKMPHSKEFRFLDRAAIKEGVS-EVNKWSISTLTD  1098
             DP  L++ D    AA D E K   K ++PHSK+FRFLDRAAI E  + E +KW +STLTD
Sbjct  275   DPSFLHDED----AAVDGEKKSRGKQRLPHSKQFRFLDRAAIMEDPAIEQSKWQLSTLTD  330

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVKQ+IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDR +  SF++PA S+ VF+VG 
Sbjct  331   VEEVKQVIRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRIGSSFQIPAGSLTVFFVGS  390

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK--VAR  744
             IL+T+ +YDR++VP   R+  NPQGL+PLQRIAVGL LS+  M+AAAL E KRL    A 
Sbjct  391   ILLTVPVYDRLVVPAAVRLTGNPQGLTPLQRIAVGLVLSIFAMVAAALTEHKRLHAAWAA  450

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             +   +    +TVP+ VFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST
Sbjct  451   NSSSSVSQGSTVPLGVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLST  510

Query  563   VALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV+IV KVTGE  K PWLAD+LN G+LY+FYWLLAV+S  NL+ FL  ++
Sbjct  511   LSLGFFLSSALVSIVHKVTGESGKGPWLADNLNDGRLYNFYWLLAVLSVANLVLFLVSAK  570

Query  389   GYVYKEKRLAEM------GIELEEE  333
             GYVYKEKR  E        +EL EE
Sbjct  571   GYVYKEKRRMEAEDGSVGAVELAEE  595



>ref|XP_009411558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/565 (68%), Positives = 450/565 (80%), Gaps = 30/565 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             A+MILGVE CERLTTLGI +NLVTYLT TMHLG+A +AN VTNFLG SFML LLGGFVAD
Sbjct  36    ASMILGVELCERLTTLGIAVNLVTYLTATMHLGSAASANAVTNFLGTSFMLCLLGGFVAD  95

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlylal  1623
             TFLGRYLTI IFT VQA+GVTILTIST  P L+PP C+ P +G CV A+G Q+GVLYL L
Sbjct  96    TFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPPACADPLTGGCVRANGTQMGVLYLGL  155

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD+ D  E+ QM++FFSWF FFI++GSL+AVTVLVYIQD
Sbjct  156   YLTALGTGGLKSSVSGFGSDQFDEGDGAEKKQMLRFFSWFFFFISIGSLMAVTVLVYIQD  215

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGRRWGYG+CA AIV  L +FLSGT RYRFK+LVGSPLTQIAAV   AWRKR L+LP+D
Sbjct  216   NLGRRWGYGICAVAIVLGLAVFLSGTSRYRFKRLVGSPLTQIAAVVTGAWRKRSLDLPAD  275

Query  1262  PELLYNVDDVVAAAGDQEHKK--------IKMPHSKEFRFLDRAAIKEGVS--EVNKWSI  1113
             P +L++VD   AA GD    +         K+PH+KEFRFLDRAA+ EG +  E +KW +
Sbjct  276   PSMLHDVD---AAGGDCTPGEKSSKKKKKQKLPHTKEFRFLDRAAVVEGDTAVEQSKWRL  332

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
             STLTDVEEVKQ+IRMLPTWATTIMFWTV+AQ+ TFSVSQA TM+R +  SFE+PA S+ V
Sbjct  333   STLTDVEEVKQVIRMLPTWATTIMFWTVYAQMTTFSVSQATTMERRIGSSFEIPAGSLTV  392

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+VG IL+T+  YDR++VP  RR+  NP GL+PLQRIAVGLALS++ M AAAL E KRL 
Sbjct  393   FFVGSILLTVPAYDRLVVPAARRLTGNPHGLTPLQRIAVGLALSILAMCAAALTERKRLA  452

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
                        AA VP+SVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLF
Sbjct  453   -----------AAVVPLSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLF  501

Query  572   LSTVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LST++LG F SS LVTIV +VTGE  K  WL D LN+GKLYDFYWLLA +S +NL+ F+ 
Sbjct  502   LSTLSLGFFLSSALVTIVHRVTGESGKGAWLPDDLNKGKLYDFYWLLAALSVVNLVVFVV  561

Query  398   CSRGYVYKEKRLAEMG---IELEEE  333
              +RGYVYKEKR A+ G   + LE+E
Sbjct  562   AARGYVYKEKRTADDGTHVVGLEDE  586



>dbj|BAJ90348.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02884.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/548 (66%), Positives = 438/548 (80%), Gaps = 11/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMH+GNA AANVVTNF+G SFML LLGGFVA
Sbjct  38    AAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAANVVTNFMGTSFMLCLLGGFVA  97

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES---GSCVPASggqlgvly  1632
             D+FLGRYLTI IFT +QA+GVTILTIST  P L+PP C+ E    G+C  ASGGQLGVLY
Sbjct  98    DSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPACTAEGAGIGTCTRASGGQLGVLY  157

Query  1631  lalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVY  1452
             LALYLTALGTGGLKSSVSG G+DQFD+S+  E+ QM++FF+WF FFI++GSLLAVTVLVY
Sbjct  158   LALYLTALGTGGLKSSVSGFGSDQFDESNSTEKSQMMRFFNWFFFFISLGSLLAVTVLVY  217

Query  1451  IQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLEL  1272
             +QDNLGR WGYG CA +I   LV+FL+GTRRYRFKKL GSPLTQIAAV VAAWRKRR++L
Sbjct  218   VQDNLGRPWGYGACAASIAAGLVVFLAGTRRYRFKKLAGSPLTQIAAVVVAAWRKRRVQL  277

Query  1271  PSDPELLYNVD--DVVAAAGDQEHK---KIKMPHSKEFRFLDRAAIK-EGVSEVNKWSIS  1110
             P+D  +LY++D   V A  G    K   K ++PH+K+FRFLD AAI  +   E  KW ++
Sbjct  278   PADTSMLYDIDVGKVAAIEGGSTKKSKLKERIPHTKQFRFLDHAAINSDPAGEPTKWQLA  337

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PA S+ VF
Sbjct  338   TLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQATTMDRHIGPSFQIPAGSLTVF  397

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T+ +YDRI+VP+ RR   NP GL+PLQRI +GL LS++ M +AALVEIKRL+V
Sbjct  398   FVGSILLTVPIYDRIVVPVARRFNGNPHGLTPLQRIGIGLVLSILAMTSAALVEIKRLRV  457

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             AR   +     A VPM+VFWL  Q+  VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  458   ARESAV--PEGAPVPMTVFWLIPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  515

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LG F SS LVT+V K+TG+++PW+AD LN+G+LY FYWLLA +   NL+ +LF +R
Sbjct  516   STLSLGFFVSSALVTVVHKITGDRRPWIADDLNKGELYKFYWLLAGVCLANLVVYLFAAR  575

Query  389   GYVYKEKR  366
              Y YK  R
Sbjct  576   WYKYKAGR  583



>ref|XP_002464959.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
 gb|EER91957.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
Length=595

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/568 (65%), Positives = 442/568 (78%), Gaps = 21/568 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILGVE  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+GASFML LLGGFVAD
Sbjct  37    AAMILGVELFERMTTLGIAVNLVPYMTGTMHLGNASAANTVTNFIGASFMLCLLGGFVAD  96

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             T+LGRYLTI +FT VQA GV ILTIST  P L+PP C    G+   CVPA+G QLGVLYL
Sbjct  97    TYLGRYLTIAVFTAVQATGVMILTISTAAPGLRPPPCGDARGASADCVPATGTQLGVLYL  156

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
              LYLTALGTGGLKSSVSG G+DQFD+S   ER +M++FF+WF FF+++G+LLAVT LVY+
Sbjct  157   GLYLTALGTGGLKSSVSGFGSDQFDESHDGERSKMLRFFNWFYFFVSIGALLAVTALVYV  216

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN+GRRWGYG+CA  I+  L +FL GTRRYRFKKLVGSPLTQ+AAV  AAW KRRL LP
Sbjct  217   QDNVGRRWGYGVCAVGILCGLAVFLLGTRRYRFKKLVGSPLTQVAAVTAAAWTKRRLPLP  276

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGV---SEVNKWSISTLTD  1098
             SDP+LLY+VD  +AA  D + K+ K+PHSKE RFLD AAI +G    S  +KW++ T TD
Sbjct  277   SDPDLLYDVDAALAAGADVKGKE-KLPHSKECRFLDHAAIIDGTGGDSAASKWALCTRTD  335

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHM--SKSFEVPAASMAVFYV  924
             VEEVKQ++RMLP WATTIMFWT+HAQ+ TFSV+QA  MDR +  S  F +PA S+ VF +
Sbjct  336   VEEVKQVVRMLPIWATTIMFWTIHAQMTTFSVAQAEVMDRAIGGSSGFHIPAGSLTVFLI  395

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDR++ P+ RRV  NP GL+PLQR+ VGL LSV GM  AALVE  R   A 
Sbjct  396   GSILLTVPVYDRLVAPLARRVTGNPHGLTPLQRVFVGLFLSVAGMAVAALVERHRQTAAS  455

Query  743   S-HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             + HG+T        +SVF L  Q+++VG+GEA TY+GQL FFLRECPKGMKTMSTGLFLS
Sbjct  456   AEHGVT--------LSVFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLFLS  507

Query  566   TVALGLFFSSVLVTIVGKVTGE---KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T ALG FFS++LVTIV KVTG    +  WLAD+L+ G+L  FYWLLAV+SA+NL+ F F 
Sbjct  508   TCALGFFFSTLLVTIVHKVTGRHGGRGGWLADNLDDGRLDYFYWLLAVISAINLVIFTFA  567

Query  395   SRGYVYKEKRLAEMGIELEEETHIPGGH  312
             +RGYVYKEKRLA+ GIEL +E  I  GH
Sbjct  568   ARGYVYKEKRLADAGIELADEESIAVGH  595



>gb|EMT10378.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=603

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/548 (66%), Positives = 439/548 (80%), Gaps = 11/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMH+GNA AANVVTNF+G SFML LLGGFVA
Sbjct  38    AAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAANVVTNFMGTSFMLCLLGGFVA  97

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG---SCVPASggqlgvly  1632
             D+FLGRYLTI IFT +QA+GVTILTIST  P L+PP C+ E G   +C  ASG QLGVLY
Sbjct  98    DSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPACTAEGGGIGTCSRASGAQLGVLY  157

Query  1631  lalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVY  1452
             LALYLTALGTGGLKSSVSG G+DQFD+SD+ E+ QM++FF+WF FFI++GSLLAVTVLVY
Sbjct  158   LALYLTALGTGGLKSSVSGFGSDQFDESDRTEKSQMMRFFNWFFFFISLGSLLAVTVLVY  217

Query  1451  IQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLEL  1272
             +QDNLGR WGYG CA +I   LV+FL+GTRRYRFKKL GSPLTQIAAV VAAWRKR ++L
Sbjct  218   VQDNLGRPWGYGACAASIAVGLVVFLAGTRRYRFKKLAGSPLTQIAAVVVAAWRKRGVQL  277

Query  1271  PSDPELLYNVD--DVVAAAGDQEHK---KIKMPHSKEFRFLDRAAIK-EGVSEVNKWSIS  1110
             P+D  +LY++D   V A  G    K   K ++PH+K+FRFLD AAI  +   E  KW ++
Sbjct  278   PTDTSMLYDIDVGKVAAIEGASTKKSKLKERIPHTKQFRFLDHAAINSDPAGEPTKWQLA  337

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PA S+ VF
Sbjct  338   TLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQATTMDRHIGPSFQIPAGSLTVF  397

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T+ +YDRI+VP+ RR+  NP GL+PLQRI +GL LS++ M +AALVE+KRL+V
Sbjct  398   FVGSILLTVPIYDRIVVPVSRRLNGNPHGLTPLQRIGIGLVLSILAMTSAALVEVKRLRV  457

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             AR   + A   A VPM+VFWL  Q+  VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  458   ARDSAVPA--GAPVPMTVFWLIPQFFFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  515

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LG F SS LVT+V K+TG+++PW+AD LN+G+LY FYWLLA +   NL+ +LF +R
Sbjct  516   STLSLGFFVSSALVTVVHKITGDRRPWIADDLNKGELYKFYWLLAGVCLANLVVYLFAAR  575

Query  389   GYVYKEKR  366
              Y YK  R
Sbjct  576   WYKYKAGR  583



>ref|XP_002443879.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
 gb|EES13374.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
Length=601

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/562 (67%), Positives = 447/562 (80%), Gaps = 14/562 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNF+G SFML LLGGFVA
Sbjct  38    AAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANVVTNFMGTSFMLCLLGGFVA  97

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS--CVPASggqlgvlyl  1629
             D+FLGRYLTI IFT +QA+GVTILTIST  P L+P  CS  +G   C  ASG QLGV+YL
Sbjct  98    DSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPAACSANAGDGECARASGAQLGVMYL  157

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALYLTALGTGGLKSSVSG G+DQFD+SD+ E+ QM++FF+WF FFI++GSLLAVTVLVY+
Sbjct  158   ALYLTALGTGGLKSSVSGFGSDQFDESDRGEKHQMMRFFNWFFFFISLGSLLAVTVLVYV  217

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDNLGRRWGYG CACAI   LV+FL+GTRRYRFKKLVGSPLTQIAAV VAAWRKRRL LP
Sbjct  218   QDNLGRRWGYGACACAIAAGLVIFLAGTRRYRFKKLVGSPLTQIAAVVVAAWRKRRLPLP  277

Query  1268  SDPELLYNVDDVVAAA-----GDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEVNKWSIST  1107
             +DP +LY++D   AAA     G +  +K ++PH+ +FRFLD AAI +E  ++ +KW +ST
Sbjct  278   ADPAMLYDIDVGKAAAVEEGSGKKSKRKERLPHTDQFRFLDHAAINEEPAAQPSKWRLST  337

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             LTDVEEVK ++RMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PA S+ VF+
Sbjct  338   LTDVEEVKTVVRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRHIGSSFQIPAGSLTVFF  397

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+T+ +YDRI+VP+ RRV  NP GL+PLQRI VGLALSV+ M  AAL EIKRL VA
Sbjct  398   VGSILLTVPVYDRIVVPVARRVSGNPHGLTPLQRIGVGLALSVIAMAGAALTEIKRLHVA  457

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             R   + A     VPMSVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  458   RDAAVPA--GGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLS  515

Query  566   TVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             T++LG F SS LV  V KVTG++ PW+AD LN+G+L +FYWLLAV+   NL+ +L  +R 
Sbjct  516   TLSLGFFVSSALVAAVHKVTGDRHPWIADDLNKGRLDNFYWLLAVICLANLLVYLVAARW  575

Query  386   YVYKEKRLAE----MGIELEEE  333
             Y YK  R        G+E+ +E
Sbjct  576   YKYKAGRPGADGSVNGVEMADE  597



>ref|XP_003573480.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=595

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/548 (66%), Positives = 439/548 (80%), Gaps = 12/548 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMH+GNA AANVVTNF+G SFML LLGGFVA
Sbjct  36    AAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAANVVTNFMGTSFMLCLLGGFVA  95

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS--CVPASggqlgvlyl  1629
             D+FLGR+LTI IFT +QA+GVTILTIST  P L+P  C+P S S  C  ASG QLG+LY 
Sbjct  96    DSFLGRFLTIAIFTAIQASGVTILTISTAAPGLRPASCTPSSSSPVCARASGAQLGILYA  155

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALYLTALGTGGLKSSVSG G+DQFD+S+  E+ QM++FF+WF FFI++GSLLAVTVLVY+
Sbjct  156   ALYLTALGTGGLKSSVSGFGSDQFDESNDTEKSQMMRFFNWFFFFISLGSLLAVTVLVYV  215

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDNLGR WGYG CA AI   LV+FL+GTRRYRFKKL GSPLTQIAAV VAAWRKR+L LP
Sbjct  216   QDNLGRPWGYGACAAAIAVGLVVFLAGTRRYRFKKLAGSPLTQIAAVVVAAWRKRKLPLP  275

Query  1268  SDPELLYNVDDVVAAAGDQEHK------KIKMPHSKEFRFLDRAAI-KEGVSEVNKWSIS  1110
             ++P++LY++D   AAA D+         K ++PH+K+FRFLD AAI  +   E +KW ++
Sbjct  276   AEPDMLYDIDVGKAAAADEAGNGKKSKLKERIPHTKQFRFLDHAAINNDPAGEQSKWELA  335

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PA S+ VF
Sbjct  336   TLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQATTMDRHIGSSFQIPAGSLTVF  395

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T+ +YDRI+VPI RR+  NP GL+PLQRI VGL LS++ M AAAL E++RL++
Sbjct  396   FVGSILLTVPIYDRIVVPISRRLSGNPHGLTPLQRIGVGLVLSILAMAAAALTEVRRLRI  455

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             AR +  T+D    VPM+VFWL  Q+L+VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  456   ARENP-TSD--GVVPMTVFWLIPQFLLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  512

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LG F SS LV+ V K+T  ++PW+AD LNQG+L+ FYWLLA +   NL+ +LF +R
Sbjct  513   STLSLGFFVSSALVSAVHKLTAHRRPWIADDLNQGELHKFYWLLAGLCLANLVVYLFAAR  572

Query  389   GYVYKEKR  366
              Y YK  R
Sbjct  573   WYKYKAGR  580



>ref|XP_009411045.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/566 (66%), Positives = 454/566 (80%), Gaps = 16/566 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ERLTTLGI +NLVTYL  TMHLG A +AN VTNF+G SFML LLGGF+A
Sbjct  35    SAAMILVVELNERLTTLGIAVNLVTYLRGTMHLGTAVSANTVTNFMGTSFMLCLLGGFIA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRYLTI IF  VQA+GVTILTIST++  L+PP CS   +G CV ASG QL VLYLA
Sbjct  95    DTFLGRYLTIAIFAAVQASGVTILTISTVVRGLRPPACSDLAAGGCVKASGTQLAVLYLA  154

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD++++RE+ QM+KFF+WF FFI++GSL+AVTVLVYIQ
Sbjct  155   LYLTALGTGGLKSSVSGFGSDQFDETNRREKVQMMKFFNWFFFFISLGSLVAVTVLVYIQ  214

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGR+WGYGLCA AI   LVLFLSGTRRYRFKKLVGSPLTQIAAV VAAWRKR LELPS
Sbjct  215   DNLGRQWGYGLCAAAIGLGLVLFLSGTRRYRFKKLVGSPLTQIAAVMVAAWRKRGLELPS  274

Query  1265  DPELLYNVDDVVAAAGDQEH------KKIKMPHSKEFRFLDRAAIKEGVSEVN--KWSIS  1110
             DP LL+++D+   AA   E        K ++P +K+FR LDRAAI   +S     KW ++
Sbjct  275   DPSLLHDIDEKQTAAPGAEKGSKKSSAKQRLPRTKQFRCLDRAAIDVNLSTAKPTKWQLA  334

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDR + +SF +P  S+ VF
Sbjct  335   TLTDVEEVKIVIRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRIGRSFRIPPGSLTVF  394

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T+ +YDR++VP+ RR   NP GL+ LQR+ VGL +S++ M+AAAL+EIKRL+V
Sbjct  395   FVGSILLTVPVYDRVVVPVTRRFTGNPHGLTSLQRMGVGLVMSILAMVAAALIEIKRLRV  454

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             AR++  + +  ATVP+SVFWL  Q+ +VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  455   ARANAASMEKGATVPVSVFWLVPQFFLVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  514

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             ST++LG F SSVLV++V KVTGE     WL D+LN+GKLY+FYWL+AV+S++NL+ +L  
Sbjct  515   STLSLGFFVSSVLVSVVHKVTGESGHGGWLTDNLNRGKLYNFYWLVAVLSSVNLVLYLVA  574

Query  395   SRGYVYKEKRL-----AEMGIELEEE  333
             ++ YVYKE+R      +  G+EL EE
Sbjct  575   AKWYVYKEQRAVVDDDSMAGVELTEE  600



>ref|XP_004972811.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Setaria italica]
Length=595

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/545 (66%), Positives = 435/545 (80%), Gaps = 8/545 (1%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNF+G SFML LLGGFVA
Sbjct  38    AAAMILVAELNERLTTLGIAVNLVTYLTATMHLGNAESANVVTNFMGTSFMLCLLGGFVA  97

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGRYLTI IFT VQA+GVTILTIST  P L+P  C     SC  A+G QLGVLY+AL
Sbjct  98    DSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPATCPSNDASCSRATGPQLGVLYIAL  157

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD++D+ E+ QM++FF+WF FFI++GSLLAVTVLVY+QD
Sbjct  158   YLTALGTGGLKSSVSGFGSDQFDETDRGEKNQMMRFFNWFFFFISLGSLLAVTVLVYVQD  217

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG CA +I   LV+FL+GTRRYRFKKL GSPLTQIAAV VAAWRKR LELP+D
Sbjct  218   NLGRPWGYGACAASIAAGLVIFLAGTRRYRFKKLAGSPLTQIAAVVVAAWRKRHLELPAD  277

Query  1262  PELLYNVD-DVVAAAGD----QEHKKIKMPHSKEFRFLDRAAIKEG-VSEVNKWSISTLT  1101
             P++LY++D   VAAA +    +  +K K+PH+ +FRFLD AAI E   +E +KW ++T T
Sbjct  278   PDMLYDIDVGKVAAAEEGSTKKSKRKEKLPHTDQFRFLDHAAINEDPAAEPSKWRLATRT  337

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK ++RMLP WATTIMFWTV+AQ+ TFSVSQA TMDR +  SF++PA S+ VF+VG
Sbjct  338   DVEEVKTVVRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRIGPSFQIPAGSLTVFFVG  397

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDRI+VP+ RR+  NP GL+PLQRI VGL LSV+ M  AA  EI+RL+VAR 
Sbjct  398   SILLTVPIYDRIVVPVARRLNGNPHGLTPLQRIGVGLVLSVIAMAGAAATEIRRLRVARD  457

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
               + A     VPMSVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST+
Sbjct  458   AAVPA--GGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  515

Query  560   ALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             +LG F SS LVT V KVTG++  W+AD LN+G+L +FYWLLAV+  +NL+ +L  +R Y 
Sbjct  516   SLGFFVSSALVTCVHKVTGDRHAWIADDLNKGRLDNFYWLLAVICLVNLLVYLVAARWYK  575

Query  380   YKEKR  366
             YK  R
Sbjct  576   YKAGR  580



>ref|XP_008658431.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46302.1| TPA: hypothetical protein ZEAMMB73_201644 [Zea mays]
Length=588

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/562 (63%), Positives = 433/562 (77%), Gaps = 16/562 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAM LGVE  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+GASFML LLGGFVAD
Sbjct  37    AAMTLGVELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTNFIGASFMLCLLGGFVAD  96

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             T+LGRYLTI IFT VQA GV ILTIST  P L+PP C   S +CV A+  QLGVLYL LY
Sbjct  97    TYLGRYLTIAIFTAVQATGVVILTISTAAPGLRPPACGAASPNCVRANKTQLGVLYLGLY  156

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             LTALGTGGLKSSVSG G+DQFD++   ER +M++FF+WF FF+++G+LLAVTVLVY+QDN
Sbjct  157   LTALGTGGLKSSVSGFGSDQFDEAHDVERNKMLRFFNWFYFFVSIGALLAVTVLVYVQDN  216

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
              GRRWGYG+CA  I+  L +FL GTR+YRF+KLVGSPLTQ+AAV VAAW KR L LPSDP
Sbjct  217   AGRRWGYGVCAAGILCGLAVFLLGTRKYRFRKLVGSPLTQVAAVTVAAWSKRALPLPSDP  276

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI---KEGVSEVNKWSISTLTDVEE  1089
             ++LY+VDDV AA  D + K+ K+PHSKE R LD AAI    E  +  +KW++ T TDVEE
Sbjct  277   DMLYDVDDVAAAGSDAKGKQ-KLPHSKECRLLDHAAIVGGGESPATASKWALCTRTDVEE  335

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKS-FEVPAASMAVFYVGGIL  912
             VKQ++RMLP WATTIMFWT+HAQ+ TFSV+QA  M+R +  S + +PA S+ VF +G IL
Sbjct  336   VKQVVRMLPIWATTIMFWTIHAQMTTFSVAQAEVMNRAIGGSGYLIPAGSLTVFLIGSIL  395

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             +T+  YDR++ P+  R+  NP GL+PLQR+ VGL LSV GM  AAL+E  R +     G+
Sbjct  396   LTVPAYDRLVAPVAHRLTGNPHGLTPLQRVFVGLLLSVAGMAVAALIERHR-QTTSELGV  454

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
             T        ++VF L  Q+++VG+GEA TY+GQL FFLRECPKGMKTMSTGLFLST A G
Sbjct  455   T--------ITVFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLFLSTCAFG  506

Query  551   LFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
              FFS++LVTIV KVTG   +  WLAD+++ G+L  FYWLLAV+SA+NL+ F F +RGYVY
Sbjct  507   FFFSTLLVTIVHKVTGHGGRGGWLADNIDDGRLDYFYWLLAVISAINLVLFTFAARGYVY  566

Query  377   KEKRLAEMGIELEEETHIPGGH  312
             KEKRLA+ GIEL +E  +  GH
Sbjct  567   KEKRLADAGIELADEECVAAGH  588



>ref|NP_001145735.1| uncharacterized protein LOC100279242 [Zea mays]
 gb|ACL52487.1| unknown [Zea mays]
Length=608

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/568 (65%), Positives = 438/568 (77%), Gaps = 19/568 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNF+G SFML LLGGFVA
Sbjct  38    AAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANVVTNFMGTSFMLCLLGGFVA  97

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG----SCVPASggqlgvl  1635
             D+FLGRYLTI IFT VQA+GVTILTIST  P L+P  CS   G     C  ASG QLGVL
Sbjct  98    DSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPASCSATGGGVVGECARASGAQLGVL  157

Query  1634  ylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLV  1455
             YLALYLTALGTGGLKSSVSG G+DQFD+SD  E+ QM++FF+WF FFI++GSLLAVTVLV
Sbjct  158   YLALYLTALGTGGLKSSVSGFGSDQFDESDGGEKRQMMRFFNWFFFFISLGSLLAVTVLV  217

Query  1454  YIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLE  1275
             Y+QDNLGRRWGYG C CAI   L++FL+GTRRYRFKKL GSPLTQIAAV VAAWRKRRL 
Sbjct  218   YVQDNLGRRWGYGACTCAIAAGLLVFLAGTRRYRFKKLAGSPLTQIAAVVVAAWRKRRLP  277

Query  1274  LPSDPELLYNVDDVVAAAGDQEHKKI------KMPHSKEFRFLDRAAIKE----GVSEVN  1125
             LP+DP +LY+VD   AAA +            ++PH+ +FRFLD AAI E    G S  +
Sbjct  278   LPADPAMLYDVDVGKAAAVEDGSSSKKSKRKERLPHTDQFRFLDHAAINEDPAAGASSSS  337

Query  1124  KWSISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAA  945
             KW ++TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA T+DR +  SF++PA 
Sbjct  338   KWRLATLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQATTIDRRVGGSFQIPAG  397

Query  944   SMAVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEI  765
             S+ VF+VG IL+T+ +YDR++VP+ RRV  NP GL+PLQRIAVGLALSVV M  AAL E+
Sbjct  398   SLTVFFVGSILLTVPVYDRLVVPVARRVSGNPHGLTPLQRIAVGLALSVVAMAGAALTEV  457

Query  764   KRLKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMS  585
             +RL+VAR    +A     VPMSVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMS
Sbjct  458   RRLRVARDSSESAS-GGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMS  516

Query  584   TGLFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             TGLFLST++LG F SS LV  V +VTG++ PW+A+ LN+G+L +FYWLLA +   NL+ +
Sbjct  517   TGLFLSTLSLGFFVSSALVAAVHRVTGDRHPWIANDLNKGRLDNFYWLLAAVCLANLLVY  576

Query  404   LFCSRGYVYKEKRLAE----MGIELEEE  333
             L  +R Y YK  R        G+E+ +E
Sbjct  577   LVAARWYKYKAGRPGADGSVNGVEMADE  604



>ref|XP_006662041.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=589

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/563 (64%), Positives = 439/563 (78%), Gaps = 17/563 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILG E  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+G SFML LLGGF+AD
Sbjct  37    AAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFIAD  96

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP---ESGSCVPASggqlgvlyl  1629
             T+LGRYLTI +F  VQA GV ILTIST  P L+PP CS    ES  CV A+G QLGVLYL
Sbjct  97    TYLGRYLTIAVFAAVQATGVMILTISTAAPGLRPPACSDPKGESADCVVANGTQLGVLYL  156

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
              LYLTALGTGGLKSSVSG G+DQFD+SD  ER +M++FF+WF FF+++G+LLA TVLVY+
Sbjct  157   GLYLTALGTGGLKSSVSGFGSDQFDESDDGERKKMMRFFNWFYFFVSIGALLATTVLVYV  216

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN+GRRWGYG+CA  I+  L +FLSGTR+YRFKKLVGSPLTQ+AAV  AAW KR L LP
Sbjct  217   QDNVGRRWGYGICAVGILVGLAVFLSGTRKYRFKKLVGSPLTQVAAVTAAAWSKRSLPLP  276

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEV--NKWSISTLTDV  1095
             SDP++LY+VDD  AA  D + K+ ++PHSKE RFLD AAI +G +     KW++ T TDV
Sbjct  277   SDPDMLYDVDDAAAAGQDIKGKQ-RLPHSKECRFLDHAAIIDGAAPAASGKWTLCTRTDV  335

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGI  915
             EEVKQ++RMLP WATTIMFWT+HAQ+ TF+V+QA+ MDR +  SF +PA S+ VF +G I
Sbjct  336   EEVKQVVRMLPIWATTIMFWTIHAQMTTFAVAQASIMDRRVVGSFLIPAGSLTVFLIGSI  395

Query  914   LVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHG  735
             L+T+  YDR+++P+ RR+  NP GL+PLQR+ VGL LS+ GM AAAL+E  RL  + SHG
Sbjct  396   LLTVPFYDRLVLPVARRLTGNPHGLTPLQRVFVGLFLSIAGMAAAALIERHRL-ASSSHG  454

Query  734   LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVAL  555
                       ++VF L  Q+++VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST A+
Sbjct  455   AV--------LTVFLLMPQFVLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLSTCAI  506

Query  554   GLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
             G FFS++LVTIV K+TG   +  WLAD+L+ G+L  FYWLLAV+SA+NL  F   ++GYV
Sbjct  507   GFFFSTLLVTIVHKITGHGPRGGWLADNLDHGRLDYFYWLLAVLSAINLCFFTLAAKGYV  566

Query  380   YKEKRLAEMGIELEEETHIPGGH  312
             YKEKRLA+ GIEL +E  I  GH
Sbjct  567   YKEKRLADAGIELADEETIAVGH  589



>ref|XP_004972812.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Setaria italica]
Length=582

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/551 (65%), Positives = 434/551 (79%), Gaps = 12/551 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNF+G SFML LLGGFVA
Sbjct  38    AAAMILVAELNERLTTLGIAVNLVTYLTATMHLGNAESANVVTNFMGTSFMLCLLGGFVA  97

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGRYLTI IFT VQA+GVTILTIST  P L+P  C     SC  A+G QLGVLY+AL
Sbjct  98    DSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPATCPSNDASCSRATGPQLGVLYIAL  157

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD++D+ E+ QM++FF+WF FFI++GSLLAVTVLVY+QD
Sbjct  158   YLTALGTGGLKSSVSGFGSDQFDETDRGEKNQMMRFFNWFFFFISLGSLLAVTVLVYVQD  217

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG CA +I   LV+FL+GTRRYRFKKL GSPLTQIAAV VAAWRKR LELP+D
Sbjct  218   NLGRPWGYGACAASIAAGLVIFLAGTRRYRFKKLAGSPLTQIAAVVVAAWRKRHLELPAD  277

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEG-VSEVNKWSISTLTDVEEV  1086
             P++LY++        D   +K K+PH+ +FRFLD AAI E   +E +KW ++T TDVEEV
Sbjct  278   PDMLYDI--------DVGKRKEKLPHTDQFRFLDHAAINEDPAAEPSKWRLATRTDVEEV  329

Query  1085  KQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVT  906
             K ++RMLP WATTIMFWTV+AQ+ TFSVSQA TMDR +  SF++PA S+ VF+VG IL+T
Sbjct  330   KTVVRMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRIGPSFQIPAGSLTVFFVGSILLT  389

Query  905   IMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTA  726
             + +YDRI+VP+ RR+  NP GL+PLQRI VGL LSV+ M  AA  EI+RL+VAR   + A
Sbjct  390   VPIYDRIVVPVARRLNGNPHGLTPLQRIGVGLVLSVIAMAGAAATEIRRLRVARDAAVPA  449

Query  725   DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLF  546
                  VPMSVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F
Sbjct  450   --GGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFF  507

Query  545   FSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKR  366
              SS LVT V KVTG++  W+AD LN+G+L +FYWLLAV+  +NL+ +L  +R Y YK  R
Sbjct  508   VSSALVTCVHKVTGDRHAWIADDLNKGRLDNFYWLLAVICLVNLLVYLVAARWYKYKAGR  567

Query  365   L-AEMGIELEE  336
               A+  I  +E
Sbjct  568   PGADGSINADE  578



>ref|XP_009388204.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=608

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/564 (66%), Positives = 445/564 (79%), Gaps = 14/564 (2%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMIL VE  ERL TLGI +NLVTYLT TMH GNA AANVVTNF+G SFML LLGGFVAD
Sbjct  41    AAMILVVELNERLATLGIAVNLVTYLTGTMHQGNADAANVVTNFMGVSFMLCLLGGFVAD  100

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlylal  1623
              +LGRYLT+GIFT VQA+GVTILTIST +P L PP C+   SGSC  ASG Q+GVLYLAL
Sbjct  101   AYLGRYLTVGIFTAVQASGVTILTISTALPGLHPPPCADTASGSCAEASGLQMGVLYLAL  160

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSGLG+DQFD+++  E+ QM+KFFSWF FFI++GSLLAVTVLVYIQD
Sbjct  161   YLTALGTGGLKSSVSGLGSDQFDETNSGEKAQMLKFFSWFFFFISLGSLLAVTVLVYIQD  220

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             +LGRRWGYGLCA +IV  LV+FL+GTRRYRFKKL GSPLTQIA V VAAWRKR LELPSD
Sbjct  221   HLGRRWGYGLCASSIVVGLVVFLAGTRRYRFKKLAGSPLTQIATVVVAAWRKRGLELPSD  280

Query  1262  PELLYNVDDVVAAAGDQEHKKIK----MPHSKEFRFLDRAAIKEGV--SEVNKWSISTLT  1101
             P LL+++D   AAA +   +K K    + H+K+FRFLDRAAI       + +KW + T+T
Sbjct  281   PSLLHDIDAKQAAAAENGSRKSKAKQRLAHTKQFRFLDRAAINVNTIADKHSKWELCTIT  340

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
             DVEEVK +IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+ +SFE+P+ S+ VF+VG
Sbjct  341   DVEEVKTVIRMLPIWATTIMFWTVYAQMTTFSVSQANTMDRHVGRSFEIPSGSLTVFFVG  400

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDR++VP+ +R+  NP G +PLQRI +GL LS + M +AAL EIKRL+VARS
Sbjct  401   SILITVPIYDRVIVPVAKRLTGNPHGFTPLQRIGIGLGLSALAMASAALTEIKRLRVARS  460

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
                  +  ATVP+SVFWL  Q+ +VG+GEA TYVGQLDFFLRECPKGMKTMSTGLFLST+
Sbjct  461   DPAALEMGATVPLSVFWLIPQFFLVGAGEAFTYVGQLDFFLRECPKGMKTMSTGLFLSTL  520

Query  560   ALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             +LG F S+ LV  V  +TG+     WLAD+LN GKL +FYWLLA +  +NLM +L  ++ 
Sbjct  521   SLGFFVSTALVAAVDSITGQSGHGAWLADNLNHGKLNNFYWLLAALCLVNLMVYLVAAKW  580

Query  386   YVYKEKRLA-----EMGIELEEET  330
             YVYK++R A        +EL EET
Sbjct  581   YVYKDQRPAVDDDSVARVELTEET  604



>ref|XP_008794846.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=606

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/565 (67%), Positives = 447/565 (79%), Gaps = 16/565 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ERLTTLGIG+NLVTYLT TMHLGNA AAN VTNF+G SFML LLGGF+A
Sbjct  35    SAAMILVVELNERLTTLGIGVNLVTYLTGTMHLGNAAAANAVTNFMGTSFMLCLLGGFIA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSC-VPASggqlgvlyl  1629
             DTFLGRY TI IFT VQAAGVTILTIST  P L+PP C+   SG C   AS  Q+GVLYL
Sbjct  95    DTFLGRYRTIAIFTAVQAAGVTILTISTAAPELRPPACADAASGDCGNEASAVQMGVLYL  154

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALYLTALGTGGLKSSVSG+G+DQFD++D+ E+ QM+ FF WF FFI++GSLLAVTVLVYI
Sbjct  155   ALYLTALGTGGLKSSVSGIGSDQFDEADREEKHQMMMFFHWFFFFISLGSLLAVTVLVYI  214

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN+GR+WGYGLCA AIV  LV+FLSGTR YRFKKLVGSPLTQIAAV VAAWRKR LELP
Sbjct  215   QDNIGRKWGYGLCAAAIVVGLVVFLSGTRCYRFKKLVGSPLTQIAAVSVAAWRKRGLELP  274

Query  1268  SDPELLYNVDDVVAAAGDQE-----HKKIKMPHSKEFRFLDRAAI-KEGVSEVNKWSIST  1107
             SDP +LY++D +  A G+++     + K ++PH+K+FRFLD AAI     +E +KW +ST
Sbjct  275   SDPSMLYDIDGISGAQGEEKGSKKRNGKQRLPHTKQFRFLDHAAIIVSSTTEESKWQLST  334

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             LTDVEEVK +IRMLP WATTI+FWTV+AQ+ TFSV+QA TMDR +  SF++P  S+  F+
Sbjct  335   LTDVEEVKIVIRMLPIWATTIIFWTVYAQMSTFSVAQATTMDRRIGPSFQIPPGSLTAFF  394

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+TI  YDRI+VPI RR   +P GL+PL+RI VGL LSV+ M AAAL EIKRLKVA
Sbjct  395   VGSILLTIAFYDRIIVPITRRFTGHPHGLTPLRRIGVGLVLSVLAMAAAALTEIKRLKVA  454

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +S  L  +  ATVP+SVF+L  Q+ +VG+GEA TYVGQLDFFLRECPKGMKTMSTGLFLS
Sbjct  455   QSSPLAVEKGATVPLSVFFLVPQFFLVGAGEAFTYVGQLDFFLRECPKGMKTMSTGLFLS  514

Query  566   TVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             T++LG F SSVLVTIV KVTGE     WL D LN+GKLY+FYWLLAV+S +N   +L  +
Sbjct  515   TLSLGFFVSSVLVTIVHKVTGEGGHGAWLTDDLNRGKLYNFYWLLAVLSLVNFGVYLVSA  574

Query  392   RGYVYKEKRLAE------MGIELEE  336
               YV KE + A       +G+EL E
Sbjct  575   WWYVPKEGQAAAAEVESMVGVELTE  599



>ref|XP_004983702.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/564 (64%), Positives = 440/564 (78%), Gaps = 18/564 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILG E  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+G SFML LLGGFVAD
Sbjct  37    AAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVAD  96

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             ++LGRYLTI IFT VQA GV ILTIST  P L+PP C+   G+   CVPA+G QLGVLYL
Sbjct  97    SYLGRYLTIAIFTAVQATGVMILTISTAAPGLRPPPCADAKGASPDCVPANGTQLGVLYL  156

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
              LYLTALGTGGLKSSVSG G+DQFD++   ER +M++FF+WF FF+++G+LLAVTVLVY+
Sbjct  157   GLYLTALGTGGLKSSVSGFGSDQFDEAHDGERSKMLRFFNWFYFFVSIGALLAVTVLVYV  216

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN+GRRWGYG+CA  I+  L +FL GTR+YRFKKLVGSPLTQ+AAV VAAW KR L +P
Sbjct  217   QDNVGRRWGYGVCAAGILVGLAVFLLGTRKYRFKKLVGSPLTQVAAVTVAAWNKRALPVP  276

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEVN--KWSISTLTDV  1095
             SDP++LY+VDD  AA  D + K+ K+PHSKE RFLD AAI +G S  N  KW+++T TDV
Sbjct  277   SDPDMLYDVDDAAAAGADVKGKQ-KLPHSKECRFLDHAAIVDGESPANASKWTLNTRTDV  335

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKS-FEVPAASMAVFYVGG  918
             EEVKQ++RMLP WATTIMFWT+HAQ+ TFSV+QA  MDR +  S F +PA S+ VF +G 
Sbjct  336   EEVKQVVRMLPIWATTIMFWTIHAQMTTFSVAQAEVMDRGIGGSGFLIPAGSLTVFLIGS  395

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR++ P+ +R+  NP GLSPLQR+ VGL LSV GM  AAL+E  R   ++ H
Sbjct  396   ILLTVPLYDRLIAPVVKRLTGNPHGLSPLQRVFVGLFLSVAGMAVAALIERHRQTTSK-H  454

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             G+T        ++VF L  Q+++VG+GEA TY+GQL FFLRECPKGMKTMSTGLFLST A
Sbjct  455   GVT--------ITVFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLFLSTCA  506

Query  557   LGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             +G FFS++LVTIVGKVTG      WLAD+LN G+L  FYWLL V+S +NL+ F   ++GY
Sbjct  507   IGFFFSTLLVTIVGKVTGHDGHGGWLADNLNDGRLDYFYWLLGVISTINLVFFTLAAKGY  566

Query  383   VYKEKRLAEMGIELEEETHIPGGH  312
             VYKEKRLA+ GIEL +E  I  GH
Sbjct  567   VYKEKRLADAGIELADEEAIAVGH  590



>ref|XP_010906610.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=539

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/536 (68%), Positives = 428/536 (80%), Gaps = 20/536 (4%)
 Frame = -3

Query  1892  MHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRYLTIGIFTTVQAAGVtiltistii  1713
             MHLGNA AAN VTNF+G SFML LLGGFVADTF+GRYLTI IF  VQA+GVTILTIST +
Sbjct  1     MHLGNAAAANTVTNFMGTSFMLCLLGGFVADTFIGRYLTIAIFAAVQASGVTILTISTAV  60

Query  1712  psLQPPKC-SPESGSCVPASggqlgvlylalyltalgtggLKSSVSGLGTDQFDDSDKRE  1536
             P L+PPKC +  SG+C+ AS  QLGVLYLALYLTALGTGGLKSSVSG G+DQFD+ +K E
Sbjct  61    PGLRPPKCPNMASGNCMKASPAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFDEKNKEE  120

Query  1535  RGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGLCACAIVGALVLFLSGTRRY  1356
             + QM+KFF+WF FFI++GSLLAVTVLVYIQDN+GRRWGYGLCA AIV  LV+FLSGTRRY
Sbjct  121   KHQMMKFFNWFFFFISLGSLLAVTVLVYIQDNIGRRWGYGLCAAAIVAGLVVFLSGTRRY  180

Query  1355  RFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDVVAAAGDQEHK--------K  1200
             RFKKLVGSPLTQIAAV VAAWRKR LELPSDP +LY++D    ++G  E K        K
Sbjct  181   RFKKLVGSPLTQIAAVVVAAWRKRGLELPSDPSMLYDID---GSSGQGEEKTSKKSTGEK  237

Query  1199  IKMPHSKEFRFLDRAAIK-EGVSEVNKWSISTLTDVEEVKQLIRMLPTWATTIMFWTVHA  1023
              ++PH+K+FRFLD AAI     +E +KW +STLTDVEEVK +IRMLP WATTIMFWTV+A
Sbjct  238   QRLPHTKQFRFLDHAAITVNPTTEQSKWQLSTLTDVEEVKIVIRMLPIWATTIMFWTVYA  297

Query  1022  QLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMMYDRIMVPIFRRVLNNPQG  843
             Q+ TFSVSQA TMDR++  SF++P  S+ VF+VG IL+T+ +YDRI+VP+ RR   NP G
Sbjct  298   QMTTFSVSQATTMDRYIGPSFQIPPGSLTVFFVGSILLTVPIYDRIVVPVSRRFTGNPHG  357

Query  842   LSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAATVPMSVFWLAAQYLIVG  663
             L+PLQRI VGL LS++ M AAAL EIKRL VARS+  T    ATVP+SVFWL  Q+ +VG
Sbjct  358   LTPLQRIGVGLVLSILAMAAAALTEIKRLHVARSNPNTIHKGATVPLSVFWLVPQFFLVG  417

Query  662   SGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSVLVTIVGKVTGE--KKPW  489
             +GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F SS LVTIV KVTG+     W
Sbjct  418   AGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTIVHKVTGKSGHGAW  477

Query  488   LADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLAE-----MGIELEE  336
             LAD+LN+GKLY+FYWLLAV+  +NL  +L  ++ YVYKE R A       G+EL E
Sbjct  478   LADNLNRGKLYNFYWLLAVLCLVNLGLYLVAAKWYVYKEGRTAAEDDSMAGVELTE  533



>ref|XP_002468692.1| hypothetical protein SORBIDRAFT_01g050410 [Sorghum bicolor]
 gb|EER95690.1| hypothetical protein SORBIDRAFT_01g050410 [Sorghum bicolor]
Length=605

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/561 (66%), Positives = 438/561 (78%), Gaps = 23/561 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ERLTTLG+G+NLVTYL DTMHLG A +AN VTNFLGASFML LLGGFVA
Sbjct  45    SAAMILVVELNERLTTLGVGVNLVTYLMDTMHLGGAASANAVTNFLGASFMLCLLGGFVA  104

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS--CVPASggqlgvlyl  1629
             DT+LGRYLTI IFT VQA G+ +LT+ST  P L+PP C+  +G   CV  SG QLGVLYL
Sbjct  105   DTYLGRYLTIAIFTAVQAVGMCVLTVSTAAPGLRPPACADPTGPNHCVEPSGTQLGVLYL  164

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALYLTALGTGGLKSSVSG G+DQFD+SD  ER  M +FFSWF FFI++GSLLAVTVLVY+
Sbjct  165   ALYLTALGTGGLKSSVSGFGSDQFDESDGGERRSMARFFSWFFFFISIGSLLAVTVLVYV  224

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QD+LGRRWGYG C  AI+  L+LFL+GT RYRFKKLVGSPLTQIAAV  AAWRKR + LP
Sbjct  225   QDHLGRRWGYGACVVAILVGLLLFLAGTPRYRFKKLVGSPLTQIAAVTAAAWRKRAMPLP  284

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEVN----------KW  1119
             SDP +LY+VDD V AAG+    K KMP +K+ RFL++AAI E   EV           KW
Sbjct  285   SDPAMLYDVDDAV-AAGEDVKGKHKMPRTKQCRFLEKAAIVELEVEVQGSGNGKGKGKKW  343

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
             +  TLTDVEEVKQ++RMLPTWATTI FWTV+AQ+ TFSVSQA  MDR +  SFE+PA S+
Sbjct  344   AACTLTDVEEVKQVVRMLPTWATTIPFWTVYAQMTTFSVSQAQAMDRRLGSSFEIPAGSL  403

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+VG IL+T+ +YDR++VP+ RR+  NPQGLSPLQRI+VGL LSV+ M+AAAL E  R
Sbjct  404   TVFFVGSILLTVPVYDRLVVPLARRLTANPQGLSPLQRISVGLLLSVLAMVAAALTERAR  463

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
                + + G T         SVF L  Q+ +VG+GEA TYVGQLDFFLRECP+GMKTMSTG
Sbjct  464   RSASLAGGATP--------SVFLLVPQFFLVGAGEAFTYVGQLDFFLRECPRGMKTMSTG  515

Query  578   LFLSTVALGLFFSSVLVTIVGKVT--GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             LFLST++LG FFS+ +V+ V  VT  G ++PWL D L+QG L+ FYWLLA +SA++L+AF
Sbjct  516   LFLSTLSLGFFFSTAIVSAVHAVTTSGGRRPWLTDDLDQGSLHKFYWLLAAISAVDLLAF  575

Query  404   LFCSRGYVYKEKRLAEMGIEL  342
             +  +RGYVYKEKRLAE GI+L
Sbjct  576   VAVARGYVYKEKRLAEAGIQL  596



>ref|XP_008649786.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA42806.1| TPA: hypothetical protein ZEAMMB73_647219 [Zea mays]
Length=600

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/564 (65%), Positives = 436/564 (77%), Gaps = 24/564 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ERLTTLG+G+NLVTYL  TMHLG A +AN VTNFLGASFML LLGGFVA
Sbjct  41    SAAMILVVELNERLTTLGVGVNLVTYLIGTMHLGGAASANAVTNFLGASFMLCLLGGFVA  100

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-----SCVPASggqlgv  1638
             DT+LGRYLTI IFT VQAAG+ +LT+ST  P L+PP C+  +G     SCV  SG QLGV
Sbjct  101   DTYLGRYLTIAIFTAVQAAGMCVLTVSTAAPGLRPPACADPTGPSRRSSCVEPSGTQLGV  160

Query  1637  lylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVL  1458
             LYL LYLTALGTGGLKSSVSG G+DQFD+SD  ER  M +FF WF FFI++GSLLAVTVL
Sbjct  161   LYLGLYLTALGTGGLKSSVSGFGSDQFDESDDGERRSMARFFGWFFFFISIGSLLAVTVL  220

Query  1457  VYIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRL  1278
             VY+QD+LGRRWGYG C  AI+  L+LF++GT RYRFKKLVGSPLTQIAAV  AAWRKR L
Sbjct  221   VYVQDHLGRRWGYGACVAAILAGLLLFVTGTSRYRFKKLVGSPLTQIAAVTAAAWRKRAL  280

Query  1277  ELPSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEVNKWSI  1113
              LP DP++LY+V D VAA  D + K+ KMP +K+ RFL+RAAI E        E NKW+ 
Sbjct  281   PLPPDPDMLYDVQDAVAAGEDVKGKQ-KMPRTKQCRFLERAAIVEEAEGSAAGETNKWAA  339

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHM-SKSFEVPAASMA  936
              TLTDVEEVKQ++RMLPTWATTI FWTV+AQ+ TFSVSQA  MDR + S +FEVPA S+ 
Sbjct  340   CTLTDVEEVKQVVRMLPTWATTIPFWTVYAQMTTFSVSQAQAMDRRLGSGAFEVPAGSLT  399

Query  935   VFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRL  756
             VF VG IL+T+ +YDR++VP+ RR   NPQGLSPLQRI+VGL LSV+ M+AAAL E  R 
Sbjct  400   VFLVGSILLTVPVYDRLVVPLARRFTANPQGLSPLQRISVGLLLSVLAMVAAALTERAR-  458

Query  755   KVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGL  576
                RS  L    A   P SVF L  Q+ +VG GEA  YVGQLDFFLRECP+GMKTMSTGL
Sbjct  459   ---RSASL----AGATP-SVFLLVPQFFLVGVGEAFAYVGQLDFFLRECPRGMKTMSTGL  510

Query  575   FLSTVALGLFFSSVLVTIVGKVT--GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFL  402
             FLST++LG FFS+ +V+ V  VT  G ++PWL D L+QG L+ FYWLLA +SA++L+AF+
Sbjct  511   FLSTLSLGFFFSTAIVSAVHAVTTSGGRRPWLTDDLDQGSLHKFYWLLAAISAVDLLAFV  570

Query  401   FCSRGYVYKEKRL-AEMGIELEEE  333
               +RGYVYKEKRL AE GI  +++
Sbjct  571   AVARGYVYKEKRLAAEAGIVHDDD  594



>ref|XP_010941437.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=589

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/543 (67%), Positives = 430/543 (79%), Gaps = 19/543 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ER+TTLGI +NLVTY+T TMHLGNA AAN VTNF+G SF+L+LLGGF+A
Sbjct  35    SAAMILVVELNERMTTLGIAVNLVTYMTVTMHLGNAAAANAVTNFMGTSFILSLLGGFIA  94

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFLGRY+TI IF  VQA+GV IL IST+ P L+PP C+   SG C  ASG QLGVLYLA
Sbjct  95    DTFLGRYVTIAIFAAVQASGVVILAISTVAPGLRPPPCADLASGGCAKASGVQLGVLYLA  154

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LY TALGTGGLKSSVSG G+DQFD++D+ E+ QM++FF WF FFI++GSL+AVTVLVY+Q
Sbjct  155   LYTTALGTGGLKSSVSGFGSDQFDENDREEKNQMIRFFHWFFFFISLGSLVAVTVLVYVQ  214

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+GRRWGYG+CA +IV  LV+FLSGTRRYRFKKLVGSPLTQIAAV VAAWRKR LELPS
Sbjct  215   DNVGRRWGYGICAASIVVGLVVFLSGTRRYRFKKLVGSPLTQIAAVAVAAWRKRGLELPS  274

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAA-IKEGVSEVNKWSISTLTDVEE  1089
             +P +L++VD      G     K ++PHSK+FRFLD AA I    +E +KW +STLTDVEE
Sbjct  275   EPSMLHDVD------GSTGPGKQRVPHSKQFRFLDHAAVIVNSTTEQSKWELSTLTDVEE  328

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VK +IRMLP WATTIMFW V+AQ+ TFSVSQA  MDRH+  SFE+P+ S+  F+VG ILV
Sbjct  329   VKIVIRMLPIWATTIMFWCVYAQMTTFSVSQATKMDRHIGPSFEIPSGSLTAFFVGSILV  388

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
             T+ +YDRI++PI RR   NP G++PLQRI VGL LS++ M+AAAL+EIKRLK ARS    
Sbjct  389   TVPIYDRIIIPITRRFTGNPYGITPLQRIGVGLILSMLAMVAAALIEIKRLKAARS----  444

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
                  TVP+ VFWL  Q+ +VGSG A TY+GQLDFFLRECPKGMKTMSTGLFLST+ALG 
Sbjct  445   ----TTVPLRVFWLVPQFFLVGSGVAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLALGF  500

Query  548   FFSSVLVTIVGKVTGE---KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             F SS LV IV  VTGE      WLA+ LN+GKLY+FYWLLAV+S +N   ++  +R YVY
Sbjct  501   FVSSGLVAIVHLVTGESGGHGAWLANDLNRGKLYNFYWLLAVLSLVNFGVYVLSARWYVY  560

Query  377   KEK  369
             KE 
Sbjct  561   KES  563



>ref|XP_003574312.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=599

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/569 (63%), Positives = 438/569 (77%), Gaps = 23/569 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMI G E  ER+TTLGI +NLV Y+T TMHLG+A AAN VTNF+G SFML LLGGFVAD
Sbjct  41    AAMICGAELFERMTTLGIAVNLVPYMTSTMHLGSAAAANTVTNFIGTSFMLCLLGGFVAD  100

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             T+LGRYLTI +F+ VQA GV +LTIST+ P L+P  C   +G    CVPA+G QLGVLYL
Sbjct  101   TYLGRYLTIAVFSAVQATGVMVLTISTVAPGLRPAACGDATGQSSECVPANGTQLGVLYL  160

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
              LY+TALGTGGLKSSVSG G+DQFD+SD  ER +M++FF+WF FF+++G+LLAVTVLVY+
Sbjct  161   GLYMTALGTGGLKSSVSGFGSDQFDESDDVERKKMMRFFNWFYFFVSIGALLAVTVLVYV  220

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN+GRRWGYG+CA  I+  L +FLSGTRRYRFKKLVGSPLTQ+AAV  AAW KR L LP
Sbjct  221   QDNVGRRWGYGICAVGILAGLGVFLSGTRRYRFKKLVGSPLTQVAAVTAAAWWKRTLPLP  280

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-----KEGVSEVNKWSISTL  1104
             SDP +LY+VDD  AAAG+    K K+PHSKE RFLD AAI      E  +  +KW++ T 
Sbjct  281   SDPGMLYDVDD-AAAAGEDLKGKQKLPHSKECRFLDHAAIVDRAAGESPATASKWTLCTR  339

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKS-FEVPAASMAVFY  927
             TDVEEVKQ++RMLP WATTIMFWT+HAQ+ TF+V QA+ MDR +  S F +PA S+ VF 
Sbjct  340   TDVEEVKQVVRMLPIWATTIMFWTIHAQMTTFAVEQASVMDRGIGGSGFLIPAGSLTVFL  399

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             +G IL+T+ +YDR++ P+ RR+  NP GLSPLQR+ +GL LS+ GM  AALVE  RL  +
Sbjct  400   IGSILLTVPLYDRLVAPVARRITGNPHGLSPLQRVFLGLFLSIAGMAVAALVERHRL-TS  458

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
              SHG T        ++VF L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  459   SSHGAT--------LTVFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLS  510

Query  566   TVALGLFFSSVLVTIVGKVTGE----KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             T ALG F S++ VTIV K+TG        WLA++L+QG+L  FYWLLAVMSA+NL+ F+ 
Sbjct  511   TCALGFFLSTLTVTIVHKITGHGPQGSAGWLANNLDQGRLDYFYWLLAVMSAVNLVFFVV  570

Query  398   CSRGYVYKEKRLAEMGIELEEETHIPGGH  312
              +RGYVYKEKRLA+ GIEL +E  I  GH
Sbjct  571   AARGYVYKEKRLADAGIELADEEAIMVGH  599



>ref|XP_003572060.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=601

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/567 (63%), Positives = 438/567 (77%), Gaps = 21/567 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMI G E  ER+TTLGI +NLV Y+T TMHLG+A AAN VTNF+G SFML LLGGFVAD
Sbjct  45    AAMICGAELFERMTTLGIAVNLVPYMTATMHLGSAAAANTVTNFIGTSFMLCLLGGFVAD  104

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             T+LGRYLTI +F+ VQA GV +LTIST+ P L+P  C   +G    CVPA+G QLGVLYL
Sbjct  105   TYLGRYLTIAVFSAVQATGVMVLTISTVAPGLRPAACGDATGQSSECVPANGTQLGVLYL  164

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
              LY+TALGTGGLKSSVSG G+DQFD+SD  ER +M++FF+WF FF+++G+LLAVTVLVY+
Sbjct  165   GLYMTALGTGGLKSSVSGFGSDQFDESDDGERKKMMRFFNWFYFFVSIGALLAVTVLVYV  224

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN+GRRWGYG+CA  I+  L +FLSGTRRYRFKKLVGSPLTQ+AAV  AAW KR L LP
Sbjct  225   QDNVGRRWGYGICAVGILSGLGVFLSGTRRYRFKKLVGSPLTQVAAVTAAAWCKRGLPLP  284

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE---VNKWSISTLTD  1098
             SDP +LY+VDD  AAAG+    K K+PHSKE RFLD AA+ +  S     +KW++ T TD
Sbjct  285   SDPGMLYDVDD-AAAAGEDLKGKQKLPHSKECRFLDHAAVVDRESSPATASKWTLCTRTD  343

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKS-FEVPAASMAVFYVG  921
             VEEVKQ++RMLP WATTIMFWT+HAQ+ TF+V QA+ MDR +  S F +PA S+ VF +G
Sbjct  344   VEEVKQVVRMLPIWATTIMFWTIHAQMTTFAVEQASVMDRGIGGSGFLIPAGSLTVFLIG  403

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDR++ P+ RR+  NP GLSPLQR+ +GL LS+ GM  AALVE  RL  + S
Sbjct  404   SILLTVPLYDRLVAPVARRITGNPHGLSPLQRVFLGLFLSIAGMAVAALVERHRL-TSSS  462

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             HG T        ++VF L  Q+L+VG+GEA TY+GQL FFLRECPKGMKTMSTGLFLST 
Sbjct  463   HGAT--------LTVFLLMPQFLLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLFLSTC  514

Query  560   ALGLFFSSVLVTIVGKVTGE----KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             ALG FFS+++VTIV KVTG        WLA++++QG+L  FYWLLAVMSA+NL+ F   +
Sbjct  515   ALGFFFSTLIVTIVHKVTGHGTRGSGGWLANNIDQGRLDYFYWLLAVMSAINLVFFTVAA  574

Query  392   RGYVYKEKRLAEMGIELEEETHIPGGH  312
             RGYVYK+KRLA+ GIEL +E  +  GH
Sbjct  575   RGYVYKDKRLADAGIELADEEAMVVGH  601



>gb|ABB47972.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG90898.1| unnamed protein product [Oryza sativa Japonica Group]
Length=596

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/568 (63%), Positives = 430/568 (76%), Gaps = 20/568 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILG E  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+G SFML LLGGFVAD
Sbjct  37    AAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVAD  96

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             T+LGRYLTI IF  VQA GV ILTIST  P L+PP C    G+   CV A G QLGVLYL
Sbjct  97    TYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDPKGASAECVAADGTQLGVLYL  156

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSD-KRERGQMVKFFSWFIFFINVGSLLAVTVLVY  1452
              LYLTALGTGGLKSSVSG G+DQFD+SD   ER +M++FF+WF FF+++G+LLAVTVLVY
Sbjct  157   GLYLTALGTGGLKSSVSGFGSDQFDESDVDGERKKMMRFFNWFYFFVSLGALLAVTVLVY  216

Query  1451  IQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLEL  1272
             +QDN+GRRWGYG+CA  I+  L +FLSGTRRYRFKKLVGSPLTQ+AAV  AAW KR L L
Sbjct  217   VQDNVGRRWGYGICAAGILAGLAVFLSGTRRYRFKKLVGSPLTQVAAVTAAAWSKRSLPL  276

Query  1271  PSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-----KEGVSEVNKWSIST  1107
             PSDP++LY+VDD  AA  D + K+ +MPHSKE RFLD AAI      E  +  +KW + T
Sbjct  277   PSDPDMLYDVDDAAAAGHDVKGKQ-RMPHSKECRFLDHAAIIDRSAAESPATASKWRLCT  335

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
              TDVEEVKQ++RMLP WATTIMFWT+HAQ+ TF+V+QA  MDR ++  F +PA S+ VF 
Sbjct  336   RTDVEEVKQVVRMLPIWATTIMFWTIHAQMTTFAVAQAELMDRRLAGGFLIPAGSLTVFL  395

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             +  IL+T+  YDR++VP+ RR   NP GL+PLQR+ VGL+LS+ GM  AA VE  R   +
Sbjct  396   IASILLTVPFYDRLVVPVARRATANPHGLTPLQRVFVGLSLSIAGMAVAAAVERHRATAS  455

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
              S    A        +VF L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  456   ASAAAAAP-------TVFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLS  508

Query  566   TVALGLFFSSVLVTIVGKVTGEKK---PWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T A+G FFS++LVTIV KVTG       WLAD+L+ G+L  FYWLLAV+SA+NL+ F   
Sbjct  509   TCAIGFFFSTLLVTIVHKVTGHGARGGGWLADNLDDGRLDYFYWLLAVISAINLVLFTVA  568

Query  395   SRGYVYKEKRLAEMGIELEEETHIPGGH  312
             +RGYVYKEKRLA+ GIEL +E  I  GH
Sbjct  569   ARGYVYKEKRLADAGIELADEETIAVGH  596



>gb|AFW57313.1| hypothetical protein ZEAMMB73_359381 [Zea mays]
Length=608

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/568 (65%), Positives = 439/568 (77%), Gaps = 19/568 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNF+G SFML LLGGFVA
Sbjct  38    AAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANVVTNFMGTSFMLCLLGGFVA  97

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG----SCVPASggqlgvl  1635
             D+FLGRYLTI IFT VQA+GVTILTIST  P L+P  CS   G     C  ASG QLGVL
Sbjct  98    DSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPASCSATGGGVVGECARASGAQLGVL  157

Query  1634  ylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLV  1455
             YLALYLTALGTGGLKSSVSG G+DQFD+SD  E+ QM++FF+WF FFI++GSLLAVTVLV
Sbjct  158   YLALYLTALGTGGLKSSVSGFGSDQFDESDGGEKRQMMRFFNWFFFFISLGSLLAVTVLV  217

Query  1454  YIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLE  1275
             Y+QDNLGRRWGYG CACAI   L++FL+GTRRYRFKKL GSPLTQIAAV VAAWRKRRL 
Sbjct  218   YVQDNLGRRWGYGACACAIAAGLLVFLAGTRRYRFKKLAGSPLTQIAAVVVAAWRKRRLP  277

Query  1274  LPSDPELLYNVDDVVAAAGDQEHKKI------KMPHSKEFRFLDRAAIKE----GVSEVN  1125
             LP+DP +LY+VD   AAA +            ++PH+ +FRFLD AAI E    G S  +
Sbjct  278   LPADPAMLYDVDVGKAAAVEDGSSSKKSKRKERLPHTDQFRFLDHAAINEDPAAGASSSS  337

Query  1124  KWSISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAA  945
             KW ++TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA TMDR +  SF++PA 
Sbjct  338   KWRLATLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRVGGSFQIPAG  397

Query  944   SMAVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEI  765
             S+ VF+VG IL+T+ +YDR++VP+ RRV  NP GL+PLQRIAVGLALSVV M  AAL E+
Sbjct  398   SLTVFFVGSILLTVPVYDRLVVPVARRVSGNPHGLTPLQRIAVGLALSVVAMAGAALTEV  457

Query  764   KRLKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMS  585
             +RL+VAR    +A     VPMSVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMS
Sbjct  458   RRLRVARDSSESAS-GGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMS  516

Query  584   TGLFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             TGLFLST++LG F SS LV  V +VTG++ PW+A+ LN+G+L +FYWLLA +   NL+ +
Sbjct  517   TGLFLSTLSLGFFVSSALVAAVHRVTGDRHPWIANDLNKGRLDNFYWLLAAVCLANLLVY  576

Query  404   LFCSRGYVYKEKRLAE----MGIELEEE  333
             L  +R Y YK  R        G+E+ +E
Sbjct  577   LVAARWYKYKAGRPGADGSVNGVEMADE  604



>ref|XP_006650950.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=570

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/544 (64%), Positives = 420/544 (77%), Gaps = 17/544 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMIL VE  ERLTTLGI +NLVTYLT TMHLG A +AN VTNFLG SF+L LLGGF+AD
Sbjct  28    AAMILFVELNERLTTLGIAVNLVTYLTATMHLGTAASANTVTNFLGTSFILCLLGGFLAD  87

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             T+L RYLTI IFT +QA G+ +LTIST    L+PP C+   GSC PA+G QLGVLYL LY
Sbjct  88    TYLARYLTIAIFTALQATGMAVLTISTAATGLRPPPCTDPIGSCEPANGTQLGVLYLGLY  147

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             LTALGTGGLKSSVSG G+DQFD+SD  ERG+M +FFSWF F I++GSLLAVTVLVYIQDN
Sbjct  148   LTALGTGGLKSSVSGFGSDQFDESDAGERGRMARFFSWFFFLISIGSLLAVTVLVYIQDN  207

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             LGRRWGYG+C  AI+  L+LFL GT RYRFKKL GSP+TQIAAV  AAWRKR+L LPSDP
Sbjct  208   LGRRWGYGICVVAILAGLLLFLGGTTRYRFKKLQGSPVTQIAAVTAAAWRKRKLPLPSDP  267

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEVNKWSISTLTDVEEVKQ  1080
              +LY  D      G+    K K+PHS + RFLD AAI +   E  +W   T+T+VEEVKQ
Sbjct  268   AMLYEYD------GENVKGKQKLPHSNQCRFLDHAAILDAAEEKKRW---TVTEVEEVKQ  318

Query  1079  LIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIM  900
             ++RMLPTWATTI+FWTV+AQ+ TFSVSQAA MDR +S SF +PA S+ VF+V  IL T+ 
Sbjct  319   VVRMLPTWATTILFWTVYAQMTTFSVSQAAAMDRRLSTSFVIPAGSLTVFFVAAILFTVP  378

Query  899   MYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADP  720
             +YDR++ P+ RR+  +P GLSPLQRI VGL L+V+GM AAAL E +R   A+S       
Sbjct  379   LYDRLLAPLARRLTGHPHGLSPLQRIFVGLLLAVLGMAAAALTERRRRDAAKS-------  431

Query  719   AATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFS  540
              + V  SVF L  Q+++VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LGLF S
Sbjct  432   GSGVTQSVFLLLPQFMLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTISLGLFLS  491

Query  539   SVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLA  360
             + LV++V KVT  ++PWLAD+L+ G+L +FYW+L  M+ LNL  F+  +R YVYKEKR A
Sbjct  492   TALVSVVHKVT-SRRPWLADNLDDGRLDNFYWMLGAMNVLNLAVFVAAARVYVYKEKRPA  550

Query  359   EMGI  348
             + GI
Sbjct  551   DAGI  554



>gb|ACR34962.1| unknown [Zea mays]
Length=568

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/565 (65%), Positives = 436/565 (77%), Gaps = 19/565 (3%)
 Frame = -3

Query  1973  MILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTF  1794
             MIL  E  ERLTTLGI +NLVTYLT TMHLGNA +ANVVTNF+G SFML LLGGFVAD+F
Sbjct  1     MILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANVVTNFMGTSFMLCLLGGFVADSF  60

Query  1793  LGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG----SCVPASggqlgvlyla  1626
             LGRYLTI IFT VQA+GVTILTIST  P L+P  CS   G     C  ASG QLGVLYLA
Sbjct  61    LGRYLTIAIFTAVQASGVTILTISTAAPGLRPASCSATGGGVVGECARASGAQLGVLYLA  120

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFD+SD  E+ QM++FF+WF FFI++GSLLAVTVLVY+Q
Sbjct  121   LYLTALGTGGLKSSVSGFGSDQFDESDGGEKRQMMRFFNWFFFFISLGSLLAVTVLVYVQ  180

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DNLGRRWGYG CACAI   L++FL+GTRRYRFKKL GSPLTQIAAV VAAWRKRRL LP+
Sbjct  181   DNLGRRWGYGACACAIAAGLLVFLAGTRRYRFKKLAGSPLTQIAAVVVAAWRKRRLPLPA  240

Query  1265  DPELLYNVDDVVAAAGDQEHKKI------KMPHSKEFRFLDRAAIKE----GVSEVNKWS  1116
             DP +LY+VD   AAA +            ++PH+ +FRFLD AAI E    G S  +KW 
Sbjct  241   DPAMLYDVDVGKAAAVEDGSSSKKSKRKERLPHTDQFRFLDHAAINEDPAAGASSSSKWR  300

Query  1115  ISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMA  936
             ++TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA TMDR +  SF++PA S+ 
Sbjct  301   LATLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQATTMDRRVGGSFQIPAGSLT  360

Query  935   VFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRL  756
             VF+VG IL+T+ +YDR++VP+ RRV  NP GL+PLQRIAVGLALSVV M  AAL E++RL
Sbjct  361   VFFVGSILLTVPVYDRLVVPVARRVSGNPHGLTPLQRIAVGLALSVVAMAGAALTEVRRL  420

Query  755   KVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGL  576
             +VAR    +A     VPMSVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGL
Sbjct  421   RVARDSSESAS-GGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGL  479

Query  575   FLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             FLST++LG F SS LV  V +VTG++ PW+A+ LN+G+L +FYWLLA +   NL+ +L  
Sbjct  480   FLSTLSLGFFVSSALVAAVHRVTGDRHPWIANDLNKGRLDNFYWLLAAVCLANLLVYLVA  539

Query  395   SRGYVYKEKRLAE----MGIELEEE  333
             +R Y YK  R        G+E+ +E
Sbjct  540   ARWYKYKAGRPGADGSVNGVEMADE  564



>gb|AAK15441.1|AC037426_3 putative nitrate transporter [Oryza sativa Japonica Group]
Length=594

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/568 (63%), Positives = 430/568 (76%), Gaps = 20/568 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILG E  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+G SFML LLGGFVAD
Sbjct  35    AAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVAD  94

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             T+LGRYLTI IF  VQA GV ILTIST  P L+PP C    G+   CV A G QLGVLYL
Sbjct  95    TYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDPKGASAECVAADGTQLGVLYL  154

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSD-KRERGQMVKFFSWFIFFINVGSLLAVTVLVY  1452
              LYLTALGTGGLKSSVSG G+DQFD+SD   ER +M++FF+WF FF+++G+LLAVTVLVY
Sbjct  155   GLYLTALGTGGLKSSVSGFGSDQFDESDVDGERKKMMRFFNWFYFFVSLGALLAVTVLVY  214

Query  1451  IQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLEL  1272
             +QDN+GRRWGYG+CA  I+  L +FLSGTRRYRFKKLVGSPLTQ+AAV  AAW KR L L
Sbjct  215   VQDNVGRRWGYGICAAGILAGLAVFLSGTRRYRFKKLVGSPLTQVAAVTAAAWSKRSLPL  274

Query  1271  PSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-----KEGVSEVNKWSIST  1107
             PSDP++LY+VDD  AA  D + K+ +MPHSKE RFLD AAI      E  +  +KW + T
Sbjct  275   PSDPDMLYDVDDAAAAGHDVKGKQ-RMPHSKECRFLDHAAIIDRSAAESPATASKWRLCT  333

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
              TDVEEVKQ++RMLP WATTIMFWT+HAQ+ TF+V+QA  MDR ++  F +PA S+ VF 
Sbjct  334   RTDVEEVKQVVRMLPIWATTIMFWTIHAQMTTFAVAQAELMDRRLAGGFLIPAGSLTVFL  393

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             +  IL+T+  YDR++VP+ RR   NP GL+PLQR+ VGL+LS+ GM  AA VE  R   +
Sbjct  394   IASILLTVPFYDRLVVPVARRATANPHGLTPLQRVFVGLSLSIAGMAVAAAVERHRATAS  453

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
              S    A        +VF L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  454   ASAAAAAP-------TVFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLS  506

Query  566   TVALGLFFSSVLVTIVGKVTGEKK---PWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T A+G FFS++LVTIV KVTG       WLAD+L+ G+L  FYWLLAV+SA+NL+ F   
Sbjct  507   TCAIGFFFSTLLVTIVHKVTGHGARGGGWLADNLDDGRLDYFYWLLAVISAINLVLFTVA  566

Query  395   SRGYVYKEKRLAEMGIELEEETHIPGGH  312
             +RGYVYKEKRLA+ GIEL +E  I  GH
Sbjct  567   ARGYVYKEKRLADAGIELADEETIAVGH  594



>ref|XP_004983703.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/564 (64%), Positives = 436/564 (77%), Gaps = 18/564 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILG E  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+G SFML LLGGFVAD
Sbjct  37    AAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVAD  96

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             ++LGRYLTI +FT VQA GV ILTIST  P L+PP C+   G+   CVPA+G QLGVLYL
Sbjct  97    SYLGRYLTIAVFTAVQATGVMILTISTAAPGLRPPPCADAKGASPDCVPANGTQLGVLYL  156

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
              LYLTALGTGGLKSSVSG G+DQFD++   ER +M++FF+WF FF+++G+LLAVTVLVY+
Sbjct  157   GLYLTALGTGGLKSSVSGFGSDQFDEAHDGERSKMLRFFNWFYFFVSIGALLAVTVLVYV  216

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN+GRRWGYG+CA  I+  L +FL GTRRYRFKKLVGSPLTQ+AAV  AAW KR L LP
Sbjct  217   QDNVGRRWGYGVCAAGILVGLAVFLLGTRRYRFKKLVGSPLTQVAAVTAAAWSKRALPLP  276

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS--EVNKWSISTLTDV  1095
             SDP  LY+VDD  AA  D + K+ K+PHSKE RFLD AAI +G S    +KW++ T TDV
Sbjct  277   SDPNTLYDVDDAAAAGADVKGKQ-KLPHSKECRFLDHAAIVDGESPASASKWTLCTRTDV  335

Query  1094  EEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHM-SKSFEVPAASMAVFYVGG  918
             EEVKQ++RMLP WATTIMFWT+HAQ+ TFSV+QA  MDR +    F +PA S+ VF +G 
Sbjct  336   EEVKQVVRMLPIWATTIMFWTIHAQMTTFSVAQAEVMDRGIGGPGFLIPAGSLTVFLIGS  395

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR++ P+ +R+  NP GLSPLQR+ VGL LSV GM  AAL+E  R +    H
Sbjct  396   ILLTVPLYDRLIAPVVKRLTGNPHGLSPLQRVFVGLFLSVAGMAVAALIERHR-QTTSEH  454

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             G+T        ++VF L  Q+++VG+GEA TY+GQL FFLRECPKGMKTMSTGLFLST A
Sbjct  455   GVT--------ITVFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLFLSTCA  506

Query  557   LGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             LG FFS++LVTIVGKVTG      WLAD+LN G+L  FYWLLAV+SA+NL+ F   +RGY
Sbjct  507   LGFFFSTLLVTIVGKVTGHGGHGGWLADNLNDGRLDYFYWLLAVISAINLVLFTLAARGY  566

Query  383   VYKEKRLAEMGIELEEETHIPGGH  312
             VYKEKRLA+ GIEL +E  I  GH
Sbjct  567   VYKEKRLADAGIELADEEAIAVGH  590



>ref|XP_008658424.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46299.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
 tpg|DAA46300.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
Length=595

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/569 (64%), Positives = 438/569 (77%), Gaps = 23/569 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILG E  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+GASFML LLGGFVAD
Sbjct  37    AAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNASAANTVTNFIGASFMLCLLGGFVAD  96

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             T+LGRYLTI IFT VQA GV ILTIST  P L+PP C+   G+   CVPA+G QLGVLYL
Sbjct  97    TYLGRYLTIAIFTAVQATGVMILTISTAAPGLRPPACADAKGASPDCVPANGTQLGVLYL  156

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
              LYLTALGTGGLKSSVSG G+DQFD++   ER +M++FF+WF FF+++G+LLAVTVLVY+
Sbjct  157   GLYLTALGTGGLKSSVSGFGSDQFDEAHGGERKRMLRFFNWFYFFVSIGALLAVTVLVYV  216

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDN+GRRWGYG+CA  I+  L +FL GTRRYRF+KLVGSPLTQ+AAV  AAW KR L LP
Sbjct  217   QDNVGRRWGYGICAVGILCGLGVFLLGTRRYRFRKLVGSPLTQVAAVTAAAWSKRALPLP  276

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSIST  1107
             SDP++LY+VDD  AA  D + K+ K+PHSKE RFLD AAI       E     +KW++ T
Sbjct  277   SDPDMLYDVDDAAAAGADVKGKE-KLPHSKECRFLDHAAIVVVDGGGESSPAASKWALCT  335

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHM--SKSFEVPAASMAV  933
              TDVEEVKQ++RMLP WATTIMFWT+HAQ+ TFSV+QA  MDR +     F +PA S+ V
Sbjct  336   RTDVEEVKQVVRMLPIWATTIMFWTIHAQMTTFSVAQAEVMDRALGGGSGFLIPAGSLTV  395

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F +G IL+T+ +YDR++ P+ RR+  NP GL+PLQR+ VGL LSV GM  AALVE  R +
Sbjct  396   FLIGSILLTVPVYDRLLAPLARRLTGNPHGLTPLQRVFVGLLLSVAGMAVAALVERHR-Q  454

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             VA  HG T        ++VF L  Q+++VG+GEA TY+GQL FFLRECPKGMKTMSTGLF
Sbjct  455   VASGHGAT--------LTVFLLMPQFVLVGAGEAFTYMGQLAFFLRECPKGMKTMSTGLF  506

Query  572   LSTVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LST ALG FFS++LVTIV KVT    +  WLAD+L+ G+L  FYWLLAV+SA+NL+ F F
Sbjct  507   LSTCALGFFFSTLLVTIVHKVTAHAGRDGWLADNLDDGRLDYFYWLLAVISAINLVLFTF  566

Query  398   CSRGYVYKEKRLAEMGIELEEETHIPGGH  312
              +RGYVYKEKRLA+ GIEL +E  I  GH
Sbjct  567   AARGYVYKEKRLADAGIELADEESIAVGH  595



>emb|CBI31901.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/558 (63%), Positives = 416/558 (75%), Gaps = 77/558 (14%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SFML LLGGFVA
Sbjct  32    SAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASSANTVTNFLGTSFMLCLLGGFVA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-CVPASggqlgvlyla  1626
             DTFLGRYLTI IF TVQA GVTILTIST IPSL+PPKC+ E+G  C PASG QL VLYLA
Sbjct  92    DTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKCAMETGPLCTPASGMQLVVLYLA  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYLTALGTGGLKSSVSG G+DQFDDS+K ER QM  FF+W                    
Sbjct  152   LYLTALGTGGLKSSVSGFGSDQFDDSNKEERNQMTNFFNW--------------------  191

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
                  +WGYG+CACAI   LV+FLSGTR+YRFKKLVGSPLTQIA V+VAAW+KR LELP+
Sbjct  192   -----KWGYGICACAIAIGLVVFLSGTRKYRFKKLVGSPLTQIATVFVAAWKKRNLELPT  246

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-----GVSEV-NKWSISTL  1104
             D   L+++D   AAA  Q+ KK ++PHSK+FRFLDRAAIK+     G++ V NKW +STL
Sbjct  247   DSSFLFDID--YAAAEGQKKKKQRLPHSKQFRFLDRAAIKDPQMGNGINAVVNKWQLSTL  304

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             TDVEEVK ++RMLPTWATTI+FWTV+AQ+ TFSVSQA TMDRH+ KSF++P AS+ VF+V
Sbjct  305   TDVEEVKLVLRMLPTWATTILFWTVYAQMTTFSVSQATTMDRHIGKSFQIPPASLTVFFV  364

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDRI+VPI  R+L NPQGL+PLQRI VGL LS++ M+AAAL E+KRL VAR
Sbjct  365   GAILLTVPVYDRILVPIAARILKNPQGLTPLQRIGVGLVLSILAMVAAALTELKRLHVAR  424

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             SHGLT DP A                    A TY+GQLDFFLR+                
Sbjct  425   SHGLTDDPTAV-------------------AFTYIGQLDFFLRD----------------  449

Query  563   VALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
                     S+LV+IV K+TG++KPWLAD+LNQGKLY+FYWLLA++S  NL  +L  ++ Y
Sbjct  450   --------SLLVSIVHKLTGDRKPWLADNLNQGKLYNFYWLLAILSVFNLGFYLIGAKWY  501

Query  383   VYKEKRLAEMGIELEEET  330
             VYK+KRLA+ GIELE++ 
Sbjct  502   VYKDKRLADEGIELEDQN  519



>dbj|BAC99394.1| putative nitrate transporter [Oryza sativa Japonica Group]
 gb|EAZ05635.1| hypothetical protein OsI_27853 [Oryza sativa Indica Group]
Length=603

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/545 (66%), Positives = 434/545 (80%), Gaps = 11/545 (2%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMH GNA AANVVTNF+G SFML LLGGFVA
Sbjct  39    AAAMILVAELNERLTTLGIAVNLVTYLTATMHAGNAEAANVVTNFMGTSFMLCLLGGFVA  98

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGRYLTI IFT VQA+GVTILTIST  P L+P  C+  S +C  A+G Q+GVLYLAL
Sbjct  99    DSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPAACAAGSAACERATGAQMGVLYLAL  158

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD+SD  E+ QM++FF+WF FFI++GSLLAVTVLVY+QD
Sbjct  159   YLTALGTGGLKSSVSGFGSDQFDESDSGEKSQMMRFFNWFFFFISLGSLLAVTVLVYVQD  218

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG CA AI   LV+FL+GTRRYRFKKLVGSPLTQIAAV VAAWRKRRLELPSD
Sbjct  219   NLGRPWGYGACAAAIAAGLVVFLAGTRRYRFKKLVGSPLTQIAAVVVAAWRKRRLELPSD  278

Query  1262  PELLYNVD--------DVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS-EVNKWSIS  1110
             P +LY++D          +AA+  +   K ++PH+K+FRFLD AAI +    E +KW+++
Sbjct  279   PAMLYDIDVGKLAAAEVELAASSKKSKLKQRLPHTKQFRFLDHAAINDAPDGEQSKWTLA  338

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PA S+ VF
Sbjct  339   TLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQATTMDRHIGASFQIPAGSLTVF  398

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T+ +YDR++VP+ RR   NP GL+PLQRI VGL LS+V M+ AAL E++RL+V
Sbjct  399   FVGSILLTVPIYDRLVVPVARRATGNPHGLTPLQRIGVGLVLSIVAMVCAALTEVRRLRV  458

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             AR   +    A  VPM+VFWL  Q+L VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFL
Sbjct  459   ARDARVGGGEA--VPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFL  516

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LG F SS LV  V K+TG++ PWLAD LN+G+L+ FYWLLA +   NL+ +L  +R
Sbjct  517   STLSLGFFVSSALVAAVHKLTGDRHPWLADDLNKGQLHKFYWLLAGVCLANLLVYLVAAR  576

Query  389   GYVYK  375
              Y YK
Sbjct  577   WYKYK  581



>gb|EMT27347.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=542

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/552 (61%), Positives = 423/552 (77%), Gaps = 18/552 (3%)
 Frame = -3

Query  1943  LTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRYLTIGIF  1764
             +TTLGI +NLV Y+T  MHLG+A +AN VTNF+G SFML LLGGF+AD++LGRYLTI +F
Sbjct  1     MTTLGIAVNLVPYMTGPMHLGSAASANTVTNFIGTSFMLCLLGGFIADSYLGRYLTIAVF  60

Query  1763  TTVQAAGVtiltistiipsLQPPKCSPESG---SCVPASggqlgvlylalyltalgtggL  1593
             + VQA GV ILTIST+ P L+P  C   +G    CVPA+G QLGVLYL LY+TALGTGGL
Sbjct  61    SAVQATGVMILTISTVAPGLRPAACGDATGQSPDCVPANGTQLGVLYLGLYMTALGTGGL  120

Query  1592  KSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGL  1413
             KSSVSG G+DQFD+SD  ER  M+   +WF FF+++G+LLAVTVLVY+QDN+GRRWGYG+
Sbjct  121   KSSVSGFGSDQFDESDDGERKMMMGLLNWFYFFVSIGALLAVTVLVYVQDNVGRRWGYGV  180

Query  1412  CACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDV  1233
              A  I+  L +FLSGTR+YRFKKLVGSPLTQ+A V  AAWRKR L  PSDP +LY+VD+ 
Sbjct  181   VAVGILCGLGVFLSGTRKYRFKKLVGSPLTQVATVTAAAWRKRSLPPPSDPSMLYDVDN-  239

Query  1232  VAAAGDQEHKKIKMPHSKEFRFLDRAAI--KEGVSEVNKWSISTLTDVEEVKQLIRMLPT  1059
              AAAG+    K+K+PHSKE RFLD AA+  +E  +  + W++ T TDVEEVKQ++RMLP 
Sbjct  240   KAAAGEDLKGKLKLPHSKECRFLDHAAVVDRESPAAASGWTLCTRTDVEEVKQVVRMLPI  299

Query  1058  WATTIMFWTVHAQLMTFSVSQAATMDRHMSKS-FEVPAASMAVFYVGGILVTIMMYDRIM  882
             WATTIMFWT+HAQ+ TF+V QA+ M+R +  S F +PA S+ VF +G IL+T+ +YDR++
Sbjct  300   WATTIMFWTIHAQMTTFAVEQASVMNRAIGGSGFLIPAGSLTVFLIGSILLTVPLYDRLV  359

Query  881   VPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAATVPM  702
              P+ RRV  NP GLSPLQR+ VGL LS+ GM AAAL+E  RL          + A  V +
Sbjct  360   APVARRVTGNPHGLSPLQRVFVGLFLSIAGMAAAALIERYRLT---------ESADGVTL  410

Query  701   SVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSVLVTI  522
             +VF L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST ALG FFS+++VTI
Sbjct  411   TVFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLSTCALGFFFSTLIVTI  470

Query  521   VGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLAEMGI  348
             V KVTG      WLA++++QG+L  FYWLLAVMS +N++ F   +RGYVYKEKR+A+ GI
Sbjct  471   VHKVTGHGSNDGWLANNIDQGRLDYFYWLLAVMSGINIVFFTIAARGYVYKEKRMADAGI  530

Query  347   ELEEETHIPGGH  312
             EL +E  +  GH
Sbjct  531   ELADEEAMIVGH  542



>dbj|BAK05363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/565 (62%), Positives = 427/565 (76%), Gaps = 30/565 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE  ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SF+L LLGGFVA
Sbjct  37    SAAMILGVELNERLTTLGIAVNLVTYLTATMHLGNAASANAVTNFLGTSFLLCLLGGFVA  96

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS-----CVPASggqlgv  1638
             DT+LGRYLTI I T VQAAG+T+LT+ST  P L+P  C   SG      C P SG QLGV
Sbjct  97    DTYLGRYLTIAISTAVQAAGMTVLTVSTAAPGLRPAPCKDPSGDGSAPGCAPPSGTQLGV  156

Query  1637  lylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVL  1458
             LYL LYLTALGTGGLKSSVSG G+DQFD+S   ER +M +FF WF FFI++GSLLAVTVL
Sbjct  157   LYLGLYLTALGTGGLKSSVSGFGSDQFDESHAGERRRMARFFGWFFFFISLGSLLAVTVL  216

Query  1457  VYIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRL  1278
             VY+QDN+GRRWGYG C  AI+  L +FL+GT RYRFKKL GSPLTQIAAV  AAWRKR L
Sbjct  217   VYVQDNVGRRWGYGACVVAILAGLGVFLAGTPRYRFKKLAGSPLTQIAAVTAAAWRKRAL  276

Query  1277  ELPSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSEVNK--------  1122
              LPSDP +LY+VDD  AAAG+    K K+PHSK+ RFLD+AAI E   E+          
Sbjct  277   PLPSDPAMLYDVDD-AAAAGEDVGGKRKLPHSKQCRFLDQAAIVEVEVELEPSSPSSGKK  335

Query  1121  -----WSISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFE  957
                  W++ T+T+VEEVKQ++RMLPTWATTI+FWTV+AQ+ TFSVSQA  +DR + +SF 
Sbjct  336   KKKKKWAVCTVTEVEEVKQVVRMLPTWATTIVFWTVYAQMTTFSVSQAQALDRRLGRSFV  395

Query  956   VPAASMAVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAA  777
             +PA S+ VF+VG IL+T+ +YDR++ P+ RR+  NPQGLSPLQRI VGL LS++ M  A 
Sbjct  396   IPAGSLTVFFVGSILLTVPIYDRLIAPLARRLTGNPQGLSPLQRIFVGLFLSILAMAVAG  455

Query  776   LVEIKRLKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGM  597
             L E +RL  +          A V +SVF +  Q+L+VG+GEA TY+GQLDFFLRECPK M
Sbjct  456   LTERRRLTAS---------TAGVQLSVFLIVPQFLLVGAGEAFTYIGQLDFFLRECPKDM  506

Query  596   KTMSTGLFLSTVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSA  423
             KTMSTGLFL+T++LG F SS LV++V  VT    ++PWLA+ +++G+L  FYWLLA +SA
Sbjct  507   KTMSTGLFLTTLSLGFFLSSGLVSVVHAVTSSDGRRPWLANDIDKGRLDYFYWLLAAISA  566

Query  422   LNLMAFLFCSRGYVYKEKRLAEMGI  348
              NL  F+  ++GYVYKEKRLA+ GI
Sbjct  567   ANLGIFVAAAKGYVYKEKRLADAGI  591



>ref|XP_007155636.1| hypothetical protein PHAVU_003G218500g [Phaseolus vulgaris]
 gb|ESW27630.1| hypothetical protein PHAVU_003G218500g [Phaseolus vulgaris]
Length=450

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/427 (67%), Positives = 352/427 (82%), Gaps = 12/427 (3%)
 Frame = -3

Query  1592  KSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGL  1413
             KSSVSG GTDQFD+SDK E+ QM+KFF+WF+FFI++G+L AVTVLVYIQD++GR WGYG+
Sbjct  21    KSSVSGFGTDQFDESDKVEKNQMIKFFNWFVFFISLGTLTAVTVLVYIQDHIGRYWGYGI  80

Query  1412  CACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDV  1233
               CAI+ AL++FLSGTRRYRFKKLVGSPLTQIA V VAAWRKR LELPSD  LL+N+DDV
Sbjct  81    SVCAILVALMVFLSGTRRYRFKKLVGSPLTQIAMVLVAAWRKRHLELPSDASLLFNLDDV  140

Query  1232  VAAAGDQEHKKIK--MPHSKEFRFLDRAAIK------EGVSEVNKWSISTLTDVEEVKQL  1077
                  D+  +K K  +PHS++FRFLD+AAIK      + ++   KW +STLTDVEEVK +
Sbjct  141   ----ADETLRKQKQMLPHSRQFRFLDKAAIKDPKTDSQEITMERKWYLSTLTDVEEVKMV  196

Query  1076  IRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMM  897
              RMLP WATTIMFWT++AQ+ TFSVSQA TMDRH+  SF++PAAS+ VF+V  IL+T+ +
Sbjct  197   QRMLPVWATTIMFWTIYAQMTTFSVSQATTMDRHIGNSFQIPAASLTVFFVASILLTVPI  256

Query  896   YDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPA  717
             YDR++ PI ++V  NPQGL+PLQRI VGL LS+  M+AAAL EIKRL+VAR+HGLT    
Sbjct  257   YDRVIAPIAKKVTKNPQGLTPLQRIGVGLVLSIFAMVAAALTEIKRLRVARAHGLTHKHN  316

Query  716   ATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSS  537
             A VP+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F SS
Sbjct  317   AVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFLSS  376

Query  536   VLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLAE  357
             +LVT+V K T   +PWLAD+LN+GKL+ FYWLLAV+S +NL+ +LFC++GYVYK+KRLAE
Sbjct  377   MLVTLVHKATRHSEPWLADNLNEGKLHHFYWLLAVLSGVNLVVYLFCAKGYVYKDKRLAE  436

Query  356   MGIELEE  336
              GIELEE
Sbjct  437   AGIELEE  443



>gb|EAZ41557.1| hypothetical protein OsJ_26080 [Oryza sativa Japonica Group]
Length=634

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/546 (66%), Positives = 428/546 (78%), Gaps = 14/546 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AAMIL  E  ERLTTLGI +NLVTYLT TMH GNA AANVVTNF+G SFML LLGGFVA
Sbjct  39    AAAMILVAELNERLTTLGIAVNLVTYLTATMHAGNAEAANVVTNFMGTSFMLCLLGGFVA  98

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGRYLTI IFT VQA GVTILTIST  P L+P  C+  S +C  A+G Q+GVLYLAL
Sbjct  99    DSFLGRYLTIAIFTAVQAPGVTILTISTAAPGLRPAACAAGSAACERATGAQMGVLYLAL  158

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD+SD  E+ QM++FF+WF FFI++GSLLAVTVLVY+QD
Sbjct  159   YLTALGTGGLKSSVSGFGSDQFDESDSGEKSQMMRFFNWFFFFISLGSLLAVTVLVYVQD  218

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             NLGR WGYG CA AI   LV+FL+GTRRYRFKKLVGSPLTQIAAV VAAWRKRRLELPSD
Sbjct  219   NLGRPWGYGACAAAIAAGLVVFLAGTRRYRFKKLVGSPLTQIAAVVVAAWRKRRLELPSD  278

Query  1262  PELLYNVD--------DVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS-EVNKWSIS  1110
             P +LY++D          +AA+  +   K ++PH+K+FRFLD AAI +    E +KW+++
Sbjct  279   PAMLYDIDVGKLAAAEVELAASSKKSKLKQRLPHTKQFRFLDHAAINDAPDGEQSKWTLA  338

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PA S+ VF
Sbjct  339   TLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQATTMDRHIGASFQIPAGSLTVF  398

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T+ +YDR++VP+ RR   NP GL+PLQRI VGL LS+V M+ AAL E++RL+V
Sbjct  399   FVGSILLTVPIYDRLVVPVARRATGNPHGLTPLQRIGVGLVLSIVAMVFAALTEVRRLRV  458

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             AR   +    A  VPM+VFWL  Q+L VG+GE  TY+GQLDFFLRECPKG+KTMSTGLFL
Sbjct  459   ARDARVGGGEA--VPMTVFWLIPQFLFVGAGEGFTYIGQLDFFLRECPKGIKTMSTGLFL  516

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ST++LG F SS LV  V K+TG++ PWLAD LN+G+L+ FYWLLA +   NL   LF  R
Sbjct  517   STLSLGFFVSSALVAAVHKLTGDRHPWLADDLNKGQLHKFYWLLAGVCLANL---LFTCR  573

Query  389   GYVYKE  372
                  E
Sbjct  574   QRAANE  579



>ref|XP_006841166.1| hypothetical protein AMTR_s00086p00160300 [Amborella trichopoda]
 gb|ERN02841.1| hypothetical protein AMTR_s00086p00160300 [Amborella trichopoda]
Length=578

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/550 (62%), Positives = 419/550 (76%), Gaps = 22/550 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA ILGVE  ERLTTLGI +NLVTYLT+TMHL +A AAN VTNFLG SFML LLGGF+A
Sbjct  29    SAASILGVELVERLTTLGIAVNLVTYLTNTMHLRSAYAANSVTNFLGTSFMLCLLGGFIA  88

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGRY TI IF  VQA GVT+LTIST+IP+L+PP C+ E G CVPAS  QL +L+LAL
Sbjct  89    DSFLGRYRTIAIFAAVQALGVTLLTISTVIPALRPPPCN-EGGRCVPASTLQLSMLFLAL  147

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD+S   E+ QM++FF WF FFI +G+L AVTVLVYIQD
Sbjct  148   YLTALGTGGLKSSVSGFGSDQFDESVANEKAQMMRFFQWFFFFITLGALGAVTVLVYIQD  207

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             N+GRRWGYG C CA+V AL ++LSGTRRYRFKKL  SPLTQIA V  A+W+ R LELP D
Sbjct  208   NIGRRWGYGTCVCAMVVALAVYLSGTRRYRFKKLASSPLTQIARVLFASWKNRHLELPLD  267

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE---GVSE--VNKWSISTLTD  1098
             P  L             E KK +  H+K+FRFLD+AAI E   G+ E   N W   +L D
Sbjct  268   PMAL-------CQENFSEMKKPRFIHTKQFRFLDKAAILEPNLGLPERPTNPWKQCSLMD  320

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK +I+MLP WATTIMFWTV+AQ+ TFSV QA TM RH+   F +P+AS+ +F+V  
Sbjct  321   VEEVKMVIKMLPIWATTIMFWTVYAQMTTFSVQQAMTMRRHIVGGFSIPSASLTLFFVVS  380

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+ + +YDR++ P+ RR+  +PQG SPLQRIA GL LSV+ M+AAAL EIKR+  A   
Sbjct  381   ILLIVPLYDRVIRPLSRRITGHPQGFSPLQRIACGLILSVLAMVAAALTEIKRVHAAHPS  440

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
                   ++ VP+SVFWL  Q+++VG GEALTYVGQLDFFL+ECP+GMK+MSTG+FLST++
Sbjct  441   ------SSVVPLSVFWLVPQFVLVGVGEALTYVGQLDFFLKECPQGMKSMSTGMFLSTLS  494

Query  557   LGLFFSSVLVTIVGKVTGEKKP---WLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             LG FFSS+LV++V K+T        W+AD LN+G+LYDFYWLL ++S LNL  F FC+RG
Sbjct  495   LGFFFSSILVSVVDKLTTHGSSGGGWIADDLNKGRLYDFYWLLGILSFLNLGVFFFCARG  554

Query  386   YVYKEKRLAE  357
             YVY + R+AE
Sbjct  555   YVYNDARMAE  564



>gb|KHG28852.1| Uncharacterized protein F383_16009 [Gossypium arboreum]
Length=526

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/553 (63%), Positives = 414/553 (75%), Gaps = 66/553 (12%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVEACERLTTLGI +NLVTYLT+TMHLGNA +AN+VTNF G SFML LLGGF+A
Sbjct  32    SAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATSANIVTNFFGTSFMLCLLGGFIA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS--CVPASggqlgvlyl  1629
             DTFLGRY TIGIFT VQA GVTILT+STIIP+L+PPKC+ E  +  C PASG QL VLYL
Sbjct  92    DTFLGRYFTIGIFTAVQATGVTILTVSTIIPTLRPPKCNREDITTICTPASGIQLSVLYL  151

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALYLTALGTGGLKSSVSG G+DQFDD+D  ER QM  FF+WF FFI++GSL +VT+LVYI
Sbjct  152   ALYLTALGTGGLKSSVSGFGSDQFDDTDPEERSQMSNFFNWFFFFISLGSLCSVTILVYI  211

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QDNLGR WGY + ACAIV  LV+FLSGT+RYRFKKLVGSPLTQIAAV+VAAWRK+ L+LP
Sbjct  212   QDNLGRDWGYCIIACAIVIGLVVFLSGTKRYRFKKLVGSPLTQIAAVFVAAWRKKHLKLP  271

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE-GVSEVNKWSISTLTDVE  1092
             SDP  L+N+DD  AA G    K+ K+PH+K+FRFLDRAAI++  V   NKW+++TLTDVE
Sbjct  272   SDPSSLFNIDD--AAEGLMMKKQQKLPHTKQFRFLDRAAIEDPSVINANKWNLATLTDVE  329

Query  1091  EVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGIL  912
             EVK ++RMLP WATTI+FWTV+AQ+ TFSVSQA TMDRH+ K F++P AS+ VF+VG IL
Sbjct  330   EVKLVLRMLPIWATTIIFWTVYAQMSTFSVSQATTMDRHIGK-FQIPPASLTVFFVGAIL  388

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             +T+ +YDR++VPI R+VL NPQGL+PLQRIAVGL LS++ M+ AAL EIKRL+ A  +GL
Sbjct  389   LTVPIYDRLIVPIARKVLKNPQGLTPLQRIAVGLVLSIIAMVGAALTEIKRLRAATRNGL  448

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
             T +P A +P+SVFWL  Q+L VG+GEA TY                              
Sbjct  449   TNNPTAPIPLSVFWLVPQFLFVGAGEAFTY------------------------------  478

Query  551   LFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE  372
                      IV KVT    PWL D+LNQG+LY+FYWLL                     +
Sbjct  479   ---------IVDKVTRNNHPWLPDNLNQGRLYNFYWLL---------------------D  508

Query  371   KRLAEMGIELEEE  333
             KRLA+ GIELE+ 
Sbjct  509   KRLADEGIELEDS  521



>ref|XP_011033951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like, partial [Populus 
euphratica]
Length=505

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/515 (63%), Positives = 402/515 (78%), Gaps = 21/515 (4%)
 Frame = -3

Query  1874  GAANVVTNFLGASFMLTLLGGFVADTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPP  1695
             G   + T FL  S+ +T L  F    F+ + +TI   +TV  +             L+PP
Sbjct  3     GRKRLWTFFLFGSYYITSLVSFFLLIFVDQGVTILTISTVVPS-------------LRPP  49

Query  1694  KCSPESGSCVPASggqlgvlylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKF  1515
             KC   +G C+PA+G QL VLYLALYLTALGTGGLKSSVSG G+DQFD++D +ER QM+ F
Sbjct  50    KCVDSTG-CIPANGEQLTVLYLALYLTALGTGGLKSSVSGFGSDQFDETDPKERKQMLNF  108

Query  1514  FSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVG  1335
             F+WF F IN+G+L AVTVLVYIQDNLGR WGYG+CACAIV  L++FLSGTRRYRF+KL G
Sbjct  109   FNWFFFLINIGALCAVTVLVYIQDNLGREWGYGICACAIVLGLIVFLSGTRRYRFRKLAG  168

Query  1334  SPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRA  1155
             SPLTQIA V+V+AWRKR +ELP D  LLYNVDDV   +   + KK K+PH+K+FRFLD+A
Sbjct  169   SPLTQIATVFVSAWRKRHMELPLDVSLLYNVDDVEEGS---KGKKQKLPHTKQFRFLDKA  225

Query  1154  AIK--EGVSEVNKWSISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMD  981
             AI+  EG  +VNKW+++TLTDVEEVK +IRM+P WATT++FWTV+AQ+ TFSVSQA TMD
Sbjct  226   AIRGLEG-GKVNKWNLATLTDVEEVKMVIRMMPIWATTVIFWTVYAQMTTFSVSQATTMD  284

Query  980   RHMSKSFEVPAASMAVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALS  801
             R + KSF++PAAS+ VF+VG IL+T+ +YDRI+VP+ RRVL +PQGL+PL+RI VGL LS
Sbjct  285   RRIGKSFQIPAASLTVFFVGSILLTVPVYDRIIVPVARRVLKHPQGLTPLRRIGVGLVLS  344

Query  800   VVGMMAAALVEIKRLKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFF  621
             +VGM+AAAL E KR   A  HGL  DP A +P++VFWL  Q+  VGSGEA TY+GQLDFF
Sbjct  345   IVGMIAAALTEKKRRSAAILHGLATDPTAEIPLTVFWLVPQFFFVGSGEAFTYIGQLDFF  404

Query  620   LRECPKGMKTMSTGLFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWL  441
             LRECPKGMKTMSTGLFLST++LG F SS LV IV KVT   KPWLAD+LNQG+L+DFYWL
Sbjct  405   LRECPKGMKTMSTGLFLSTLSLGFFVSSSLVAIVHKVT-LNKPWLADNLNQGRLHDFYWL  463

Query  440   LAVMSALNLMAFLFCSRGYVYKEKRLAEMGIELEE  336
             +A++SALN + +L C+R YV K++RLA  GIEL+E
Sbjct  464   VAILSALNFVIYLICARWYVSKDERLAAEGIELDE  498



>ref|XP_006440345.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53585.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=448

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/418 (68%), Positives = 347/418 (83%), Gaps = 11/418 (3%)
 Frame = -3

Query  1592  KSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGL  1413
             KSSVSG G+DQFDDSD +ER QM  FF+WF FFI++GSL AVTVLVYIQDNLGR WGYG+
Sbjct  21    KSSVSGFGSDQFDDSDPQERNQMTNFFNWFFFFISIGSLAAVTVLVYIQDNLGREWGYGI  80

Query  1412  CACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDV  1233
             CACAIV  LV+FLSGTRRYRFKKLVGSPLTQIA+V+VAAWRKR L+LPSDP + +N+DD+
Sbjct  81    CACAIVFGLVVFLSGTRRYRFKKLVGSPLTQIASVFVAAWRKRHLDLPSDPSMFFNIDDI  140

Query  1232  VAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTLTDVEEVKQLI  1074
                  + +  K ++PH+K+FRFLD+AAI             +NKW+++TLTDVEEVK +I
Sbjct  141   PV---EGKKTKQRLPHTKQFRFLDKAAIFKDSDMSNSTTVVINKWNLATLTDVEEVKMVI  197

Query  1073  RMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMMY  894
             RMLP WATTI+FWTV+AQ+ TFSVSQA TM+RH+  SFE+P AS+  F+VG IL+T+ +Y
Sbjct  198   RMLPIWATTIIFWTVYAQMTTFSVSQATTMNRHIG-SFEIPGASLTFFFVGSILLTVPVY  256

Query  893   DRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAA  714
             DRI+VPI R+V   PQGL+PLQRI VGL LS+  M+AAAL EIKRL+ ARSHGLT DP A
Sbjct  257   DRIIVPIARKVFKTPQGLTPLQRIGVGLVLSIFAMVAAALCEIKRLRAARSHGLTNDPTA  316

Query  713   TVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSV  534
              +P+SVFWL  Q+ +VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F SS+
Sbjct  317   EIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSL  376

Query  533   LVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLA  360
             LV++V KVTG+KKPWLAD+LNQG+LYDFYWLLA++SALN + +L  +R YVYK+KRLA
Sbjct  377   LVSLVHKVTGDKKPWLADNLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKRLA  434



>gb|EEC67416.1| hypothetical protein OsI_34598 [Oryza sativa Indica Group]
Length=568

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/568 (61%), Positives = 413/568 (73%), Gaps = 46/568 (8%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILG E  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+G SFML LLGGFVAD
Sbjct  35    AAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVAD  94

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             T+LGRYLTI IF  VQA GV ILTIST  P L+PP C    G+   CV A G QLGVLYL
Sbjct  95    TYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDPKGASAECVAADGTQLGVLYL  154

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSD-KRERGQMVKFFSWFIFFINVGSLLAVTVLVY  1452
              LYLTALGTGGLKSSVSG G+DQFD+SD   ER +M++FF+WF FF+++G+LLAVTVLVY
Sbjct  155   GLYLTALGTGGLKSSVSGFGSDQFDESDVDGERKKMMRFFNWFYFFVSLGALLAVTVLVY  214

Query  1451  IQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLEL  1272
             +QDN+GRRWGYG+CA  I+  L +FLSGTRRYRFKKLVGSPLTQ+AAV  AAW KR L L
Sbjct  215   VQDNVGRRWGYGICAAGILAGLAVFLSGTRRYRFKKLVGSPLTQVAAVTAAAWSKRSLPL  274

Query  1271  PSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-----KEGVSEVNKWSIST  1107
             PSDP++LY+VDD  AA  D + K+ +MPHSKE RFLD AAI      E  +  +KW + T
Sbjct  275   PSDPDMLYDVDDAAAAGHDVKGKQ-RMPHSKECRFLDHAAIIDRSAAESPAMASKWRLCT  333

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
              TDVEEVKQ++RMLP WATTIMFWT+HAQ+ TF+V+QA  MDR ++  F +PA S+ VF 
Sbjct  334   RTDVEEVKQVVRMLPIWATTIMFWTIHAQMTTFAVAQAELMDRRLAGGFLIPAGSLTVFL  393

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             +  IL+T                          R+ VGL+LS+ GM  AA VE  R   +
Sbjct  394   IASILLT--------------------------RVFVGLSLSIAGMAVAAAVERHRATAS  427

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
              S       AA  P +VF L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  428   ASA------AAAAP-TVFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLS  480

Query  566   TVALGLFFSSVLVTIVGKVTGEKK---PWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T A+G FFS++LVTIV KVTG       WLAD+L+ G+L  FYWLLAV+SA+NL+ F   
Sbjct  481   TCAIGFFFSTLLVTIVHKVTGHGARGGGWLADNLDDGRLDYFYWLLAVISAINLVLFTVA  540

Query  395   SRGYVYKEKRLAEMGIELEEETHIPGGH  312
             +RGYVYKEKRLA+ GIEL +E  I  GH
Sbjct  541   ARGYVYKEKRLADAGIELADEETIAVGH  568



>gb|ABF93501.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01124.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64490.1| hypothetical protein OsJ_19340 [Oryza sativa Japonica Group]
Length=589

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/553 (63%), Positives = 422/553 (76%), Gaps = 24/553 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ERLTTLG+ +NLVTYLT TMHLG+A +AN VTNFLG SFML LLGGF+A
Sbjct  50    SAAMILCVELNERLTTLGVAVNLVTYLTGTMHLGSAASANAVTNFLGTSFMLCLLGGFLA  109

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DT+LGRYLTI IFT VQAAG+ +LTIST  P L+PP CS     C  A+G QLGVLYL L
Sbjct  110   DTYLGRYLTIAIFTAVQAAGMAVLTISTAAPGLRPPPCSSGGSGCAAANGTQLGVLYLGL  169

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSVSG G+DQFD+SD  ERG M +FFSWF FFI++GSLLAVTVLVY+QD
Sbjct  170   YMTALGTGGLKSSVSGFGSDQFDESDGGERGSMARFFSWFFFFISMGSLLAVTVLVYVQD  229

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GRRWGYG+C  AI+  L+ FL+GT  YRFKKL+GSPLTQIAAV  AAW  R L LPSD
Sbjct  230   KVGRRWGYGICVVAILTGLLFFLAGTTTYRFKKLLGSPLTQIAAVTAAAWTNRNLPLPSD  289

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS----EVNKW-SISTLTD  1098
             P +L N DD   +A        K+PHSK+FRFLD AAI E  +    +  +W +  T+T+
Sbjct  290   PSML-NHDD---SAHTTAKPNQKLPHSKQFRFLDHAAIVETTTAEAKKRKRWAACCTVTE  345

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVKQL+RMLPTWATTI+FWTV+AQ+ TFSVSQAA MDR +S SF +PA S+ VF+V  
Sbjct  346   VEEVKQLVRMLPTWATTILFWTVYAQMTTFSVSQAAVMDRRLSTSFVIPAGSLTVFFVAA  405

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQ-GLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             IL+T+ +Y R++ P+ RR+  NP+  LSPL RI VGL L+ + M+AAAL E  R   A  
Sbjct  406   ILLTVPLYYRLLAPLVRRLTANPRYDLSPLHRIFVGLLLAALAMVAAALTERARRDAA--  463

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
                       V +SVF+L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST+
Sbjct  464   ----------VTLSVFYLLPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  513

Query  560   ALGLFFSSVLVTIVGKVTGE-KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFL-FCSRG  387
             +LG FFS+ LVT+V KVT E ++PWLAD+L++G+L +FYWLL  +S +NL  F+   +RG
Sbjct  514   SLGFFFSTALVTVVHKVTAESRRPWLADNLDEGRLDNFYWLLGGISVVNLAVFVAAAARG  573

Query  386   YVYKEKRLAEMGI  348
             YVY+EKRLA+ GI
Sbjct  574   YVYREKRLADAGI  586



>gb|EAY88182.1| hypothetical protein OsI_09629 [Oryza sativa Indica Group]
Length=589

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/553 (63%), Positives = 422/553 (76%), Gaps = 24/553 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMIL VE  ERLTTLG+ ++LVTYLT TMHLG+A +AN VTNFLG SFML LLGGF+A
Sbjct  50    SAAMILCVELNERLTTLGVAVHLVTYLTGTMHLGSAASANAVTNFLGTSFMLCLLGGFLA  109

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             DT+LGRYL I IFT VQAAG+ +LTIST  P L+PP CS     C  A+G QLGVLYL L
Sbjct  110   DTYLGRYLPIAIFTAVQAAGMAVLTISTAAPGLRPPPCSSGGSGCAAANGTQLGVLYLGL  169

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+TALGTGGLKSSVSG G+DQFD+SD  ERG M +FFSWF FFI++GSLLAVTVLVY+QD
Sbjct  170   YMTALGTGGLKSSVSGFGSDQFDESDGGERGSMARFFSWFFFFISMGSLLAVTVLVYVQD  229

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GRRWGYG+C  AI+  L+ FL+GT  YRFKKL+GSPLTQIAAV  AAW  R L LPSD
Sbjct  230   KVGRRWGYGICVVAILTGLLFFLAGTTTYRFKKLLGSPLTQIAAVTAAAWTNRNLPLPSD  289

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS----EVNKW-SISTLTD  1098
             P +L N DD   +A        K+PHSK+FRFLD AAI E  +    +  +W +  T+T+
Sbjct  290   PSML-NHDD---SAHTTAKPNQKLPHSKQFRFLDHAAIVETTTAEAKKRKRWAACCTVTE  345

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVKQL+RMLPTWATTI+FWTV+AQ+ TFSVSQAA MDR +S SF +PA S+ VF+V  
Sbjct  346   VEEVKQLVRMLPTWATTILFWTVYAQMTTFSVSQAAVMDRRLSTSFVIPAGSLTVFFVAA  405

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQ-GLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
             IL+T+ +YDR++ P+ RR+  NP+  LSPL RI VGL L+ + M+AAAL E  R   A  
Sbjct  406   ILLTVPLYDRLLAPLVRRLTANPRYDLSPLHRIFVGLLLAALAMVAAALTERARRDAA--  463

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
                       V +SVF+L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST+
Sbjct  464   ----------VTLSVFYLLPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTL  513

Query  560   ALGLFFSSVLVTIVGKVTGE-KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFL-FCSRG  387
             +LG FFS+ LVT+V KVT E ++PWLAD+L++G+L +FYWLL  +S +NL  F+   +RG
Sbjct  514   SLGFFFSTALVTVVHKVTAESRRPWLADNLDEGRLDNFYWLLGGISVVNLAVFVAAAARG  573

Query  386   YVYKEKRLAEMGI  348
             YVY+EKRLA+ GI
Sbjct  574   YVYREKRLADAGI  586



>gb|EAZ16929.1| hypothetical protein OsJ_32411 [Oryza sativa Japonica Group]
Length=574

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/568 (60%), Positives = 406/568 (71%), Gaps = 40/568 (7%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AAMILG E  ER+TTLGI +NLV Y+T TMHLGNA AAN VTNF+G SFML LLGGFVAD
Sbjct  35    AAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVAD  94

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS---CVPASggqlgvlyl  1629
             T+LGRYLTI IF  VQA GV ILTIST  P L+PP C    G+   CV A G QLGVLYL
Sbjct  95    TYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDPKGASAECVAADGTQLGVLYL  154

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSD-KRERGQMVKFFSWFIFFINVGSLLAVTVLVY  1452
              LYLTALGTGGLKSSVSG G+DQFD+SD   ER +M++FF+W                  
Sbjct  155   GLYLTALGTGGLKSSVSGFGSDQFDESDVDGERKKMMRFFNW------------------  196

Query  1451  IQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLEL  1272
                    RWGYG+CA  I+  L +FLSGTRRYRFKKLVGSPLTQ+AAV  AAW KR L L
Sbjct  197   --TTSDARWGYGICAAGILAGLAVFLSGTRRYRFKKLVGSPLTQVAAVTAAAWSKRSLPL  254

Query  1271  PSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-----KEGVSEVNKWSIST  1107
             PSDP++LY+VDD  AA  D + K+ +MPHSKE RFLD AAI      E  +  +KW + T
Sbjct  255   PSDPDMLYDVDDAAAAGHDVKGKQ-RMPHSKECRFLDHAAIIDRSAAESPATASKWRLCT  313

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
              TDVEEVKQ++RMLP WATTIMFWT+HAQ+ TF+V+QA  MDR ++  F +PA S+ VF 
Sbjct  314   RTDVEEVKQVVRMLPIWATTIMFWTIHAQMTTFAVAQAELMDRRLAGGFLIPAGSLTVFL  373

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             +  IL+T+  YDR++VP+ RR   NP GL+PLQR+ VGL+LS+ GM  AA VE  R   +
Sbjct  374   IASILLTVPFYDRLVVPVARRATANPHGLTPLQRVFVGLSLSIAGMAVAAAVERHRATAS  433

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
              S    A        +VF L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLS
Sbjct  434   ASAAAAAP-------TVFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLS  486

Query  566   TVALGLFFSSVLVTIVGKVTGEKK---PWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T A+G FFS++LVTIV KVTG       WLAD+L+ G+L  FYWLLAV+SA+NL+ F   
Sbjct  487   TCAIGFFFSTLLVTIVHKVTGHGARGGGWLADNLDDGRLDYFYWLLAVISAINLVLFTVA  546

Query  395   SRGYVYKEKRLAEMGIELEEETHIPGGH  312
             +RGYVYKEKRLA+ GIEL +E  I  GH
Sbjct  547   ARGYVYKEKRLADAGIELADEETIAVGH  574



>ref|NP_001061020.1| Os08g0155400 [Oryza sativa Japonica Group]
 dbj|BAF22934.1| Os08g0155400, partial [Oryza sativa Japonica Group]
Length=525

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/505 (66%), Positives = 402/505 (80%), Gaps = 11/505 (2%)
 Frame = -3

Query  1862  VVTNFLGASFMLTLLGGFVADTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP  1683
             VVTNF+G SFML LLGGFVAD+FLGRYLTI IFT VQA+GVTILTIST  P L+P  C+ 
Sbjct  1     VVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPAACAA  60

Query  1682  ESGSCVPASggqlgvlylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWF  1503
              S +C  A+G Q+GVLYLALYLTALGTGGLKSSVSG G+DQFD+SD  E+ QM++FF+WF
Sbjct  61    GSAACERATGAQMGVLYLALYLTALGTGGLKSSVSGFGSDQFDESDSGEKSQMMRFFNWF  120

Query  1502  IFFINVGSLLAVTVLVYIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLT  1323
              FFI++GSLLAVTVLVY+QDNLGR WGYG CA AI   LV+FL+GTRRYRFKKLVGSPLT
Sbjct  121   FFFISLGSLLAVTVLVYVQDNLGRPWGYGACAAAIAAGLVVFLAGTRRYRFKKLVGSPLT  180

Query  1322  QIAAVYVAAWRKRRLELPSDPELLYNVD--------DVVAAAGDQEHKKIKMPHSKEFRF  1167
             QIAAV VAAWRKRRLELPSDP +LY++D          +AA+  +   K ++PH+K+FRF
Sbjct  181   QIAAVVVAAWRKRRLELPSDPAMLYDIDVGKLAAAEVELAASSKKSKLKQRLPHTKQFRF  240

Query  1166  LDRAAIKEGVS-EVNKWSISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAA  990
             LD AAI +    E +KW+++TLTDVEEVK + RMLP WATTIMFWTV+AQ+ TFSVSQA 
Sbjct  241   LDHAAINDAPDGEQSKWTLATLTDVEEVKTVARMLPIWATTIMFWTVYAQMTTFSVSQAT  300

Query  989   TMDRHMSKSFEVPAASMAVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGL  810
             TMDRH+  SF++PA S+ VF+VG IL+T+ +YDR++VP+ RR   NP GL+PLQRI VGL
Sbjct  301   TMDRHIGASFQIPAGSLTVFFVGSILLTVPIYDRLVVPVARRATGNPHGLTPLQRIGVGL  360

Query  809   ALSVVGMMAAALVEIKRLKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQL  630
              LS+V M+ AAL E++RL+VAR   +    A  VPM+VFWL  Q+L VG+GEA TY+GQL
Sbjct  361   VLSIVAMVCAALTEVRRLRVARDARVGGGEA--VPMTVFWLIPQFLFVGAGEAFTYIGQL  418

Query  629   DFFLRECPKGMKTMSTGLFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDF  450
             DFFLRECPKGMKTMSTGLFLST++LG F SS LV  V K+TG++ PWLAD LN+G+L+ F
Sbjct  419   DFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKLTGDRHPWLADDLNKGQLHKF  478

Query  449   YWLLAVMSALNLMAFLFCSRGYVYK  375
             YWLLA +   NL+ +L  +R Y YK
Sbjct  479   YWLLAGVCLANLLVYLVAARWYKYK  503



>gb|ACF22756.1| nitrate transporter [Brachypodium distachyon]
Length=609

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/561 (62%), Positives = 426/561 (76%), Gaps = 25/561 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAAMILGVE  ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SF+L LLGGF+A
Sbjct  56    SAAMILGVELNERLTTLGIAVNLVTYLTGTMHLGNAASANAVTNFLGTSFLLCLLGGFLA  115

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG---SCVPASggqlgvly  1632
             DTFLGRYLTI IFT VQA+G+ ILT+ST  P L+P  C+  +G   +C   SG QLGVLY
Sbjct  116   DTFLGRYLTIAIFTAVQASGMAILTVSTAAPGLRPVACADPTGASRTCAAPSGAQLGVLY  175

Query  1631  lalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVY  1452
             L LYLTALGTGGLKSSVSG G+DQFD++D  ER  M +FF WF FFI++GSLLAVTVLVY
Sbjct  176   LGLYLTALGTGGLKSSVSGFGSDQFDEADPVERRVMARFFGWFFFFISLGSLLAVTVLVY  235

Query  1451  IQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLEL  1272
             +QDN+GRRWGYG+C  A++  L +FL+GTRRYRFKKL GSPLTQIA V  AAW KRRL +
Sbjct  236   VQDNVGRRWGYGICVVAVLAGLAVFLAGTRRYRFKKLAGSPLTQIAVVTAAAWTKRRLPM  295

Query  1271  PSDPELLYNVDDVVAAAGDQ--EHKKIK---MPHSKEFRFLDRAAIKE--GVSEVNKWSI  1113
             PSDP LLY+VDD   AAG+   + K IK   +PHS ++RFLD+AAI E    S  NKW+ 
Sbjct  296   PSDPALLYDVDD---AAGEDVVKGKGIKRRLLPHSNQYRFLDQAAIVEPSPASGKNKWAC  352

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
              T+T+VEEVKQ++RMLPTWATTI+FWTV+AQ+ TFSVSQA +M R +   F +P+ SM V
Sbjct  353   CTVTEVEEVKQVVRMLPTWATTILFWTVYAQMTTFSVSQAQSMGRRLGP-FTIPSGSMTV  411

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+V  IL+T+ +YDR++ P+ RR+  +P GL+PLQRIA GLALS + M AAAL E  RL 
Sbjct  412   FFVASILLTVPLYDRLVAPLARRLTGHPHGLTPLQRIAAGLALSALAMAAAALTERHRLL  471

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
              +             P SVF L  Q+L+VG+GEA  YVGQLDFFLRECP  MKTMSTGLF
Sbjct  472   SSSKK----------PPSVFLLVPQFLLVGAGEAFAYVGQLDFFLRECPADMKTMSTGLF  521

Query  572   LSTVALGLFFSSVLVTIVGKVTGE-KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             L+T++LG F S+ LVT V   TG   +PWLAD ++QG+L  FYWLLAV+S LNL  F+  
Sbjct  522   LTTLSLGFFLSTALVTAVHAATGSGGRPWLADDIDQGRLDYFYWLLAVLSVLNLAVFVAA  581

Query  395   SRGYVYKEKRLAEMGIELEEE  333
             +RGYVYK+KRLA+ G+++ ++
Sbjct  582   ARGYVYKDKRLADAGVKVNDD  602



>ref|XP_003562233.2| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Brachypodium distachyon]
Length=551

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/558 (62%), Positives = 423/558 (76%), Gaps = 25/558 (4%)
 Frame = -3

Query  1973  MILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTF  1794
             MILGVE  ERLTTLGI +NLVTYLT TMHLGNA +AN VTNFLG SF+L LLGGF+ADTF
Sbjct  1     MILGVELNERLTTLGIAVNLVTYLTGTMHLGNAASANAVTNFLGTSFLLCLLGGFLADTF  60

Query  1793  LGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG---SCVPASggqlgvlylal  1623
             LGRYLTI IFT VQA+G+ ILT+ST  P L+P  C+  +G   +C   SG QLGVLYL L
Sbjct  61    LGRYLTIAIFTAVQASGMAILTVSTAAPGLRPVACADPTGASRTCAAPSGAQLGVLYLGL  120

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YLTALGTGGLKSSVSG G+DQFD++D  ER  M +FF WF FFI++GSLLAVTVLVY+QD
Sbjct  121   YLTALGTGGLKSSVSGFGSDQFDEADPVERRVMARFFGWFFFFISLGSLLAVTVLVYVQD  180

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             N+GRRWGYG+C  A++  L +FL+GTRRYRFKKL GSPLTQIA V  AAW KRRL +PSD
Sbjct  181   NVGRRWGYGICVVAVLAGLAVFLAGTRRYRFKKLAGSPLTQIAVVTAAAWTKRRLPMPSD  240

Query  1262  PELLYNVDDVVAAAGDQ--EHKKIK---MPHSKEFRFLDRAAIKE--GVSEVNKWSISTL  1104
             P LLY+VDD   AAG+   + K IK   +PHS ++RFLD+AAI E    S  NKW+  T+
Sbjct  241   PALLYDVDD---AAGEDVVKGKGIKRRLLPHSNQYRFLDQAAIVEPSPASGKNKWACCTV  297

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T+VEEVKQ++RMLPTWATTI+FWTV+AQ+ TFSVSQA +M R +   F +P+ SM VF+V
Sbjct  298   TEVEEVKQVVRMLPTWATTILFWTVYAQMTTFSVSQAQSMGRRLGP-FTIPSGSMTVFFV  356

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR++ P+ RR+  +P GL+PLQRIA GLALS + M AAAL E  RL  + 
Sbjct  357   ASILLTVPLYDRLVAPLARRLTGHPHGLTPLQRIAAGLALSALAMAAAALTERHRLLSSS  416

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
                         P SVF L  Q+L+VG+GEA  YVGQLDFFLRECP  MKTMSTGLFL+T
Sbjct  417   KK----------PPSVFLLVPQFLLVGAGEAFAYVGQLDFFLRECPADMKTMSTGLFLTT  466

Query  563   VALGLFFSSVLVTIVGKVTGE-KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             ++LG F S+ LVT V   TG   +PWLAD ++QG+L  FYWLLAV+S LNL  F+  +RG
Sbjct  467   LSLGFFLSTALVTAVHAATGSGGRPWLADDIDQGRLDYFYWLLAVLSVLNLAVFVAAARG  526

Query  386   YVYKEKRLAEMGIELEEE  333
             YVYK+KRLA+ G+++ ++
Sbjct  527   YVYKDKRLADAGVKVNDD  544



>gb|ABF46820.1| putative nitrate chlorate transporter 1.1 [Fagus sylvatica]
Length=443

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/445 (70%), Positives = 370/445 (83%), Gaps = 9/445 (2%)
 Frame = -3

Query  1778  TIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlylalyltalgt  1602
             TI IF T+QA GVTILTIST+IPSL+PPKC+ E+   CVPA+G QLGVLYLAL+LTALGT
Sbjct  1     TIAIFATIQATGVTILTISTLIPSLRPPKCAAETVPPCVPANGMQLGVLYLALFLTALGT  60

Query  1601  ggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWG  1422
             GGLKSSVSG G+DQFDD DK E+ QM  FF+WF FFI++GSL AVT+LVYIQDNLGR WG
Sbjct  61    GGLKSSVSGFGSDQFDDLDKEEKIQMTNFFNWFFFFISIGSLCAVTILVYIQDNLGREWG  120

Query  1421  YGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNV  1242
             YG+C CAIV  LV+FLSGTR+YRFKKL GSPLTQI  V+VAAWRKR LELPS+  LL+NV
Sbjct  121   YGICVCAIVLGLVVFLSGTRKYRFKKLAGSPLTQIITVFVAAWRKRHLELPSESSLLFNV  180

Query  1241  DDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE------GVSEVNKWSISTLTDVEEVKQ  1080
             DD+    G ++ KK ++P +K+FRFLD+AAIK+      G++ VNKW +STLTDVEEVK 
Sbjct  181   DDI-HDEGQRKKKKQRLPRTKQFRFLDKAAIKDPEMASTGIAVVNKWYLSTLTDVEEVKL  239

Query  1079  LIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIM  900
             +IRMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PAAS+ VF+VG IL+T+ 
Sbjct  240   VIRMLPIWATTIMFWTVYAQMSTFSVSQATTMDRHIG-SFQIPAASLTVFFVGSILLTVP  298

Query  899   MYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADP  720
             +YDRI+VP+  +VL NP GL+PLQRI VGL  S+  M+AAAL E+KRLK ARSHGLT  P
Sbjct  299   IYDRIIVPVAGKVLKNPHGLTPLQRIVVGLVFSIFAMVAAALTELKRLKAARSHGLTDHP  358

Query  719   AATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFS  540
              A +P+SVFWL  Q+  VGSGEA TY+GQLDFFLRECPKGMKTMSTGLFL+T++LG F S
Sbjct  359   TAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLNTLSLGFFVS  418

Query  539   SVLVTIVGKVTGEKKPWLADHLNQG  465
             S+LVTIV KVTG K+PWLAD+LNQG
Sbjct  419   SLLVTIVHKVTGNKRPWLADNLNQG  443



>ref|XP_006837800.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
 gb|ERN00369.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
Length=576

 Score =   525 bits (1351),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 296/558 (53%), Positives = 397/558 (71%), Gaps = 27/558 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA ILG+E  ERL+TLGIG+NLVTYL  TMHL +A +AN+VT+F+G  F+L LLGGF+AD
Sbjct  23    AAFILGIELVERLSTLGIGVNLVTYLVGTMHLPSATSANIVTDFMGTCFLLCLLGGFIAD  82

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRYLTI IF+ +QA G  +L I + IP L PP C   +  C  A+G Q+GVLY++LY
Sbjct  83    SFLGRYLTILIFSALQALGTGMLAIVSRIPQLHPPPCGHGNHHCEQANGLQMGVLYISLY  142

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D++ER QM  FFS F F I++GSLLAVTVLVYIQD 
Sbjct  143   LIALGTGGLKSSVSGFGTDQFDEKDEKERTQMAHFFSRFFFCISLGSLLAVTVLVYIQDA  202

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRR--LELPS  1266
             +GR W Y +C+ +++ A+ +FL GT RYRFKK  GSP+  I  V +AA RKR+  L+LP 
Sbjct  203   VGRSWAYAICSLSMIVAIAIFLFGTPRYRFKKSAGSPIVHILQVIMAAMRKRKRNLQLPQ  262

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSISTL  1104
             +  LLY  +D   A         ++PH+K+FRFLD AAI      +EG+   N W + ++
Sbjct  263   ESSLLY--EDCNGAP--------RIPHTKQFRFLDHAAIITPEDQEEGLRSRNPWKLCSV  312

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++RMLP WAT+IMFWT +AQ++TFSV QA TM R +  SF +P AS+ VF+V
Sbjct  313   TRVEEVKMVVRMLPIWATSIMFWTTYAQMVTFSVEQATTMHRTLFGSFSIPPASLTVFFV  372

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQ-GLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             G IL+T+ +YDR++ P++RR  ++ Q  LS LQRI +GL LS++ M +AAL+E KRL +A
Sbjct  373   GTILITLAVYDRLVNPLYRRFSDSRQPPLSNLQRIGLGLFLSIISMASAALIEAKRLNIA  432

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +      D    +PMSVF+L  Q+ +VGSGEA  Y GQLDFF+ + P GMKTMSTGLFL+
Sbjct  433   KD---LHDEHGPLPMSVFYLVPQFFLVGSGEAFIYTGQLDFFITQSPAGMKTMSTGLFLT  489

Query  566   TVALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             T++LG F SS+LV++V ++TG   K  WLAD +N+G+L  FYWLL+ +S +N   +L+C+
Sbjct  490   TLSLGFFVSSMLVSMVDRITGGSGKGGWLADDINKGRLDCFYWLLSGLSLVNFAVYLWCA  549

Query  392   RGYVYKEKRLAEMGIELE  339
                 + + R     +E+E
Sbjct  550   ---AWFKPRPPPQDMEME  564



>dbj|BAG91755.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   517 bits (1332),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 264/415 (64%), Positives = 327/415 (79%), Gaps = 11/415 (3%)
 Frame = -3

Query  1592  KSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGL  1413
             KSSVSG G+DQFD+SD  E+ QM++FF+WF FFI++GSLLAVTVLVY+QDNLGR WGYG 
Sbjct  19    KSSVSGFGSDQFDESDSGEKSQMMRFFNWFFFFISLGSLLAVTVLVYVQDNLGRPWGYGA  78

Query  1412  CACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVD--  1239
             CA AI   LV+FL+GTRRYRFKKLVGSPLTQIAAV VAAWRKRRLELPSDP +LY++D  
Sbjct  79    CAAAIAAGLVVFLAGTRRYRFKKLVGSPLTQIAAVVVAAWRKRRLELPSDPAMLYDIDVG  138

Query  1238  ------DVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVS-EVNKWSISTLTDVEEVKQ  1080
                     +AA+  +   K ++PH+K+FRFLD AAI +    E +KW+++TLTDVEEVK 
Sbjct  139   KLAAAEVELAASSKKSKLKQRLPHTKQFRFLDHAAINDAPDGEQSKWTLATLTDVEEVKT  198

Query  1079  LIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIM  900
             + RMLP WATTIMFWTV+AQ+ TFSVSQA TMDRH+  SF++PA S+ VF+VG IL+T+ 
Sbjct  199   VARMLPIWATTIMFWTVYAQMTTFSVSQATTMDRHIGASFQIPAGSLTVFFVGSILLTVP  258

Query  899   MYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADP  720
             +YDR++VP+ RR   NP GL+PLQRI VGL LS+V M+ AAL E++RL+VAR   +    
Sbjct  259   IYDRLVVPVARRATGNPHGLTPLQRIGVGLVLSIVAMVCAALTEVRRLRVARDARVGGGE  318

Query  719   AATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFS  540
             A  VPM+VFWL  Q+L VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST++LG F S
Sbjct  319   A--VPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVS  376

Query  539   SVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             S LV  V K+TG++ PWLAD LN+G+L+ FYWLLA +   NL+ +L  +R Y YK
Sbjct  377   SALVAAVHKLTGDRHPWLADDLNKGQLHKFYWLLAGVCLANLLVYLVAARWYKYK  431



>ref|XP_008457678.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Cucumis melo]
Length=581

 Score =   521 bits (1342),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 291/566 (51%), Positives = 403/566 (71%), Gaps = 32/566 (6%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+I+G+E CERL+T+GI +NLVTYL  T+HL +A +AN+VT+F+G  F+L++LGGF+AD
Sbjct  31    AALIVGIELCERLSTMGIAVNLVTYLVGTLHLPSATSANIVTDFMGTCFLLSMLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlylal  1623
             +FLGRY TI IF T+Q  G   L + T +P L PP C P  S +C  A+G Q+G++YL L
Sbjct  91    SFLGRYKTIAIFATIQTLGTGTLAVITKLPQLHPPPCHPIGSKNCKQANGFQMGMIYLPL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGG+KSSVSG GTDQFD+ D +E+ QM  FF+ F  F++ G+LLAVTVLVY+QD
Sbjct  151   YLIALGTGGIKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFLFVSSGTLLAVTVLVYLQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C+ ++  A+++FL GT+RYR+KK +GSP+  I  V VAA  KR +EL  +
Sbjct  211   EVGRSWAYGICSVSMFTAILIFLCGTKRYRYKKSMGSPIVHIFQVIVAAINKRSMELQLN  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTL  1104
               LLY  +D  A +        ++ H+ +F+FLD+AAI       K   S  N W + ++
Sbjct  271   ATLLY--EDSAATS--------RIDHTNQFQFLDKAAIVAEGDFEKSVSSAPNPWKLCSV  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  321   TRVEEVKMMMRLLPVWATTIIFWTTYAQMITFSVVQASTMERSLG-NFKIPAGSLTVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+  YDR+++P++++    P G + LQRIA+GL LS  GM AAALVE+KRL VA+
Sbjct  380   AAILITLAFYDRLIMPLWKKWKGQP-GFTNLQRIAIGLILSTFGMAAAALVEMKRLSVAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G++    AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  439   AVGIS---TATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  495

Query  563   VALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV +V +VTG  + + WLAD++N  +L  FY LLA++SA+N +AFL C+ 
Sbjct  496   LSLGFFVSSFLVAVVKRVTGSMDGQGWLADNINYARLDCFYGLLAILSAINFVAFLVCAV  555

Query  389   GYV-YKEKRLAEMGIELEEETHIPGG  315
              Y   K K+L EM      ET   GG
Sbjct  556   WYKPQKPKQLLEM------ETSTNGG  575



>ref|XP_002986344.1| hypothetical protein SELMODRAFT_425373 [Selaginella moellendorffii]
 gb|EFJ12553.1| hypothetical protein SELMODRAFT_425373 [Selaginella moellendorffii]
Length=584

 Score =   516 bits (1330),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 282/549 (51%), Positives = 386/549 (70%), Gaps = 17/549 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             A ++ G E CER+TTLG+  NLVTYLT+ +HL N  A N+VTNFLG SFML LLGGF+AD
Sbjct  28    AVLVFGPELCERMTTLGVATNLVTYLTNDLHLSNTKAPNIVTNFLGTSFMLCLLGGFIAD  87

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             T++GR+ T+ I  T+Q  G+ +LTI T +PSL+PP C  +   C PA   QL +LYLALY
Sbjct  88    TYIGRFWTVAIAATIQFLGMLVLTILTSLPSLRPPHCVHD---CPPAKAKQLSLLYLALY  144

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L+ALGTGG+KS+VS  G DQFD ++ +E+  M  FF+WF   I+VG+L ++TVLVYIQDN
Sbjct  145   LSALGTGGIKSNVSAFGADQFDKNEPKEQKLMSYFFNWFFVSISVGALFSLTVLVYIQDN  204

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR WGYG+CA A++ A+V+FL+GTR YR+K   GSPLT+IA V VAA RK +LELP D 
Sbjct  205   VGRGWGYGICAAAMLLAIVIFLAGTRMYRYKAPSGSPLTRIAKVVVAAVRKHKLELPRDQ  264

Query  1259  ELLYNV----DDVVAAAGDQEHKKI-KMPHSKEFRFLDRAAIKEGVSE------VNKWSI  1113
               LY       D    A DQ  +   +  H  ++RFLD+AA+ E   +         W +
Sbjct  265   SSLYGSLGPGKDAEDPASDQSARHTNQFRHLYQYRFLDKAAVLEPSDDEIYDENPKPWRL  324

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
              T+T +EEVK ++R+LP WATTI F+TV+AQ++TFSV Q + MDR M  SF  P+AS A 
Sbjct  325   CTVTQIEEVKMVLRLLPIWATTITFYTVYAQMLTFSVVQGSKMDRKMG-SFLFPSASSAA  383

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F    I+VT+ +YDR +VP+ R++  +PQG++ LQRI VGL ++++ M+ AA+VE +R++
Sbjct  384   FLFATIMVTVTVYDRFIVPLMRKLTGHPQGITTLQRIGVGLVVAILAMVVAAMVERRRVR  443

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             +AR + L   P   VPMSV W+  QY++VG GEA TY+GQL+FF RE P GM+++  GLF
Sbjct  444   IARENKLLDSPDVPVPMSVLWILPQYVLVGIGEAFTYIGQLEFFYRESPDGMQSLGVGLF  503

Query  572   LSTVALGLFFSSVLVTIVGKVT--GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LST++LG F SS LV++V  VT  G    W+A++LN+ +L DFYWLLAV+S+ NL+ +L 
Sbjct  504   LSTISLGFFLSSFLVSVVDSVTRGGGSGGWIANNLNRSRLDDFYWLLAVVSSANLVLYLI  563

Query  398   CSRGYVYKE  372
             C+R Y Y+ 
Sbjct  564   CARWYKYRR  572



>gb|AFR11354.1| nitrate transporter [Cucumis sativus]
Length=581

 Score =   516 bits (1328),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 288/566 (51%), Positives = 400/566 (71%), Gaps = 32/566 (6%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+I+G+E CERL+T+GI +NLVTYL  T+HL +A +AN+VT+F+G  F+L++LGGF+AD
Sbjct  31    AALIVGIELCERLSTMGIAVNLVTYLVGTLHLPSANSANIVTDFMGTCFLLSMLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlylal  1623
             +FLGRY TI IF ++Q  G   L + T +P L PP C P  S +C  A+G Q+G++YL L
Sbjct  91    SFLGRYKTIAIFASIQTLGTGTLAVITKLPQLHPPPCHPIASKNCKQANGFQMGMIYLPL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+ ALGTGG+KSSVSG GTDQFD+ D +E+ QM  FF+ F  F++ G+LLAVTVLVY+QD
Sbjct  151   YIIALGTGGIKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFLFVSSGTLLAVTVLVYLQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C+ ++  A+++FL GT+RYR+K  +GSP+  I  V VAA  KR++EL  +
Sbjct  211   EVGRSWAYGICSVSMFTAILIFLCGTKRYRYKISMGSPIVHIFQVLVAAINKRKMELQLN  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTL  1104
               LLY  +D  A +        ++ H+ +F+FLD+AAI       K   S  N W + ++
Sbjct  271   ATLLY--EDSAATS--------RIDHTNQFQFLDKAAIVADGDFEKSVSSAPNPWKLCSV  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  321   TRVEEVKMMMRLLPIWATTIIFWTTYAQMITFSVVQASTMERSLG-NFKIPAGSLPVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+  YDR+++P++++    P G + LQRIA+GL LS  GM AAALVEIKRL VA+
Sbjct  380   AAILITLAFYDRLIMPLWKKWKGQP-GFTNLQRIAIGLILSTFGMAAAALVEIKRLSVAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G +    AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  439   AVGRS---TATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  495

Query  563   VALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV +V  VTG  + + WLAD++N  +L  FY LL ++SA+N +AFL C+ 
Sbjct  496   LSLGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLTILSAINFVAFLVCAI  555

Query  389   GY-VYKEKRLAEMGIELEEETHIPGG  315
              Y   K K+L EM      ET   GG
Sbjct  556   WYKPQKPKQLLEM------ETSTNGG  575



>ref|XP_004159415.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   516 bits (1329),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 288/566 (51%), Positives = 400/566 (71%), Gaps = 32/566 (6%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+I+G+E CERL+T+GI +NLVTYL  T+HL +A +AN+VT+F+G  F+L++LGGF+AD
Sbjct  73    AALIVGIELCERLSTMGIAVNLVTYLVGTLHLPSANSANIVTDFMGTCFLLSMLGGFLAD  132

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlylal  1623
             +FLGRY TI IF ++Q  G   L + T +P L PP C P  S +C  A+G Q+G++YL L
Sbjct  133   SFLGRYKTIAIFASIQTLGTGTLAVITKLPQLHPPPCHPIASKNCKQANGFQMGMIYLPL  192

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+ ALGTGG+KSSVSG GTDQFD+ D +E+ QM  FF+ F  F++ G+LLAVTVLVY+QD
Sbjct  193   YIIALGTGGIKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFLFVSSGTLLAVTVLVYLQD  252

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C+ ++  A+++FL GT+RYR+K  +GSP+  I  V VAA  KR++EL  +
Sbjct  253   EVGRSWAYGICSVSMFTAILIFLCGTKRYRYKISMGSPIVHIFQVLVAAINKRKMELQLN  312

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTL  1104
               LLY  +D  A +        ++ H+ +F+FLD+AAI       K   S  N W + ++
Sbjct  313   ATLLY--EDSAATS--------RIDHTNQFQFLDKAAIVADGDFEKSVSSAPNPWKLCSV  362

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  363   TRVEEVKMMMRLLPIWATTIIFWTTYAQMITFSVVQASTMERSLG-NFKIPAGSLPVFFV  421

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+  YDR+++P++++    P G + LQRIA+GL LS  GM AAALVEIKRL VA+
Sbjct  422   AAILITLAFYDRLIMPLWKKWKGQP-GFTNLQRIAIGLILSTFGMAAAALVEIKRLSVAK  480

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G +    AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  481   AVGRS---TATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  537

Query  563   VALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV +V  VTG  + + WLAD++N  +L  FY LL ++SA+N +AFL C+ 
Sbjct  538   LSLGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLTILSAINFVAFLVCAI  597

Query  389   GYV-YKEKRLAEMGIELEEETHIPGG  315
              Y   K K+L EM      ET   GG
Sbjct  598   WYKPQKPKQLLEM------ETSTNGG  617



>gb|KGN60671.1| hypothetical protein Csa_2G006170 [Cucumis sativus]
Length=581

 Score =   512 bits (1319),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 285/566 (50%), Positives = 399/566 (70%), Gaps = 32/566 (6%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+++G+E CERL+T+GI +NLVTYL  T+HL +A +AN+VT+F+G  F+L++LGGF+AD
Sbjct  31    AALVVGIELCERLSTMGIAVNLVTYLVGTLHLPSANSANIVTDFMGTCFLLSMLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlylal  1623
             +FLGRY TI IF ++Q  G   L + T +P L PP C P  S +C  A+G Q+G++YL L
Sbjct  91    SFLGRYKTIAIFASIQTLGTGTLAVITKLPQLHPPPCHPIASKNCKQANGFQMGMIYLPL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+ ALGTGG+KSSVSG GTDQFD+ D +E+ QM  FF+ F  F++ G+LLAVTVLVY+QD
Sbjct  151   YIIALGTGGIKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFLFVSSGTLLAVTVLVYLQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C+ ++  A+++FL GT+RYR+K  +GSP+  I  V VAA  KR++EL  +
Sbjct  211   EVGRSWAYGICSVSMFTAILIFLCGTKRYRYKISMGSPIVHIFQVLVAAINKRKMELQLN  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTL  1104
               LLY  +D  A +        ++ H+ +F+FLD+AAI       K   S  N W + ++
Sbjct  271   ATLLY--EDSAATS--------RIDHTNQFQFLDKAAIVADGDFEKSVSSAPNPWKLCSV  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  321   TRVEEVKMMMRLLPIWATTIIFWTTYAQMITFSVVQASTMERSLG-NFKIPAGSLPVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+  YDR+++P++++    P G + LQRIA+GL LS  GM AAALVE+KRL VA+
Sbjct  380   AAILITLAFYDRLIMPLWKKWKGQP-GFTNLQRIAIGLILSTFGMAAAALVEMKRLSVAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G +    AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  439   AVGRS---TATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  495

Query  563   VALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV +V  VTG  + + WLAD++N  +L  FY LL ++S +N +AFL C+ 
Sbjct  496   LSLGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLTILSTINFVAFLVCAI  555

Query  389   GY-VYKEKRLAEMGIELEEETHIPGG  315
              Y   K K+L EM      ET   GG
Sbjct  556   WYKPQKPKQLLEM------ETSTNGG  575



>ref|XP_002979108.1| hypothetical protein SELMODRAFT_444106 [Selaginella moellendorffii]
 gb|EFJ20065.1| hypothetical protein SELMODRAFT_444106 [Selaginella moellendorffii]
Length=584

 Score =   512 bits (1318),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 280/549 (51%), Positives = 384/549 (70%), Gaps = 17/549 (3%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             A ++ G E CER+TTLG+  NLVTYLT+ +HL N  A N+VTNFLG SFML LLGGF+AD
Sbjct  28    AVLVFGPELCERMTTLGVATNLVTYLTNDLHLSNTKAPNIVTNFLGTSFMLCLLGGFIAD  87

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             T++GR+ T+ I  T+Q  G+ +LTI T +PSL+ P C  +   C PA   QL +LYLALY
Sbjct  88    TYIGRFWTVAIAATIQFLGMLVLTILTSLPSLRSPHCVHD---CPPAKAKQLSLLYLALY  144

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L+ALGTGG+KS+VS  G DQFD ++ +E+  M  FF+WF   I+VG+L ++TVLVYIQDN
Sbjct  145   LSALGTGGIKSNVSAFGADQFDKNEPKEQKLMSYFFNWFFVSISVGALFSLTVLVYIQDN  204

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR WGYG+CA A++ A+V+FL+GTR YR+K   GSPLT+IA V VAA RK +LELP D 
Sbjct  205   VGRGWGYGICAAAMLLAIVIFLAGTRMYRYKAPSGSPLTRIAKVVVAAVRKHKLELPRDQ  264

Query  1259  ELLYNV----DDVVAAAGDQEHKKI-KMPHSKEFRFLDRAAIKEGVSE------VNKWSI  1113
               LY       D    A DQ  +   +  H  ++RFLD+AA+ E   +         W +
Sbjct  265   SSLYGSLGPGKDAEDPATDQSARHTNQFRHPYQYRFLDKAAVLEPSDDEIYDENPKPWRL  324

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
              T+T +EEVK ++R+LP WATTI F+TV+AQ++TFSV Q + MDR M  SF  P+AS A 
Sbjct  325   CTVTQIEEVKMVLRLLPIWATTITFYTVYAQMLTFSVVQGSKMDRKMG-SFLFPSASSAA  383

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F    I+VT+ +YDR +VP+ R++  +PQG++ LQRI VGL ++++ M+ AA VE +R++
Sbjct  384   FLFATIMVTVTVYDRFIVPLMRKLTGHPQGITTLQRIGVGLVVAILAMVVAATVERRRVR  443

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             +AR + L   P   VPMSV W+  QY++VG GEA TY+GQL+FF RE P GM+++  GLF
Sbjct  444   IARENKLLDSPDVPVPMSVLWILPQYVLVGIGEAFTYIGQLEFFYRESPDGMQSLGVGLF  503

Query  572   LSTVALGLFFSSVLVTIVGKVT--GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LST++LG F SS LV++V  VT  G    W+ ++LN+ +L DFYWLLAV+S++NL+ +L 
Sbjct  504   LSTISLGFFLSSFLVSVVDSVTRGGGSGGWIVNNLNRSRLDDFYWLLAVVSSVNLVLYLI  563

Query  398   CSRGYVYKE  372
             C+R Y Y+ 
Sbjct  564   CARWYKYRR  572



>ref|XP_004139418.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   513 bits (1320),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 285/566 (50%), Positives = 399/566 (70%), Gaps = 32/566 (6%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+++G+E CERL+T+GI +NLVTYL  T+HL +A +AN+VT+F+G  F+L++LGGF+AD
Sbjct  73    AALVVGIELCERLSTMGIAVNLVTYLVGTLHLPSANSANIVTDFMGTCFLLSMLGGFLAD  132

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlylal  1623
             +FLGRY TI IF ++Q  G   L + T +P L PP C P  S +C  A+G Q+G++YL L
Sbjct  133   SFLGRYKTIAIFASIQTLGTGTLAVITKLPQLHPPPCHPIASKNCKQANGFQMGMIYLPL  192

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y+ ALGTGG+KSSVSG GTDQFD+ D +E+ QM  FF+ F  F++ G+LLAVTVLVY+QD
Sbjct  193   YIIALGTGGIKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFLFVSSGTLLAVTVLVYLQD  252

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C+ ++  A+++FL GT+RYR+K  +GSP+  I  V VAA  KR++EL  +
Sbjct  253   EVGRSWAYGICSVSMFTAILIFLCGTKRYRYKISMGSPIVHIFQVLVAAINKRKMELQLN  312

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTL  1104
               LLY  +D  A +        ++ H+ +F+FLD+AAI       K   S  N W + ++
Sbjct  313   ATLLY--EDSAATS--------RIDHTNQFQFLDKAAIVADGDFEKSVSSAPNPWKLCSV  362

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  363   TRVEEVKMMMRLLPIWATTIIFWTTYAQMITFSVVQASTMERSLG-NFKIPAGSLPVFFV  421

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+  YDR+++P++++    P G + LQRIA+GL LS  GM AAALVE+KRL VA+
Sbjct  422   AAILITLAFYDRLIMPLWKKWKGQP-GFTNLQRIAIGLILSTFGMAAAALVEMKRLSVAK  480

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G +    AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  481   AVGRS---TATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  537

Query  563   VALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV +V  VTG  + + WLAD++N  +L  FY LL ++S +N +AFL C+ 
Sbjct  538   LSLGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLTILSTINFVAFLVCAI  597

Query  389   GYV-YKEKRLAEMGIELEEETHIPGG  315
              Y   K K+L EM      ET   GG
Sbjct  598   WYKPQKPKQLLEM------ETSTNGG  617



>gb|KDP32393.1| hypothetical protein JCGZ_13318 [Jatropha curcas]
Length=586

 Score =   508 bits (1308),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 289/548 (53%), Positives = 389/548 (71%), Gaps = 27/548 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ LG+E CERL T+GIG+NLVTYL  TMHL +A +AN+VT+F+G SFML LLGGF+AD
Sbjct  31    AALALGIEICERLATMGIGVNLVTYLIGTMHLSSATSANIVTDFMGTSFMLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF  VQA G  +L   T +P L+PP C   + SC  A+G Q+GVLY+ALY
Sbjct  91    SFLGRYKTIAIFAVVQAIGTGMLATVTKLPQLRPPPCGTNN-SCEQATGFQMGVLYIALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF  F FFI++G+LLAVTVLVYIQD 
Sbjct  150   LIALGTGGLKSSVSGFGTDQFDEKDEKEKSQMTYFFHRFFFFISIGTLLAVTVLVYIQDE  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C+ ++  A+++F SGT+RYR+KK +GSP+  I  V VAA +KR ++LP + 
Sbjct  210   VGRSWAYGICSASMFLAILIFFSGTKRYRYKKSLGSPIVHIFQVIVAAIKKRNMDLPYNF  269

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSISTLTD  1098
              LLY          +   +  ++ H+ +FRFLD+AAI      +   S  N W + ++T 
Sbjct  270   GLLY----------ENNPEATRIQHTDQFRFLDKAAIVAEGDFENSGSAPNPWKLCSVTG  319

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEE K ++R+LP WATTI+FWT +AQ+MTFSV QA TM+R +  +F++PA S+ VF+V  
Sbjct  320   VEETKMMVRLLPIWATTIIFWTTYAQMMTFSVEQATTMERSIG-NFQIPAGSLTVFFVAA  378

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YD +++P++++    P G S LQRI +GL LS +GM AAAL E KRL VA+S 
Sbjct  379   ILITLAVYDVLIMPLWKKFKGKP-GFSSLQRIGIGLVLSTLGMAAAALAERKRLSVAKS-  436

Query  737   GLTAD-PAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
                AD   +T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T+
Sbjct  437   ---ADGKTSTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  493

Query  560   ALGLFFSSVLVTIVGKVTGEK---KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             +LG FFSS LV +V KVTG     + WL D++N G+L  FY LLA +  +N + +L C+ 
Sbjct  494   SLGFFFSSFLVIVVKKVTGSNGTGQGWLGDNINNGRLDCFYGLLATLCVINFLVYLVCAL  553

Query  389   GYVYKEKR  366
              Y  ++K 
Sbjct  554   WYKPRKKN  561



>ref|XP_008784904.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Phoenix dactylifera]
Length=589

 Score =   507 bits (1305),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 292/562 (52%), Positives = 397/562 (71%), Gaps = 28/562 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+IL +E  ERL+T+GI +NLVTYL  TMHL +A +ANVV++F+G S++L LLGGF+AD
Sbjct  31    AALILVIEISERLSTMGIAVNLVTYLGGTMHLPSAESANVVSDFMGTSYLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             +FLGRYLTI IF  VQA G   L+++T +P L+PP C S  + +C  A   Q+G+LYL+L
Sbjct  91    SFLGRYLTIAIFAMVQALGTGTLSVATRLPQLRPPPCNSSTTTTCQHADRFQMGILYLSL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             ++ ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF  F FFI+ G+LLAVTVLVYIQD
Sbjct  151   FVIALGTGGLKSSVSGFGTDQFDEKDEKEKTQMANFFHRFFFFISTGTLLAVTVLVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              + R W YG+C  +++ A+ +FL+GTRRYR+K+  GSP+  I  V VAA RKR LE PSD
Sbjct  211   EVSRSWAYGICCISMLVAIAVFLTGTRRYRYKRSAGSPIVHILQVVVAAVRKRGLEYPSD  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI---------KEGVSEVNKWSIS  1110
               LLY  +D   A+        ++ H+ +FRFLD+AAI           G S  N W + 
Sbjct  271   IALLY--EDCPEAS--------RIQHTDQFRFLDKAAIMADGDNYVVNGGTSTPNPWKLR  320

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T +EEVK +IR+LP W TTIMFWTV+AQ++TFSV QA TM+R +  SF++PA S+ VF
Sbjct  321   SVTRIEEVKMMIRLLPVWTTTIMFWTVYAQIITFSVEQATTMERSIG-SFQIPAGSLTVF  379

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VGGIL+T+ +YDR+++P+ +      QG + +Q+I +GL LS++GM+AAAL E+KRL V
Sbjct  380   FVGGILITLAVYDRMIMPLLKN-WKGKQGFTNIQKIGIGLTLSMIGMVAAALAEVKRLSV  438

Query  749   ARSHG-LTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             AR  G   A    T+P+SVF L  Q+ +VG+ E   Y GQLDFF+   PKGMKTMSTGLF
Sbjct  439   AREVGPAAARRGTTLPVSVFTLIPQFFLVGAAEGFVYTGQLDFFITRSPKGMKTMSTGLF  498

Query  572   LSTVALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             L+T++LG F SS LV+IV  +T   E   WLAD++N G+L  FY LLAV+SA+NL AFL 
Sbjct  499   LTTLSLGFFVSSFLVSIVKSLTAGREGNGWLADNINYGRLDCFYGLLAVLSAVNLGAFLL  558

Query  398   CSRGYVYKEKRLAEMGIELEEE  333
             C+      + +  + G+++E +
Sbjct  559   CA---ARTKPQTPKAGVQMESK  577



>ref|NP_001065341.2| Os10g0554200 [Oryza sativa Japonica Group]
 dbj|BAF27178.2| Os10g0554200, partial [Oryza sativa Japonica Group]
Length=465

 Score =   501 bits (1289),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 259/431 (60%), Positives = 322/431 (75%), Gaps = 17/431 (4%)
 Frame = -3

Query  1577  GLGTDQFDDSD-KRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGLCACA  1401
             G  +DQFD+SD   ER +M++FF+WF FF+++G+LLAVTVLVY+QDN+GRRWGYG+CA  
Sbjct  43    GGASDQFDESDVDGERKKMMRFFNWFYFFVSLGALLAVTVLVYVQDNVGRRWGYGICAAG  102

Query  1400  IVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDVVAAA  1221
             I+  L +FLSGTRRYRFKKLVGSPLTQ+AAV  AAW KR L LPSDP++LY+VDD  AA 
Sbjct  103   ILAGLAVFLSGTRRYRFKKLVGSPLTQVAAVTAAAWSKRSLPLPSDPDMLYDVDDAAAAG  162

Query  1220  GDQEHKKIKMPHSKEFRFLDRAAI-----KEGVSEVNKWSISTLTDVEEVKQLIRMLPTW  1056
              D + K+ +MPHSKE RFLD AAI      E  +  +KW + T TDVEEVKQ++RMLP W
Sbjct  163   HDVKGKQ-RMPHSKECRFLDHAAIIDRSAAESPATASKWRLCTRTDVEEVKQVVRMLPIW  221

Query  1055  ATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMMYDRIMVP  876
             ATTIMFWT+HAQ+ TF+V+QA  MDR ++  F +PA S+ VF +  IL+T+  YDR++VP
Sbjct  222   ATTIMFWTIHAQMTTFAVAQAELMDRRLAGGFLIPAGSLTVFLIASILLTVPFYDRLVVP  281

Query  875   IFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAATVPMSV  696
             + RR   NP GL+PLQR+ VGL+LS+ GM  AA VE       R     +  AA    +V
Sbjct  282   VARRATANPHGLTPLQRVFVGLSLSIAGMAVAAAVE-------RHRATASASAAAAAPTV  334

Query  695   FWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSVLVTIVG  516
             F L  Q+L+VG+GEA TY+GQLDFFLRECPKGMKTMSTGLFLST A+G FFS++LVTIV 
Sbjct  335   FLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLSTCAIGFFFSTLLVTIVH  394

Query  515   KVTGEKKP---WLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLAEMGIE  345
             KVTG       WLAD+L+ G+L  FYWLLAV+SA+NL+ F   +RGYVYKEKRLA+ GIE
Sbjct  395   KVTGHGARGGGWLADNLDDGRLDYFYWLLAVISAINLVLFTVAARGYVYKEKRLADAGIE  454

Query  344   LEEETHIPGGH  312
             L +E  I  GH
Sbjct  455   LADEETIAVGH  465



>emb|CDP10398.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   504 bits (1297),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 292/554 (53%), Positives = 400/554 (72%), Gaps = 27/554 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +AN VT+F+G SF+L LLGGF+AD
Sbjct  29    AALILGIEICERLSTMGIAVNLVTYLGGTMHLPSAVSANTVTDFMGTSFLLCLLGGFLAD  88

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF+T+QA G  +L I+T +P L+PP C+  + +C  A+G Q+G+LYLALY
Sbjct  89    SFLGRYKTIAIFSTIQAMGTGMLAITTKVPQLRPPPCAAHA-NCQTANGLQMGMLYLALY  147

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG G+DQFD+ D++E+ QM  FF+ F  FI++G+L AVTVLVY++DN
Sbjct  148   LIALGTGGLKSSVSGFGSDQFDERDEKEKSQMAYFFNRFFLFISIGTLTAVTVLVYLEDN  207

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             + R   YG+C+ ++  A+ +F SGTRRYR+KK V SP+ QI+ V  AA RKRR+ +P D 
Sbjct  208   VSRSLAYGICSLSMFIAIFIFFSGTRRYRYKKTVRSPIVQISQVIAAAIRKRRMNVPYDI  267

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI--------KEGVSEVNKWSISTL  1104
              +LY  +          H+  ++ H+ +FRFLD+AAI        K+  +  N W++ T+
Sbjct  268   NMLYETN----------HEASRIQHTDQFRFLDKAAIVAEDDFSEKKVAASPNPWNLCTV  317

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  318   TRVEEVKMMARLLPIWATTIIFWTTYAQMITFSVDQASTMERSIG-NFQIPAGSVTVFFV  376

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P +++    P G + LQRIA+GL LS +GM AAALVE+KRL VA+
Sbjct  377   AAILITLAVYDRLIMPFWKKWKGKP-GFTSLQRIAIGLVLSTIGMAAAALVEMKRLSVAK  435

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S G T    AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  436   SAGRT---TATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  492

Query  563   VALGLFFSSVLVTIVGKVTGEKK--PWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG FFSS+LV+IV   T   +   WLAD +N G+L  FY LLAV+  +N + +  C+ 
Sbjct  493   LSLGFFFSSMLVSIVKGATRSHRGEGWLADKINYGRLDLFYALLAVLGVINFVVYSICAV  552

Query  389   GYVYKEKRLA-EMG  351
              Y  K+   A EMG
Sbjct  553   WYKPKKPNPAVEMG  566



>gb|EMT23542.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=630

 Score =   504 bits (1297),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 284/539 (53%), Positives = 373/539 (69%), Gaps = 31/539 (6%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA ++G+E CERL T+GI +NLVTYLTDTMHL  A +ANVVT+F+G SF+L  LGGF+AD
Sbjct  89    AASVVGIELCERLATMGIAVNLVTYLTDTMHLPGAASANVVTDFMGTSFLLCFLGGFLAD  148

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
              FLGRYLTI IF  VQA G  +L +ST +  L+PP C   +  C  A+G Q+GVLY+ LY
Sbjct  149   AFLGRYLTIAIFALVQALGTGLLAVSTTVRHLRPPPCG-GAAPCEEATGLQMGVLYVCLY  207

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D RER  M  FF  F F I++G+LLAVTVLVYIQD+
Sbjct  208   LIALGTGGLKSSVSGFGTDQFDEHDDRERAAMGCFFDRFFFIISLGTLLAVTVLVYIQDH  267

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YGLC+ A++ A+ +FLSGT+RYR+K+  GSP+  I  V VAA RKR L+ P   
Sbjct  268   VGRSWAYGLCSGAMLVAIAVFLSGTKRYRYKRSSGSPVVHILQVLVAAARKRGLKQPLTA  327

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI----------KEGVSEVNKWSIS  1110
               LY            EH +I   H+ +FR LD AA+           +G    N W + 
Sbjct  328   ATLYE--------DRPEHARIH--HTDQFRCLDSAAVMAGEEDNEVGPDGRPAPNPWKLC  377

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             +++ VEEVK ++R++P WATTI+FWT++AQ++TFSV QA TMDR +   FE+PAAS+ VF
Sbjct  378   SVSRVEEVKMVVRLMPVWATTILFWTIYAQMITFSVEQATTMDRRIG-GFEIPAASLTVF  436

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG I++T+ +YDR+ +P+ R +   P G + L++I +GL LS++GM+AAA+ E KRL V
Sbjct  437   FVGAIMLTLAVYDRVFIPLCRNLTGRP-GFTNLEKIGIGLVLSIIGMVAAAICEKKRLTV  495

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A     TA     +P+SVF L  Q+L+VG+GEA  Y GQLDFF+   PK MKTMSTGLFL
Sbjct  496   AS----TATNGTALPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRSPKSMKTMSTGLFL  551

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             +T++LG F SS LV++V   T     WL D +N  +L  FYWLLAV+ A+NL A+L C+
Sbjct  552   TTLSLGFFLSSALVSLVRGAT----TWLGDTINHSRLDYFYWLLAVLGAINLAAYLLCA  606



>ref|XP_006347704.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=575

 Score =   501 bits (1289),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 286/555 (52%), Positives = 406/555 (73%), Gaps = 26/555 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA++LG+E  ERL+T+GI +NLVTYL  TMHL +A +AN+VT+F+G +F+L+LLGGF+AD
Sbjct  27    AALVLGIEINERLSTMGIAVNLVTYLGGTMHLPSAASANIVTDFMGTAFLLSLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF  +QA G  +LT++T +P L+PP C P    C PA+G Q+G+LYLALY
Sbjct  87    SFLGRYKTIAIFALIQALGTGMLTVTTGMPQLRPPTCHPHDKYCEPANGFQMGILYLALY  146

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF+ F  FI++G+L AVTVLVY+QD 
Sbjct  147   LIALGTGGLKSSVSGFGTDQFDEKDEKEKSQMAYFFNRFFIFISIGTLTAVTVLVYVQDE  206

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C  ++V A+++F +GT+RYR+K+  GSP+ QI  V +AA RKR++++P D 
Sbjct  207   VGRSWAYGICCISMVIAIIIFFAGTKRYRYKRSSGSPIVQIFQVILAATRKRKMDVPYDV  266

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSE-----VNKWSISTLTD  1098
              +LY +        + +  +I+  H+ +FR LD+AAI  +G  E      N W + T+T 
Sbjct  267   GMLYEM--------NPDGSRIQ--HTDQFRCLDKAAIVAQGDFEDHDLNPNPWKLCTVTR  316

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK + R++P WATTI+FWT +AQ++TFSV QAATM+R++ K F++PA S+ VF+V  
Sbjct  317   VEEVKMMARLIPIWATTILFWTNYAQMITFSVEQAATMERNVGK-FKIPAGSLTVFFVSA  375

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+++YDR ++P+++++   P G + LQ+IA+GL LS +GM  AALVE+KRL VA+S 
Sbjct  376   ILITLIIYDRFIMPLWQKLKGKP-GFTSLQKIAIGLVLSTMGMGIAALVEMKRLSVAKST  434

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             G      +T+P+SVF+L  Q+ +VG+GE   Y GQLDFF+ + PKGMKTMSTGLFL+T+A
Sbjct  435   GRN---ISTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTLA  491

Query  557   LGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             LG F SS LV+I+ KVTG      WLAD++N G+L  FY LLA++  +N + +LFC+  +
Sbjct  492   LGFFVSSFLVSIIKKVTGSNGGHDWLADNINYGRLDCFYGLLAILGVINFVLYLFCATWF  551

Query  383   VYKEKRLAEMGIELE  339
                + R A+  I +E
Sbjct  552   ---KPRKAKSAINME  563



>gb|KDO61703.1| hypothetical protein CISIN_1g008020mg [Citrus sinensis]
Length=581

 Score =   499 bits (1286),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 290/555 (52%), Positives = 398/555 (72%), Gaps = 26/555 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ LG+E CERL+T+GI +NLVTYL  TMHL +A +AN+VT+F+G SF+L LLGGF+AD
Sbjct  31    AALSLGIEICERLSTMGIAVNLVTYLGGTMHLPSATSANIVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             +FLGRY TI IF TVQ  G  +L IST  P L+PP C + +   C  ASG Q+GVLY++L
Sbjct  91    SFLGRYRTIAIFATVQTFGTGLLAISTKQPQLRPPPCQATDITKCQHASGIQMGVLYISL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FFS F F I+ G+L+AVTVLVYIQD
Sbjct  151   YLIALGTGGLKSSVSGFGTDQFDEKDEKEKTQMAYFFSRFFFVISTGTLMAVTVLVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR WGYG+C+  +  A+++FLSGTRRYR+KK  GSP+  I  V VAA +KR++ELPS 
Sbjct  211   EVGRSWGYGICSICMFTAILIFLSGTRRYRYKKCSGSPIVHICQVVVAARKKRKVELPSS  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTL  1104
                LY          +   ++ ++ H+ +FR LD+A++       ++G    N W++  +
Sbjct  271   TASLY----------EDYPEESRIQHTYQFRCLDKASVVTNTDYSEDGAFVSNPWTLCPV  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK +IR+LP WATTI+FW+ +AQ++TFSV QA TM R +  +F++PAAS+ VF+V
Sbjct  321   TRVEEVKMVIRLLPIWATTILFWSTYAQMITFSVEQATTMQRSIG-NFKIPAASLTVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+  YDR+++P+ ++    P G S LQ IA+GL LS +GM +A++VE+KRL VA+
Sbjct  380   AAILITLGAYDRLIIPLLKKRKGKP-GFSNLQLIAIGLFLSALGMASASVVEVKRLAVAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             ++G T     T+P+SVF+L  Q+ +VGSGE   Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  439   ANGTT---GTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQSPKGMKTMSTGLFLTT  495

Query  563   VALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG FFSS+LV+IV   TG   K  W+ +++N+G+L  FY LLA +S +N   FL C+ 
Sbjct  496   LSLGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCAS  555

Query  389   GYVYKE-KRLAEMGI  348
              Y  K+ K++ EM I
Sbjct  556   WYKRKKAKQVPEMEI  570



>ref|XP_004230062.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=574

 Score =   498 bits (1283),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 279/549 (51%), Positives = 397/549 (72%), Gaps = 22/549 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA++LG+E  ERL+T+GI +NLVTYL  TMHL +A +AN+VT+F+G +F+L+LLGGF+AD
Sbjct  28    AALVLGIEINERLSTMGIAVNLVTYLGGTMHLPSAASANIVTDFMGTAFLLSLLGGFLAD  87

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF  +QA G  +LT++T +P L+PP C P    C PA+G Q+G+LYLALY
Sbjct  88    SFLGRYKTIAIFALIQALGTGMLTVTTGLPQLRPPTCHPHDKYCEPANGFQMGILYLALY  147

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF+ F  FI++G+L AVTVLVY+QD 
Sbjct  148   LIALGTGGLKSSVSGFGTDQFDEKDEKEKSQMAYFFNRFFIFISIGTLAAVTVLVYVQDE  207

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C  ++V A+++F SGT+RYR+K+  GSP+ QI  V +AA RKR++++P D 
Sbjct  208   VGRSWAYGICCISMVIAIIIFFSGTKRYRYKRSSGSPIVQIFQVILAATRKRKMDVPYDV  267

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSISTLTD  1098
              +LY  +              ++ H+ +FR LD+AAI       +     N W + T+T 
Sbjct  268   GMLYETN---------PEGSSRIQHTDQFRCLDKAAIVAQGDFDDHDLNPNPWKLCTVTR  318

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK + R++P WATTI+FWT +AQ++TFSV QAATM+R++ K F++PA S+ VF+V  
Sbjct  319   VEEVKMMARLIPIWATTILFWTTYAQMITFSVEQAATMERNVGK-FKIPAGSLTVFFVSA  377

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+++YDR ++P+++++   P G + LQ+IA+GL LS +GM  AALVE+KRL VA+S 
Sbjct  378   ILITLIIYDRFIMPLWQKLKGKP-GFTSLQKIAIGLVLSTMGMGIAALVEMKRLSVAKST  436

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             G      +T+P+SVF+L  Q+ +VG+GE   Y GQLDFF+ + PKGMKTMSTGLFL+T+A
Sbjct  437   GRN---LSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTLA  493

Query  557   LGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             LG F SS LV+I+ KVTG      WLAD++N G+L  FY LLA++  +N + ++ C+  +
Sbjct  494   LGFFVSSFLVSIIKKVTGSNGGHDWLADNINYGRLDCFYGLLAILGVINFVLYIICATWF  553

Query  383   VYKEKRLAE  357
               ++ +  E
Sbjct  554   KPRKDKYME  562



>ref|XP_010093242.1| Nitrate transporter 1.4 [Morus notabilis]
 gb|EXB53744.1| Nitrate transporter 1.4 [Morus notabilis]
Length=581

 Score =   498 bits (1282),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 287/552 (52%), Positives = 397/552 (72%), Gaps = 27/552 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+IL +E  ERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  27    AALILVIELSERLSTMGIAVNLVTYLVGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-SCVPASggqlgvlylal  1623
             +FLGRY TI IF  +Q  G   L IST +P LQPP C   SG +C PA+G Q+G+LYLAL
Sbjct  87    SFLGRYKTIAIFAAIQTLGTGALAISTKLPQLQPPACDTASGKNCKPANGFQMGILYLAL  146

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG G+DQFD+ D++E+ QM  FF  F  FI+VG+L+AVTVLVYIQD
Sbjct  147   YLIALGTGGLKSSVSGFGSDQFDEKDEKEKAQMAYFFQRFFLFISVGTLMAVTVLVYIQD  206

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C+ +++ ++++FL GT+RYR+KK +GSP+ QI  V  AA++KR +  P +
Sbjct  207   EVGRSWAYGICSVSMLISIIVFLCGTKRYRYKKCMGSPIVQIFQVIAAAFKKRNMSGPFN  266

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAA---------IKEGVSEVNKWSIS  1110
               LLY  +D   A+        ++ H+++FRFLD+AA         I    S  N W + 
Sbjct  267   VSLLY--EDTPEAS--------RIAHTEQFRFLDKAAIVTEDDFEKINGKTSAPNPWKLC  316

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             + T VEEVK +IR+LP WATTI+FWT +AQ++TFSV QA+TM+R +   F++PA S+ VF
Sbjct  317   SATKVEEVKMMIRLLPVWATTILFWTTYAQMITFSVEQASTMERSIG-GFQIPAGSLTVF  375

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  I++TI+ YDR+++P++++     QG + LQR+A+GL LS+ GM AAAL E+KRL V
Sbjct  376   FVVAIMITIVFYDRVIMPLWKK-WKGEQGFTNLQRMAIGLVLSIFGMAAAALSEMKRLLV  434

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S   T     T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  435   AKSAAPTTQ---TLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV++V KVTG +  + WLAD++N+G+L  FY LL V+  +N  A++ C
Sbjct  492   TTLSLGFFVSSFLVSVVKKVTGSRDGQGWLADNINEGRLDCFYGLLTVLGVINFAAYIVC  551

Query  395   SRGYVYKEKRLA  360
             ++ Y  K+ + A
Sbjct  552   AKWYKPKKAKPA  563



>ref|XP_008792049.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Phoenix 
dactylifera]
Length=585

 Score =   498 bits (1282),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 301/563 (53%), Positives = 404/563 (72%), Gaps = 30/563 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +ANVV++F+G SF+L LLGGF+AD
Sbjct  27    AALILGIEICERLSTMGIAVNLVTYLGGTMHLPSAESANVVSDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC---SPESGSCVPASggqlgvlyl  1629
             +FLGRYLTI IF  VQA G  +L+++T +P L+PP C   S  S  C  A+G QLG+LYL
Sbjct  87    SFLGRYLTIAIFAVVQALGTCMLSVTTRLPQLRPPPCNSLSSRSTKCEQANGFQLGILYL  146

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             +LYL ALGTGGLKSSVSG GTDQFD+ ++ E+ QMV FFS F FFI+ G+LLAVTVLVYI
Sbjct  147   SLYLIALGTGGLKSSVSGFGTDQFDEKNEEEKTQMVYFFSRFFFFISTGTLLAVTVLVYI  206

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QD +GR W YG+C  +++ A+++FLSGTRRYR+K+  GSP+  I  V  AA RK++L+ P
Sbjct  207   QDEVGRSWAYGICCISMLIAILVFLSGTRRYRYKQSAGSPIVHILQVVAAAARKKKLQYP  266

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEV-------NKWSI  1113
             S+   LY          +   +  ++ H+ +FR LD+AAI  EG  EV       N W +
Sbjct  267   SNIAFLY----------ENSPEASRIQHTDQFRCLDKAAIVAEGDDEVNGETSSPNPWKL  316

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
              ++T +EEVK +IR+LP WATTIMFWT++AQ++TFSV QA TM+R +   F++PA S+ V
Sbjct  317   CSVTRIEEVKMMIRLLPVWATTIMFWTIYAQMITFSVEQATTMERSIG-GFQIPAGSLTV  375

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+ G IL+T+ +YDR+++P+ ++     QG S LQRI +GLALSV+GM AAA+ E+KRL 
Sbjct  376   FFAGAILITLAVYDRMIMPLLKK-WKGKQGFSNLQRIGIGLALSVIGMAAAAVAEVKRLS  434

Query  752   VARSHGLTA--DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             VAR  G  A      T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+   PKGMKTMSTG
Sbjct  435   VARGAGPAAAHHRGTTLPISVFILIPQFFLVGAGEAFVYTGQLDFFITRSPKGMKTMSTG  494

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             LFL+T++LG F SS LV++V  +TG K    WLAD++N G+L  FY LLAV+SA+NL AF
Sbjct  495   LFLTTLSLGFFLSSFLVSVVKSLTGGKHGNGWLADNINYGRLDCFYGLLAVLSAINLGAF  554

Query  404   LFCSRGYVYKEKRLAEMGIELEE  336
             L C+    + + + A+ G++ E 
Sbjct  555   LVCA---AWSKPQAAKPGLQTES  574



>ref|XP_008792048.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Phoenix 
dactylifera]
Length=589

 Score =   498 bits (1282),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 301/563 (53%), Positives = 404/563 (72%), Gaps = 30/563 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +ANVV++F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEICERLSTMGIAVNLVTYLGGTMHLPSAESANVVSDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC---SPESGSCVPASggqlgvlyl  1629
             +FLGRYLTI IF  VQA G  +L+++T +P L+PP C   S  S  C  A+G QLG+LYL
Sbjct  91    SFLGRYLTIAIFAVVQALGTCMLSVTTRLPQLRPPPCNSLSSRSTKCEQANGFQLGILYL  150

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             +LYL ALGTGGLKSSVSG GTDQFD+ ++ E+ QMV FFS F FFI+ G+LLAVTVLVYI
Sbjct  151   SLYLIALGTGGLKSSVSGFGTDQFDEKNEEEKTQMVYFFSRFFFFISTGTLLAVTVLVYI  210

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QD +GR W YG+C  +++ A+++FLSGTRRYR+K+  GSP+  I  V  AA RK++L+ P
Sbjct  211   QDEVGRSWAYGICCISMLIAILVFLSGTRRYRYKQSAGSPIVHILQVVAAAARKKKLQYP  270

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEV-------NKWSI  1113
             S+   LY          +   +  ++ H+ +FR LD+AAI  EG  EV       N W +
Sbjct  271   SNIAFLY----------ENSPEASRIQHTDQFRCLDKAAIVAEGDDEVNGETSSPNPWKL  320

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
              ++T +EEVK +IR+LP WATTIMFWT++AQ++TFSV QA TM+R +   F++PA S+ V
Sbjct  321   CSVTRIEEVKMMIRLLPVWATTIMFWTIYAQMITFSVEQATTMERSIG-GFQIPAGSLTV  379

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+ G IL+T+ +YDR+++P+ ++     QG S LQRI +GLALSV+GM AAA+ E+KRL 
Sbjct  380   FFAGAILITLAVYDRMIMPLLKK-WKGKQGFSNLQRIGIGLALSVIGMAAAAVAEVKRLS  438

Query  752   VARSHGLTA--DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             VAR  G  A      T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+   PKGMKTMSTG
Sbjct  439   VARGAGPAAAHHRGTTLPISVFILIPQFFLVGAGEAFVYTGQLDFFITRSPKGMKTMSTG  498

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             LFL+T++LG F SS LV++V  +TG K    WLAD++N G+L  FY LLAV+SA+NL AF
Sbjct  499   LFLTTLSLGFFLSSFLVSVVKSLTGGKHGNGWLADNINYGRLDCFYGLLAVLSAINLGAF  558

Query  404   LFCSRGYVYKEKRLAEMGIELEE  336
             L C+    + + + A+ G++ E 
Sbjct  559   LVCA---AWSKPQAAKPGLQTES  578



>ref|XP_006483348.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
Length=581

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 289/555 (52%), Positives = 397/555 (72%), Gaps = 26/555 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ LG+E CERL+T+GI +NLVTYL  TMHL +A +AN+VT+F+G SF+L LLGGF+AD
Sbjct  31    AALSLGIEICERLSTMGIAVNLVTYLGGTMHLPSATSANIVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             +FLGRY TI IF TVQ  G  +L IST  P L+PP C + +   C  ASG Q+GVLY++L
Sbjct  91    SFLGRYRTIAIFATVQTFGTGLLAISTKQPQLRPPPCQATDITKCQHASGIQMGVLYISL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FFS F F I+ G+L+AVTVLVYIQD
Sbjct  151   YLIALGTGGLKSSVSGFGTDQFDEKDEKEKTQMAYFFSRFFFVISTGTLMAVTVLVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR WGYG+C+  +  A+++FLSGTRRYR+KK  GSP+  I  V VAA +KR++ELPS 
Sbjct  211   EVGRSWGYGICSICMFTAILIFLSGTRRYRYKKCSGSPIVHICQVVVAARKKRKVELPSS  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTL  1104
                LY          +   ++ ++  + +FR LD+A++       ++G    N W++  +
Sbjct  271   TASLY----------EDYPEESRIQRTYQFRCLDKASVVTNTDYSEDGAFVSNPWTLCPV  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK +IR+LP WATTI+FW+ +AQ++TFSV QA TM R +  +F++PAAS+ VF+V
Sbjct  321   TRVEEVKMVIRLLPIWATTILFWSTYAQMITFSVEQATTMQRSIG-NFKIPAASLTVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+  YDR+++P+ ++    P G S LQ IA+GL LS +GM +A++VE+KRL VA+
Sbjct  380   AAILITLGAYDRLIIPLLKKRKGKP-GFSNLQLIAIGLFLSALGMASASVVEVKRLAVAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             ++G T     T+P+SVF+L  Q+ +VGSGE   Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  439   ANGTT---GTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQSPKGMKTMSTGLFLTT  495

Query  563   VALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG FFSS+LV+IV   TG   K  W+ +++N+G+L  FY LLA +S +N   FL C+ 
Sbjct  496   LSLGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCAS  555

Query  389   GYVYKE-KRLAEMGI  348
              Y  K+ K++ EM I
Sbjct  556   WYKRKKAKQVPEMEI  570



>ref|XP_009407665.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=575

 Score =   495 bits (1275),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 289/540 (54%), Positives = 381/540 (71%), Gaps = 26/540 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+IL +E CERL+T+GI +NLVTYL  TMH+ +A +AN+VT+F+G SF+L L GGF+AD
Sbjct  31    AALILVIEICERLSTMGIAVNLVTYLGGTMHIPSAESANIVTDFMGTSFLLCLFGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             +FLGRYLTI IF  +QA G  +L+IST +P L+PP C S  +G C  A+G Q+G LYL+L
Sbjct  91    SFLGRYLTIAIFAMIQALGTGLLSISTKLPQLRPPPCNSTVTGQCQRANGFQMGALYLSL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL A+GTGGLKSSVSG GTDQFD+ D++ER QM  FF+ F FFI+ G+L A TVLVYIQD
Sbjct  151   YLIAVGTGGLKSSVSGFGTDQFDEKDEKERSQMAYFFNRFFFFISTGTLFACTVLVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++V AL++FLSGTRRYR+KK  GSP+  I  V VAA RKR+L LPS 
Sbjct  211   EVGRSWAYGICCISMVLALLVFLSGTRRYRYKKSSGSPIVHILQVIVAAIRKRKLMLPSS  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI--------KEGVSEVNKWSIST  1107
                LY  DD   A+        ++ H+ +FRFLD+AAI        K    + N W + +
Sbjct  271   VVFLY--DDCPEAS--------RIQHTDQFRFLDKAAIVAEEDHEVKGETKQPNPWKMCS  320

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T +EEVK +IR+LP WATT MFWT++AQ++TFSV QA TM+R +  SF++PA S+  F+
Sbjct  321   VTRIEEVKMMIRLLPIWATTFMFWTIYAQMITFSVEQATTMERSIG-SFQIPAGSLTAFF  379

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             V  IL+T  +YDR+++P+ ++     QG + LQRI +GL+ S++GM AAAL E+KRL VA
Sbjct  380   VAAILITCAVYDRVIMPLMKK-WKGKQGFTSLQRIGIGLSFSIMGMAAAALTEVKRLSVA  438

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             R     A    T+P+SVF L  Q+L VG+GEA  Y GQLDFF+   PKGMKTMSTGLFL+
Sbjct  439   RE---AASGTTTLPISVFTLIPQFLFVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLT  495

Query  566   TVALGLFFSSVLVTI--VGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             T++LG F SS LV+           + WLAD++N G+L  FY LLA +S +NL AFL C+
Sbjct  496   TLSLGFFLSSFLVSFVKGVTGGKGGQGWLADNINYGRLDCFYGLLAGLSTMNLGAFLVCA  555



>ref|XP_009591623.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=583

 Score =   494 bits (1272),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 288/560 (51%), Positives = 402/560 (72%), Gaps = 27/560 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  28    AALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLAD  87

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF  +Q  G  +LT++  +P L+PP C     SC PA G Q+G+LY+ALY
Sbjct  88    SFLGRYKTIAIFALIQTLGTGMLTLAVSLPQLRPPPCHRHDVSCQPAKGSQMGILYMALY  147

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D +E+ QM  FF+ F FFI++G+L AVTVLVYIQD 
Sbjct  148   LIALGTGGLKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFFFISIGTLTAVTVLVYIQDE  207

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C+ +++ A+++FL GT++YR+KK  GSP+  I  V  AA RKR+++LP D 
Sbjct  208   VGRSWAYGVCSVSMLIAILIFLLGTKKYRYKKSSGSPIVHIFQVIFAAIRKRKMDLPYDV  267

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG--------VSEVNKWSIST  1107
              +LY   +  A          ++ H++EFR LD+AAI  EG         S+ N W +ST
Sbjct  268   GMLYETTNSEAT---------RIQHTQEFRVLDKAAIVAEGDFEDQYGSCSDPNPWKLST  318

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+
Sbjct  319   VTRVEEVKMMARLLPIWATTIIFWTTYAQMITFSVEQASTMERSIG-NFQIPAGSLTVFF  377

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             V  IL+T+ +YDRI++P++++    P G S LQRI++GL  S++GM AAAL E KRL VA
Sbjct  378   VAAILITLAVYDRIIMPLWKKWKGKP-GFSSLQRISIGLVFSIIGMAAAALAEKKRLTVA  436

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +S G   + +  +P+SVF+L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+
Sbjct  437   KSMG-RHNSSTNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLT  495

Query  566   TVALGLFFSSVLVTIVGKVT---GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T++LG F SS LV+++ KVT   G  + WLAD++N G+L  FYWLLAV+  +N++ +L C
Sbjct  496   TLSLGFFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYWLLAVLGVINIVIYLIC  555

Query  395   SRGYVYKEKRLAEMGIELEE  336
             +  Y   + R  +  I++E 
Sbjct  556   ATWY---KPRKPKSAIQMEN  572



>ref|XP_010656420.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010656421.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 emb|CBI28187.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   494 bits (1271),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 295/556 (53%), Positives = 405/556 (73%), Gaps = 27/556 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +AN VT+F+G SF+L LLGGF+AD
Sbjct  27    AALILGIEICERLSTMGIAVNLVTYLVSTMHLPSATSANTVTDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             +FLGR+ TI IF TVQA G  +L I T +P LQPP C +  + +C  A+G Q+G+LYLAL
Sbjct  87    SFLGRFRTIAIFATVQAMGTGMLAIITRLPQLQPPPCKNTPTQTCKQANGFQMGILYLAL  146

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFDD D++E+ QM+ FFS F FFI+ G+L+AVTVLVYIQD
Sbjct  147   YLIALGTGGLKSSVSGFGTDQFDDKDEKEQSQMIYFFSRFFFFISTGTLMAVTVLVYIQD  206

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              + R  GYG+C  +++ A++++ SGT+RYR+KK VGSP+  I+ V VAA RKR+++LP +
Sbjct  207   EVSRSLGYGICCVSMLIAILVYFSGTKRYRYKKSVGSPIVHISQVIVAAMRKRKMDLPFN  266

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSISTLT  1101
               LLY          +   +  ++ H+ +FR LD+AAI      K   S+ N W + ++T
Sbjct  267   ASLLY----------EDSAEGSRIQHTDQFRCLDKAAILAGEFDKTASSDPNPWKLCSVT  316

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
              VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V 
Sbjct  317   RVEEVKMMARLLPIWATTIIFWTTYAQMITFSVEQASTMERSIG-NFQIPAGSLTVFFVA  375

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDR ++P++++    P G S LQRIA+GL LS+VGM AAAL E +RL VA++
Sbjct  376   AILITLAVYDRFIMPMWKKWRGKP-GFSSLQRIALGLILSIVGMTAAALAERRRLSVAKA  434

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
              G   D  AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFLST+
Sbjct  435   VG---DNTATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLSTL  491

Query  560   ALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             +LG F SS LV++V +VTG +  + WLAD++N G+L  FY LLA++S +N   FL C+  
Sbjct  492   SLGFFVSSFLVSVVKRVTGSRDGQGWLADNINYGRLDCFYGLLAILSFINFAVFLVCA--  549

Query  386   YVYKEKRLAEMGIELE  339
              V+ + +    G+++E
Sbjct  550   -VWYKPQKPNDGMQME  564



>ref|XP_002281975.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Vitis 
vinifera]
Length=580

 Score =   493 bits (1270),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 295/556 (53%), Positives = 405/556 (73%), Gaps = 27/556 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +AN VT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEICERLSTMGIAVNLVTYLVSTMHLPSATSANTVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             +FLGR+ TI IF TVQA G  +L I T +P LQPP C +  + +C  A+G Q+G+LYLAL
Sbjct  91    SFLGRFRTIAIFATVQAMGTGMLAIITRLPQLQPPPCKNTPTQTCKQANGFQMGILYLAL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFDD D++E+ QM+ FFS F FFI+ G+L+AVTVLVYIQD
Sbjct  151   YLIALGTGGLKSSVSGFGTDQFDDKDEKEQSQMIYFFSRFFFFISTGTLMAVTVLVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              + R  GYG+C  +++ A++++ SGT+RYR+KK VGSP+  I+ V VAA RKR+++LP +
Sbjct  211   EVSRSLGYGICCVSMLIAILVYFSGTKRYRYKKSVGSPIVHISQVIVAAMRKRKMDLPFN  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSISTLT  1101
               LLY          +   +  ++ H+ +FR LD+AAI      K   S+ N W + ++T
Sbjct  271   ASLLY----------EDSAEGSRIQHTDQFRCLDKAAILAGEFDKTASSDPNPWKLCSVT  320

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
              VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V 
Sbjct  321   RVEEVKMMARLLPIWATTIIFWTTYAQMITFSVEQASTMERSIG-NFQIPAGSLTVFFVA  379

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+T+ +YDR ++P++++    P G S LQRIA+GL LS+VGM AAAL E +RL VA++
Sbjct  380   AILITLAVYDRFIMPMWKKWRGKP-GFSSLQRIALGLILSIVGMTAAALAERRRLSVAKA  438

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
              G   D  AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFLST+
Sbjct  439   VG---DNTATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLSTL  495

Query  560   ALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             +LG F SS LV++V +VTG +  + WLAD++N G+L  FY LLA++S +N   FL C+  
Sbjct  496   SLGFFVSSFLVSVVKRVTGSRDGQGWLADNINYGRLDCFYGLLAILSFINFAVFLVCA--  553

Query  386   YVYKEKRLAEMGIELE  339
              V+ + +    G+++E
Sbjct  554   -VWYKPQKPNDGMQME  568



>ref|NP_850084.1| nitrate transporter 1.4 [Arabidopsis thaliana]
 sp|Q9SZY4.1|PTR27_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.2; Short=AtNPF6.2; AltName: 
Full=Nitrate transporter 1.4 [Arabidopsis thaliana]
 emb|CAB38705.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEC07875.1| nitrate transporter 1.4 [Arabidopsis thaliana]
Length=577

 Score =   493 bits (1268),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 280/541 (52%), Positives = 389/541 (72%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TIGIF+T+QA G   L ++T +P L+PP C     +C+PA+  Q+ +LY++L
Sbjct  90    DSFLGRFKTIGIFSTIQALGTGALAVATKLPELRPPTCH-HGEACIPATAFQMTILYVSL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+  M  FF+ F FFI++G+LLAVTVLVY+QD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAHMAFFFNRFFFFISMGTLLAVTVLVYMQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+V+FL GT+RYR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIVIFLCGTKRYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + I++ H+ +F  LD+AAI          +GV+  N W +S
Sbjct  269   IVYLY----------EDNPEGIRIEHTDQFHLLDKAAIVAEGDFEQTLDGVAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  SF++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-SFKIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  378   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKSSS-----QKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV +VT       WLAD++N G+L  FYWLL ++S +N + ++ C
Sbjct  492   TTLSLGFFVSSFLVSIVKRVTSTSTDVGWLADNINHGRLDYFYWLLVILSGINFVVYIIC  551

Query  395   S  393
             +
Sbjct  552   A  552



>ref|XP_004968920.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Setaria italica]
Length=590

 Score =   493 bits (1269),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 290/541 (54%), Positives = 386/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA++LG+E CERL+T+GI +NLVTYLT TMHL +A AANVVT+F+G SF+L LLGGF+A
Sbjct  44    AAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSATAANVVTDFMGTSFLLCLLGGFLA  103

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             D+FLGRYLTI IF  VQA G  +L +ST +  L+PP C P  +G C  A+G Q+ VLY+ 
Sbjct  104   DSFLGRYLTIAIFALVQAIGTGLLAVSTEVRQLRPPPCGPGAAGPCEQATGLQMSVLYVC  163

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALGTGGLKSSVSG GTDQFD+ D RER  M  FF+ F FFI+VG+LLAVT+LVY+Q
Sbjct  164   LYLIALGTGGLKSSVSGFGTDQFDERDARERAAMGLFFNRFFFFISVGTLLAVTILVYVQ  223

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR W YG+C  A++ A+ +FLSGTRRYR+K+  GSP+ QI  V VAA +KR ++ P 
Sbjct  224   DHVGRSWAYGICTGAMLVAIAVFLSGTRRYRYKRGSGSPIVQILQVLVAAAQKRSIKQPL  283

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI----------KEGVSEVNKWS  1116
                 LY            EH +I  PH+ +F  LDRAA+          ++G    N W 
Sbjct  284   TASALYE--------DRPEHARI--PHTAQFPCLDRAAVMAGDDDNEVGRDGRPVPNPWK  333

Query  1115  ISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMA  936
             + +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR M + FE+PAAS+ 
Sbjct  334   LCSVSRVEEVKMVARLMPVWATTILFWTIYAQMITFSVEQATTMDRRMGR-FEIPAASLT  392

Query  935   VFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRL  756
             VF+VG I++T+ +YDR+ VP+ R ++   QGL+ L++I +GL LS+ GM AAA+ E KRL
Sbjct  393   VFFVGAIMLTLAVYDRVFVPLCRSLMTGRQGLTNLEKIGMGLVLSIAGMAAAAICEKKRL  452

Query  755   KVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGL  576
              VA +    A    ++P+SVF L  Q+L+VG+GEA  Y GQLDFF+   PKGMKTMSTGL
Sbjct  453   AVAAT---AAGQHESLPISVFMLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGL  509

Query  575   FLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             FL+T++LG F SS LV++V   T     WL D +N  +L  FYWLLAV+S +NL+A+L C
Sbjct  510   FLTTLSLGFFLSSALVSLVKGCT----TWLGDTINHSRLDYFYWLLAVLSVVNLVAYLVC  565

Query  395   S  393
             +
Sbjct  566   A  566



>ref|XP_009608737.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=578

 Score =   493 bits (1268),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 285/558 (51%), Positives = 394/558 (71%), Gaps = 33/558 (6%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA++LG+E  ERL+T+GI +NLVTYL   MHL +A +AN+VT+F+G +F+L LLGGF+AD
Sbjct  31    AALVLGIEINERLSTMGIAVNLVTYLGGVMHLPSAASANIVTDFMGTAFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF  +Q+ G  +LT++T +P L+P  C P    C PA+G Q+G+LYLALY
Sbjct  91    SFLGRYKTIAIFAIIQSLGTGLLTLTTGLPQLRPHPCHPHE-KCKPATGIQMGILYLALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFDD D++E+ QM  FF+ F  FI++G+L AVTVLVY+QD 
Sbjct  150   LIALGTGGLKSSVSGFGTDQFDDKDEKEKSQMAYFFNRFFLFISMGTLAAVTVLVYVQDE  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C  +++ A+V+F SGTRRYR+KK  GSP+ QI  V VAA RKR +++P D 
Sbjct  210   VGRSWAYGICCISMLIAIVIFFSGTRRYRYKKSSGSPIVQIFQVIVAASRKRNMDVPYDV  269

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI---------KEGVSEVNKWSIST  1107
              +LY  +              ++ HS++FRFLD+AAI             S  N W + T
Sbjct  270   SMLYETNP-------------EIQHSEQFRFLDKAAIVAQGDFDKHANSTSAPNPWKLCT  316

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T VEEVK + R+LP WATTI+FWT +AQ++TFSV QAATMDR + K F +PA S+ VF+
Sbjct  317   VTRVEEVKMMARLLPIWATTILFWTTYAQMITFSVEQAATMDRSLGK-FRIPAGSLTVFF  375

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             V  IL+T+ +YDR ++P++++    P G + LQ+IA+GL LS +GM  AALV++KRL VA
Sbjct  376   VSAILITLAIYDRFIMPLWQKFKGKP-GFTSLQKIAIGLVLSTMGMAIAALVDLKRLSVA  434

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +S G      +T+P+SVF+L  Q+ +VG+GE   Y GQLDFF+ + PKGMKTMSTGLFL+
Sbjct  435   KSVGRN---MSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLT  491

Query  566   TVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             T++LG FFSS LV+I+ KVT       WLAD++N  +L  FY LLA++  +N   +L C+
Sbjct  492   TLSLGFFFSSFLVSIIKKVTRSNGGDGWLADNINYARLDCFYGLLAILGVINFALYLICA  551

Query  392   RGYVYKEKRLAEMGIELE  339
                ++ + R ++  I++E
Sbjct  552   ---IWFKPRKSKSAIQME  566



>ref|XP_009778211.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=587

 Score =   493 bits (1268),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 290/560 (52%), Positives = 402/560 (72%), Gaps = 27/560 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  32    AALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLAD  91

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF  +Q  G  +LT++  +P L+PP C     +C PA G Q+G+LY+ALY
Sbjct  92    SFLGRYKTIVIFALIQTLGTGMLTLAVSLPQLRPPLCHRHDVNCQPAKGSQMGILYMALY  151

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D +E+ QM  FF+ F FFI++G+L AVTVLVYIQD 
Sbjct  152   LIALGTGGLKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFFFISIGTLTAVTVLVYIQDE  211

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C+ +++ A+++FL GTRRYR+KK  GSP+  I  V  AA RKR+++LP D 
Sbjct  212   VGRSWAYGVCSVSMLIAILIFLLGTRRYRYKKSSGSPIVHIFQVIFAAIRKRKMDLPYDV  271

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG--------VSEVNKWSIST  1107
              +LY   +  A          ++ H++EFR LD+AAI  EG         S  N W +ST
Sbjct  272   GMLYETTNSEAT---------RIQHTQEFRVLDKAAIVAEGDFEDQYGSCSAPNPWKLST  322

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+
Sbjct  323   VTRVEEVKMMARLLPIWATTIIFWTTYAQMITFSVEQASTMERSIG-NFQIPAGSLTVFF  381

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             V  IL+T+ +YDRI++P++++    P G S LQ+I++GL LS++GM AAAL E KRL VA
Sbjct  382   VAAILITLAVYDRIIMPLWKKWKGKP-GFSSLQKISIGLVLSIIGMAAAALAEKKRLTVA  440

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +S G  +  +  +P+SVF+L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+
Sbjct  441   KSVGRHSS-STNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLT  499

Query  566   TVALGLFFSSVLVTIVGKVT---GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T++LG F SS LV+++ KVT   G  + WLAD++N G+L  FYWLLAV+  +N + +L C
Sbjct  500   TLSLGFFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYWLLAVLGVINFVIYLIC  559

Query  395   SRGYVYKEKRLAEMGIELEE  336
             +  Y   + R A+  I++E 
Sbjct  560   ATWY---KPRKAKSAIQMEN  576



>gb|AAB95302.1| putative nitrate transporter [Arabidopsis thaliana]
Length=586

 Score =   493 bits (1268),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 280/541 (52%), Positives = 389/541 (72%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  39    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  98

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TIGIF+T+QA G   L ++T +P L+PP C     +C+PA+  Q+ +LY++L
Sbjct  99    DSFLGRFKTIGIFSTIQALGTGALAVATKLPELRPPTCH-HGEACIPATAFQMTILYVSL  157

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+  M  FF+ F FFI++G+LLAVTVLVY+QD
Sbjct  158   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAHMAFFFNRFFFFISMGTLLAVTVLVYMQD  217

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+V+FL GT+RYR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  218   EVGRSWAYGICTVSMAIAIVIFLCGTKRYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  277

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + I++ H+ +F  LD+AAI          +GV+  N W +S
Sbjct  278   IVYLY----------EDNPEGIRIEHTDQFHLLDKAAIVAEGDFEQTLDGVAIPNPWKLS  327

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  SF++PA S+ VF
Sbjct  328   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-SFKIPAGSLTVF  386

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  387   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLSV  445

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  446   AKSSS-----QKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  500

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV +VT       WLAD++N G+L  FYWLL ++S +N + ++ C
Sbjct  501   TTLSLGFFVSSFLVSIVKRVTSTSTDVGWLADNINHGRLDYFYWLLVILSGINFVVYIIC  560

Query  395   S  393
             +
Sbjct  561   A  561



>ref|XP_007204809.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
 gb|EMJ06008.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
Length=585

 Score =   492 bits (1266),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 283/551 (51%), Positives = 384/551 (70%), Gaps = 29/551 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E CERL+T+GIG+NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  26    AAALILGIEICERLSTMGIGVNLVTYLVGTMHLPSSTSANIVTDFVGTSFLLCLLGGFLA  85

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC--SPESGSCVPASggqlgvlyl  1629
             D+FLGRY TI IF ++Q  G+  L IS  +P L+PP C  +  S +C  A+G Q+G+ YL
Sbjct  86    DSFLGRYNTIAIFASIQTVGMVALAISVKLPQLRPPLCHATAASNNCKQANGFQMGIFYL  145

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALY   LG GGLKSSVSG GTDQFD+ D +E+ QM  FF+ F  FI+ G+L+AVT+LVYI
Sbjct  146   ALYTIGLGIGGLKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFLFISTGTLVAVTILVYI  205

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QD + R   YG+C+ ++  A++LFL+GTRRYR+KK  GSP+ QI  V VAA RKR++  P
Sbjct  206   QDEVDRSLAYGICSISMFMAILLFLAGTRRYRYKKSSGSPIVQILQVIVAAIRKRKMITP  265

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI----------KEGVSEVNKW  1119
              D   LY          +   +  ++ H+ +FRFLD+AAI            G    N W
Sbjct  266   VDTNSLY----------ENSPEASRIDHTDQFRFLDKAAILAQGDFEERNAAGSLSPNPW  315

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + ++T VEEVK ++R++P WATTIMFWT +AQ++TFSV QA+TM R + K F++PA S+
Sbjct  316   KLRSVTRVEEVKMMVRLVPIWATTIMFWTAYAQMITFSVEQASTMQRSIGK-FQIPAGSL  374

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+V  I++T+  YDR+++P++++  N   G + LQR+A+GL LS +GM  AAL E KR
Sbjct  375   TVFFVLAIMITLAFYDRLIMPLWKK-WNGQPGFTNLQRMAIGLVLSTIGMAVAALSERKR  433

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L VAR+ G T     T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTG
Sbjct  434   LSVARAVGGTTK---TLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKSPKGMKTMSTG  490

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             LFLST++LG F SS LV+IV  VTG K  + WL D++N G+L  FY LL V+S +N + +
Sbjct  491   LFLSTLSLGFFVSSFLVSIVKAVTGSKDEQGWLTDNINYGRLDCFYGLLTVLSVINFVVY  550

Query  404   LFCSRGYVYKE  372
             L C+R Y   E
Sbjct  551   LVCARWYKTHE  561



>ref|XP_007013426.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=581

 Score =   491 bits (1264),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 294/564 (52%), Positives = 406/564 (72%), Gaps = 30/564 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +ANVVT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEICERLSTMGIAVNLVTYLVSTMHLPSASSANVVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             +FLGRY TI IF  +Q  G   L I+T +P L+PP C +  S +C PA+G Q+GVLY+AL
Sbjct  91    SFLGRYKTIAIFAIIQTLGTGTLAIATKLPQLRPPPCHASASLTCKPANGFQMGVLYMAL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD  D++E+ QM  FF+ F FFI+ G+L+AVTVLVY+QD
Sbjct  151   YLIALGTGGLKSSVSGFGTDQFDQKDEKEKAQMAYFFNRFYFFISTGTLMAVTVLVYLQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C+ ++  A+++FLSGT+RYR+KK +GSP+  I  V VAA +KR+++LP +
Sbjct  211   EVGRSWAYGICSVSMFVAILIFLSGTKRYRYKKSLGSPIVHIFQVIVAAIKKRKMDLPYN  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG------VSEVNKWSISTL  1104
              ELLY          +   +  ++ H+ +F FLD+AAI  EG      VS  N W + ++
Sbjct  271   VELLY----------EDTPEATRIHHTDQFYFLDKAAIVAEGDFERNVVSAPNPWKLCSV  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++ +LP WATTIMFWT HAQ++TFSV QA+TM+R +   F++PA S+ VF+V
Sbjct  321   TRVEEVKMMVGLLPIWATTIMFWTTHAQMITFSVEQASTMERSIG-GFQIPAGSLTVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P +++    P G + LQRIA+GL LS+ GM AAAL E KRL VAR
Sbjct  380   AAILITLAVYDRVIMPFWKKWKGKP-GFTNLQRIAIGLVLSIFGMAAAALAEKKRLAVAR  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G T    AT+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  439   AAGAT---TATLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  495

Query  563   VALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV++V ++TG  + + WLAD++N G+L  FY L+AV+  +N + +L C+ 
Sbjct  496   LSLGFFVSSFLVSVVKRLTGSNDGQGWLADNINHGRLDCFYGLVAVLDIINFVVYLVCAA  555

Query  389   GYVYKEKRLAEMGIELEEETHIPG  318
              +  ++ + A     L+ ET + G
Sbjct  556   WHKPRKPKPA-----LQMETIVNG  574



>gb|AAM20651.1| putative nitrate transporter [Arabidopsis thaliana]
Length=577

 Score =   491 bits (1264),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 280/541 (52%), Positives = 389/541 (72%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TIGIF+T+QA G   L ++T +P L+PP C     +C+PA+  Q+ +LY++L
Sbjct  90    DSFLGRFKTIGIFSTIQALGTGALAVATKLPELRPPTCH-HGEACIPATAFQMTILYVSL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+  M  FF+ F FFI++G+LLAVTVLVY+QD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAHMAFFFNRFFFFISMGTLLAVTVLVYMQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+V+FL GT+RYR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIVIFLCGTKRYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + I++ H+ +F  LD+AAI          +GV+  N W +S
Sbjct  269   IVYLY----------EDNPEGIRIEHTDQFHLLDKAAIVAEGDFEQTLDGVAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  SF++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-SFKIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  378   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLCV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKSSS-----QKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV +VT       WLAD++N G+L  FYWLL ++S +N + ++ C
Sbjct  492   TTLSLGFFVSSFLVSIVKRVTSTSTDVGWLADNINHGRLDYFYWLLVILSGINFVVYIIC  551

Query  395   S  393
             +
Sbjct  552   A  552



>ref|XP_006475796.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
 ref|XP_006475797.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
 gb|KDO80312.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=575

 Score =   490 bits (1262),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 296/562 (53%), Positives = 410/562 (73%), Gaps = 28/562 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA++LG+E CERL+T+GI +NLVTYL  TMHL +A +AN+VT+F+G SF+L LLGGF+AD
Sbjct  27    AALVLGIELCERLSTMGIAVNLVTYLVGTMHLPSATSANIVTDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlylal  1623
             TFLGRY TI IF  VQ  G  +L + T +  L+P  C    + +C  ASG Q+GVLY+AL
Sbjct  87    TFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRPRPCKETATHTCEQASGFQMGVLYIAL  146

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FFS F FFI++G+L+AVTVLVYIQD
Sbjct  147   YLIALGTGGLKSSVSGFGTDQFDEKDEKEKTQMAYFFSRFFFFISLGTLMAVTVLVYIQD  206

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              + R  GYG+C+ A+  A+++FL+GT+RYR+KK  GSP+  I  V VAA +KR+++LP +
Sbjct  207   EISRSVGYGICSVAMFMAIIIFLAGTKRYRYKKSSGSPIVHIFQVIVAAIKKRKMDLPCN  266

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK-----EGVSEVNKWSISTLTD  1098
               +LY  +D   A+        ++ H+++F FLD+AAI      E  S  N W + ++T 
Sbjct  267   VGMLY--EDTPEAS--------RIHHTEQFHFLDKAAIVAEGDFEAGSTPNPWKLCSVTS  316

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK + R+LP WATTI+FWT +AQ++TFSV QA TM+R + + F++PA S+ VF+V  
Sbjct  317   VEEVKMVARLLPIWATTIIFWTTYAQMITFSVEQATTMERSIGR-FQIPAGSLTVFFVSA  375

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR+++P++++    P G + LQR+A+GL LS+VGM AAALVE KRL VAR+ 
Sbjct  376   ILITLAVYDRLIMPLWKKWKGKP-GFTNLQRMAIGLVLSIVGMAAAALVERKRLSVARAV  434

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GLT    AT+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T++
Sbjct  435   GLT---TATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTMSTGLFLTTLS  491

Query  557   LGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             LG F SS LV +V KVTG K    WLAD++N+G+L  FY LLA++S +NL+ +L C+   
Sbjct  492   LGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICA---  548

Query  383   VYKEKRLAEMGIELEEETHIPG  318
             V+ + +  + GI++  ET++ G
Sbjct  549   VWYKPKKPKAGIQM--ETYVKG  568



>gb|AGA60121.1| nitrate transporter NRT1.4B [Cucumis sativus]
 gb|KGN65321.1| hypothetical protein Csa_1G324370 [Cucumis sativus]
Length=580

 Score =   490 bits (1262),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 295/562 (52%), Positives = 407/562 (72%), Gaps = 28/562 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL   MHL +A +AN+VT+F+G  F+L LLGGF+AD
Sbjct  32    AALILGIEICERLSTMGIAVNLVTYLGGVMHLPSAASANIVTDFMGTCFLLCLLGGFLAD  91

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI I   +Q  G   L +ST +P L+PP C   + +C  A+G Q+G+LYLALY
Sbjct  92    SFLGRYYTILISALIQTLGTAALAVSTKLPQLRPPPCD-GTKTCKEANGFQMGILYLALY  150

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSS+SG GTDQFDD+D++E+ +M  FF+ F FFI+ G+L+AVTVLVYIQD 
Sbjct  151   LIALGTGGLKSSISGFGTDQFDDTDEKEKAKMAYFFNRFFFFISTGTLMAVTVLVYIQDE  210

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C+ +++GA++LFLSGT+RYR+KK +GSP+  I  V  AA +KR+LELP + 
Sbjct  211   VGRSWAYGICSVSMLGAILLFLSGTKRYRYKKSMGSPVVHILQVIAAAIKKRKLELPQNV  270

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEG-VSEVNKWSISTL  1104
              LLY          D   +  ++ H+K+F+FLD+AAI       K G VS +N W +S++
Sbjct  271   GLLYE---------DSPDQASRIEHTKQFQFLDKAAIVAEGDFEKHGAVSALNPWKLSSV  321

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  SF++PA S+ VF+V
Sbjct  322   TRVEEVKMMARLLPIWATTIIFWTTYAQMITFSVQQASTMERSIG-SFQIPAGSLTVFFV  380

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P++++     QG + +QR+A+GL LS++GM AAAL E KRL VA+
Sbjct  381   AAILITLGVYDRLIMPLWKK-WKGKQGFTNIQRMAIGLVLSILGMAAAALAESKRLGVAK  439

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G       T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFLST
Sbjct  440   AVG---GDTTTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTMSTGLFLST  496

Query  563   VALGLFFSSVLVTIVGKVTG-EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             ++LG F SS LV++V +VTG + + WLAD++N G+L  FY LL ++S +N +AFL C   
Sbjct  497   LSLGFFISSFLVSVVKRVTGNDGEGWLADNVNYGRLDCFYGLLTILSIINFVAFLVCVIW  556

Query  386   YV-YKEKRLAEMGI---ELEEE  333
             Y+  K K   + GI    L EE
Sbjct  557   YMPQKRKDFQKNGIVNGNLAEE  578



>ref|XP_004150978.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
 ref|XP_004168393.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=599

 Score =   490 bits (1261),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 295/562 (52%), Positives = 407/562 (72%), Gaps = 28/562 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL   MHL +A +AN+VT+F+G  F+L LLGGF+AD
Sbjct  51    AALILGIEICERLSTMGIAVNLVTYLGGVMHLPSAASANIVTDFMGTCFLLCLLGGFLAD  110

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI I   +Q  G   L +ST +P L+PP C   + +C  A+G Q+G+LYLALY
Sbjct  111   SFLGRYYTILISALIQTLGTAALAVSTKLPQLRPPPCD-GTKTCKEANGFQMGILYLALY  169

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSS+SG GTDQFDD+D++E+ +M  FF+ F FFI+ G+L+AVTVLVYIQD 
Sbjct  170   LIALGTGGLKSSISGFGTDQFDDTDEKEKAKMAYFFNRFFFFISTGTLMAVTVLVYIQDE  229

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C+ +++GA++LFLSGT+RYR+KK +GSP+  I  V  AA +KR+LELP + 
Sbjct  230   VGRSWAYGICSVSMLGAILLFLSGTKRYRYKKSMGSPVVHILQVIAAAIKKRKLELPQNV  289

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEG-VSEVNKWSISTL  1104
              LLY          D   +  ++ H+K+F+FLD+AAI       K G VS +N W +S++
Sbjct  290   GLLYE---------DSPDQASRIEHTKQFQFLDKAAIVAEGDFEKHGAVSALNPWKLSSV  340

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  SF++PA S+ VF+V
Sbjct  341   TRVEEVKMMARLLPIWATTIIFWTTYAQMITFSVQQASTMERSIG-SFQIPAGSLTVFFV  399

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P++++     QG + +QR+A+GL LS++GM AAAL E KRL VA+
Sbjct  400   AAILITLGVYDRLIMPLWKK-WKGKQGFTNIQRMAIGLVLSILGMAAAALAESKRLGVAK  458

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G       T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFLST
Sbjct  459   AVG---GDTTTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTMSTGLFLST  515

Query  563   VALGLFFSSVLVTIVGKVTG-EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             ++LG F SS LV++V +VTG + + WLAD++N G+L  FY LL ++S +N +AFL C   
Sbjct  516   LSLGFFISSFLVSVVKRVTGNDGEGWLADNVNYGRLDCFYGLLTILSIINFVAFLVCVIW  575

Query  386   YV-YKEKRLAEMGI---ELEEE  333
             Y+  K K   + GI    L EE
Sbjct  576   YMPQKRKDFQKNGIVNGNLAEE  597



>ref|XP_008352261.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   489 bits (1259),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 284/555 (51%), Positives = 388/555 (70%), Gaps = 29/555 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A AAN+VT+F+G SF+L LLGGF+A
Sbjct  31    AAALILGIEICERLSTMGIAVNLVTYLVGTMHLPSATAANIVTDFVGTSFLLCLLGGFLA  90

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC--SPESGSCVPASggqlgvlyl  1629
             D+FLGRY TI IF ++Q  G+  L IS  +P L+PP C  +  +  C  A+G Q+G+LYL
Sbjct  91    DSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLRPPHCDTTAATNHCKEANGFQMGILYL  150

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALY+ ALG GGLKSSVSG GTDQFD+ D +E+ QM  FF+ F  FI+ G+L+AVTVLVY+
Sbjct  151   ALYIIALGIGGLKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFLFISTGTLVAVTVLVYM  210

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QD + R   YG+C+ ++  A+V+F +GT+RYR+KK  GSP+ QI  V VAA RKR+++ P
Sbjct  211   QDEVDRSLAYGICSVSMFIAIVVFFAGTKRYRYKKSSGSPIVQIFQVVVAAIRKRKMKAP  270

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI----------KEGVSEVNKW  1119
              D   LY          +   + +++ H+ +FRFLD+AA+            G S    W
Sbjct  271   LDIASLY----------ENNPEALRIDHTDQFRFLDKAAVVVEGBFEEGNATGSSTAXHW  320

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + T+T VEEVK + R+LP WATTIMFWT +AQ++TFSV QA+TM+R + K F++PA S+
Sbjct  321   KLRTVTRVEEVKMMXRLLPIWATTIMFWTAYAQMITFSVEQASTMERSIRK-FQIPAGSL  379

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+V  I +T+   DR+++P++++  N   G + LQRIA+GL LS +GM AAAL E KR
Sbjct  380   TVFFVLAIXITLAFNDRVIMPLWKK-WNGQPGFTNLQRIAIGLVLSTIGMAAAALSERKR  438

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L VA+S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTG
Sbjct  439   LSVAKS---ARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKSPKGMKTMSTG  495

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             LFLST++LG F SS+LV+IV  VTG +  + WLA+++N G+L  FY LL V+S +N +A+
Sbjct  496   LFLSTLSLGFFVSSLLVSIVTAVTGNEDGQGWLABNINYGRLDCFYGLLTVLSVINFVAY  555

Query  404   LFCSRGYVYKEKRLA  360
             L C+R Y    K+ A
Sbjct  556   LVCARWYHKTHKQHA  570



>ref|XP_010914872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=582

 Score =   489 bits (1258),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 293/540 (54%), Positives = 391/540 (72%), Gaps = 26/540 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +ANVVT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEICERLSTMGIAVNLVTYLVGTMHLPSAESANVVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC--SPESGSCVPASggqlgvlyla  1626
             +FLGRYLTI IF  VQA G  +L+++T +P L+P  C  S  + SC  A+G Q+G+LYL+
Sbjct  91    SFLGRYLTIAIFAVVQALGTGMLSVTTRLPQLRPAPCNASTATKSCQQANGFQMGILYLS  150

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALGTGGLKSSVSG GTDQFDD D++E+ QM  FF+ F FFI+ G+LLAVTVLVYIQ
Sbjct  151   LYLIALGTGGLKSSVSGFGTDQFDDKDEKEKAQMAYFFNRFFFFISTGTLLAVTVLVYIQ  210

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D +GR W Y +C  +++ A+++FLSGTRRYR+KK  GSP+  I  V VAA  K++L+ PS
Sbjct  211   DEVGRSWAYAICCISMLIAILVFLSGTRRYRYKKSAGSPIVHILQVVVAAASKKKLQYPS  270

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEV-------NKWSIS  1110
             +   LY          +   +  ++ H+ +FR LD+AAI  EG +EV       N W + 
Sbjct  271   NLAFLY----------ENCPEASRIQHTDQFRCLDKAAIMAEGDNEVNGETSSPNPWKLC  320

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T +EEVK +IR+LP WATTI+FWT++AQ++TFSV QA TM+R +  SF++PA S+ VF
Sbjct  321   SVTRIEEVKMMIRLLPVWATTILFWTIYAQMITFSVEQATTMERSIG-SFQIPAGSLTVF  379

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG IL+T+ +YDR+++P+ ++     QG + LQRI +GLALSV+GM+AAA+ E KRL V
Sbjct  380   FVGAILITLAVYDRMIMPLLKK-WKGKQGFTNLQRIGIGLALSVLGMVAAAVAEAKRLSV  438

Query  749   --ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGL  576
                           T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+   PKGMKTMSTGL
Sbjct  439   ARGAGAAAAHRGGTTLPISVFTLIPQFFLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGL  498

Query  575   FLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFL  402
             FL+T++LG F SS LV+IV  +TG K    WLAD +N G+L  FYWLLAV+SA+NL AF+
Sbjct  499   FLTTLSLGFFLSSFLVSIVKTLTGGKHGNGWLADDINHGRLDCFYWLLAVLSAINLGAFI  558



>ref|XP_009591624.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=576

 Score =   488 bits (1257),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 284/555 (51%), Positives = 397/555 (72%), Gaps = 27/555 (5%)
 Frame = -3

Query  1964  GVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGR  1785
             G+E  ERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+AD+FLGR
Sbjct  26    GIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGR  85

Query  1784  YLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalyltalg  1605
             Y TI IF  +Q  G  +LT++  +P L+PP C     SC PA G Q+G+LY+ALYL ALG
Sbjct  86    YKTIAIFALIQTLGTGMLTLAVSLPQLRPPPCHRHDVSCQPAKGSQMGILYMALYLIALG  145

Query  1604  tggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRW  1425
             TGGLKSSVSG GTDQFD+ D +E+ QM  FF+ F FFI++G+L AVTVLVYIQD +GR W
Sbjct  146   TGGLKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFFFISIGTLTAVTVLVYIQDEVGRSW  205

Query  1424  GYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYN  1245
              YG+C+ +++ A+++FL GT++YR+KK  GSP+  I  V  AA RKR+++LP D  +LY 
Sbjct  206   AYGVCSVSMLIAILIFLLGTKKYRYKKSSGSPIVHIFQVIFAAIRKRKMDLPYDVGMLYE  265

Query  1244  VDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG--------VSEVNKWSISTLTDVE  1092
               +  A          ++ H++EFR LD+AAI  EG         S+ N W +ST+T VE
Sbjct  266   TTNSEAT---------RIQHTQEFRVLDKAAIVAEGDFEDQYGSCSDPNPWKLSTVTRVE  316

Query  1091  EVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGIL  912
             EVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V  IL
Sbjct  317   EVKMMARLLPIWATTIIFWTTYAQMITFSVEQASTMERSIG-NFQIPAGSLTVFFVAAIL  375

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             +T+ +YDRI++P++++    P G S LQRI++GL  S++GM AAAL E KRL VA+S G 
Sbjct  376   ITLAVYDRIIMPLWKKWKGKP-GFSSLQRISIGLVFSIIGMAAAALAEKKRLTVAKSMG-  433

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
               + +  +P+SVF+L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T++LG
Sbjct  434   RHNSSTNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLG  493

Query  551   LFFSSVLVTIVGKVT---GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYV  381
              F SS LV+++ KVT   G  + WLAD++N G+L  FYWLLAV+  +N++ +L C+  Y 
Sbjct  494   FFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYWLLAVLGVINIVIYLICATWY-  552

Query  380   YKEKRLAEMGIELEE  336
               + R  +  I++E 
Sbjct  553   --KPRKPKSAIQMEN  565



>ref|XP_010254380.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Nelumbo nucifera]
Length=578

 Score =   488 bits (1257),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 296/557 (53%), Positives = 401/557 (72%), Gaps = 25/557 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +AN VT+F+G SF+L LLGGF+A
Sbjct  26    SAALILGIEICERLSTMGIAVNLVTYLGGTMHLPSATSANTVTDFMGTSFLLCLLGGFLA  85

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlyla  1626
             D+FLGRY TI IF+ VQ  G  +L +ST +P L+PP C+   S  C  A+G Q+G+LYL+
Sbjct  86    DSFLGRYKTIAIFSVVQTLGTGLLAMSTRLPQLRPPPCNTTLSRKCEEANGFQMGILYLS  145

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALGTGGLKSSVSG G+DQFD+ DK+E  QM  FF+ F FFI++G+L AVTVLVYIQ
Sbjct  146   LYLIALGTGGLKSSVSGFGSDQFDEKDKKEMTQMTYFFNRFFFFISIGTLTAVTVLVYIQ  205

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D +GR W YG+C+ ++  A+++FLSGT+RYR+KK +GSP+  I  V VAA  KR++ELP 
Sbjct  206   DEVGRSWAYGICSVSMFVAILIFLSGTKRYRYKKRMGSPIVHILQVIVAATTKRKIELPK  265

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEV-NKWSIST  1107
             +  LLY          +   +  ++ HS +F  LD+AAI      +  VS   N W + +
Sbjct  266   NVSLLY----------EDSPEATRIQHSDQFCCLDKAAIILEEDYQRNVSSTPNPWKLCS  315

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T VEEVK +IR+LP WATTI+FWT +AQ++TFSV QA+TM+R +   F++PA S+ VF+
Sbjct  316   VTRVEEVKMMIRLLPVWATTIIFWTTYAQMITFSVEQASTMERSIGH-FQIPAGSLTVFF  374

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+T+ +YD +++ ++++    P G + LQRIA+GL LS VGM AA+L E+KRL VA
Sbjct  375   VGAILITLAVYDCLIIRLWKKWKGKP-GFTSLQRIAIGLVLSTVGMTAASLAEVKRLSVA  433

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +  G T   + T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFLS
Sbjct  434   KDVGGTT--STTLPLSVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLS  491

Query  566   TVALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             T++LG F SS+LV++V KVTG  + + WLAD++N G+L  FY LLAV S +N + FL C+
Sbjct  492   TLSLGFFVSSLLVSVVKKVTGSNDGQGWLADNINDGRLDCFYGLLAVSSFINFLLFLLCT  551

Query  392   RGYVYKEKRLAEMGIEL  342
               Y  K+K    + IE+
Sbjct  552   VWY-KKQKPQRSLQIEI  567



>ref|XP_010254379.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Nelumbo nucifera]
Length=582

 Score =   488 bits (1257),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 296/557 (53%), Positives = 401/557 (72%), Gaps = 25/557 (4%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA+ILG+E CERL+T+GI +NLVTYL  TMHL +A +AN VT+F+G SF+L LLGGF+A
Sbjct  30    SAALILGIEICERLSTMGIAVNLVTYLGGTMHLPSATSANTVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlyla  1626
             D+FLGRY TI IF+ VQ  G  +L +ST +P L+PP C+   S  C  A+G Q+G+LYL+
Sbjct  90    DSFLGRYKTIAIFSVVQTLGTGLLAMSTRLPQLRPPPCNTTLSRKCEEANGFQMGILYLS  149

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALGTGGLKSSVSG G+DQFD+ DK+E  QM  FF+ F FFI++G+L AVTVLVYIQ
Sbjct  150   LYLIALGTGGLKSSVSGFGSDQFDEKDKKEMTQMTYFFNRFFFFISIGTLTAVTVLVYIQ  209

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D +GR W YG+C+ ++  A+++FLSGT+RYR+KK +GSP+  I  V VAA  KR++ELP 
Sbjct  210   DEVGRSWAYGICSVSMFVAILIFLSGTKRYRYKKRMGSPIVHILQVIVAATTKRKIELPK  269

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEV-NKWSIST  1107
             +  LLY          +   +  ++ HS +F  LD+AAI      +  VS   N W + +
Sbjct  270   NVSLLY----------EDSPEATRIQHSDQFCCLDKAAIILEEDYQRNVSSTPNPWKLCS  319

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T VEEVK +IR+LP WATTI+FWT +AQ++TFSV QA+TM+R +   F++PA S+ VF+
Sbjct  320   VTRVEEVKMMIRLLPVWATTIIFWTTYAQMITFSVEQASTMERSIGH-FQIPAGSLTVFF  378

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG IL+T+ +YD +++ ++++    P G + LQRIA+GL LS VGM AA+L E+KRL VA
Sbjct  379   VGAILITLAVYDCLIIRLWKKWKGKP-GFTSLQRIAIGLVLSTVGMTAASLAEVKRLSVA  437

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +  G T   + T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFLS
Sbjct  438   KDVGGTT--STTLPLSVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLS  495

Query  566   TVALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             T++LG F SS+LV++V KVTG  + + WLAD++N G+L  FY LLAV S +N + FL C+
Sbjct  496   TLSLGFFVSSLLVSVVKKVTGSNDGQGWLADNINDGRLDCFYGLLAVSSFINFLLFLLCT  555

Query  392   RGYVYKEKRLAEMGIEL  342
               Y  K+K    + IE+
Sbjct  556   VWY-KKQKPQRSLQIEI  571



>ref|XP_006450986.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
 gb|ESR64226.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
Length=575

 Score =   488 bits (1256),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 295/562 (52%), Positives = 409/562 (73%), Gaps = 28/562 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA++LG+E CERL+T+GI +NLVTYL  TMHL +A +AN+VT+F+G SF+L LLGGF+AD
Sbjct  27    AALVLGIELCERLSTMGIAVNLVTYLVGTMHLPSATSANIVTDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlylal  1623
             TFLGRY TI IF  VQ  G  +L + T +  L+P  C    + +C  A G Q+GVLY+AL
Sbjct  87    TFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRPRPCKETATHTCEQARGFQMGVLYIAL  146

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FFS F FFI++G+L+AVTVLVYIQD
Sbjct  147   YLIALGTGGLKSSVSGFGTDQFDEKDEKEKTQMAYFFSRFFFFISLGTLMAVTVLVYIQD  206

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              + R  GYG+C+ A+  A+++FL+GT+RYR+KK  GSP+  I  V VAA +KR+++LP +
Sbjct  207   EISRSVGYGICSVAMFMAIIIFLAGTKRYRYKKSSGSPIVHIFQVIVAAIKKRKMDLPCN  266

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK-----EGVSEVNKWSISTLTD  1098
               +LY  +D   A+        ++ H+++F FLD+AAI      E  S  N W + ++T 
Sbjct  267   VGMLY--EDTPEAS--------RIHHTEQFHFLDKAAIVAEGDFEAGSTPNPWKLCSVTS  316

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK + R+LP WATTI+FWT +AQ++TFSV QA TM+R + + F++PA S+ VF+V  
Sbjct  317   VEEVKMVARLLPIWATTIIFWTTYAQMITFSVEQATTMERSIGR-FQIPAGSLTVFFVSA  375

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR+++P++++    P G + LQR+A+GL LS+VGM AAALVE KRL VAR+ 
Sbjct  376   ILITLAVYDRLIMPLWKKWKGKP-GFTNLQRMAIGLVLSIVGMAAAALVERKRLSVARAV  434

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             GLT    AT+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T++
Sbjct  435   GLT---TATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTMSTGLFLTTLS  491

Query  557   LGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGY  384
             LG F SS LV +V KVTG K    WLAD++N+G+L  FY LLA++S +NL+ +L C+   
Sbjct  492   LGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICA---  548

Query  383   VYKEKRLAEMGIELEEETHIPG  318
             V+ + +  + GI++  ET++ G
Sbjct  549   VWYKPKKPKAGIQM--ETYVKG  568



>ref|XP_010533169.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   488 bits (1256),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 284/541 (52%), Positives = 390/541 (72%), Gaps = 27/541 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTYL DTMHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEIVERLSTMGIAVNLVTYLMDTMHLPSSTSANIVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGR+ TI IF  VQ  G   L ++T +P L+PP C      C PASG Q+ +LY+ALY
Sbjct  91    SFLGRFKTIAIFAFVQLLGTGSLALATKLPGLRPPPCH-HGEHCKPASGFQMTILYIALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG G+DQFDD D +E+ QM  FF+ F FFI++G+L+AVTVLVY+QD 
Sbjct  150   LIALGTGGLKSSVSGFGSDQFDDKDPKEKSQMAYFFNRFFFFISMGTLMAVTVLVYMQDE  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C  ++V A+VLFLSGT+RYRFKK  GSP+ QI  V  A+ RKR++ELP   
Sbjct  210   VGRSWAYGICTVSMVIAIVLFLSGTKRYRFKKSQGSPVVQILQVLAASSRKRKMELPQSV  269

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIST  1107
               LY          +   + +++ H+ +F  LD+AAI          +G +  N W + +
Sbjct  270   AYLY----------EDAPEGLRVEHTDQFHLLDKAAIVAEGDFDKNLDGTAIPNPWRLCS  319

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T +EEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM+R +   F +PA S+ VF+
Sbjct  320   VTKIEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMERTIG-GFMIPAGSLTVFF  378

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             V  IL+T+ +YDR ++P++++    P G S LQR+A+GL LS +GM AAAL E KRL VA
Sbjct  379   VAAILITLAVYDRAIMPLWKKWKGKP-GFSNLQRMAIGLVLSTLGMAAAALAEQKRLSVA  437

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +S  +T   + T+P+SVF+L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+
Sbjct  438   KS--VTTAHSKTLPISVFFLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLT  495

Query  566   TVALGLFFSSVLVTIVGKVTGEK---KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T++LG F SS LV++V KVTG     + WLAD++N G+L  FYWLLAV+S +N++ ++ C
Sbjct  496   TLSLGFFVSSFLVSVVKKVTGSSGNGQGWLADNINHGRLDRFYWLLAVLSGINIVVYMIC  555

Query  395   S  393
             +
Sbjct  556   A  556



>ref|XP_008337300.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   488 bits (1255),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 283/555 (51%), Positives = 387/555 (70%), Gaps = 29/555 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A AAN+VT+F+G SF+L LLGGF+A
Sbjct  31    AAALILGIEICERLSTMGIAVNLVTYLVGTMHLPSATAANIVTDFVGTSFLLCLLGGFLA  90

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC--SPESGSCVPASggqlgvlyl  1629
             D+FLGRY TI IF ++Q  G+  L IS  +P L+PP C  +  +  C  A+G Q+G+LYL
Sbjct  91    DSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLRPPHCDTTAATNHCKEANGFQMGILYL  150

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALY+ ALG GGLKSSVSG GTDQFD+ D +E+ QM  FF+ F  FI+ G+L+AVTVLVY+
Sbjct  151   ALYIIALGIGGLKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFLFISTGTLVAVTVLVYM  210

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QD + R   YG+C+ ++  A+V+F +GT+RYR+KK  GSP+ QI  V VAA RKR+++ P
Sbjct  211   QDEVDRSLAYGICSVSMFIAIVVFFAGTKRYRYKKSSGSPIVQIFQVVVAAIRKRKMKAP  270

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI----------KEGVSEVNKW  1119
              D   LY          +   + +++ H+ +FRFLD+AA+            G S    W
Sbjct  271   LDIASLY----------ENNPEALRIDHTDQFRFLDKAAVVVEGBFEEGNATGSSTAXHW  320

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + T+T VEEVK + R+LP WATTIMFWT +AQ++TFSV QA+TM+R + K F++PA S+
Sbjct  321   KLRTVTRVEEVKMMXRLLPIWATTIMFWTAYAQMITFSVEQASTMERSIRK-FQIPAGSL  379

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+V  I +T+   DR+++P++++  N   G + LQRIA+GL LS +GM AAAL E KR
Sbjct  380   TVFFVLAIXITLAFNDRVIMPLWKK-WNGQPGFTNLQRIAIGLVLSTIGMAAAALSERKR  438

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L  A+S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTG
Sbjct  439   LSXAKS---ARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKSPKGMKTMSTG  495

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             LFLST++LG F SS+LV+IV  VTG +  + WLA+++N G+L  FY LL V+S +N +A+
Sbjct  496   LFLSTLSLGFFVSSLLVSIVTAVTGNEDGQGWLABNINYGRLDCFYGLLTVLSVINFVAY  555

Query  404   LFCSRGYVYKEKRLA  360
             L C+R Y    K+ A
Sbjct  556   LVCARWYHKTHKQHA  570



>ref|XP_006475799.1| PREDICTED: nitrate transporter 1.4-like isoform X4 [Citrus sinensis]
 ref|XP_006475800.1| PREDICTED: nitrate transporter 1.4-like isoform X5 [Citrus sinensis]
Length=560

 Score =   486 bits (1252),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 293/559 (52%), Positives = 407/559 (73%), Gaps = 28/559 (5%)
 Frame = -3

Query  1970  ILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFL  1791
             ++G+E CERL+T+GI +NLVTYL  TMHL +A +AN+VT+F+G SF+L LLGGF+ADTFL
Sbjct  15    LVGIELCERLSTMGIAVNLVTYLVGTMHLPSATSANIVTDFMGTSFLLCLLGGFLADTFL  74

Query  1790  GRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlylalylt  1614
             GRY TI IF  VQ  G  +L + T +  L+P  C    + +C  ASG Q+GVLY+ALYL 
Sbjct  75    GRYKTIAIFAAVQTLGTGMLAMVTKLRQLRPRPCKETATHTCEQASGFQMGVLYIALYLI  134

Query  1613  algtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLG  1434
             ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FFS F FFI++G+L+AVTVLVYIQD + 
Sbjct  135   ALGTGGLKSSVSGFGTDQFDEKDEKEKTQMAYFFSRFFFFISLGTLMAVTVLVYIQDEIS  194

Query  1433  RRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPEL  1254
             R  GYG+C+ A+  A+++FL+GT+RYR+KK  GSP+  I  V VAA +KR+++LP +  +
Sbjct  195   RSVGYGICSVAMFMAIIIFLAGTKRYRYKKSSGSPIVHIFQVIVAAIKKRKMDLPCNVGM  254

Query  1253  LYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK-----EGVSEVNKWSISTLTDVEE  1089
             LY  +D   A+        ++ H+++F FLD+AAI      E  S  N W + ++T VEE
Sbjct  255   LY--EDTPEAS--------RIHHTEQFHFLDKAAIVAEGDFEAGSTPNPWKLCSVTSVEE  304

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VK + R+LP WATTI+FWT +AQ++TFSV QA TM+R + + F++PA S+ VF+V  IL+
Sbjct  305   VKMVARLLPIWATTIIFWTTYAQMITFSVEQATTMERSIGR-FQIPAGSLTVFFVSAILI  363

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
             T+ +YDR+++P++++    P G + LQR+A+GL LS+VGM AAALVE KRL VAR+ GLT
Sbjct  364   TLAVYDRLIMPLWKKWKGKP-GFTNLQRMAIGLVLSIVGMAAAALVERKRLSVARAVGLT  422

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
                 AT+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T++LG 
Sbjct  423   ---TATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTMSTGLFLTTLSLGF  479

Query  548   FFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             F SS LV +V KVTG K    WLAD++N+G+L  FY LLA++S +NL+ +L C+   V+ 
Sbjct  480   FVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICA---VWY  536

Query  374   EKRLAEMGIELEEETHIPG  318
             + +  + GI++  ET++ G
Sbjct  537   KPKKPKAGIQM--ETYVKG  553



>emb|CDX71495.1| BnaC04g17300D [Brassica napus]
Length=600

 Score =   488 bits (1255),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 276/541 (51%), Positives = 385/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  53    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSNSANIVTDFMGTSFLLCLLGGFLA  112

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L ++T +P L+PP C     +C PA+  Q+  LY+AL
Sbjct  113   DSFLGRFKTIAIFSTIQALGTGALAVATKLPQLRPPTCH-HGEACTPATAFQMTFLYIAL  171

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+ QM  FF+ F F I++G+L+AVTVLVYIQD
Sbjct  172   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAQMAFFFNRFFFIISMGTLMAVTVLVYIQD  231

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FLSGT+ YR+KK  GSP+ QI  +  A+ RKR+ ELP  
Sbjct  232   EVGRSWAYGICTVSMAIAIAVFLSGTKSYRYKKSQGSPIVQIFQIIAASIRKRKTELPQS  291

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +FR LD+AA+          +G++  N W +S
Sbjct  292   IVYLY----------EDTPEGLRIEHTDQFRMLDKAAVVTEGDFEQTLDGIAIPNPWKLS  341

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  342   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNVG-NFQIPAGSLTVF  400

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+  YDR+++P +++    P G S LQR+A+GL LS VGM AAA+VE KRL V
Sbjct  401   FVAAILITLAFYDRVIMPFWKKWKGKP-GFSSLQRMAIGLVLSTVGMAAAAIVEQKRLSV  459

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  460   AKS-----STQKTLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  514

Query  569   STVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV KVT       WLAD++N G+L  FYWLL ++S +N + +L C
Sbjct  515   TTLSLGFFVSSFLVSIVKKVTATSVNGGWLADNINHGRLDLFYWLLVILSGINFVVYLIC  574

Query  395   S  393
             +
Sbjct  575   A  575



>ref|XP_006408724.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 dbj|BAJ33792.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50177.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=578

 Score =   486 bits (1252),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 282/560 (50%), Positives = 395/560 (71%), Gaps = 31/560 (6%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL  TMHL ++ +ANVVT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMGTMHLPSSTSANVVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L ++T +P L+PP C      C PA+  Q+ +LY+AL
Sbjct  90    DSFLGRFKTIAIFSTIQALGTGALAVATKLPELRPPVCH-HGEVCTPATAFQMTILYIAL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQF+D D +E+ QM  FF+ F FFI++G+L+AVTVLVYIQD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFNDKDPKEKAQMAYFFNRFFFFISMGTLMAVTVLVYIQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FLSGT+RYR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIAVFLSGTKRYRYKKSQGSPVVQILQVIAAAFRKRKMELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +F  LD+AAI          +G++  N W +S
Sbjct  269   TVYLY----------EDNPEGMRIEHTDQFHMLDKAAIVREEDFDQTIDGIAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK +IR+LP WATTI+FWT +AQ++TFSV QA TM R++  +F +PA S+ VF
Sbjct  319   SVTKVEEVKMMIRLLPIWATTIIFWTTYAQMITFSVEQATTMRRNVG-NFTIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+++ +YDR ++P++++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  378   FVAAILISLAVYDRAIMPLWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKS-----STHKTMPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV++V +VT       WLAD++NQG+L  FYWLL ++S +N + ++ C
Sbjct  492   TTLSLGFFVSSFLVSVVKRVTATSMDGGWLADNINQGRLDRFYWLLVILSGINFVVYVIC  551

Query  395   SRGYVYKEKRLAEMGIELEE  336
             +    +K  +  E  +E+E+
Sbjct  552   A--LWFKPTKGKEDSVEMEK  569



>ref|XP_009403461.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   486 bits (1252),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 291/520 (56%), Positives = 384/520 (74%), Gaps = 21/520 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             A +IL +E CERL+TLGIG+NLVTYL+ TMHL +A +ANVV++F+G SF+L LLGGF+AD
Sbjct  31    AMLILVIEICERLSTLGIGVNLVTYLSGTMHLPSAESANVVSDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS--CVPASggqlgvlyla  1626
              +LGRYLT+ IF+ VQA G  +LT+ T +P L+PP C   SG+  C  A+G Q+G+LYL+
Sbjct  91    AYLGRYLTVAIFSAVQAFGTGMLTVVTKLPQLRPPPCGSSSGASKCHRANGFQIGLLYLS  150

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF+ F FFI+ GSL AVTVLVYIQ
Sbjct  151   LYLIALGTGGLKSSVSGFGTDQFDEKDEKEKSQMAYFFNRFFFFISTGSLFAVTVLVYIQ  210

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D +GR W YG+C  +++ A+VLFLSGTRRYRFKK  GSP+  I  V VAA+RKR+L+ P+
Sbjct  211   DEVGRSWSYGICCISMLLAVVLFLSGTRRYRFKKRSGSPIVHILQVLVAAFRKRQLKHPA  270

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE----GVSEVNKWSISTLTD  1098
             +P  L+  +D   A+        ++ H+ +FRFLD+AAI E      S +N W + ++T 
Sbjct  271   NPAFLF--EDFPEAS--------RIQHTDKFRFLDKAAIGEEFHGKTSTMNPWRLCSVTR  320

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK +I++LP WATTIMFWT++AQ+MTFSV QA TMDR +  SF +PA S+ VF+V  
Sbjct  321   VEEVKMMIQLLPVWATTIMFWTIYAQMMTFSVEQATTMDRSVG-SFGIPAGSLNVFFVSA  379

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+T+ +YDR+++P  ++     QG + LQRI +GL LS++ M +AAL E+KRL VAR  
Sbjct  380   ILITLAIYDRVIMPAMKK-WKGKQGFTNLQRIGLGLTLSIMAMASAALTEVKRLSVAREA  438

Query  737   GLTADP-AATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             G  A P  A +P+SVF L  Q+ +VGSGEAL Y GQLDFF+   PKGMKTMSTGLFL+T+
Sbjct  439   GKAAAPRGAALPISVFTLVPQFFLVGSGEALIYTGQLDFFITRSPKGMKTMSTGLFLTTL  498

Query  560   ALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFY  447
             +LG F SS +V+IV  VTG +  + WLAD++N G+L  FY
Sbjct  499   SLGFFLSSFIVSIVKSVTGGESGQGWLADNINHGRLDYFY  538



>ref|XP_008444009.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Cucumis melo]
Length=580

 Score =   486 bits (1252),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 293/562 (52%), Positives = 406/562 (72%), Gaps = 28/562 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL   MHL +A +AN+VT+F+G  F+L LLGGF+AD
Sbjct  32    AALILGIEICERLSTMGIAVNLVTYLGGVMHLPSAASANIVTDFMGTCFLLCLLGGFLAD  91

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI I   +Q  G   L +ST +P L+PP C   + +C  A+G Q+G+LYLALY
Sbjct  92    SFLGRYYTILISAIIQTLGTATLAVSTKLPQLRPPPCD-GTKTCKEANGFQMGILYLALY  150

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSS+SG GTDQFDD+D++E+ +M  FF+ F FFI+ G+L+AVTVLVYIQD 
Sbjct  151   LIALGTGGLKSSISGFGTDQFDDTDEKEKAKMAYFFNRFFFFISTGTLMAVTVLVYIQDE  210

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C+ +++ A++LF+SGT+RYR+KK +GSP+ QI  V  AA +KR+LELP + 
Sbjct  211   VGRSWAYGICSVSMLIAILLFVSGTKRYRYKKSMGSPVVQILQVIAAAIKKRKLELPQNV  270

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG-------VSEVNKWSISTL  1104
              LLY          D      ++ H+K+F+FLD+AAI  EG       VS +N W +S++
Sbjct  271   GLLYE---------DSSDHASRIEHTKQFQFLDKAAIVAEGDFQAHGAVSALNPWKLSSV  321

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  SF++PA S+ VF+V
Sbjct  322   TKVEEVKMMARLLPIWATTIIFWTTYAQMITFSVQQASTMERSIG-SFQIPAGSLTVFFV  380

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P++++     QG + +QR+A+GL LS++GM AAAL E KRL VA+
Sbjct  381   AAILITLGVYDRLIMPLWKK-WKGKQGFTNIQRMAIGLVLSILGMAAAALAERKRLAVAK  439

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             + G       T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  440   AVG---GDTTTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTMSTGLFLTT  496

Query  563   VALGLFFSSVLVTIVGKVTG-EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             ++LG F SS LV++V +VTG + + WLAD++N G+L  FY LL ++S +N +AFL C   
Sbjct  497   LSLGFFISSFLVSVVKRVTGNDGEGWLADNINYGRLDCFYGLLTILSIINFVAFLVCVIW  556

Query  386   YV-YKEKRLAEMGI---ELEEE  333
             Y+  K K   + GI    L EE
Sbjct  557   YMPQKRKDFQKNGIVNGNLAEE  578



>ref|XP_009368838.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Pyrus x bretschneideri]
Length=576

 Score =   486 bits (1251),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 384/545 (70%), Gaps = 29/545 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E CERL+T+GI +NLVTYL  TMHL +A AAN+VT+F+G SF+L LLGGF+A
Sbjct  26    AAALILGIEICERLSTMGIAVNLVTYLVGTMHLPSATAANIVTDFVGTSFLLCLLGGFLA  85

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGS--CVPASggqlgvlyl  1629
             D+FLGRY TI IF ++Q  G+  L IS  +P L+PP C   + +  C  A+G Q+G+LYL
Sbjct  86    DSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLRPPHCDTTAATNHCKEANGFQMGILYL  145

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALY+ ALG GGLKSSVSG GTDQFD+ D +E+ QM  FF+ F  FI+ G+L+AVTVLVY+
Sbjct  146   ALYIIALGIGGLKSSVSGFGTDQFDEKDDKEKAQMSYFFNRFFLFISTGTLVAVTVLVYV  205

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QD + R   YG+C+ ++  A+V+F +GT+RYR+KK  GSP+ Q   V VAA RKR+++ P
Sbjct  206   QDEVDRSLAYGICSVSMFIAIVVFFAGTKRYRYKKSSGSPIVQNFQVVVAAIRKRKMKAP  265

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI----------KEGVSEVNKW  1119
              D   LY          +   +  ++ H+ +FRFLD+AA+            G S    W
Sbjct  266   LDIASLY----------ENNPEASRIDHTDQFRFLDKAAVVVEGDFEEGDATGSSTAKPW  315

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + T+T VEEVK ++R+LP WATTIMFWT +AQ++TFSV QA+TM+R + K F++PA S+
Sbjct  316   KLRTVTRVEEVKMMVRLLPIWATTIMFWTAYAQMITFSVEQASTMERSIRK-FQIPAGSL  374

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+V  I++T+   DR+++P++++  N   G + LQRIA+GL LS +GM AAAL E KR
Sbjct  375   TVFFVLAIMITLAFNDRVIMPLWKK-WNGQPGFTNLQRIAIGLVLSTIGMAAAALSERKR  433

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L VA+S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTG
Sbjct  434   LSVAKS---ARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKSPKGMKTMSTG  490

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             LFLST++LG F SS+LV+IV  VTG +  + WLAD++N G+L  FY LL V+S +N +A+
Sbjct  491   LFLSTLSLGFFVSSLLVSIVKSVTGNEDGQGWLADNINYGRLDCFYGLLTVLSVINFVAY  550

Query  404   LFCSR  390
             L C+R
Sbjct  551   LVCAR  555



>ref|XP_004288806.1| PREDICTED: nitrate transporter 1.4-like [Fragaria vesca subsp. 
vesca]
Length=617

 Score =   487 bits (1254),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 289/563 (51%), Positives = 394/563 (70%), Gaps = 27/563 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA+ILG+E CERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F G SF+L LLGGF+A
Sbjct  68    SAALILGIEICERLSTMGIAVNLVTYLVGTMHLPSSTSANIVTDFAGTSFLLCLLGGFLA  127

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC--SPESGSCVPASggqlgvlyl  1629
             D+FLGRY TI IF ++Q+ G+  L IS  +P L+PP C  +  +  C  A+  Q+G LYL
Sbjct  128   DSFLGRYKTIAIFASIQSLGIVALAISVKLPQLRPPHCDITAANNDCQQANEFQMGFLYL  187

Query  1628  alyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYI  1449
             ALY+ ALG GGLKSSVSG GTDQFDD D +E+ QM  FF+ F FFI+ G+L+AVTVLVYI
Sbjct  188   ALYMIALGIGGLKSSVSGFGTDQFDDKDDKEKAQMAYFFNRFFFFISTGTLMAVTVLVYI  247

Query  1448  QDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELP  1269
             QD + R   YG+C+ ++  A+++F SGT+RYR+KK  GSP+ QI  V VAA RKR++ LP
Sbjct  248   QDQVDRSLAYGICSISMFIAILVFFSGTKRYRYKKSTGSPIVQIFQVIVAAVRKRKMPLP  307

Query  1268  SDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI---------KEGVSEVNKWS  1116
              D  LLY          +   +  ++ H+ +FRFLD+AAI             S  N W 
Sbjct  308   FDVALLY----------ENYPEASRICHTDQFRFLDKAAIVAEEDFERNAPAGSLPNPWK  357

Query  1115  ISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMA  936
             + ++T VEEVK ++++LP WATTIMFWT +AQ++TFSV QA+TM+R + K F++PA S+ 
Sbjct  358   LCSVTRVEEVKMMVKLLPIWATTIMFWTAYAQMLTFSVEQASTMERSIGK-FQIPAGSLT  416

Query  935   VFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRL  756
             VF+V  IL+T+ + DRI++P++++    P G + LQRIA+GL LS +GM AAAL E KRL
Sbjct  417   VFFVLAILITLAVNDRIIMPVWKKWKGQP-GFTNLQRIAIGLVLSTLGMAAAALTEKKRL  475

Query  755   KVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGL  576
              VA+  G+       +P+SV+WL  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGL
Sbjct  476   LVAK--GMKTMSTGALPISVYWLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGL  533

Query  575   FLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFL  402
             FLST+ALG F SS LV+IV + TG K  + WLAD++N G+L  FY LL+V+S +N +A+L
Sbjct  534   FLSTIALGFFVSSFLVSIVRRFTGSKDGQGWLADNINYGRLDCFYGLLSVLSVINFVAYL  593

Query  401   FCSRGYVYKEKRLAEMGIELEEE  333
              C+R Y  ++      G   E++
Sbjct  594   VCARWYKPRKPTKPSNGSSAEDK  616



>ref|XP_009397479.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   486 bits (1251),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 298/541 (55%), Positives = 396/541 (73%), Gaps = 24/541 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+IL +E CERL+T+GI +NLVTYL  TMHL +A +ANVV++FLGASF+L LLGGF+AD
Sbjct  27    AALILVIEICERLSTMGIAVNLVTYLGGTMHLPSAESANVVSDFLGASFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlylal  1623
             +FLGRYLT+ IF  VQA G  +LT+ST +P L+PP C+   +  C  ASG Q+G+LYL+L
Sbjct  87    SFLGRYLTVAIFALVQALGTGMLTVSTSLPRLRPPPCNTSATNRCRRASGFQMGILYLSL  146

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFDD D++E+ QM  FF+ F FFI++GSLLAVTVLVYIQD
Sbjct  147   YLIALGTGGLKSSVSGFGTDQFDDKDEKEKSQMAYFFNRFFFFISIGSLLAVTVLVYIQD  206

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  +++ A++LFLSGT+RYR+KK  GSP+  I  V VAA+ KR+L+ P+ 
Sbjct  207   EVGRSWAYGICCISMLLAVILFLSGTKRYRYKKSSGSPIVHILQVIVAAFSKRQLKYPAT  266

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSE-------VNKWSIST  1107
                LY     ++          ++ H+ +F FLD+AAI  EG S+       VN+W + +
Sbjct  267   IAFLYEDSPEIS----------RIQHTDQFHFLDKAAIMAEGDSDVHGETSTVNRWRLCS  316

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T +EEVK +IR+LP WATTIMFWTV+AQ++TFSV QA TM+R +  SF++PA S+ VF+
Sbjct  317   VTRIEEVKMMIRLLPVWATTIMFWTVYAQIITFSVEQATTMERSIG-SFQIPAGSLTVFF  375

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             VG I+VT+ +YDR ++P+ ++     QG + LQRI +GLA S++GM AAA+ E KRL VA
Sbjct  376   VGAIMVTLGIYDRAIMPLMKK-WKGKQGFTNLQRIGIGLAFSIIGMAAAAVAEAKRLSVA  434

Query  746   RSHGLTAD-PAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             R  G  A    AT+P+SVF L  Q+ +VG+GEA  Y GQLDFF+   PKGMKTMSTGLFL
Sbjct  435   RRAGEGAALRGATLPISVFTLIPQFFLVGAGEAFLYTGQLDFFITRSPKGMKTMSTGLFL  494

Query  569   STVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++ G F SS +V++V  VTG K  + WLAD++N G+L  FY LLA +S LN+ AFL C
Sbjct  495   TTLSFGFFLSSFMVSVVRDVTGGKNGQGWLADNINYGRLDYFYGLLAALSTLNMGAFLVC  554

Query  395   S  393
             +
Sbjct  555   A  555



>ref|XP_006475798.1| PREDICTED: nitrate transporter 1.4-like isoform X3 [Citrus sinensis]
 gb|KDO80313.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=565

 Score =   484 bits (1246),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 293/557 (53%), Positives = 405/557 (73%), Gaps = 28/557 (5%)
 Frame = -3

Query  1964  GVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGR  1785
             G+E CERL+T+GI +NLVTYL  TMHL +A +AN+VT+F+G SF+L LLGGF+ADTFLGR
Sbjct  22    GIELCERLSTMGIAVNLVTYLVGTMHLPSATSANIVTDFMGTSFLLCLLGGFLADTFLGR  81

Query  1784  YLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlylalyltal  1608
             Y TI IF  VQ  G  +L + T +  L+P  C    + +C  ASG Q+GVLY+ALYL AL
Sbjct  82    YKTIAIFAAVQTLGTGMLAMVTKLRQLRPRPCKETATHTCEQASGFQMGVLYIALYLIAL  141

Query  1607  gtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRR  1428
             GTGGLKSSVSG GTDQFD+ D++E+ QM  FFS F FFI++G+L+AVTVLVYIQD + R 
Sbjct  142   GTGGLKSSVSGFGTDQFDEKDEKEKTQMAYFFSRFFFFISLGTLMAVTVLVYIQDEISRS  201

Query  1427  WGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLY  1248
              GYG+C+ A+  A+++FL+GT+RYR+KK  GSP+  I  V VAA +KR+++LP +  +LY
Sbjct  202   VGYGICSVAMFMAIIIFLAGTKRYRYKKSSGSPIVHIFQVIVAAIKKRKMDLPCNVGMLY  261

Query  1247  NVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK-----EGVSEVNKWSISTLTDVEEVK  1083
               +D   A+        ++ H+++F FLD+AAI      E  S  N W + ++T VEEVK
Sbjct  262   --EDTPEAS--------RIHHTEQFHFLDKAAIVAEGDFEAGSTPNPWKLCSVTSVEEVK  311

Query  1082  QLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTI  903
              + R+LP WATTI+FWT +AQ++TFSV QA TM+R + + F++PA S+ VF+V  IL+T+
Sbjct  312   MVARLLPIWATTIIFWTTYAQMITFSVEQATTMERSIGR-FQIPAGSLTVFFVSAILITL  370

Query  902   MMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTAD  723
              +YDR+++P++++    P G + LQR+A+GL LS+VGM AAALVE KRL VAR+ GLT  
Sbjct  371   AVYDRLIMPLWKKWKGKP-GFTNLQRMAIGLVLSIVGMAAAALVERKRLSVARAVGLT--  427

Query  722   PAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFF  543
               AT+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T++LG F 
Sbjct  428   -TATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKSPKGMKTMSTGLFLTTLSLGFFV  486

Query  542   SSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEK  369
             SS LV +V KVTG K    WLAD++N+G+L  FY LLA++S +NL+ +L C+   V+ + 
Sbjct  487   SSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICA---VWYKP  543

Query  368   RLAEMGIELEEETHIPG  318
             +  + GI++  ET++ G
Sbjct  544   KKPKAGIQM--ETYVKG  558



>ref|XP_007013427.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY31046.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=583

 Score =   484 bits (1247),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 281/543 (52%), Positives = 375/543 (69%), Gaps = 25/543 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILGVE CERL+T+ I +NLVTYL  TMHL +A ++NV TNF G S+ML LLGG +A
Sbjct  30    AAALILGVEICERLSTMAIVVNLVTYLVGTMHLPSATSSNVSTNFGGTSYMLCLLGGILA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             DTFL RY TI IF  + A G  +L IST +P L+PP C P +S  CV A+  Q+GV   A
Sbjct  90    DTFLTRYWTIAIFAVINAMGTCLLAISTGLPQLRPPPCGPAQSNECVEANSLQMGVFSCA  149

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL  LG GG+KSSVSG GTDQFD +DK+E+ QM  FF  F   IN+G+LLAVTVLVYIQ
Sbjct  150   LYLYGLGLGGIKSSVSGFGTDQFDKNDKKEKQQMASFFDMFYLIINIGTLLAVTVLVYIQ  209

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D +GR WGYG+C+  ++ A  +FLSGT++YR+K+  GSP+ QI  V VAA RKR ++ PS
Sbjct  210   DKVGRSWGYGICSVTMLLAAFIFLSGTKKYRYKESPGSPVVQILQVLVAAIRKRNVDFPS  269

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI----KEGVSEV---NKWSIST  1107
             +   LY          +   +++++ H+ + R LD+AA+      G+SE    N WS+ +
Sbjct  270   NISHLY----------EDPAQELRLSHTNKLRCLDKAAVITSKDAGISESPTPNPWSLCS  319

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T VEEVK L  +LP WATTIMFWTV+AQ+ +FSV QA TM+R +  +FE+P AS  VF 
Sbjct  320   VTRVEEVKMLTGLLPIWATTIMFWTVYAQMASFSVQQALTMERSIG-NFEIPPASFNVFM  378

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             +G I++T+ +YDR+++P+FR+    PQGL+ LQ+I  GL  S++ M AAA  E+KRL VA
Sbjct  379   IGSIMLTLAIYDRLIMPLFRKT-RKPQGLTNLQKIGFGLFFSIIAMAAAAFAEMKRLSVA  437

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             ++ G T     T+P+S F L  Q+++VG G+A  Y GQLDFF+ E P+GMK + TGLFL+
Sbjct  438   KTKGTT---TLTLPVSGFLLLPQFILVGIGDAFIYAGQLDFFITESPRGMKAIGTGLFLT  494

Query  566   TVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             T+ALGLF SS+LV IV  VT       WLA  +N G+L  FY LLAV+S +NL  FL C+
Sbjct  495   TIALGLFGSSILVEIVRNVTETNGGHDWLAHRINDGRLDYFYGLLAVLSLINLGLFLVCA  554

Query  392   RGY  384
             + Y
Sbjct  555   KRY  557



>ref|XP_006293915.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
 gb|EOA26813.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
Length=570

 Score =   483 bits (1244),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 276/541 (51%), Positives = 387/541 (72%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +A +ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  23    TATLILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  82

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L+I+T +P L+PP C     +CVPA+  Q+ +LY++L
Sbjct  83    DSFLGRFKTIAIFSTIQALGTGALSIATKLPELRPPTCH-HGEACVPATSFQMTILYISL  141

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+ QM  FF+ F FFI++G+L+AVTVLVY+QD
Sbjct  142   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAQMAFFFNRFFFFISMGTLMAVTVLVYMQD  201

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FL GT+ YR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  202   EVGRSWAYGICTVSMAIAIGIFLFGTKSYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  261

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE---------GVSEVNKWSIS  1110
                LY          +   + +++ H+ +F  LD+AAI +         GV+  N W +S
Sbjct  262   IVYLY----------EDSPEGVRIEHTDQFHLLDKAAIVQEGDFEQTLDGVAIPNPWKLS  311

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  312   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-NFKIPAGSLTVF  370

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAA+VE KRL V
Sbjct  371   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAAIVEQKRLSV  429

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  430   AKS-----STQKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  484

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV++V KVT       WLAD++N G+L  FYWLL ++S +N +A+  C
Sbjct  485   TTLSLGFFVSSFLVSVVKKVTSTSTDGGWLADNINHGRLDYFYWLLVILSGINFVAYFIC  544

Query  395   S  393
             +
Sbjct  545   A  545



>ref|XP_003609313.1| Nitrate transporter [Medicago truncatula]
 gb|AES91510.1| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score =   483 bits (1244),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 293/548 (53%), Positives = 404/548 (74%), Gaps = 28/548 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTYL   MH+ ++ AAN VT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEIVERLSTMGIAVNLVTYLMGVMHMPSSTAANTVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TIGIF+ +Q  G   L IST +PSL+PP C     SC PA+G Q+GVLYLALY
Sbjct  91    SFLGRYKTIGIFSAIQTLGTAALAISTKLPSLRPPPCHAGE-SCKPANGIQMGVLYLALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSS+SG G+DQFD+ D++E+ QM  FF+ F FFI++G+L AVT+LVYIQD 
Sbjct  150   LIALGTGGLKSSISGFGSDQFDEKDEKEKSQMTFFFNRFFFFISLGTLAAVTILVYIQDE  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             + R W YG+C+ ++V A+++FLSGT RYR+KK +GSP+  I  V VA+ +KR++ELP   
Sbjct  210   ISRSWAYGICSISMVIAILIFLSGTTRYRYKKSLGSPIVHIFQVIVASIKKRKMELP---  266

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGV-------SEVNKWSISTL  1104
                YNV  +     +   +  ++  S++FRFL++AAI  EG        S  N W + +L
Sbjct  267   ---YNVGSLY----EDTPEDSRIEQSEQFRFLEKAAIVVEGDFDKDLYGSGPNPWKLCSL  319

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QAATM+R++  +F++PA S+ VF+V
Sbjct  320   TRVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQAATMERNVG-NFQIPAGSLTVFFV  378

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ + DRI++P++++ LN   G S LQRIA+GL LS +GM AA+L+E+KRL VA+
Sbjct  379   VAILLTLAVNDRIIMPLWKK-LNGKPGFSNLQRIAIGLLLSTIGMAAASLIEVKRLSVAK  437

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
               G+  +   T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  438   --GVKGN-QTTLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  494

Query  563   VALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV++V KVTG +  + WLADH+N+G+L  FY LL ++S +N +AFL C+ 
Sbjct  495   LSLGFFVSSFLVSVVKKVTGTRDGQGWLADHINKGRLDLFYALLTILSFINFVAFLVCA-  553

Query  389   GYVYKEKR  366
              + YK K+
Sbjct  554   -FWYKPKK  560



>ref|XP_009103552.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brassica rapa]
Length=577

 Score =   483 bits (1242),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 276/560 (49%), Positives = 393/560 (70%), Gaps = 32/560 (6%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSNSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L ++T +P L+PP C     +C PA+  Q+  LY+AL
Sbjct  90    DSFLGRFKTIAIFSTIQALGTGALAVATKLPELRPPTCH-HGEACTPATAFQMTFLYIAL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+ QM  FF+ F F I++G+L+AVTVLVYIQD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAQMAFFFNRFFFIISMGTLMAVTVLVYIQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FLSGT+ YR+KK  GSP+ QI  +  A+ RKR+ ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIAVFLSGTKSYRYKKSQGSPVVQIFQIIAASIRKRKTELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +FR LD+AA+          +G++  N W +S
Sbjct  269   IVYLY----------EDTPEGLRIEHTDQFRMLDKAAVVTEGDFEQTLDGIAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNVG-NFQIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+  YDR+++P +++    P G S LQ +A+GL LS +GM AAA+VE KRL V
Sbjct  378   FVAAILITLAFYDRVIMPFWKKWKGKP-GFSSLQLMAIGLVLSTIGMAAAAIVEQKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKS-----STQKTLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV KVT       WLAD++N G+L  FYWLL ++S +N + ++ C
Sbjct  492   TTLSLGFFVSSFLVSIVKKVTATSVNGGWLADNINHGRLDLFYWLLVILSGINFVVYVIC  551

Query  395   SRGYVYKEKRLAEMGIELEE  336
             +  +   + + +E   E+E+
Sbjct  552   ALWFKPTKSKDSE---EMEK  568



>emb|CDY45207.1| BnaA07g12830D, partial [Brassica napus]
Length=587

 Score =   483 bits (1242),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 273/541 (50%), Positives = 384/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  40    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSNSANIVTDFMGTSFLLCLLGGFLA  99

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L ++T +P L+PP C     +C PA+  Q+  LY+AL
Sbjct  100   DSFLGRFKTIAIFSTIQALGTGALAVATKLPELRPPTCH-HGEACTPATAFQMTFLYIAL  158

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+ QM  FF+ F F I++G+L+AVTVLVYIQD
Sbjct  159   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAQMAFFFNRFFFIISMGTLMAVTVLVYIQD  218

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FLSGT+ YR+KK  GSP+ QI  +  A+ RKR+ ELP  
Sbjct  219   EVGRSWAYGICTVSMAIAIAVFLSGTKSYRYKKSQGSPVVQIFQIIAASIRKRKTELPQS  278

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +FR LD+AA+          +G++  N W +S
Sbjct  279   IVYLY----------EDTPEGLRIEHTDQFRMLDKAAVVTEGDFEQTLDGIAIPNPWKLS  328

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  329   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNVG-NFQIPAGSLTVF  387

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+  YDR+++P +++    P G S LQ +A+GL LS +GM AAA+VE KRL V
Sbjct  388   FVAAILITLAFYDRVIMPFWKKWKGKP-GFSSLQLMAIGLVLSTIGMAAAAIVEQKRLSV  446

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  447   AKS-----STQKTLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  501

Query  569   STVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV KVT       WLAD++N G+L  FYWLL ++S +N + ++ C
Sbjct  502   TTLSLGFFVSSFLVSIVKKVTATSVNGGWLADNINHGRLDLFYWLLVILSGINFVVYVIC  561

Query  395   S  393
             +
Sbjct  562   A  562



>dbj|BAJ90833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   482 bits (1240),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 281/539 (52%), Positives = 369/539 (68%), Gaps = 35/539 (6%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA ++G+E CERL T+GI +NLVTYLTDTMHL +A +ANVVT+F+G SF+L  LGGF+AD
Sbjct  40    AASVVGIELCERLATMGIAVNLVTYLTDTMHLPSADSANVVTDFMGTSFLLCFLGGFLAD  99

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
              FLGRYLTI IF  VQA G  +L +ST +  L+PP           A+  Q+ VLY+ LY
Sbjct  100   AFLGRYLTIAIFALVQALGTGLLAVSTTVHQLRPPPSEE-------ATDLQMSVLYMCLY  152

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D RER  M  FF  F FFI++G+LLAVTVLVYIQD+
Sbjct  153   LIALGTGGLKSSVSGFGTDQFDERDDRERAAMGYFFDRFFFFISLGTLLAVTVLVYIQDH  212

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YGLC+ A++ A+ +FLSGT+RYR+K+  GSP+  I  V VAA RKR L+ P   
Sbjct  213   VGRSWAYGLCSGAMLIAIAVFLSGTKRYRYKRSSGSPVVHILQVLVAAARKRGLKQPHTA  272

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE----------VNKWSIS  1110
               LY            EH +I   H+ +FR LD AA+  G  +           N W + 
Sbjct  273   AALYE--------DRPEHARIH--HTDQFRCLDSAAVMAGEEDNEMGPDGRPTPNPWKLC  322

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR +   FE+PAAS+ VF
Sbjct  323   SVSRVEEVKMVARLMPVWATTILFWTIYAQMITFSVEQATTMDRRIG-GFEIPAASLTVF  381

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +VG I++T+ +YDR+ +P+ R +   P G + L++I +GL LS+ GM+AAA+ E KRL V
Sbjct  382   FVGAIMLTLAVYDRVFIPLCRNLTGRP-GFTNLEKIGIGLVLSIAGMVAAAVTEKKRLTV  440

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A +   T      +P++VF L  Q+L+VG+GEA  Y GQLDFF+   PKGMKTMSTGLFL
Sbjct  441   ASTA--TTMNGTALPITVFMLIPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFL  498

Query  569   STVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             +T++LG F SS LV++V   T     WL D +N  +L  FYWLLAV+ ALNL A+L C+
Sbjct  499   TTLSLGFFLSSALVSLVRGAT----TWLGDTINHSRLDYFYWLLAVLGALNLAAYLLCA  553



>ref|XP_010473052.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   482 bits (1240),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 276/541 (51%), Positives = 385/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L I+T +P L+PP C     +C+PA+  Q+ +LY++L
Sbjct  90    DSFLGRFKTIAIFSTIQALGTGALAIATKLPELRPPTCH-HGEACIPATTFQMTILYISL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFD+ D +E+ QM  FF+ F FFI++G+L+AVTVLVY+QD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDEKDPKEKAQMAFFFNRFFFFISMGTLMAVTVLVYMQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FL GT+ YR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIGIFLFGTKSYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +F  LD+AAI          +GV+  N W +S
Sbjct  269   IVYLY----------EDNPEGVRIEHTDQFHLLDKAAIVTEGDFEQTLDGVAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  SF++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-SFKIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  378   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKS-----STQKTLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+++ KVT       WLAD++N G+L  FYWLL ++S +N   +  C
Sbjct  492   TTLSLGFFVSSFLVSVIKKVTSTSTDGGWLADNINHGRLDYFYWLLVILSGINFGVYFIC  551

Query  395   S  393
             +
Sbjct  552   A  552



>ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF37920.1| oligopeptide transporter, putative [Ricinus communis]
Length=581

 Score =   482 bits (1240),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 288/541 (53%), Positives = 391/541 (72%), Gaps = 25/541 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA++LG+E CERL+T+GIG+NLVTYL  TMHL +A +ANVVT+F+G SF+L LLGGF+AD
Sbjct  31    AALVLGIEVCERLSTMGIGVNLVTYLIGTMHLPSATSANVVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF  VQ  G  +L   T IP L+PP C+  + SCV A+G Q+G+LYLALY
Sbjct  91    SFLGRYKTIAIFALVQTLGTGMLAAITKIPQLRPPPCNTNN-SCVQANGFQMGILYLALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF  F FFI++G+L+AVTVLVY+QD 
Sbjct  150   LIALGTGGLKSSVSGFGTDQFDEKDEKEKSQMNYFFHRFFFFISIGTLMAVTVLVYVQDE  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR WGYG+C+ ++  A+++FLSGT+RYR+KK  GSP+  I  V  AA +KR ++LP + 
Sbjct  210   VGRSWGYGICSVSMFVAILIFLSGTKRYRYKKSSGSPIVHIFQVIAAAVKKRHMDLPYNV  269

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSISTLTD  1098
              LLY  ++ + AA        ++ H+ +F FLD+AAI        G +  N W +  +T 
Sbjct  270   SLLY--ENTLEAA--------RIQHTDQFHFLDKAAIVAEGDFANGGTTPNPWKLCPVTR  319

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK ++ MLP WATTI+FWT +AQ++TFSV QA+TM+R +  SF++PA S+ VF+V  
Sbjct  320   VEEVKMMVSMLPIWATTILFWTTYAQMITFSVEQASTMERSIG-SFQIPAGSLTVFFVAA  378

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+++  YDRI++P+++     P G + LQRI++GL LS +GM AAALVE KRL VA++ 
Sbjct  379   ILISLAAYDRIIMPLWKTWKGKP-GFTNLQRISIGLVLSTLGMAAAALVERKRLSVAKAV  437

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
             G       T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T++
Sbjct  438   G---GDTLTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLS  494

Query  557   LGLFFSSVLVTIVGKVTGEK---KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             LG F SS LV +V +VTG     + WLAD++N G+L  FY LLAV+  +N + +L C+  
Sbjct  495   LGFFVSSFLVMVVKRVTGSNGGGQGWLADNINYGRLDCFYGLLAVLGVVNFVVYLICALW  554

Query  386   Y  384
             Y
Sbjct  555   Y  555



>ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cicer arietinum]
Length=581

 Score =   481 bits (1239),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 288/549 (52%), Positives = 399/549 (73%), Gaps = 27/549 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL   MHL ++ AAN VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEIVERLSTMGIAVNLVTYLMGVMHLPSSTAANTVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF  +Q  G   L IST +P L+PP C   + SC PA+G Q+G+LYLAL
Sbjct  90    DSFLGRFRTIVIFAAIQTLGTATLAISTKLPQLRPPPCPASNESCKPANGIQMGILYLAL  149

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG G+DQFD+ D++E  Q   FF+ F FFI++G+L AVT+LVYIQD
Sbjct  150   YLIALGTGGLKSSVSGFGSDQFDEKDEKENSQRNYFFNRFFFFISLGTLAAVTILVYIQD  209

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              + R W YG+C+ +++ A+++FLSGT+RYR+KK +GSP+  I  V VAA +KR++ELP +
Sbjct  210   EVSRSWAYGICSVSMIIAILVFLSGTKRYRYKKSLGSPIVHIFQVIVAALKKRKMELPCN  269

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGV-------SEVNKWSIST  1107
                LY     V+          ++ H+ +FRFL++AAI  EG        S  N W + +
Sbjct  270   VGSLYEDTPEVS----------RIEHTDQFRFLEKAAIVVEGDFDKDLYGSGPNPWKLCS  319

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             LT VEEVK ++R+LP WATTI+FWT +AQL+TFSV QA+TM+R++ +SF++PA S+ VF+
Sbjct  320   LTRVEEVKMMVRLLPIWATTIIFWTTYAQLITFSVEQASTMERNV-RSFQIPAGSLTVFF  378

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             V  IL+T+ + DRI++P+++++   P G + LQRIA+GL LS  GM AA+L E+KRL VA
Sbjct  379   VAAILITLAVNDRIIMPLWKKMKGKP-GFTNLQRIAIGLLLSTFGMAAASLCEVKRLSVA  437

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +S        AT+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+
Sbjct  438   KS---VKGNQATIPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLT  494

Query  566   TVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             T++LG F SS LV++V KVTG +  + WLAD++N+G+L  F+ LL ++S +N +AFL C+
Sbjct  495   TLSLGFFISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFFALLTILSFINFVAFLVCA  554

Query  392   RGYVYKEKR  366
               + YK K+
Sbjct  555   --FWYKPKK  561



>ref|XP_007011886.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY29505.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=668

 Score =   484 bits (1247),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 293/561 (52%), Positives = 401/561 (71%), Gaps = 27/561 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ LG+E CERL+T+GI +NLVTYL  TMHL +A +ANVVT+F+G SF+L LLGGF+AD
Sbjct  119   AALSLGIEICERLSTMGIAVNLVTYLGGTMHLPSATSANVVTDFMGTSFLLCLLGGFLAD  178

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             ++LGRY TI IF  +Q  G  +L +ST +P L+PP C S E   C  A+  Q+G+LYL+L
Sbjct  179   SYLGRYRTIAIFAIIQTLGTCMLAVSTRLPELRPPPCQSTEVAQCKQANNFQMGILYLSL  238

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF+ F F I++G+LLAVTVLVYIQD
Sbjct  239   YLIALGTGGLKSSVSGFGTDQFDEKDEKEKAQMAYFFNRFFFVISIGTLLAVTVLVYIQD  298

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR WGYG+C+ ++  A+++FLSGT+RYR+KK VGSP+  I  V+ AA  K+ +++PSD
Sbjct  299   EVGRSWGYGICSASMFVAILIFLSGTKRYRYKKCVGSPVVHICQVFAAAIGKKNVKVPSD  358

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTL  1104
               L Y  +D+  A        ++  H+ +F FLD+A++        +G   VN W +  +
Sbjct  359   IALSY--EDLPEA--------LRSHHTDQFCFLDKASVVIEDDYGDDGSFTVNPWKLCPV  408

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK++IR+LP WATTI+FWT +AQ+MTFSV QA TM+R +   F++PA S+ VF+V
Sbjct  409   TRVEEVKKMIRLLPIWATTIIFWTTYAQMMTFSVEQATTMERTIGH-FQIPAGSLTVFFV  467

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
             G IL+T+ +YDR+++P++++    P G + LQRIA+GL LS VGM AAA+ E+KRL VA+
Sbjct  468   GAILITLAVYDRLVMPLWKKWKGKP-GFTNLQRIAIGLFLSAVGMAAAAVAEVKRLSVAK  526

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
                 T     T+P++VF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  527   QSSET----TTLPITVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  582

Query  563   VALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             +ALG F SS+LV+IV  VTG   K+ W+ +++N+G+L  FY LLA +S +N   FL C+ 
Sbjct  583   LALGFFLSSLLVSIVKTVTGSSGKQGWVGENINEGRLDCFYGLLAALSFINFALFLVCAA  642

Query  389   GYVYKE-KRLAEMGIELEEET  330
              Y  K  KR  E+ I  +E T
Sbjct  643   WYRKKTVKRDPELEIIAKEST  663



>ref|XP_007013425.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=591

 Score =   481 bits (1239),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 289/558 (52%), Positives = 400/558 (72%), Gaps = 30/558 (5%)
 Frame = -3

Query  1961  VEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRY  1782
             +E CERL+T+GI +NLVTYL  TMHL +A +ANVVT+F+G SF+L LLGGF+AD+FLGRY
Sbjct  47    IEICERLSTMGIAVNLVTYLVSTMHLPSASSANVVTDFMGTSFLLCLLGGFLADSFLGRY  106

Query  1781  LTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylalyltalg  1605
              TI IF  +Q  G   L I+T +P L+PP C +  S +C PA+G Q+GVLY+ALYL ALG
Sbjct  107   KTIAIFAIIQTLGTGTLAIATKLPQLRPPPCHASASLTCKPANGFQMGVLYMALYLIALG  166

Query  1604  tggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRW  1425
             TGGLKSSVSG GTDQFD  D++E+ QM  FF+ F FFI+ G+L+AVTVLVY+QD +GR W
Sbjct  167   TGGLKSSVSGFGTDQFDQKDEKEKAQMAYFFNRFYFFISTGTLMAVTVLVYLQDEVGRSW  226

Query  1424  GYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYN  1245
              YG+C+ ++  A+++FLSGT+RYR+KK +GSP+  I  V VAA +KR+++LP + ELLY 
Sbjct  227   AYGICSVSMFVAILIFLSGTKRYRYKKSLGSPIVHIFQVIVAAIKKRKMDLPYNVELLY-  285

Query  1244  VDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG------VSEVNKWSISTLTDVEEV  1086
                      +   +  ++ H+ +F FLD+AAI  EG      VS  N W + ++T VEEV
Sbjct  286   ---------EDTPEATRIHHTDQFYFLDKAAIVAEGDFERNVVSAPNPWKLCSVTRVEEV  336

Query  1085  KQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVT  906
             K ++ +LP WATTIMFWT HAQ++TFSV QA+TM+R +   F++PA S+ VF+V  IL+T
Sbjct  337   KMMVGLLPIWATTIMFWTTHAQMITFSVEQASTMERSIG-GFQIPAGSLTVFFVAAILIT  395

Query  905   IMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTA  726
             + +YDR+++P +++    P G + LQRIA+GL LS+ GM AAAL E KRL VAR+ G T 
Sbjct  396   LAVYDRVIMPFWKKWKGKP-GFTNLQRIAIGLVLSIFGMAAAALAEKKRLAVARAAGAT-  453

Query  725   DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLF  546
                AT+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T++LG F
Sbjct  454   --TATLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFF  511

Query  545   FSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE  372
              SS LV++V ++TG  + + WLAD++N G+L  FY L+AV+  +N + +L C+  +  ++
Sbjct  512   VSSFLVSVVKRLTGSNDGQGWLADNINHGRLDCFYGLVAVLDIINFVVYLVCAAWHKPRK  571

Query  371   KRLAEMGIELEEETHIPG  318
              + A     L+ ET + G
Sbjct  572   PKPA-----LQMETIVNG  584



>ref|XP_010541927.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   481 bits (1238),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 282/541 (52%), Positives = 390/541 (72%), Gaps = 27/541 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L+LLGGF+AD
Sbjct  31    AALILGIEIVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLSLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGR+ TI  F  VQ  G   L ++T +P L+PP C      C PASG Q+ +LY+ALY
Sbjct  91    SFLGRFKTIAAFAVVQMLGTGSLALATKLPGLRPPPCH-HGEHCNPASGFQMTILYIALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG G+DQFD+ D +E+ QM  FF+ F FFI++G+L+AVTVLVY+QD 
Sbjct  150   LIALGTGGLKSSVSGFGSDQFDEKDPKEKSQMAYFFNRFFFFISMGTLMAVTVLVYMQDE  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C  ++V A+VLFLSGT+RYR+KK  GSP+ QI  V   A RKR+++LP   
Sbjct  210   VGRSWAYGICTVSMVVAIVLFLSGTKRYRYKKSRGSPVVQILQVLAVAARKRKMDLPQSI  269

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIST  1107
               LY          +   + +++ H+ +FR LD+AAI          +G +  N W + +
Sbjct  270   AYLY----------EDSSEGLRVDHTDQFRLLDKAAIVAEGDFDQNLDGTAVPNPWRLCS  319

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T +EEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F +PA S+ VF+
Sbjct  320   VTKIEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMERTIG-TFVIPAGSLTVFF  378

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             V  ILVT+ +YDR ++P++++    P G S LQR+A+GL +S VGM AAAL E KRL VA
Sbjct  379   VAAILVTLAVYDRAIMPLWKKWKGKP-GFSNLQRMAIGLVMSTVGMAAAALAEQKRLSVA  437

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             +S  +T +   T+P+SVF+L  Q+ +VGSGEA  Y GQLDFFL + PKGMKTMSTGLFL+
Sbjct  438   KS--VTHNYNKTLPISVFFLVPQFFLVGSGEAFIYTGQLDFFLTQSPKGMKTMSTGLFLT  495

Query  566   TVALGLFFSSVLVTIVGKVTGEK---KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T++LG F SS LV++V KVTG     + WLAD++N G+L  FYWLLAV+S +N + ++ C
Sbjct  496   TLSLGFFVSSFLVSVVKKVTGSSGNGQGWLADNINHGRLDCFYWLLAVLSGINFVVYMVC  555

Query  395   S  393
             +
Sbjct  556   A  556



>ref|XP_010510873.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510875.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510876.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510877.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
Length=577

 Score =   481 bits (1237),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 274/541 (51%), Positives = 386/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L I+T +P L+PP C     +C+PA+  Q+ +LY++L
Sbjct  90    DSFLGRFKTIAIFSTIQALGTGALAIATKLPELRPPTCH-HGEACIPATTFQMTILYISL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFD+ D +E+ QM  FF+ F FFI++G+L+AVTVLVY+QD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDEKDPKEKAQMAFFFNRFFFFISMGTLMAVTVLVYMQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FL GT+ YR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIGIFLFGTKSYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +F  LD+AAI          +GV+  N W +S
Sbjct  269   IVYLY----------EDNPEGLRIEHTDQFHLLDKAAIVTEGDFEQTLDGVAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-NFKIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  378   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKS-----STQKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+++ KVT       WLAD++N G+L  FYWLL ++S +N + +  C
Sbjct  492   TTLSLGFFVSSFLVSVIKKVTSTSTDGGWLADNINHGRLDYFYWLLVILSGINFVVYFIC  551

Query  395   S  393
             +
Sbjct  552   A  552



>emb|CDY30787.1| BnaC07g16870D [Brassica napus]
Length=601

 Score =   481 bits (1237),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 274/541 (51%), Positives = 383/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  54    TAAFILGIEVVERLSTMGIAVNLVTYLMETMHLPSSNSANIVTDFMGTSFLLCLLGGFLA  113

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L ++T +P L+PP C     +C  A+  Q+  LY+AL
Sbjct  114   DSFLGRFKTIAIFSTIQALGTGALAVATKLPELRPPTCH-HGETCTTATAFQMTFLYIAL  172

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+ QM  FF+ F F I++G+L+AVTVLVYIQD
Sbjct  173   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAQMAFFFNRFFFIISMGTLMAVTVLVYIQD  232

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FLSGT+ YR+KK  GSP+ QI  +  A+ RKR+ ELP  
Sbjct  233   EVGRSWAYGICTVSMAIAIAVFLSGTKSYRYKKSQGSPVVQIFQIIAASIRKRKTELPQS  292

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +FR LD+AA+          +G++  N W +S
Sbjct  293   IVYLY----------EDTPEGLRIEHTDQFRMLDKAAVVTEGDFEQTLDGIAIPNPWKLS  342

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  343   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNVG-NFQIPAGSLTVF  401

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+  YDR+++P +++    P G S LQR+A+GL LS VGM AAA+VE KRL V
Sbjct  402   FVAAILITLAFYDRVIMPFWKKWKGKP-GFSSLQRMAIGLVLSTVGMAAAAIVEQKRLLV  460

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S          +P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  461   AKS-----STQKILPISVFQLVPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  515

Query  569   STVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV KVT       WLAD++N G+L  FYWLLA++S +N + ++ C
Sbjct  516   TTLSLGFFVSSFLVSIVKKVTATSVNGGWLADNINHGRLDLFYWLLAILSGINFVVYVIC  575

Query  395   S  393
             +
Sbjct  576   A  576



>ref|XP_010417814.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   479 bits (1233),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 274/541 (51%), Positives = 385/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L I+T +P L+PP C     +C+PA+  Q+ +LY++L
Sbjct  90    DSFLGRFKTIAIFSTIQALGTGALAIATKLPELRPPACH-HGEACIPATTFQMTILYISL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFD+ D +E+ QM  FF+ F FFI++G+L+AVTVLVY+QD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDEKDPKEKAQMAFFFNRFFFFISMGTLMAVTVLVYMQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FL GT+ YR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIGIFLFGTKSYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +F  LD+AAI          +GV+  N W +S
Sbjct  269   IVYLY----------EDNPEGVRIEHTDQFHLLDKAAIVTEGDFEQTLDGVAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-NFKIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  378   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKS-----STQKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+++ KVT       WLAD++N G+L  FYWLL ++S +N   +  C
Sbjct  492   TTLSLGFFVSSFLVSVIKKVTSSSTDGGWLADNINHGRLDYFYWLLVILSGINFGVYFIC  551

Query  395   S  393
             +
Sbjct  552   A  552



>ref|XP_007011887.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29506.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=553

 Score =   478 bits (1230),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 289/555 (52%), Positives = 396/555 (71%), Gaps = 27/555 (5%)
 Frame = -3

Query  1961  VEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRY  1782
             +E CERL+T+GI +NLVTYL  TMHL +A +ANVVT+F+G SF+L LLGGF+AD++LGRY
Sbjct  10    IEICERLSTMGIAVNLVTYLGGTMHLPSATSANVVTDFMGTSFLLCLLGGFLADSYLGRY  69

Query  1781  LTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylalyltalg  1605
              TI IF  +Q  G  +L +ST +P L+PP C S E   C  A+  Q+G+LYL+LYL ALG
Sbjct  70    RTIAIFAIIQTLGTCMLAVSTRLPELRPPPCQSTEVAQCKQANNFQMGILYLSLYLIALG  129

Query  1604  tggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRW  1425
             TGGLKSSVSG GTDQFD+ D++E+ QM  FF+ F F I++G+LLAVTVLVYIQD +GR W
Sbjct  130   TGGLKSSVSGFGTDQFDEKDEKEKAQMAYFFNRFFFVISIGTLLAVTVLVYIQDEVGRSW  189

Query  1424  GYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYN  1245
             GYG+C+ ++  A+++FLSGT+RYR+KK VGSP+  I  V+ AA  K+ +++PSD  L Y 
Sbjct  190   GYGICSASMFVAILIFLSGTKRYRYKKCVGSPVVHICQVFAAAIGKKNVKVPSDIALSY-  248

Query  1244  VDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTLTDVEEV  1086
              +D+  A        ++  H+ +F FLD+A++        +G   VN W +  +T VEEV
Sbjct  249   -EDLPEA--------LRSHHTDQFCFLDKASVVIEDDYGDDGSFTVNPWKLCPVTRVEEV  299

Query  1085  KQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVT  906
             K++IR+LP WATTI+FWT +AQ+MTFSV QA TM+R +   F++PA S+ VF+VG IL+T
Sbjct  300   KKMIRLLPIWATTIIFWTTYAQMMTFSVEQATTMERTIGH-FQIPAGSLTVFFVGAILIT  358

Query  905   IMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTA  726
             + +YDR+++P++++    P G + LQRIA+GL LS VGM AAA+ E+KRL VA+    T 
Sbjct  359   LAVYDRLVMPLWKKWKGKP-GFTNLQRIAIGLFLSAVGMAAAAVAEVKRLSVAKQSSET-  416

Query  725   DPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLF  546
                 T+P++VF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T+ALG F
Sbjct  417   ---TTLPITVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLALGFF  473

Query  545   FSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE  372
              SS+LV+IV  VTG   K+ W+ +++N+G+L  FY LLA +S +N   FL C+  Y  K 
Sbjct  474   LSSLLVSIVKTVTGSSGKQGWVGENINEGRLDCFYGLLAALSFINFALFLVCAAWYRKKT  533

Query  371   -KRLAEMGIELEEET  330
              KR  E+ I  +E T
Sbjct  534   VKRDPELEIIAKEST  548



>ref|XP_006356754.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=580

 Score =   479 bits (1233),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 284/551 (52%), Positives = 391/551 (71%), Gaps = 24/551 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             A +ILG+E  ERL+T+GI +NLVTYL   MHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  27    ATLILGIEIVERLSTMGIAVNLVTYLGGAMHLASSNSANIVTDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI +F  +Q  G  +LT++T +P L+P  C     +C PA+G Q+G+LYLALY
Sbjct  87    SFLGRYKTIALFALIQTLGTGMLTVATSLPQLRPSPCHRHDVNCQPANGFQMGILYLALY  146

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D +E+ QM  FF+ F FFI++G+L AVTVLVYIQD 
Sbjct  147   LIALGTGGLKSSVSGFGTDQFDEKDDKEKAQMAYFFNRFFFFISLGTLTAVTVLVYIQDE  206

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C+ ++  A+++FL GT+RYR+KK  GSP+  I  V VAA RKR+++LP D 
Sbjct  207   VGRIWAYGVCSVSMFIAIIIFLLGTKRYRYKKSAGSPIVHIFQVIVAAIRKRKMDLPYDA  266

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG-------VSEVNKWSISTL  1104
              +LY       A        + + H++EFR LD+AAI  EG        S  N W +S++
Sbjct  267   AMLYESTSTPEA--------MTIQHTQEFRILDKAAIVTEGDFEEHASCSAPNPWKLSSV  318

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  319   TRVEEVKMMARLLPIWATTIIFWTTYAQMITFSVEQASTMERTIG-NFQIPAGSLTVFFV  377

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDRI++P++++    P G + LQRIA+GL LSV+GM AAAL E KRL VA+
Sbjct  378   AAILITLALYDRIIMPLWKKWKGKP-GFTNLQRIAIGLVLSVIGMAAAALAEQKRLTVAK  436

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S G      +T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  437   SVGRN---TSTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  493

Query  563   VALGLFFSSVLVTIVGKVTGEK---KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             ++LG F SS LV+++ K T      + WLAD++N G+L  FYWLLA +  +N   +L C+
Sbjct  494   LSLGFFISSFLVSVINKTTKSNATAQGWLADNINYGRLDFFYWLLAALGVINFAIYLNCA  553

Query  392   RGYVYKEKRLA  360
               Y  ++ + A
Sbjct  554   TWYKPRKPKSA  564



>ref|XP_010510874.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Camelina 
sativa]
Length=577

 Score =   479 bits (1232),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 274/541 (51%), Positives = 385/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L I+T +P L+PP C     +C+PA+  Q+ +LY++L
Sbjct  90    DSFLGRFKTIAIFSTIQALGTGALAIATKLPELRPPTCH-HGEACIPATTFQMTILYISL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFD+ D +E+ QM  FF+ F FFI++G+L+AVTVLVY+QD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDEKDPKEKAQMAFFFNRFFFFISMGTLMAVTVLVYMQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FL GT+ YR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIGIFLFGTKSYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + +++ H+ +F  LD+AAI          +GV+  N W +S
Sbjct  269   IVYLY----------EDNPEGLRIEHTDQFHLLDKAAIVTEGDFEQTLDGVAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-NFKIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  378   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKS-----STQKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+++ KVT       WLAD++N G+L  FYWLL ++S +N   +  C
Sbjct  492   TTLSLGFFVSSFLVSVIKKVTSTSTDGGWLADNINHGRLDYFYWLLVILSGINFGVYFIC  551

Query  395   S  393
             +
Sbjct  552   A  552



>ref|XP_009781779.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=576

 Score =   478 bits (1230),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 284/553 (51%), Positives = 399/553 (72%), Gaps = 25/553 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA++LG+E  ERL+T+GI +NLVTYL   MHL +A +AN+VT+F+G +F+L LLGGF+AD
Sbjct  31    AALVLGIEINERLSTMGIAVNLVTYLGGVMHLPSAASANIVTDFMGTAFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IF  +Q+ G  +LT++T +P L+P  C P    C PA+G Q+G+LYLALY
Sbjct  91    SFLGRYKTIAIFAIIQSLGTGMLTLATGLPQLRPQPCHPHE-KCKPATGFQMGILYLALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFDD D++E+ QM  FF+ F  FI++G+L AVTVLVY+QD 
Sbjct  150   LIALGTGGLKSSVSGFGTDQFDDKDEKEKSQMAYFFNRFFLFISMGTLAAVTVLVYVQDE  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C  +++ A+++F SGTR YR+KK  GSP+ QI  V VAA RKR +++P D 
Sbjct  210   VGRSWAYGICCISMIIAIIIFFSGTRMYRYKKSSGSPIVQIFQVIVAASRKRNMDVPYDV  269

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG---VSEVNKWSISTLTDVE  1092
              +LY          + E  +I+  HS++FRFLD+AAI  +G    S  N W + T+T VE
Sbjct  270   SMLYET--------NPEASRIQ--HSEQFRFLDKAAIVAQGDFDTSAPNPWKLCTVTRVE  319

Query  1091  EVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGIL  912
             EVK + R+LP WATTI+FWT +AQ++TFSV QAATMDR + K F++PA S+ VF+V  IL
Sbjct  320   EVKMMARLLPIWATTILFWTTYAQMITFSVEQAATMDRSVGK-FQIPAGSLTVFFVSAIL  378

Query  911   VTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGL  732
             +++ +YDR ++P+++++   P G + LQ+IA+GL LS +GM  AALV++KRL VA+S G 
Sbjct  379   ISLAIYDRFIMPLWQKLKGKP-GFTSLQKIAIGLVLSTIGMAIAALVDLKRLSVAKSVGR  437

Query  731   TADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALG  552
                  +T+P+SVF+L  Q+ +VG+GE   Y GQLDFF+ + PKGMKTMSTGLFL+T++LG
Sbjct  438   N---MSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLG  494

Query  551   LFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
              FFSS LV+I+ KVTG      WLAD++N  +L  FY LLA++  +N   +L  +   ++
Sbjct  495   FFFSSFLVSIIKKVTGSNGGDGWLADNINYARLDCFYGLLAILGVINFALYLIAA---IW  551

Query  377   KEKRLAEMGIELE  339
              + R ++  +++E
Sbjct  552   FKPRKSKSAVQME  564



>ref|XP_006483349.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
Length=536

 Score =   476 bits (1225),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 279/540 (52%), Positives = 384/540 (71%), Gaps = 26/540 (5%)
 Frame = -3

Query  1934  LGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRYLTIGIFTTV  1755
             +GI +NLVTYL  TMHL +A +AN+VT+F+G SF+L LLGGF+AD+FLGRY TI IF TV
Sbjct  1     MGIAVNLVTYLGGTMHLPSATSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFATV  60

Query  1754  QAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylalyltalgtggLKSSVS  1578
             Q  G  +L IST  P L+PP C + +   C  ASG Q+GVLY++LYL ALGTGGLKSSVS
Sbjct  61    QTFGTGLLAISTKQPQLRPPPCQATDITKCQHASGIQMGVLYISLYLIALGTGGLKSSVS  120

Query  1577  GLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGLCACAI  1398
             G GTDQFD+ D++E+ QM  FFS F F I+ G+L+AVTVLVYIQD +GR WGYG+C+  +
Sbjct  121   GFGTDQFDEKDEKEKTQMAYFFSRFFFVISTGTLMAVTVLVYIQDEVGRSWGYGICSICM  180

Query  1397  VGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDVVAAAG  1218
               A+++FLSGTRRYR+KK  GSP+  I  V VAA +KR++ELPS    LY          
Sbjct  181   FTAILIFLSGTRRYRYKKCSGSPIVHICQVVVAARKKRKVELPSSTASLY----------  230

Query  1217  DQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSISTLTDVEEVKQLIRMLPT  1059
             +   ++ ++  + +FR LD+A++       ++G    N W++  +T VEEVK +IR+LP 
Sbjct  231   EDYPEESRIQRTYQFRCLDKASVVTNTDYSEDGAFVSNPWTLCPVTRVEEVKMVIRLLPI  290

Query  1058  WATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMMYDRIMV  879
             WATTI+FW+ +AQ++TFSV QA TM R +  +F++PAAS+ VF+V  IL+T+  YDR+++
Sbjct  291   WATTILFWSTYAQMITFSVEQATTMQRSIG-NFKIPAASLTVFFVAAILITLGAYDRLII  349

Query  878   PIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAATVPMS  699
             P+ ++    P G S LQ IA+GL LS +GM +A++VE+KRL VA+++G T     T+P+S
Sbjct  350   PLLKKRKGKP-GFSNLQLIAIGLFLSALGMASASVVEVKRLAVAKANGTT---GTTLPIS  405

Query  698   VFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSVLVTIV  519
             VF+L  Q+ +VGSGE   Y GQLDFF+ + PKGMKTMSTGLFL+T++LG FFSS+LV+IV
Sbjct  406   VFYLIPQFFLVGSGEGFMYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFFSSLLVSIV  465

Query  518   GKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKE-KRLAEMGI  348
                TG   K  W+ +++N+G+L  FY LLA +S +N   FL C+  Y  K+ K++ EM I
Sbjct  466   KAATGSNGKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQVPEMEI  525



>gb|EAY74514.1| hypothetical protein OsI_02405 [Oryza sativa Indica Group]
Length=566

 Score =   477 bits (1227),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 286/543 (53%), Positives = 379/543 (70%), Gaps = 37/543 (7%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA++LG+E CERL+T+GI +NLVTYLT TMHL +A AANVVT+F+G SF+L LLGGF+A
Sbjct  23    AAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAANVVTDFMGTSFLLCLLGGFLA  82

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGRYLTI +F  VQ+ G  +L  ST++  L+PP           A+  Q+ VLY  L
Sbjct  83    DSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPPGEQ-------ATPVQMAVLYACL  135

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFDD D RER  M  FF+ F FFI++G+LLAVTVLVY+QD
Sbjct  136   YLIALGTGGLKSSVSGFGTDQFDDRDGRERADMGLFFNRFFFFISLGTLLAVTVLVYVQD  195

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRR-LELPS  1266
             ++GR W YG+C+ A++ A+ +FLSGTRRYR+K+  GSP+  I  V VAA RKR  ++ P 
Sbjct  196   HVGRSWAYGICSAAMLAAIAVFLSGTRRYRYKRSSGSPIVHILQVLVAAARKRGVVKRPP  255

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE-----------VNKW  1119
                 LY  D         EH +I   H+ +F  LD AA+  G  +            N W
Sbjct  256   TAAELYEDD-------RPEHARIA--HTAQFPCLDMAAVVAGEEDNEVAGPGGPAAPNPW  306

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR +   FE+PAAS+
Sbjct  307   KLCSVSRVEEVKMVARLMPVWATTILFWTIYAQMITFSVEQATTMDRRVGAGFEIPAASL  366

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+VG I++T+ +YDR+ +P+  RVL   QG + L++I +GLALS++GM AAAL E KR
Sbjct  367   TVFFVGAIMLTLAVYDRVFIPLC-RVLTGKQGFTNLEKIGIGLALSILGMAAAALCEKKR  425

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L VA    + A    + P+SVF L  Q+L+VG+GEA  Y GQLDFF+   PKGMKTMSTG
Sbjct  426   LAVA----VAATTGNSTPISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTG  481

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LFL+T++LG FFSSVLV++V   T     WL D +++ +L  FYWLLAV+S LNL A+L 
Sbjct  482   LFLTTLSLGFFFSSVLVSLVKGAT----TWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLV  537

Query  398   CSR  390
             C++
Sbjct  538   CAK  540



>gb|EPS59108.1| hypothetical protein M569_15702, partial [Genlisea aurea]
Length=523

 Score =   475 bits (1222),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 283/546 (52%), Positives = 382/546 (70%), Gaps = 27/546 (5%)
 Frame = -3

Query  1964  GVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGR  1785
             G+E CERL+T+GI +NLVTYL   MHL +  +AN+VT+F+G  F+L LLGGF+AD+FLGR
Sbjct  1     GIEICERLSTMGIAVNLVTYLGGVMHLPSFTSANIVTDFMGTCFLLCLLGGFLADSFLGR  60

Query  1784  YLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalyltalg  1605
             Y TI IFT VQ  G   L+++T +P L+PP C+  +  C  A+G Q+G+LYLALYL ALG
Sbjct  61    YTTIAIFTAVQILGTAALSLTTKLPHLRPPPCAAGAADCRQATGFQMGMLYLALYLIALG  120

Query  1604  tggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRW  1425
             TGGLKSSVSG G+DQFD+ D RE+ QM  FF+ F FFI++G+L AVTVLVY++D++GR  
Sbjct  121   TGGLKSSVSGFGSDQFDEHDAREKSQMAYFFNRFFFFISIGTLTAVTVLVYVEDHIGRSV  180

Query  1424  GYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYN  1245
              YG+C+ ++  AL +FLSGTR+YR+K+  GSPL QI  V VAA RKR+ ELP   E+L+ 
Sbjct  181   AYGICSVSMFIALAVFLSGTRKYRYKRSTGSPLLQIFQVIVAATRKRKAELPFQAEMLH-  239

Query  1244  VDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI--KEGVSEVNKWSISTLTDVEEVKQLIR  1071
                        E+    + H+ +F FLDRAAI     + E N W IST+T VEEVK ++R
Sbjct  240   -----------EYHASTIHHTDQFPFLDRAAIVGDGDLEERNPWKISTVTKVEEVKMMVR  288

Query  1070  MLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMMYD  891
             +LP WATTI+FWT +AQL+TFSV QA TMDR++   F++PA S+ VF+V  IL+T+   D
Sbjct  289   LLPIWATTILFWTTYAQLITFSVEQATTMDRNIGPHFQIPAGSLTVFFVLAILITLAFND  348

Query  890   RIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAAT  711
             RI++P++ R+    QG S LQR+ +GL LS +GM+AAALVE KRLK + S         +
Sbjct  349   RIIMPLWTRI-KGQQGFSSLQRMGIGLVLSTIGMVAAALVETKRLKASSS---------S  398

Query  710   VPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSVL  531
               +SVF L  Q+ ++GSGEA  Y GQLDFF+ + PKGMKTMST LFL+T+ALG F SS L
Sbjct  399   RNLSVFLLIPQFFLLGSGEAFIYTGQLDFFITQSPKGMKTMSTALFLTTLALGFFLSSFL  458

Query  530   VTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLAE  357
             VT+V ++T    +  WLA ++++G+L  FY LLA +  LN   +L C+  Y Y++ +  E
Sbjct  459   VTVVKQITASSSRGGWLAGNIDRGRLDCFYGLLAALGGLNFAVYLVCAAKYKYQKPK-HE  517

Query  356   MGIELE  339
               +ELE
Sbjct  518   QVVELE  523



>ref|XP_007154995.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
 gb|ESW26989.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
Length=581

 Score =   476 bits (1226),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 286/552 (52%), Positives = 400/552 (72%), Gaps = 25/552 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTY+   MHL ++ AAN VT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEIVERLSTMGIAVNLVTYMISVMHLPSSTAANTVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TIGIF ++Q  G   L IS+ +P L+PP C   S SC  A+G Q+G+LYL+LY
Sbjct  91    SFLGRYKTIGIFASIQTLGTAALAISSKLPQLRPPPCHANSDSCQQANGFQMGILYLSLY  150

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG G+DQFD+ D++E+ QM  FF+ F FFI+ G+L AVTVLVY+QD 
Sbjct  151   LIALGTGGLKSSVSGFGSDQFDEKDEKEKSQMAYFFNRFFFFISFGTLAAVTVLVYLQDE  210

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             + R  GYG+C+ +++ A+++FLSGT+RYR+KK  GSP+  I  V VA+ +KR+++LP + 
Sbjct  211   VSRSLGYGICSVSMIIAIIVFLSGTKRYRYKKSFGSPIVHIWQVIVASIKKRKMQLPYNV  270

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEV-------NKWSISTL  1104
               LY  +D   A+        ++ H+ +FRFL++AAI  EG  E        N W + TL
Sbjct  271   GSLY--EDTPEAS--------RIEHTDQFRFLEKAAIVTEGDFETNLSGSAPNPWKLCTL  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM+R+M  SF++PA S+ VF+V
Sbjct  321   TRVEEVKMMVRLLPVWATTIIFWTTYAQMITFSVEQASTMERNMG-SFQIPAGSLTVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+++ +YDR+++P++++    P G + LQRIA+GL  S+ GM  A+L E KRL VA+
Sbjct  380   AAILISLAVYDRLVMPLWKKWKGKP-GFTDLQRIAIGLVFSIFGMAVASLCERKRLSVAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S  +T +  AT+P+SVF L  Q+ +VG+GEA  Y GQLDFF+   PKGMKTMSTGLFL+T
Sbjct  439   S--VTGN-NATLPISVFLLIPQFFLVGTGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTT  495

Query  563   VALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV++V KVTG +  + WLAD++NQG+L  FY LL ++S +N +AFL C+ 
Sbjct  496   LSLGFFVSSFLVSVVKKVTGTRDGQGWLADNINQGRLDLFYGLLTILSFVNFVAFLVCAV  555

Query  389   GYVYKEKRLAEM  354
              +  K+ +   M
Sbjct  556   WFKPKKPKQPAM  567



>ref|XP_009608738.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=533

 Score =   474 bits (1221),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 276/543 (51%), Positives = 381/543 (70%), Gaps = 33/543 (6%)
 Frame = -3

Query  1934  LGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRYLTIGIFTTV  1755
             +GI +NLVTYL   MHL +A +AN+VT+F+G +F+L LLGGF+AD+FLGRY TI IF  +
Sbjct  1     MGIAVNLVTYLGGVMHLPSAASANIVTDFMGTAFLLCLLGGFLADSFLGRYKTIAIFAII  60

Query  1754  QAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalyltalgtggLKSSVSG  1575
             Q+ G  +LT++T +P L+P  C P    C PA+G Q+G+LYLALYL ALGTGGLKSSVSG
Sbjct  61    QSLGTGLLTLTTGLPQLRPHPCHPHE-KCKPATGIQMGILYLALYLIALGTGGLKSSVSG  119

Query  1574  LGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGLCACAIV  1395
              GTDQFDD D++E+ QM  FF+ F  FI++G+L AVTVLVY+QD +GR W YG+C  +++
Sbjct  120   FGTDQFDDKDEKEKSQMAYFFNRFFLFISMGTLAAVTVLVYVQDEVGRSWAYGICCISML  179

Query  1394  GALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDVVAAAGD  1215
              A+V+F SGTRRYR+KK  GSP+ QI  V VAA RKR +++P D  +LY  +        
Sbjct  180   IAIVIFFSGTRRYRYKKSSGSPIVQIFQVIVAASRKRNMDVPYDVSMLYETNP-------  232

Query  1214  QEHKKIKMPHSKEFRFLDRAAI---------KEGVSEVNKWSISTLTDVEEVKQLIRMLP  1062
                   ++ HS++FRFLD+AAI             S  N W + T+T VEEVK + R+LP
Sbjct  233   ------EIQHSEQFRFLDKAAIVAQGDFDKHANSTSAPNPWKLCTVTRVEEVKMMARLLP  286

Query  1061  TWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMMYDRIM  882
              WATTI+FWT +AQ++TFSV QAATMDR + K F +PA S+ VF+V  IL+T+ +YDR +
Sbjct  287   IWATTILFWTTYAQMITFSVEQAATMDRSLGK-FRIPAGSLTVFFVSAILITLAIYDRFI  345

Query  881   VPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAATVPM  702
             +P++++    P G + LQ+IA+GL LS +GM  AALV++KRL VA+S G      +T+P+
Sbjct  346   MPLWQKFKGKP-GFTSLQKIAIGLVLSTMGMAIAALVDLKRLSVAKSVGRN---MSTLPI  401

Query  701   SVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSVLVTI  522
             SVF+L  Q+ +VG+GE   Y GQLDFF+ + PKGMKTMSTGLFL+T++LG FFSS LV+I
Sbjct  402   SVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFFSSFLVSI  461

Query  521   VGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLAEMGI  348
             + KVT       WLAD++N  +L  FY LLA++  +N   +L C+   ++ + R ++  I
Sbjct  462   IKKVTRSNGGDGWLADNINYARLDCFYGLLAILGVINFALYLICA---IWFKPRKSKSAI  518

Query  347   ELE  339
             ++E
Sbjct  519   QME  521



>gb|KFK32490.1| hypothetical protein AALP_AA6G249500 [Arabis alpina]
Length=577

 Score =   476 bits (1225),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 273/541 (50%), Positives = 384/541 (71%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L ++T +P L+PP C     +C PA+  Q+ +LY++L
Sbjct  90    DSFLGRFKTIAIFSTIQALGTGALAVATKLPELRPPTCH-HGEACTPATSFQMTILYISL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+  M  FF+ F FFI++G+L+AVTVLVY+QD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAHMAFFFNRFFFFISMGTLMAVTVLVYMQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+ +FL GT+ YR+KK  GSP+ QI  V  AA+RKR+ E+P  
Sbjct  209   EVGRSWAYGICTVSMAIAIAVFLFGTKSYRYKKSQGSPVVQIFQVIAAAFRKRKSEVPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI---------KEGVSEVNKWSIS  1110
                LY          +   + +++ H+ +F  LD+AAI          +G++  N W +S
Sbjct  269   IAYLY----------EDNPEGMRIEHTDQFFLLDKAAIITEGDFEQTLDGIAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-NFKIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAALVE KRL V
Sbjct  378   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEGKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKS-----TTHKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV KVT       WLAD++N G+L  FYWLL ++S +N + ++ C
Sbjct  492   TTLSLGFFVSSFLVSIVKKVTATSTDGGWLADNINHGRLDCFYWLLVILSGVNFVVYIIC  551

Query  395   S  393
             +
Sbjct  552   A  552



>ref|XP_011093557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=583

 Score =   476 bits (1225),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 280/559 (50%), Positives = 396/559 (71%), Gaps = 25/559 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL   MHL ++ +AN+VT+F+G  F+L LLGGF+AD
Sbjct  31    AALILGIEICERLSTMGIAVNLVTYLGGVMHLPSSTSANIVTDFMGTCFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI +F  +Q  G  +L I++ +P L+PP C     +C  A+G Q+G+LYLALY
Sbjct  91    SFLGRYKTIAVFAIIQTLGTGMLAITSELPQLRPPPCHAHDINCKQANGFQMGMLYLALY  150

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF+ F FFI++G+L AVTVLVYIQD 
Sbjct  151   LIALGTGGLKSSVSGFGTDQFDEKDEKEKSQMAYFFNRFFFFISIGTLTAVTVLVYIQDE  210

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR   YG+C+ +++ A+ +F SGT+RYR+K+  GSP+  I  V  AA RKR + LP D 
Sbjct  211   VGRSLAYGICSVSMLVAIFIFFSGTKRYRYKRSSGSPIVHIFQVIAAAIRKRNMNLPYDV  270

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI--------KEGVSEVNKWSISTL  1104
             E+LY  +D   A+        ++ H+ +FRFLD+AAI        +   SE N W + ++
Sbjct  271   EMLY--EDTPEAS--------RIHHTDQFRFLDKAAIVAEGDFANRSTCSEPNPWKLCSV  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  321   TRVEEVKMMARLLPIWATTIIFWTTYAQMITFSVEQASTMNRSIG-NFQIPAGSLTVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P++++    P G S LQRIA+GL LS VGM  A L E+KRL VA+
Sbjct  380   AAILITLAVYDRLIMPLWKKWKGKP-GFSSLQRIAIGLVLSTVGMGVATLAEMKRLSVAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S    +  ++ +P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  439   S---VSRSSSNLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  495

Query  563   VALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV+++ KVT     + WLAD++N G+L  FY LLAV+  +NL+ +L C+ 
Sbjct  496   LSLGFFVSSFLVSVIKKVTSSNGGQGWLADNINYGRLDCFYGLLAVLGIINLVIYLICAV  555

Query  389   GYVYKEKRLAEMGIELEEE  333
              Y   +K   +  +++E +
Sbjct  556   WYKPDQKPKPQPALQMEAK  574



>ref|XP_010925226.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=588

 Score =   476 bits (1225),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 287/563 (51%), Positives = 395/563 (70%), Gaps = 28/563 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+IL +E  ERL+T+GI +NLVTYL  T+HL +A +ANVV++F+G SF+L LLGGF+AD
Sbjct  27    AALILVIEIAERLSTMGIAVNLVTYLGGTLHLPSAESANVVSDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC-SPESGSCVPASggqlgvlylal  1623
             +FLGRYLTI IF  +QA G  +L++ T +P L+PP C S  +  C  A   Q+G+LYL+L
Sbjct  87    SFLGRYLTIVIFAVIQALGTGMLSVVTRLPQLRPPPCNSSTTAKCQEADVFQMGILYLSL  146

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF  F FFI+ G+LLAVTVLVYIQD
Sbjct  147   YLIALGTGGLKSSVSGFGTDQFDEKDEKEKSQMANFFHRFFFFISTGTLLAVTVLVYIQD  206

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  +++ ++V+FLSGTRRYR+K+  GSP+  I  V VAA RKR+L+ P  
Sbjct  207   EVGRSWAYGICCLSMLISIVVFLSGTRRYRYKRSTGSPIVHILQVVVAAVRKRKLQCPWP  266

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI---------KEGVS-EVNKWSI  1113
              ++ +  +D   A+        ++ H+ +FRFLD+AAI           G S + N W +
Sbjct  267   WDVAFLYEDSPEAS--------RIQHTDQFRFLDKAAIMADGDNHQVHGGTSTDPNPWKL  318

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
              ++T +EEVK +IR+LP WATTIMFWT++AQ++TFSV QA TM+R +  SF++PA S+ V
Sbjct  319   CSVTRIEEVKMMIRLLPVWATTIMFWTIYAQIITFSVEQATTMERSIG-SFQIPAGSLTV  377

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F VG IL+T+ +YDR+++P+ +R     QG + LQ+I +GL LSV+GM+AAAL E+KRL 
Sbjct  378   FLVGAILITLAIYDRMIMPVLKR-WKGKQGFTNLQKIGIGLTLSVIGMVAAALAEVKRLS  436

Query  752   --VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
                       +    T+P+SVF L  Q+ +VG+GE   Y GQLDFF+   PKGMKTMSTG
Sbjct  437   VARRVGAAAASRGGTTLPVSVFTLIPQFFLVGAGEGFVYTGQLDFFITRSPKGMKTMSTG  496

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAF  405
             LFL+T++LG F SS+LV+IV  +TG K    WLAD++N G+L  FY LLAV+ A+NL AF
Sbjct  497   LFLTTLSLGFFVSSLLVSIVNSLTGGKHGNGWLADNINNGRLDCFYGLLAVLGAVNLGAF  556

Query  404   LFCSRGYVYKEKRLAEMGIELEE  336
             L C+      + +  + G+++E 
Sbjct  557   LLCA---ARTKPQTPQAGLQMES  576



>ref|NP_001043326.1| Os01g0556700 [Oryza sativa Japonica Group]
 dbj|BAF05240.1| Os01g0556700 [Oryza sativa Japonica Group]
Length=566

 Score =   475 bits (1222),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 285/543 (52%), Positives = 378/543 (70%), Gaps = 37/543 (7%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA++LG+E CERL+T+GI +NLVTYLT TMHL +A AANVVT+F+G SF+L LLGGF+A
Sbjct  23    AAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAANVVTDFMGTSFLLCLLGGFLA  82

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGRYLTI +F  VQ+ G  +L  ST++  L+PP     +         Q+ VLY  L
Sbjct  83    DSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPPGEQPT-------PVQMAVLYACL  135

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFDD D RER  M  FF+ F FFI++G+LLAVTVLVY+QD
Sbjct  136   YLIALGTGGLKSSVSGFGTDQFDDRDGRERAAMGLFFNRFFFFISLGTLLAVTVLVYVQD  195

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRR-LELPS  1266
             ++GR W YG+C+ A++ A+ +FLSGTRRYR+K+  GSP+  I  V VAA RKR  ++ P 
Sbjct  196   HVGRSWAYGICSAAMLAAIAVFLSGTRRYRYKRSSGSPIVHILQVLVAAARKRGVVKRPP  255

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE-----------VNKW  1119
                 LY  D         EH +I   H+ +F  LD AA+  G  +            N W
Sbjct  256   TAAELYEDD-------RPEHARIA--HTAQFPCLDMAAVVAGEEDNEVAGPGGPAAPNPW  306

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR +   FE+PAAS+
Sbjct  307   KLCSVSRVEEVKMVARLMPVWATTILFWTIYAQMITFSVEQATTMDRRVGAGFEIPAASL  366

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+VG I++T+ +YDR+ +P+  RVL   QG + L++I +GLALS++GM AAAL E KR
Sbjct  367   TVFFVGAIMLTLAVYDRVFIPLC-RVLTGKQGFTNLEKIGIGLALSILGMAAAALCEKKR  425

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L VA    + A    + P+SVF L  Q+L+VG+GEA  Y GQLDFF+   PKGMKTMSTG
Sbjct  426   LAVA----VAATTGNSTPISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTG  481

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LFL+T++LG FFSSVLV++V   T     WL D +++ +L  FYWLLAV+S LNL A+L 
Sbjct  482   LFLTTLSLGFFFSSVLVSLVKGAT----TWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLV  537

Query  398   CSR  390
             C++
Sbjct  538   CAK  540



>gb|KHG05036.1| Nitrate transporter 1.4 -like protein [Gossypium arboreum]
Length=579

 Score =   475 bits (1223),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 285/560 (51%), Positives = 398/560 (71%), Gaps = 26/560 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ LG+E CERL+T+GI +NLVTYL  TMHL +A +ANVVT+F+G SF+L LLGGF+AD
Sbjct  31    AALSLGIEICERLSTMGIAVNLVTYLGGTMHLPSATSANVVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlylal  1623
             ++LGRY TI IF  VQ  G  +L +ST +P L+PP C   +   C  A+  Q+G+LYL+L
Sbjct  91    SYLGRYRTIAIFAMVQMLGTCLLAVSTKLPQLRPPLCKYTDVTQCEQANSFQMGILYLSL  150

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD+ +++E+ QM  FF+ F F I+ G+L+AVTVLVYIQD
Sbjct  151   YLIALGTGGLKSSVSGFGTDQFDEKNEKEKAQMAYFFNRFFFVISTGTLMAVTVLVYIQD  210

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR WGYG+C+ ++  AL++F SGT+RYR+KK  GSP+  I  V  AA  K+  +LPSD
Sbjct  211   EVGRSWGYGICSASMFIALLIFFSGTKRYRYKKCSGSPIVHICQVVSAASGKKTAKLPSD  270

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSISTLT  1101
               LLY  +D+  A+        ++ H+ +FRFLD+A++      ++G   +N W +  +T
Sbjct  271   ISLLY--EDLPEAS--------RIHHTDQFRFLDKASVVTEDDYRQGSFMMNPWKLCPVT  320

Query  1100  DVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVG  921
              VEEVK++IR+LP WATTI+FWT +AQ++TFSV QA TMDR +   F++PA S+ VF+VG
Sbjct  321   RVEEVKKMIRLLPIWATTIIFWTTYAQMITFSVEQATTMDRTIGH-FQIPAGSLTVFFVG  379

Query  920   GILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS  741
              IL+++ +YDR ++P+ ++    P G + LQ I +GL LS +GM AAA+VE+KRL VA+ 
Sbjct  380   AILISLAVYDRFIIPLCKKWRGEP-GFTNLQLIGIGLFLSAMGMAAAAVVEVKRLSVAKK  438

Query  740   HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTV  561
             +  T     T+P++VF+L  Q+ +VG+GE   Y GQLDFF+ + PKGMKTMSTGLFL+T+
Sbjct  439   YNET----TTLPITVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMSTGLFLTTL  494

Query  560   ALGLFFSSVLVTIVGKVTG--EKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRG  387
             +LG FFSS+LV+IV   TG  +K+ WL +H+N+G+L  FY LLA +S LN   FL  +  
Sbjct  495   SLGFFFSSLLVSIVKATTGSSDKQGWLGEHINKGRLDCFYGLLAALSFLNFGLFLLSAVW  554

Query  386   YVYKE-KRLAEMGIELEEET  330
             +  K  K+  +M I ++E T
Sbjct  555   FRKKTVKQAPKMEIVVKEST  574



>gb|EAZ12317.1| hypothetical protein OsJ_02208 [Oryza sativa Japonica Group]
Length=566

 Score =   474 bits (1221),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 285/542 (53%), Positives = 377/542 (70%), Gaps = 37/542 (7%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA++LG+E CERL+T+GI +NLVTYLT TMHL +A AANVVT+F+G SF+L LLGGF+AD
Sbjct  24    AALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAANVVTDFMGTSFLLCLLGGFLAD  83

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRYLTI +F  VQ+ G  +L  ST++  L+PP     +         Q+ VLY  LY
Sbjct  84    SFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPPGEQPT-------PVQMAVLYACLY  136

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFDD D RER  M  FF+ F FFI++G+LLAVTVLVY+QD+
Sbjct  137   LIALGTGGLKSSVSGFGTDQFDDRDGRERAAMGLFFNRFFFFISLGTLLAVTVLVYVQDH  196

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRR-LELPSD  1263
             +GR W YG+C+ A++ A+ +FLSGTRRYR+K+  GSP+  I  V VAA RKR  ++ P  
Sbjct  197   VGRSWAYGICSAAMLAAIAVFLSGTRRYRYKRSSGSPIVHILQVLVAAARKRGVVKRPPT  256

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE-----------VNKWS  1116
                LY  D         EH +I   H+ +F  LD AA+  G  +            N W 
Sbjct  257   AAELYEDD-------RPEHARIA--HTAQFPCLDMAAVVAGEEDNEVAGPGGPAAPNPWK  307

Query  1115  ISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMA  936
             + +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR +   FE+PAAS+ 
Sbjct  308   LCSVSRVEEVKMVARLMPVWATTILFWTIYAQMITFSVEQATTMDRRVGAGFEIPAASLT  367

Query  935   VFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRL  756
             VF+VG I++T+ +YDR+ +P+  RVL   QG + L++I +GLALS++GM AAAL E KRL
Sbjct  368   VFFVGAIMLTLAVYDRVFIPLC-RVLTGKQGFTNLEKIGIGLALSILGMAAAALCEKKRL  426

Query  755   KVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGL  576
              VA    + A    + P+SVF L  Q+L+VG+GEA  Y GQLDFF+   PKGMKTMSTGL
Sbjct  427   AVA----VAATTGNSTPISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGL  482

Query  575   FLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             FL+T++LG FFSSVLV++V   T     WL D +++ +L  FYWLLAV+S LNL A+L C
Sbjct  483   FLTTLSLGFFFSSVLVSLVKGAT----TWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLVC  538

Query  395   SR  390
             ++
Sbjct  539   AK  540



>ref|XP_002880817.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57076.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score =   474 bits (1221),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 276/541 (51%), Positives = 387/541 (72%), Gaps = 29/541 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA+ILG+E  ERL+T+GI +NLVTYL +TMHL ++ +AN+VT+F+G SF+L LLGGF+A
Sbjct  30    TAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSANIVTDFMGTSFLLCLLGGFLA  89

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+ TI IF+T+QA G   L ++T +P L+PP C     +C+PA+  Q+ +LY++L
Sbjct  90    DSFLGRFKTIAIFSTIQALGTGALAVATKLPELRPPTCH-HGEACIPATSFQMTILYISL  148

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSS+SG G+DQFDD D +E+  M  FF+ F FFI++G+LLAVTVLVY+QD
Sbjct  149   YLIALGTGGLKSSISGFGSDQFDDKDPKEKAHMAFFFNRFFFFISMGTLLAVTVLVYMQD  208

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
              +GR W YG+C  ++  A+V+FL GT+RYR+KK  GSP+ QI  V  AA+RKR++ELP  
Sbjct  209   EVGRSWAYGICTVSMAIAIVIFLCGTKRYRYKKSQGSPVVQIFQVIAAAFRKRKMELPQS  268

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSIS  1110
                LY          +   + I++ H+ +F  LD+AAI          +GV+  N W +S
Sbjct  269   IVYLY----------EDNPEAIRIEHTDQFHLLDKAAIVAEGDFEQTLDGVAIPNPWKLS  318

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK ++R+LP WATTI+FWT +AQ++TFSV QA+TM R++  +F++PA S+ VF
Sbjct  319   SVTKVEEVKMMVRLLPIWATTIIFWTTYAQMITFSVEQASTMRRNIG-NFKIPAGSLTVF  377

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             +V  IL+T+ +YDR ++P +++    P G S LQRIA+GL LS  GM AAA+ E KRL V
Sbjct  378   FVAAILITLAVYDRAIMPFWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAAIAEQKRLSV  436

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S         T+P+SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL
Sbjct  437   AKSSS-----QKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFL  491

Query  569   STVALGLFFSSVLVTIVGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             +T++LG F SS LV+IV +VT       WLAD++N G+L  FYWLL ++S +N + ++ C
Sbjct  492   TTLSLGFFVSSFLVSIVKRVTSTSTDGGWLADNINHGRLDYFYWLLVILSGINFVVYIIC  551

Query  395   S  393
             +
Sbjct  552   A  552



>dbj|BAD87491.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
 dbj|BAD87642.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
Length=587

 Score =   474 bits (1221),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 285/543 (52%), Positives = 378/543 (70%), Gaps = 37/543 (7%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA++LG+E CERL+T+GI +NLVTYLT TMHL +A AANVVT+F+G SF+L LLGGF+A
Sbjct  44    AAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAANVVTDFMGTSFLLCLLGGFLA  103

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGRYLTI +F  VQ+ G  +L  ST++  L+PP     +         Q+ VLY  L
Sbjct  104   DSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPPGEQPT-------PVQMAVLYACL  156

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFDD D RER  M  FF+ F FFI++G+LLAVTVLVY+QD
Sbjct  157   YLIALGTGGLKSSVSGFGTDQFDDRDGRERAAMGLFFNRFFFFISLGTLLAVTVLVYVQD  216

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRR-LELPS  1266
             ++GR W YG+C+ A++ A+ +FLSGTRRYR+K+  GSP+  I  V VAA RKR  ++ P 
Sbjct  217   HVGRSWAYGICSAAMLAAIAVFLSGTRRYRYKRSSGSPIVHILQVLVAAARKRGVVKRPP  276

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE-----------VNKW  1119
                 LY  D         EH +I   H+ +F  LD AA+  G  +            N W
Sbjct  277   TAAELYEDD-------RPEHARIA--HTAQFPCLDMAAVVAGEEDNEVAGPGGPAAPNPW  327

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR +   FE+PAAS+
Sbjct  328   KLCSVSRVEEVKMVARLMPVWATTILFWTIYAQMITFSVEQATTMDRRVGAGFEIPAASL  387

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+VG I++T+ +YDR+ +P+  RVL   QG + L++I +GLALS++GM AAAL E KR
Sbjct  388   TVFFVGAIMLTLAVYDRVFIPLC-RVLTGKQGFTNLEKIGIGLALSILGMAAAALCEKKR  446

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L VA    + A    + P+SVF L  Q+L+VG+GEA  Y GQLDFF+   PKGMKTMSTG
Sbjct  447   LAVA----VAATTGNSTPISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTG  502

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LFL+T++LG FFSSVLV++V   T     WL D +++ +L  FYWLLAV+S LNL A+L 
Sbjct  503   LFLTTLSLGFFFSSVLVSLVKGAT----TWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLV  558

Query  398   CSR  390
             C++
Sbjct  559   CAK  561



>emb|CBI28188.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   474 bits (1219),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 270/544 (50%), Positives = 371/544 (68%), Gaps = 28/544 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA ILG+E  ER TT+GI +NLVTYL +TMH  +A ++ +V NF G SF+L LLGG VA
Sbjct  31    SAATILGIEVSERFTTMGIAVNLVTYLDNTMHQPSATSSTIVANFSGVSFLLCLLGGCVA  90

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-SCVPASggqlgvlyla  1626
             D+FLGRY TI IF  ++A G  +L IS  +  L+PP C+P     CV A+  Q+GV +L 
Sbjct  91    DSFLGRYWTIAIFAVIEALGACVLAISATLSHLRPPPCNPSVAIKCVKANNLQMGVFFLG  150

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             L+  ALG GG+KSSVS LGTDQFD +D++E+ QM  FF+ F F IN+G++LAVT+LVYIQ
Sbjct  151   LFAMALGIGGVKSSVSALGTDQFDQTDEKEKTQMEYFFNRFYFLINIGTILAVTLLVYIQ  210

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D + R  GYG+C+ A++ A+++FLS TRRYR+KKL GSPL Q+  V VAA +KR+LE PS
Sbjct  211   DEVSRGVGYGICSAAMLMAVIVFLSRTRRYRYKKLTGSPLIQVIQVIVAAIQKRKLEFPS  270

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSIST  1107
             D  LLY          +    K K+  + +FR+LD+A I       K G    N W +ST
Sbjct  271   DLSLLY----------EDSSAKSKICRTDQFRWLDKATIRSDGDLGKNGSETPNPWRLST  320

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T VEE+K +IR+LP WATTI+FW VHAQ++TFSV QAA+MDR + K F VPAAS +VF+
Sbjct  321   VTRVEELKMMIRLLPIWATTIIFWCVHAQVITFSVQQAASMDRSIGK-FHVPAASFSVFF  379

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             +G  ++T+ +YDR+++   R      +GL+ LQ+I +GLA+SV+ M  AA +E KRLKV 
Sbjct  380   IGATMITLALYDRMVMKKSR----GSRGLTNLQKIGLGLAISVIAMAVAAAMEQKRLKVI  435

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             R++  T  P +T+P++ F L  Q+ IVG  EA  Y GQL FF+ E PKGMK +S  LFL+
Sbjct  436   RANRNT--PTSTLPLTAFILIPQFAIVGIAEAFMYSGQLAFFISEAPKGMKAISNSLFLT  493

Query  566   TVALGLFFSSVLVTIVGKVTGEKK---PWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T++ G F +++LV ++ K+T  K     WLA  +N  +L  FY L++V+S +NL  +L C
Sbjct  494   TISFGYFVTTILVDLIKKITPGKDGGHGWLAPKINDSRLDYFYALISVLSFINLGLYLVC  553

Query  395   SRGY  384
             +R Y
Sbjct  554   ARWY  557



>ref|XP_002282012.3| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Vitis vinifera]
Length=587

 Score =   474 bits (1219),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 270/544 (50%), Positives = 371/544 (68%), Gaps = 28/544 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA ILG+E  ER TT+GI +NLVTYL +TMH  +A ++ +V NF G SF+L LLGG VA
Sbjct  33    SAATILGIEVSERFTTMGIAVNLVTYLDNTMHQPSATSSTIVANFSGVSFLLCLLGGCVA  92

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESG-SCVPASggqlgvlyla  1626
             D+FLGRY TI IF  ++A G  +L IS  +  L+PP C+P     CV A+  Q+GV +L 
Sbjct  93    DSFLGRYWTIAIFAVIEALGACVLAISATLSHLRPPPCNPSVAIKCVKANNLQMGVFFLG  152

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             L+  ALG GG+KSSVS LGTDQFD +D++E+ QM  FF+ F F IN+G++LAVT+LVYIQ
Sbjct  153   LFAMALGIGGVKSSVSALGTDQFDQTDEKEKTQMEYFFNRFYFLINIGTILAVTLLVYIQ  212

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D + R  GYG+C+ A++ A+++FLS TRRYR+KKL GSPL Q+  V VAA +KR+LE PS
Sbjct  213   DEVSRGVGYGICSAAMLMAVIVFLSRTRRYRYKKLTGSPLIQVIQVIVAAIQKRKLEFPS  272

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEGVSEVNKWSIST  1107
             D  LLY          +    K K+  + +FR+LD+A I       K G    N W +ST
Sbjct  273   DLSLLY----------EDSSAKSKICRTDQFRWLDKATIRSDGDLGKNGSETPNPWRLST  322

Query  1106  LTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFY  927
             +T VEE+K +IR+LP WATTI+FW VHAQ++TFSV QAA+MDR + K F VPAAS +VF+
Sbjct  323   VTRVEELKMMIRLLPIWATTIIFWCVHAQVITFSVQQAASMDRSIGK-FHVPAASFSVFF  381

Query  926   VGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVA  747
             +G  ++T+ +YDR+++   R      +GL+ LQ+I +GLA+SV+ M  AA +E KRLKV 
Sbjct  382   IGATMITLALYDRMVMKKSR----GSRGLTNLQKIGLGLAISVIAMAVAAAMEQKRLKVI  437

Query  746   RSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLS  567
             R++  T  P +T+P++ F L  Q+ IVG  EA  Y GQL FF+ E PKGMK +S  LFL+
Sbjct  438   RANRNT--PTSTLPLTAFILIPQFAIVGIAEAFMYSGQLAFFISEAPKGMKAISNSLFLT  495

Query  566   TVALGLFFSSVLVTIVGKVTGEKK---PWLADHLNQGKLYDFYWLLAVMSALNLMAFLFC  396
             T++ G F +++LV ++ K+T  K     WLA  +N  +L  FY L++V+S +NL  +L C
Sbjct  496   TISFGYFVTTILVDLIKKITPGKDGGHGWLAPKINDSRLDYFYALISVLSFINLGLYLVC  555

Query  395   SRGY  384
             +R Y
Sbjct  556   ARWY  559



>gb|EYU29790.1| hypothetical protein MIMGU_mgv1a003653mg [Erythranthe guttata]
Length=571

 Score =   473 bits (1217),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 284/554 (51%), Positives = 389/554 (70%), Gaps = 24/554 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL   MHL ++ +AN+VT+F+G  F+L LLGGF+AD
Sbjct  31    AALILGIEICERLSTMGIAVNLVTYLGGVMHLPSSTSANIVTDFMGTCFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI +F  VQ  G  +L   T +P L+PP C     +C  A+G Q+ +LYLALY
Sbjct  91    SFLGRYKTIAVFALVQTLGTGMLATITALPELRPPPCHTRDINCKEANGFQIAILYLALY  150

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFD+ D++E+ QM  FF+ F FFI++G+L AVTVLVYIQD 
Sbjct  151   LIALGTGGLKSSVSGFGTDQFDEKDEKEKAQMAYFFNRFFFFISIGTLTAVTVLVYIQDE  210

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR   YG+C+ +++ A+++FLSGT++YR+KK  GSP+  I  V  AA RKR + LP   
Sbjct  211   VGRSLAYGICSASMLIAILIFLSGTKKYRYKKSSGSPIVHIFQVIAAAIRKRNMSLP---  267

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI------KEGVSEVNKWSISTLTD  1098
                YN+D +     D+     ++ H+ +F FLD+AAI      KE     N W + ++T 
Sbjct  268   ---YNIDMLYEDTPDES----RIRHTDQFNFLDKAAIVAEGDLKENTKGPNPWKLRSVTR  320

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK + R+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V  
Sbjct  321   VEEVKMMGRLLPIWATTIIFWTTYAQMITFSVEQASTMNRRIG-NFQIPAGSLTVFFVAA  379

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARS-  741
             IL+T+ +YDRI++P++ +      G S LQ+IA+GL LS +GM  AALVE+KRL VA+S 
Sbjct  380   ILITLAVYDRIIMPLWNK-WKGKTGFSSLQKIAIGLVLSTLGMAVAALVEMKRLSVAKSV  438

Query  740   -HGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
              +  TAD    VP+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  439   NNNTTADDH--VPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  496

Query  563   VALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV++V KVT     + WLAD++N G+L  FY LLAV+  +NL+ +L C+ 
Sbjct  497   LSLGFFVSSFLVSVVKKVTTSNGGQGWLADNINHGRLDCFYGLLAVLGFVNLIIYLICAA  556

Query  389   GYVYKEKRLAEMGI  348
              Y   + +  + GI
Sbjct  557   WYKPHKPKPLQPGI  570



>ref|XP_010049997.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Eucalyptus grandis]
Length=580

 Score =   473 bits (1218),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 290/539 (54%), Positives = 387/539 (72%), Gaps = 26/539 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEICERLSTMGIAVNLVTYLGGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IFT +Q  G   L +S  +P L+PP C P+   C  A G Q+G+LYLALY
Sbjct  91    SFLGRYRTIAIFTLIQTLGTATLALSAKLPRLRPPPCLPDR-PCEQADGLQMGILYLALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFDD D++E+ QM  FF+ F  FI++G+L AVTVLVY+QD 
Sbjct  150   LVALGTGGLKSSVSGFGTDQFDDKDEKEKAQMAYFFNRFFLFISMGTLTAVTVLVYVQDE  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR   YG C+ A++ A+++FLSGTRRYR+KK +GSP+ QI  V  A+ +KR LE+P D 
Sbjct  210   VGRSISYGACSVAMLIAILVFLSGTRRYRYKKCLGSPIVQIMQVVAASIKKRSLEVPYDV  269

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEG-VSEVNKWSISTL  1104
               LY  +D     G + H      H+ +F+ LD+AAI       K+G  S  N W + +L
Sbjct  270   GCLY--ED--GPEGSRIH------HTDQFQCLDKAAIVAEGDFMKDGHNSAPNPWKLCSL  319

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK +IR+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  320   TRVEEVKMMIRLLPVWATTIIFWTTYAQMITFSVEQASTMERSIG-TFQIPAGSLTVFFV  378

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               I++T+ +YDR ++P +++    P G S LQRIA+GL LS +GM AAA+ E KRL VA 
Sbjct  379   AAIMITLAVYDRFIMPFWKKWKGKP-GFSNLQRIAIGLVLSTLGMAAAAITERKRLSVAA  437

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S G T     T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  438   SVGRT---TTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  494

Query  563   VALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             ++LG F SS LV+IV K TG    + WLAD++N G+L  FY LL ++S +N +A+L C+
Sbjct  495   LSLGFFVSSFLVSIVKKATGTGAGQGWLADNINYGRLDCFYGLLTLLSLVNFVAYLVCA  553



>gb|KCW82843.1| hypothetical protein EUGRSUZ_C04214 [Eucalyptus grandis]
Length=576

 Score =   473 bits (1216),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 290/539 (54%), Positives = 387/539 (72%), Gaps = 26/539 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  27    AALILGIEICERLSTMGIAVNLVTYLGGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IFT +Q  G   L +S  +P L+PP C P+   C  A G Q+G+LYLALY
Sbjct  87    SFLGRYRTIAIFTLIQTLGTATLALSAKLPRLRPPPCLPDR-PCEQADGLQMGILYLALY  145

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFDD D++E+ QM  FF+ F  FI++G+L AVTVLVY+QD 
Sbjct  146   LVALGTGGLKSSVSGFGTDQFDDKDEKEKAQMAYFFNRFFLFISMGTLTAVTVLVYVQDE  205

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR   YG C+ A++ A+++FLSGTRRYR+KK +GSP+ QI  V  A+ +KR LE+P D 
Sbjct  206   VGRSISYGACSVAMLIAILVFLSGTRRYRYKKCLGSPIVQIMQVVAASIKKRSLEVPYDV  265

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-------KEG-VSEVNKWSISTL  1104
               LY  +D     G + H      H+ +F+ LD+AAI       K+G  S  N W + +L
Sbjct  266   GCLY--ED--GPEGSRIH------HTDQFQCLDKAAIVAEGDFMKDGHNSAPNPWKLCSL  315

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK +IR+LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  316   TRVEEVKMMIRLLPVWATTIIFWTTYAQMITFSVEQASTMERSIG-TFQIPAGSLTVFFV  374

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               I++T+ +YDR ++P +++    P G S LQRIA+GL LS +GM AAA+ E KRL VA 
Sbjct  375   AAIMITLAVYDRFIMPFWKKWKGKP-GFSNLQRIAIGLVLSTLGMAAAAITERKRLSVAA  433

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S G T     T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  434   SVGRT---TTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  490

Query  563   VALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             ++LG F SS LV+IV K TG    + WLAD++N G+L  FY LL ++S +N +A+L C+
Sbjct  491   LSLGFFVSSFLVSIVKKATGTGAGQGWLADNINYGRLDCFYGLLTLLSLVNFVAYLVCA  549



>ref|XP_010049998.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Eucalyptus 
grandis]
Length=580

 Score =   472 bits (1215),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 290/548 (53%), Positives = 390/548 (71%), Gaps = 26/548 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E CERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEVCERLSTMGIAVNLVTYLGGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI IFT VQ  G  +L IST +P L+PP C P +  C  A G Q+G+LYLALY
Sbjct  91    SFLGRYRTIAIFTLVQTLGTALLAISTKLPRLRPPPCQP-TLPCNQADGFQMGILYLALY  149

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG GTDQFDD DK+E+ QM  FF+ F FFI+VG+L AVTVLVY+QD 
Sbjct  150   LVALGTGGLKSSVSGFGTDQFDDKDKKEKAQMAYFFNRFFFFISVGTLTAVTVLVYVQDQ  209

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             + R   YG C+ A++ AL++FL+GTRRYR+KK  GSP+ QI  V  A+ +KR LE+P D 
Sbjct  210   VSRSIAYGTCSVAMLTALLVFLAGTRRYRYKKSTGSPIVQILQVVAASIKKRSLEVPYDV  269

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAA-IKEG-------VSEVNKWSISTL  1104
               LY         G + H      H+ +FR LD+AA + EG        S  N W + ++
Sbjct  270   GYLYE----NGPEGSRIH------HTDQFRCLDKAAVVAEGDFVQGGHNSAPNPWKLCSV  319

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FW  +AQ++TFSV QA+TM+R +  SF++PA S+ VF+V
Sbjct  320   TRVEEVKMMVRLLPIWATTIIFWRAYAQMITFSVEQASTMERSIG-SFQIPAGSLTVFFV  378

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               I++T+ + DR ++P++++    P G S LQRIA+GLALS +GM+AAA+ E KRL VA 
Sbjct  379   VAIMITLAVNDRFIMPLWKKWTGKP-GFSSLQRIAIGLALSTLGMLAAAITERKRLSVAA  437

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S G       T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  438   SVG---RATTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  494

Query  563   VALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS+LV++V K TG   ++ WLADH+N G+L  F+ LL ++S +N + +L C+ 
Sbjct  495   LSLGFFLSSLLVSVVKKATGSGGRQGWLADHINYGRLDWFFGLLTILSLVNFVVYLVCAA  554

Query  389   GYVYKEKR  366
              Y  ++ +
Sbjct  555   WYKPQKPK  562



>ref|XP_004243154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
 ref|XP_010323568.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=569

 Score =   471 bits (1211),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 282/549 (51%), Positives = 391/549 (71%), Gaps = 27/549 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             A +ILG+E  ERL+T+GI +NLVTYL  TMHL ++ +AN+VT+F+G SF+L LLGGF+AD
Sbjct  24    ATLILGIEIVERLSTMGIAVNLVTYLGGTMHLASSNSANIVTDFMGTSFLLCLLGGFLAD  83

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TI +F  +Q  G  +LT++T +P L+PP C+    +C PA+G Q+G+LYLALY
Sbjct  84    SFLGRYKTIALFALIQTLGTGMLTVATTLPQLRPPPCNL---NCQPANGFQMGILYLALY  140

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVS  GTDQFD+ D +E+ QM  FF+ F FFI++G+L AVTVLVYIQD 
Sbjct  141   LIALGTGGLKSSVSVFGTDQFDEKDDKEKAQMTYFFNRFFFFISLGTLTAVTVLVYIQDE  200

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             +GR W YG+C+ ++  A+++FL G++RYR+KK  GSP+  I  V VAA RKR+L+LP D 
Sbjct  201   VGRIWAYGVCSLSMFIAIIIFLLGSKRYRYKKSAGSPIVHIFQVIVAAIRKRKLDLPYDA  260

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEG-------VSEVNKWSISTL  1104
              +LY       A+        ++ H++EFR LD+AAI  EG        S  N W +S++
Sbjct  261   AMLYESTSTPEAS--------RIQHTQEFRILDKAAIVTEGDFEEHASCSAPNPWKLSSV  312

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK + ++LP WATTI+FWT +AQ++TFSV QA+TM+R +  +F++PA S+ VF+V
Sbjct  313   TRVEEVKMMAKLLPIWATTIIFWTTYAQMITFSVEQASTMERTIG-NFQIPAGSLTVFFV  371

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDRI++P++++    P G + LQRIA+GL LSV+GM AAAL E KRL VA+
Sbjct  372   AAILITLALYDRIIMPLWKKWKGKP-GFTNLQRIAIGLVLSVIGMAAAALAEQKRLTVAK  430

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S G      +T+P+SVF L  Q+  VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T
Sbjct  431   SAGRN---TSTLPISVFLLIPQFFFVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTT  487

Query  563   VALGLFFSSVLVTIVGKVT---GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             ++LG F SS LV+++ K T      + WLAD++N G+L  FYWLLA +  +N   +L  +
Sbjct  488   LSLGFFISSFLVSVIKKATKTNATAQGWLADNINYGRLDLFYWLLAALGVINFAIYLNSA  547

Query  392   RGYVYKEKR  366
               Y  ++ +
Sbjct  548   TWYKPRKPK  556



>gb|KHN47160.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   469 bits (1207),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 280/564 (50%), Positives = 402/564 (71%), Gaps = 23/564 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTY+   MHL ++ AAN VT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEIVERLSTMGIAVNLVTYMISIMHLPSSTAANTVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TIGIF ++Q  G   L IST +P L+PP C   S SC  A+G Q+G+LYL+LY
Sbjct  91    SFLGRYKTIGIFASIQTLGTATLAISTKLPGLRPPPCHANSDSCKQANGFQMGILYLSLY  150

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG G+DQFD+ D++E+ QM  FF+ F FFI+ G+L AVTVLVY+QD 
Sbjct  151   LIALGTGGLKSSVSGFGSDQFDEKDEKEKSQMAYFFNRFFFFISFGTLAAVTVLVYLQDE  210

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             + R   YG+C+ +++ A+++FLSGT+RYR+K+ +GSP+  I  V  A+ +KR+++LP + 
Sbjct  211   VSRSLAYGICSVSMIIAIIVFLSGTKRYRYKRSLGSPIVHIFQVIAASIKKRKMQLPYNV  270

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEV-------NKWSISTL  1104
               LY  +D   A+        ++ H+++FRFL++AAI  E   E        N W + +L
Sbjct  271   GSLY--EDTPEAS--------RIEHTEQFRFLEKAAIVAEDDFETNLCGSGPNPWKLCSL  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT++AQ++TFSV QA+TM+R++  SF++PA S+ VF+V
Sbjct  321   TRVEEVKMMVRLLPVWATTIIFWTIYAQMITFSVEQASTMERNIG-SFQIPAGSLTVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P++++  N   G + LQRIA+GL  S+ GM AA++ E KRL  A+
Sbjct  380   AAILITLAVYDRLIMPLWKK-WNGKPGFTDLQRIAIGLVFSIFGMAAASVCERKRLSAAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S     + A T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+   PKGMKTMSTGLFL+T
Sbjct  439   SVS-GGNQATTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTT  497

Query  563   VALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG F SS LV++V KVTG +  + WLAD++N+G+L  FY LL ++S +N +AF  C+ 
Sbjct  498   LSLGFFISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFYALLTILSFINFVAFAVCAL  557

Query  389   GYVYKEKRLAEMGIELEEETHIPG  318
              +  K+ +   M +  ++   + G
Sbjct  558   WFKPKKPKQPAMQMGPQQRKSVEG  581



>ref|XP_006361731.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=599

 Score =   469 bits (1207),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 267/548 (49%), Positives = 384/548 (70%), Gaps = 28/548 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S A+I+G+E  ERL+T+GI +NLVTYL  TMHL +A +A +V++F+G SF+L LLGG +A
Sbjct  29    SNALIVGIEVSERLSTMGIAVNLVTYLIGTMHLPSATSAKIVSDFMGTSFLLCLLGGVIA  88

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC----SPESGSCVPASggqlgvl  1635
             D+FLGRY TI IF  +Q  G  +L+IST +P LQP  C    S +S +C  A+  Q+ VL
Sbjct  89    DSFLGRYRTIAIFAIIQTLGTGMLSISTRLPQLQPTPCNVHYSLKSTNCEQATTSQMSVL  148

Query  1634  ylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLV  1455
             Y++LYL ALG GGLKSSVSG  TDQFD++D++E+ Q+  FF+WF FFI +G+LLAVTVLV
Sbjct  149   YISLYLMALGIGGLKSSVSGFCTDQFDETDEKEKAQLTLFFNWFFFFITIGTLLAVTVLV  208

Query  1454  YIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLE  1275
             YIQD +GR WGYG+C+ +++ A+++FLSGT+RYR+KK + SP+ QI  V +AA RKRRL+
Sbjct  209   YIQDEVGRSWGYGICSFSMLVAVIMFLSGTKRYRYKKTMKSPIAQIIQVLIAAIRKRRLQ  268

Query  1274  LPSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-----KEGVSEV--NKWS  1116
             LP +   LY          +      ++ H+ +FR LD+AAI      E +S +  N W 
Sbjct  269   LPKNDCFLY----------ENNSDSSRISHTDQFRILDKAAILTKEDYECISSLAQNPWR  318

Query  1115  ISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMA  936
             IS++T VEEVK +IR+LP W TTI+FWT +AQL+TFSV QA+TM+R +  +F +PAAS+ 
Sbjct  319   ISSVTKVEEVKMIIRLLPIWTTTILFWTAYAQLVTFSVEQASTMERSIG-NFRIPAASLT  377

Query  935   VFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRL  756
              F+V  IL+++  YDR++VP F +      G + LQ+I +GL LS +GM  A+++E+KRL
Sbjct  378   AFFVSAILISLATYDRLIVP-FVKKWTTKSGFTSLQKIGIGLFLSCLGMGVASIIEVKRL  436

Query  755   KVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGL  576
              +A+++  T++    +P+SVF L  Q+ +VG+G    Y GQLD F+ + PKGMKTMSTGL
Sbjct  437   SIAKANEETSN---NLPISVFLLIPQFFLVGAGVGFMYTGQLDLFITQSPKGMKTMSTGL  493

Query  575   FLSTVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFL  402
             FL+T+ALG FFSS+L++IV KVT       W+ + +N+ +L  FY LLA++  ++   ++
Sbjct  494   FLTTMALGFFFSSLLISIVKKVTTTNINNGWVGESINKSRLDCFYGLLAILIFIDFGFYV  553

Query  401   FCSRGYVY  378
              C+  Y +
Sbjct  554   LCASWYFW  561



>ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Glycine max]
Length=585

 Score =   468 bits (1205),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 280/548 (51%), Positives = 394/548 (72%), Gaps = 22/548 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTY+   MHL ++ AAN VT+F+G SF+L LLGGF+AD
Sbjct  31    AALILGIEIVERLSTMGIAVNLVTYMISIMHLPSSTAANTVTDFMGTSFLLCLLGGFLAD  90

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TIGIF ++Q  G   L IST +P L+PP C   S SC  A+G Q+G+LYL+LY
Sbjct  91    SFLGRYKTIGIFASIQTLGTATLAISTKLPGLRPPPCHANSDSCKQANGFQMGILYLSLY  150

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG G+DQFD+ D++E+ QM  FF+ F FFI+ G+L AVTVLVY+QD 
Sbjct  151   LIALGTGGLKSSVSGFGSDQFDEKDEKEKSQMAYFFNRFFFFISFGTLAAVTVLVYLQDE  210

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             + R   YG+C+ +++ A+++FLSGT+RYR+K+ +GSP+  I  V  A+ +KR+++LP + 
Sbjct  211   VSRSLAYGICSVSMIIAIIVFLSGTKRYRYKRSLGSPIVHIFQVIAASIKKRKMQLPYNV  270

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEVN-------KWSISTL  1104
               LY  +D   A+        ++ H+++FRFL++AAI  E   E N        W + +L
Sbjct  271   GSLY--EDTPEAS--------RIEHTEQFRFLEKAAIVAEDDFETNLCGSGPNPWKLCSL  320

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT++AQL+TFSV QA+TM+R++  SF++PA S+ VF+V
Sbjct  321   TRVEEVKMMVRLLPVWATTIIFWTIYAQLITFSVEQASTMERNIG-SFQIPAGSVTVFFV  379

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P++++  N   G + LQRIA+GL  S+ GM AA++ E KRL VA+
Sbjct  380   AAILITLAVYDRLIMPLWKK-WNGKPGFTDLQRIAIGLVFSIFGMAAASVCERKRLSVAK  438

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+   PKGMKTMSTGLFL+T
Sbjct  439   SVSGGNQATTTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTT  498

Query  563   VALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG FFSS LV++V KVTG +  + WLAD +N+G+L  FY LL ++S +N  AF  C+ 
Sbjct  499   LSLGFFFSSFLVSVVKKVTGTRDGQGWLADSINKGRLDLFYALLTILSFVNFAAFAVCAV  558

Query  389   GYVYKEKR  366
              +  K+ +
Sbjct  559   WFKPKKPK  566



>ref|XP_006408723.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 gb|ESQ50176.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=533

 Score =   466 bits (1199),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 272/544 (50%), Positives = 381/544 (70%), Gaps = 31/544 (6%)
 Frame = -3

Query  1934  LGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVADTFLGRYLTIGIFTTV  1755
             +GI +NLVTYL  TMHL ++ +ANVVT+F+G SF+L LLGGF+AD+FLGR+ TI IF+T+
Sbjct  1     MGIAVNLVTYLMGTMHLPSSTSANVVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTI  60

Query  1754  QAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylalyltalgtggLKSSVSG  1575
             QA G   L ++T +P L+PP C      C PA+  Q+ +LY+ALYL ALGTGGLKSS+SG
Sbjct  61    QALGTGALAVATKLPELRPPVCH-HGEVCTPATAFQMTILYIALYLIALGTGGLKSSISG  119

Query  1574  LGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDNLGRRWGYGLCACAIV  1395
              G+DQF+D D +E+ QM  FF+ F FFI++G+L+AVTVLVYIQD +GR W YG+C  ++ 
Sbjct  120   FGSDQFNDKDPKEKAQMAYFFNRFFFFISMGTLMAVTVLVYIQDEVGRSWAYGICTVSMA  179

Query  1394  GALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDPELLYNVDDVVAAAGD  1215
              A+ +FLSGT+RYR+KK  GSP+ QI  V  AA+RKR++ELP     LY          +
Sbjct  180   IAIAVFLSGTKRYRYKKSQGSPVVQILQVIAAAFRKRKMELPQSTVYLY----------E  229

Query  1214  QEHKKIKMPHSKEFRFLDRAAIK---------EGVSEVNKWSISTLTDVEEVKQLIRMLP  1062
                + +++ H+ +F  LD+AAI          +G++  N W +S++T VEEVK +IR+LP
Sbjct  230   DNPEGMRIEHTDQFHMLDKAAIVREEDFDQTIDGIAIPNPWKLSSVTKVEEVKMMIRLLP  289

Query  1061  TWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILVTIMMYDRIM  882
              WATTI+FWT +AQ++TFSV QA TM R++  +F +PA S+ VF+V  IL+++ +YDR +
Sbjct  290   IWATTIIFWTTYAQMITFSVEQATTMRRNVG-NFTIPAGSLTVFFVAAILISLAVYDRAI  348

Query  881   VPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLTADPAATVPM  702
             +P++++    P G S LQRIA+GL LS  GM AAALVE KRL VA+S         T+P+
Sbjct  349   MPLWKKWKGKP-GFSSLQRIAIGLVLSTAGMAAAALVEQKRLSVAKS-----STHKTMPI  402

Query  701   SVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGLFFSSVLVTI  522
             SVF L  Q+ +VG+GEA  Y GQLDFF+ + PKGMKTMSTGLFL+T++LG F SS LV++
Sbjct  403   SVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSV  462

Query  521   VGKVTGEKKP--WLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYKEKRLAEMGI  348
             V +VT       WLAD++NQG+L  FYWLL ++S +N + ++ C+    +K  +  E  +
Sbjct  463   VKRVTATSMDGGWLADNINQGRLDRFYWLLVILSGINFVVYVICA--LWFKPTKGKEDSV  520

Query  347   ELEE  336
             E+E+
Sbjct  521   EMEK  524



>ref|XP_002993534.1| hypothetical protein SELMODRAFT_137176 [Selaginella moellendorffii]
 gb|EFJ05426.1| hypothetical protein SELMODRAFT_137176 [Selaginella moellendorffii]
Length=586

 Score =   468 bits (1204),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 254/541 (47%), Positives = 362/541 (67%), Gaps = 14/541 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +A +I G+E CER+ +LG+  NLVTY  + MH+    AAN+V+NF+G  ++   +GGF+A
Sbjct  40    AAPLIFGMELCERMASLGLQRNLVTYFVNEMHIAIPKAANMVSNFVGTLYLTPFIGGFLA  99

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlyla  1626
             D +LGR+LTI +F +VQ AG+ +LTIS ++PSL+PPKCS P    C  A G Q+ VL+  
Sbjct  100   DAYLGRFLTINLFASVQLAGMVLLTISAVLPSLRPPKCSDPSQVICPRAHGSQIAVLFTG  159

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALG GG+K +VS +G DQFD+ D  E   M  FF+WF F I+VGSL+++TV VY+Q
Sbjct  160   LYLVALGNGGIKPNVSSMGADQFDEGDPHESKHMSSFFNWFYFIISVGSLISITVFVYLQ  219

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+G  WG+G+ +  +VGA+V+F  G   YR+K   GS LT+IA V VAA  K+    P+
Sbjct  220   DNVGFGWGFGIPSGLLVGAIVVFCLGAPLYRYKPPSGSSLTRIAQVIVAALTKKNAAYPA  279

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEVNKWSISTLTDVEE  1089
             D   LY          + E    K+ HS +FRFLDRAAI + G+ E + W + T+T VEE
Sbjct  280   DAGELY----------EDEKPDQKIEHSNQFRFLDRAAILRPGMYEKSPWHLCTVTQVEE  329

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VK ++R+LP WATT   WT  AQ+ TFSV Q ATM R +   F  P ASM+VF +  +L+
Sbjct  330   VKMVLRLLPIWATTAFVWTALAQMETFSVEQGATMQRRLGPRFVFPPASMSVFELINVLL  389

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
              + +YD+  VP  R+   + QG++ LQRI +G+  S++ M++AALVE +R+  AR +G  
Sbjct  390   FLPLYDKFFVPFARKFTGHEQGITALQRIGIGILASILSMVSAALVEARRIDTARKYGFL  449

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
               P A +P+++FWL  QY + G+ E  T VGQL+FF +E P+ M++  T L+LST+A+G 
Sbjct  450   DKPKAVLPITIFWLIPQYFLRGTTEIFTQVGQLEFFYKESPRHMRSFGTALYLSTIAVGH  509

Query  548   FFSSVLVTIVGKVT--GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             F S+ +VTIV +VT  G++  WL ++LN+ KL +FYWLLA MS++N + +L CS+ Y YK
Sbjct  510   FLSTAVVTIVNRVTSHGDQPGWLTNNLNRSKLSNFYWLLAAMSSVNFLFYLACSKWYKYK  569

Query  374   E  372
             E
Sbjct  570   E  570



>gb|AFW80908.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=587

 Score =   468 bits (1204),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 289/564 (51%), Positives = 384/564 (68%), Gaps = 35/564 (6%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA+ +G+E CERL+T+GI +NLVTYLT TMHL +A AANVVT+F+G SF+L LLGGF+A
Sbjct  39    SAALAVGIELCERLSTMGIAVNLVTYLTATMHLPSAAAANVVTDFMGTSFLLCLLGGFLA  98

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             D+FLGRYLTI IF  VQA G  +L +ST +  L+PP C P  +G C  A+G Q+GVLY+ 
Sbjct  99    DSFLGRYLTIAIFAVVQAIGTGLLAVSTEVRQLRPPPCGPGAAGPCEQATGLQMGVLYVC  158

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALGTGGLKSSVSG GTDQFD+ D RER  M  FF  F FF+  G+LLAVTVLVY+Q
Sbjct  159   LYLIALGTGGLKSSVSGFGTDQFDERDARERAAMGLFFDRFFFFVTFGTLLAVTVLVYVQ  218

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR   YG+CA A++ A+ +FLSGTRRYR+K+  GSP+  I  V VAA RKR + +  
Sbjct  219   DHVGRSCAYGICAGAMLVAVAVFLSGTRRYRYKRSSGSPIVHILQVLVAATRKRNIVM--  276

Query  1265  DPELLYNVDDVVAAAGDQEH-KKIKMPHSKEFRFLDRAAI----------KEGVSEVNKW  1119
                       + AAA  ++H +  ++PH+ +F  LDRAA+           +G   +N W
Sbjct  277   --------QPLTAAALYEDHPEHARIPHTAQFPCLDRAAVMAGDDDNEVGHDGRPTMNPW  328

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR M   FE+PAAS+
Sbjct  329   KLRSVSRVEEVKMVARLMPVWATTILFWTMYAQMITFSVEQATTMDRRMG-GFEIPAASL  387

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+VG I++T+  YDR+ VP+ R ++   QG + L++I +GL LS  GM AAA+ E KR
Sbjct  388   TVFFVGAIMLTLAFYDRVFVPLCRSLMTGRQGFTNLEKIGIGLVLSTFGMAAAAICEKKR  447

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L VA +    A    ++P+SVF L  Q+L+VGSGEA  Y GQLDFF+   PK MKTMSTG
Sbjct  448   LAVAATS--VAVGHGSLPISVFMLTPQFLLVGSGEAFIYTGQLDFFIMRSPKSMKTMSTG  505

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LFL+T++LG F SS LV++V   T     WL D +N  +L  FYWLLAV+  +NL+A++ 
Sbjct  506   LFLTTLSLGFFLSSALVSLVKSCT----RWLGDTINHSRLDYFYWLLAVLGVVNLVAYI-  560

Query  398   CSRGYVYKEKRLAEMGIELEEETH  327
                  VY     A    + E+  H
Sbjct  561   -----VYAMWAAAPASSQAEQPQH  579



>ref|NP_001169613.1| uncharacterized protein LOC100383494 [Zea mays]
 gb|ACN34269.1| unknown [Zea mays]
 gb|AFW80907.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=591

 Score =   468 bits (1204),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 289/564 (51%), Positives = 384/564 (68%), Gaps = 35/564 (6%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA+ +G+E CERL+T+GI +NLVTYLT TMHL +A AANVVT+F+G SF+L LLGGF+A
Sbjct  43    SAALAVGIELCERLSTMGIAVNLVTYLTATMHLPSAAAANVVTDFMGTSFLLCLLGGFLA  102

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSP-ESGSCVPASggqlgvlyla  1626
             D+FLGRYLTI IF  VQA G  +L +ST +  L+PP C P  +G C  A+G Q+GVLY+ 
Sbjct  103   DSFLGRYLTIAIFAVVQAIGTGLLAVSTEVRQLRPPPCGPGAAGPCEQATGLQMGVLYVC  162

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALGTGGLKSSVSG GTDQFD+ D RER  M  FF  F FF+  G+LLAVTVLVY+Q
Sbjct  163   LYLIALGTGGLKSSVSGFGTDQFDERDARERAAMGLFFDRFFFFVTFGTLLAVTVLVYVQ  222

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D++GR   YG+CA A++ A+ +FLSGTRRYR+K+  GSP+  I  V VAA RKR + +  
Sbjct  223   DHVGRSCAYGICAGAMLVAVAVFLSGTRRYRYKRSSGSPIVHILQVLVAATRKRNIVM--  280

Query  1265  DPELLYNVDDVVAAAGDQEH-KKIKMPHSKEFRFLDRAAI----------KEGVSEVNKW  1119
                       + AAA  ++H +  ++PH+ +F  LDRAA+           +G   +N W
Sbjct  281   --------QPLTAAALYEDHPEHARIPHTAQFPCLDRAAVMAGDDDNEVGHDGRPTMNPW  332

Query  1118  SISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASM  939
              + +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR M   FE+PAAS+
Sbjct  333   KLRSVSRVEEVKMVARLMPVWATTILFWTMYAQMITFSVEQATTMDRRMG-GFEIPAASL  391

Query  938   AVFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKR  759
              VF+VG I++T+  YDR+ VP+ R ++   QG + L++I +GL LS  GM AAA+ E KR
Sbjct  392   TVFFVGAIMLTLAFYDRVFVPLCRSLMTGRQGFTNLEKIGIGLVLSTFGMAAAAICEKKR  451

Query  758   LKVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTG  579
             L VA +    A    ++P+SVF L  Q+L+VGSGEA  Y GQLDFF+   PK MKTMSTG
Sbjct  452   LAVAATS--VAVGHGSLPISVFMLTPQFLLVGSGEAFIYTGQLDFFIMRSPKSMKTMSTG  509

Query  578   LFLSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLF  399
             LFL+T++LG F SS LV++V   T     WL D +N  +L  FYWLLAV+  +NL+A++ 
Sbjct  510   LFLTTLSLGFFLSSALVSLVKSCT----RWLGDTINHSRLDYFYWLLAVLGVVNLVAYI-  564

Query  398   CSRGYVYKEKRLAEMGIELEEETH  327
                  VY     A    + E+  H
Sbjct  565   -----VYAMWAAAPASSQAEQPQH  583



>ref|XP_002975508.1| hypothetical protein SELMODRAFT_103849 [Selaginella moellendorffii]
 gb|EFJ23137.1| hypothetical protein SELMODRAFT_103849 [Selaginella moellendorffii]
Length=586

 Score =   468 bits (1203),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 254/541 (47%), Positives = 361/541 (67%), Gaps = 14/541 (3%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +A +I G+E CER+ +LG+  NLVTY  + MH+    AAN+V+NF+G  ++   +GGF+A
Sbjct  40    AAPLIFGMELCERMASLGLQRNLVTYFVNEMHIAIPKAANMVSNFVGTLYLTPFIGGFLA  99

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCS-PESGSCVPASggqlgvlyla  1626
             D +LGR+LTI +F +VQ AG+ +LTIS ++PSL+PPKCS P    C  A G Q+ VL+  
Sbjct  100   DAYLGRFLTINLFASVQLAGMVLLTISAVLPSLRPPKCSDPSQVICPRAHGSQIAVLFTG  159

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             LYL ALG GG+K +VS +G DQFD+ D  E   M  FF+WF F I+VGSL+++TV VY+Q
Sbjct  160   LYLVALGNGGIKPNVSSMGADQFDEGDPHESKHMSSFFNWFYFIISVGSLISITVFVYLQ  219

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             DN+G  WG+G+ +  +VGA+V+F  G   YR+K   GS LT+IA V VAA  K+    P+
Sbjct  220   DNVGFGWGFGIPSGLLVGAIVVFCLGAPLYRYKPPSGSSLTRIAQVIVAALTKKNAAYPA  279

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEVNKWSISTLTDVEE  1089
             D   LY          + E    K+ HS +FRFLDRAAI + G+ E + W + T+T VEE
Sbjct  280   DAGELY----------EDEKPDQKIEHSNQFRFLDRAAILRPGMYEKSPWHLCTVTQVEE  329

Query  1088  VKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGGILV  909
             VK ++R+LP WATT   WT  AQ+ TFSV Q ATM R +   F  P ASM+VF +  +L+
Sbjct  330   VKMVLRLLPIWATTAFVWTALAQMETFSVEQGATMQRRLGPRFVFPPASMSVFELINVLL  389

Query  908   TIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSHGLT  729
              + +YD+  VP  R+   + QG++ LQRI +G+  S++ M++AALVE +R+  AR +G  
Sbjct  390   FLPLYDKFFVPFARKFTGHEQGITALQRIGIGILASILSMVSAALVEARRIDTARKYGFL  449

Query  728   ADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVALGL  549
               P A +P+++FWL  QY + G+ E  T VGQL+FF +E P+ M++  T L+LST+A+G 
Sbjct  450   DKPKAVLPITIFWLIPQYFLRGTTEIFTQVGQLEFFYKESPRHMRSFGTALYLSTIAVGH  509

Query  548   FFSSVLVTIVGKVT--GEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVYK  375
             F S+ +VTIV +VT  G+   WL ++LN+ KL +FYWLLA MS++N + +L CS+ Y YK
Sbjct  510   FLSTAVVTIVNRVTSHGDHPGWLTNNLNRSKLSNFYWLLAAMSSVNFLFYLACSKWYKYK  569

Query  374   E  372
             E
Sbjct  570   E  570



>gb|EYU29794.1| hypothetical protein MIMGU_mgv1a003534mg [Erythranthe guttata]
Length=579

 Score =   466 bits (1199),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 258/552 (47%), Positives = 377/552 (68%), Gaps = 27/552 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             SAA IL VE CERL+T+ I +NLVTYL  T+HL +A ++ VV+N+ G SF+L+L GG +A
Sbjct  32    SAASILSVELCERLSTMAIAVNLVTYLQGTLHLPSAESSAVVSNWGGISFLLSLFGGILA  91

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPE-SGSCVPASggqlgvlyla  1626
             D+FLGRY TI IF+TV   G  +L +ST+ P L+PP C+P  S +C+ A+G Q+ V Y++
Sbjct  92    DSFLGRYWTIAIFSTVHFLGSCLLALSTVFPKLRPPPCNPSLSNNCIQANGLQMAVFYIS  151

Query  1625  lyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQ  1446
             +Y  ALG GG+K SVSG GTDQFD  D +E+ QM  FF+ F FFI++G+L+AVTV +YIQ
Sbjct  152   IYTVALGLGGIKCSVSGFGTDQFDQKDDKEKAQMASFFNKFYFFISIGTLIAVTVFIYIQ  211

Query  1445  DNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPS  1266
             D + R WGYG C+  ++ ALVLFLSGT+RYR+K  +GSP+ QI  V V A +KR L   S
Sbjct  212   DKVSRVWGYGSCSVIMLLALVLFLSGTKRYRYKACLGSPIVQIFQVLVVAVKKRNLNYTS  271

Query  1265  DPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-----KEGVSEV---NKWSIS  1110
             + E LY          +   ++ ++P + +FR LD+AAI     K+ + E    N W + 
Sbjct  272   NVEQLY----------ETHPQESRIPRTCQFRSLDKAAIIDDGDKDTMIESGTPNPWRLC  321

Query  1109  TLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVF  930
             ++T VEEVK + R+LP W TTIMF+ +HAQ++T++V QA+TM R +  +F +PA S  VF
Sbjct  322   SVTKVEEVKMMARLLPIWTTTIMFYVIHAQMITYAVLQASTMKRSIG-TFNIPAGSFNVF  380

Query  929   YVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKV  750
             ++G IL+ + ++DR++VP+ ++      GL+  Q+I VGL +S++ M+ AA++E KRLKV
Sbjct  381   FIGSILLALGIHDRLIVPLLKKK-KGTLGLTKFQKIGVGLFISILSMVFAAIIETKRLKV  439

Query  749   ARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFL  570
             A+S   T+   + +P+S FWL  Q+++ G+ E   Y GQ+DFFL E PKGMK MST LFL
Sbjct  440   AKS---TSRAVSILPISAFWLVPQFVLAGAAEGFVYTGQIDFFLTESPKGMKAMSTSLFL  496

Query  569   STVALGLFFSSVLVTIVGKVTGE-KKPWLADHLNQ--GKLYDFYWLLAVMSALNLMAFLF  399
             +T++ G F SS L+ I+ K T      WL  +LN   GKL  FY L+A++SA+NL  +L+
Sbjct  497   TTISFGFFVSSALIAIIRKATQRGGHNWLPANLNNADGKLNYFYALVALLSAINLGFYLY  556

Query  398   CSRGYVYKEKRL  363
             C++ ++ K++++
Sbjct  557   CAKLFLRKKRQI  568



>ref|XP_004251535.1| PREDICTED: protein NRT1/ PTR FAMILY 6.4 [Solanum lycopersicum]
Length=592

 Score =   466 bits (1200),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 278/555 (50%), Positives = 375/555 (68%), Gaps = 29/555 (5%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             A +ILG E  ER+  +GI +NLVTYL   +HL ++ +AN+VTNF+G   +L LLGGF+AD
Sbjct  37    AGLILGTELSERICVMGISMNLVTYLVGDLHLPSSDSANIVTNFMGTLNLLALLGGFLAD  96

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPES-GSCVPASggqlgvlylal  1623
               LGRY TI IF  + A GVT+LT++T IPS++PP C   S G C+ ASG QL +LY AL
Sbjct  97    AKLGRYATIAIFGCIAAVGVTLLTLATSIPSMKPPVCDSRSKGHCIEASGQQLALLYAAL  156

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             Y  +LG GG+KSSVSG G+DQFD S+ +E   M+ FF+ F F I++GSL AVTVLVYIQD
Sbjct  157   YTISLGCGGIKSSVSGFGSDQFDSSNPKENKAMIYFFNRFYFCISLGSLFAVTVLVYIQD  216

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             N+GR WGYG+ A  +V A+ + L GT  YRFKK  GSPLT I  V + AWRKR++  PSD
Sbjct  217   NVGRGWGYGISAGTMVLAVAVLLCGTSLYRFKKPEGSPLTIIWRVLILAWRKRKISHPSD  276

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKE--GVSEVNK---WSISTLTD  1098
             P  L             E+   K+PH+K  R LD+AAI +   V++ N+   W +ST++ 
Sbjct  277   PGFL------------NEYHNAKVPHTKMLRCLDKAAIIDDYAVADENRISSWIVSTVSQ  324

Query  1097  VEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYVGG  918
             VEEVK +++++P W+T I+FWTV++Q+ TFS+ QA  M+R++ K F +PA S + F    
Sbjct  325   VEEVKMVLKLIPIWSTCILFWTVYSQMNTFSIEQATFMNRNVGK-FGIPAGSFSFFLFIS  383

Query  917   ILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVARSH  738
             IL+   + +R+ VPI RR+  N QGL+ LQR+ +GL LS+VGM+AAA+VE +R + A  H
Sbjct  384   ILLFTSLNERVTVPIARRITGNRQGLTSLQRVGIGLILSIVGMVAAAVVEKQRRENAIHH  443

Query  737   GLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLSTVA  558
                        +S FWL  Q+ IVG+GEA  YVGQL+FF+RE P+GMK+MSTGLFLST++
Sbjct  444   DYN--------ISAFWLVPQFFIVGAGEAFAYVGQLEFFIREAPEGMKSMSTGLFLSTLS  495

Query  557   LGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSRGYVY  378
             +G F SS+LV+IV KVT     WL ++LN GKL  FYW+LAV+  LN   FL  S  + Y
Sbjct  496   MGFFMSSLLVSIVHKVT--NGSWLKNNLNNGKLDYFYWMLAVLGVLNYFVFLVFSTRHQY  553

Query  377   KEKRLAEMGIELEEE  333
             K + L+    + EEE
Sbjct  554   KTQHLSTTLEDSEEE  568



>gb|KHN15097.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   466 bits (1198),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 279/548 (51%), Positives = 393/548 (72%), Gaps = 22/548 (4%)
 Frame = -3

Query  1979  AAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVAD  1800
             AA+ILG+E  ERL+T+GI +NLVTY+   MHL ++ AAN VT+F+G SF+L LLGGF+AD
Sbjct  27    AALILGIEIVERLSTMGIAVNLVTYMISIMHLPSSTAANTVTDFMGTSFLLCLLGGFLAD  86

Query  1799  TFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylaly  1620
             +FLGRY TIGIF ++Q  G   L IST +P L+PP C   S SC  A+G Q+G+LYL+LY
Sbjct  87    SFLGRYKTIGIFASIQTLGTATLAISTKLPGLRPPPCHANSDSCKQANGFQMGILYLSLY  146

Query  1619  ltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQDN  1440
             L ALGTGGLKSSVSG G+DQFD+ D++E+ QM  FF+ F FFI+ G+L AVTVLVY+QD 
Sbjct  147   LIALGTGGLKSSVSGFGSDQFDEKDEKEKSQMAYFFNRFFFFISFGTLAAVTVLVYLQDE  206

Query  1439  LGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSDP  1260
             + R   YG+C+ +++ A+++FLSGT+RYR+K+  GSP+  I  V  A+ +KR+++LP + 
Sbjct  207   VSRSLAYGICSVSMIIAIIVFLSGTKRYRYKRSFGSPIVHIFQVIAASIKKRKMQLPYNV  266

Query  1259  ELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI-KEGVSEVN-------KWSISTL  1104
               LY  +D   A+        ++ H+++F FL++AAI  E   E N        W + +L
Sbjct  267   GSLY--EDTPEAS--------RIEHTEQFGFLEKAAIVAEDDFETNLCGSGPNPWKLCSL  316

Query  1103  TDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAVFYV  924
             T VEEVK ++R+LP WATTI+FWT++AQL+TFSV QA+TM+R++  SF++PA S+ VF+V
Sbjct  317   TRVEEVKMMVRLLPVWATTIIFWTIYAQLITFSVEQASTMERNIG-SFQIPAGSLTVFFV  375

Query  923   GGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLKVAR  744
               IL+T+ +YDR+++P++++  N   G + LQRIA+GL  S+ GM AA++ E KRL VA+
Sbjct  376   AAILITLAVYDRLIMPLWKK-WNGKPGFTDLQRIAIGLVFSIFGMAAASVCERKRLSVAK  434

Query  743   SHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLFLST  564
             S         T+P+SVF L  Q+ +VGSGEA  Y GQLDFF+   PKGMKTMSTGLFL+T
Sbjct  435   SVSGGNQATTTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTT  494

Query  563   VALGLFFSSVLVTIVGKVTGEK--KPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCSR  390
             ++LG FFSS LV++V KVTG +  + WLAD +N+G+L  FY LL ++S +N +AF  C+ 
Sbjct  495   LSLGFFFSSFLVSVVKKVTGTRDGQGWLADSINKGRLDLFYALLTILSFVNFVAFAVCAV  554

Query  389   GYVYKEKR  366
              +  K+ +
Sbjct  555   WFKPKKPK  562



>ref|XP_004245323.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Solanum 
lycopersicum]
Length=564

 Score =   464 bits (1194),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 264/546 (48%), Positives = 380/546 (70%), Gaps = 27/546 (5%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             S A+I+G+E  ERL+T+GI +NLVTYL   MH+ +A +A +V++F+G SF+L LLGG +A
Sbjct  27    SNALIVGIEVSERLSTMGIAVNLVTYLIGRMHIPSATSAKIVSDFMGTSFLLCLLGGLIA  86

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKC----SPESGSCVPASggqlgvl  1635
             D+FLGRY TI IF  +Q  G  +L IS+++P LQP  C    S +S +C  A+  Q+ VL
Sbjct  87    DSFLGRYRTIAIFAIIQTLGTGMLAISSMLPQLQPTPCNIHYSLKSSNCEQATTSQMSVL  146

Query  1634  ylalyltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLV  1455
             Y++LYL ALGTGGLKSSVSG  TDQFD++++ E+ Q+  FF+WF FFI +G+LLAVTVLV
Sbjct  147   YISLYLMALGTGGLKSSVSGFCTDQFDETNEEEKAQLTLFFNWFFFFITLGTLLAVTVLV  206

Query  1454  YIQDNLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLE  1275
             YIQD +GR  GYG+C+ +++ A+++FLSGT+RYR+KK + SP+ QI  V +AA RKRRL+
Sbjct  207   YIQDEVGRSCGYGICSFSMLVAILMFLSGTKRYRYKKTMKSPIAQILHVLIAAIRKRRLQ  266

Query  1274  LPSDPELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAI--KEGVSEVNK-----WS  1116
             LP++   LY          +      ++ H+ +FR LD+AAI  KE    +N      W 
Sbjct  267   LPTNDSFLY----------EDNSNSSRISHTDQFRILDKAAIMTKEDYECINSLAENPWR  316

Query  1115  ISTLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMA  936
             IS++T VEEVK +IR+LP W T+I+FWT +AQL+TFSV QA+TMDR +   F +PAAS+ 
Sbjct  317   ISSVTKVEEVKMIIRLLPIWTTSILFWTAYAQLVTFSVEQASTMDRSIGD-FRIPAASLT  375

Query  935   VFYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRL  756
              F+V  IL+++  YDR+++P  +       GL+ LQ+I +GL LS +GM  A+++E+KRL
Sbjct  376   AFFVSAILISLATYDRLILPFLKIWTAKKSGLTSLQKIGIGLFLSCLGMGVASIIEVKRL  435

Query  755   KVARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGL  576
              +A+ +  T +   T+P+SVF L  Q+ +VG+G    Y GQLD F+ + PKGMKTMSTGL
Sbjct  436   SIAKENEETPN---TLPISVFLLIPQFFLVGAGVGFMYTGQLDLFITQSPKGMKTMSTGL  492

Query  575   FLSTVALGLFFSSVLVTIVGKVTGE--KKPWLADHLNQGKLYDFYWLLAVMSALNLMAFL  402
             FL+T+ALG FFSS+L++IV KVT       W+ + +N+G+L  FY LLA++  ++   ++
Sbjct  493   FLTTMALGFFFSSLLISIVKKVTTANINNGWVGESINKGRLDCFYGLLAILIFIDFGFYV  552

Query  401   FCSRGY  384
              C+  Y
Sbjct  553   LCASWY  558



>ref|XP_003566777.2| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brachypodium distachyon]
Length=627

 Score =   464 bits (1193),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 280/540 (52%), Positives = 376/540 (70%), Gaps = 33/540 (6%)
 Frame = -3

Query  1982  SAAMILGVEACERLTTLGIGINLVTYLTDTMHLGNAGAANVVTNFLGASFMLTLLGGFVA  1803
             +AA++LG+E CERL T+GI +NLVTYLTDTMHL +A +ANVVT+F+G SF+L LLGGF+A
Sbjct  88    AAALVLGIELCERLATMGIAVNLVTYLTDTMHLPSAESANVVTDFMGTSFLLCLLGGFLA  147

Query  1802  DTFLGRYLTIGIFTTVQAAGVtiltistiipsLQPPKCSPESGSCVPASggqlgvlylal  1623
             D+FLGR+LTI IF  +QA G  +L +ST +  L+P       G    A+G Q+GVLY  L
Sbjct  148   DSFLGRFLTIAIFALLQALGTGLLAVSTTVRQLRP-------GPGEAATGLQMGVLYACL  200

Query  1622  yltalgtggLKSSVSGLGTDQFDDSDKRERGQMVKFFSWFIFFINVGSLLAVTVLVYIQD  1443
             YL ALGTGGLKSSVSG GTDQFD+ D +ER  M  FF+ F FFI++G+L+AVTVLVY+QD
Sbjct  201   YLIALGTGGLKSSVSGFGTDQFDERDDQERAAMGHFFNRFFFFISLGTLMAVTVLVYVQD  260

Query  1442  NLGRRWGYGLCACAIVGALVLFLSGTRRYRFKKLVGSPLTQIAAVYVAAWRKRRLELPSD  1263
             ++GR W YG+C+  ++ A+ +FLSGTRRYR+K+  GSP+  I  V VAA RKR   +   
Sbjct  261   HVGRSWAYGICSACMLLAVAVFLSGTRRYRYKRSAGSPIVHILQVLVAAARKRG-PIKRG  319

Query  1262  PELLYNVDDVVAAAGDQEHKKIKMPHSKEFRFLDRAAIKEGVSE----------VNKWSI  1113
             P          AA  +   +  ++PH+ +F  LD AA+  G  +           N W +
Sbjct  320   PL-------AAAALYEDRQEDERIPHTAQFLCLDAAAVMAGEEDNEIGTVGRQAPNPWKL  372

Query  1112  STLTDVEEVKQLIRMLPTWATTIMFWTVHAQLMTFSVSQAATMDRHMSKSFEVPAASMAV  933
              +++ VEEVK + R++P WATTI+FWT++AQ++TFSV QA TMDR M  SFE+PAAS+ V
Sbjct  373   CSVSRVEEVKMVARLMPVWATTILFWTIYAQMITFSVEQATTMDRRMVGSFEIPAASLTV  432

Query  932   FYVGGILVTIMMYDRIMVPIFRRVLNNPQGLSPLQRIAVGLALSVVGMMAAALVEIKRLK  753
             F+VG I++T+ +YDRI +P+  R+L   QG + L++I +GLALS+ GM AAA+ E KRL 
Sbjct  433   FFVGAIMLTLALYDRIFIPLC-RILTGRQGFTSLEKIGIGLALSIAGMAAAAVCEKKRLA  491

Query  752   VARSHGLTADPAATVPMSVFWLAAQYLIVGSGEALTYVGQLDFFLRECPKGMKTMSTGLF  573
             VA +    +   A +P+SVF L  Q+L+VG+GEA  Y GQLDFF+   PKGMKTMSTGLF
Sbjct  492   VAAA---ASTDTAVLPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLF  548

Query  572   LSTVALGLFFSSVLVTIVGKVTGEKKPWLADHLNQGKLYDFYWLLAVMSALNLMAFLFCS  393
             L+T++LG F SS LV++V   T     WL D +N  +L  FYWLLAV+ A+NL A+L C+
Sbjct  549   LATLSLGFFLSSALVSLVKGAT----TWLGDTINHSRLDYFYWLLAVLGAVNLAAYLLCA  604



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6054778787830