BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16272_g4_i1 len=374 path=[384:0-373]

Length=374
                                                                      Score     E

ref|XP_004141285.1|  PREDICTED: zinc finger protein ZAT10-like        62.0    3e-09   
ref|XP_008452639.1|  PREDICTED: zinc finger protein ZAT10-like        60.8    9e-09   
ref|XP_009347118.1|  PREDICTED: zinc finger protein ZAT10-like        59.7    2e-08   
ref|XP_008348887.1|  PREDICTED: zinc finger protein ZAT10-like        57.8    9e-08   
gb|KDP44482.1|  hypothetical protein JCGZ_16315                       57.8    9e-08   
ref|XP_004501530.1|  PREDICTED: zinc finger protein ZAT10-like        56.6    3e-07   
ref|XP_002527502.1|  zinc finger protein, putative                    56.2    4e-07   Ricinus communis
ref|XP_008236445.1|  PREDICTED: zinc finger protein ZAT10-like        55.8    5e-07   
ref|XP_008364438.1|  PREDICTED: zinc finger protein ZAT10-like        55.5    6e-07   
gb|ACO54857.1|  zinc finger protein ZF1                               55.5    7e-07   
gb|AAC06243.1|  osmotic stress-induced zinc-finger protein            55.8    8e-07   Nicotiana tabacum [American tobacco]
ref|XP_009772006.1|  PREDICTED: zinc finger protein ZAT10-like        55.1    1e-06   
ref|XP_010556440.1|  PREDICTED: zinc finger protein ZAT10-like        54.7    1e-06   
ref|XP_010272343.1|  PREDICTED: zinc finger protein ZAT10             54.3    2e-06   
ref|XP_006433625.1|  hypothetical protein CICLE_v10002297mg           54.3    2e-06   
gb|AGQ03803.1|  Cys2/His2-type zinc finger protein                    54.3    2e-06   
ref|XP_006472288.1|  PREDICTED: zinc finger protein ZAT10-like        54.3    2e-06   
ref|XP_010687351.1|  PREDICTED: zinc finger protein ZAT10-like        53.5    3e-06   
gb|AFH57271.1|  ZFP                                                   53.5    3e-06   
ref|XP_009335384.1|  PREDICTED: zinc finger protein ZAT10-like        53.1    4e-06   
emb|CBI22466.3|  unnamed protein product                              52.0    5e-06   
ref|XP_002264302.1|  PREDICTED: zinc finger protein ZAT10             52.8    6e-06   Vitis vinifera
emb|CAN61394.1|  hypothetical protein VITISV_013327                   52.8    7e-06   Vitis vinifera
ref|XP_002285260.1|  PREDICTED: zinc finger protein ZAT10-like        52.4    7e-06   Vitis vinifera
emb|CAN61204.1|  hypothetical protein VITISV_013668                   53.5    7e-06   Vitis vinifera
ref|XP_006486925.1|  PREDICTED: zinc finger protein ZAT10-like        52.8    8e-06   
ref|XP_010906283.1|  PREDICTED: zinc finger protein 1-like            52.4    8e-06   
ref|XP_009625229.1|  PREDICTED: zinc finger protein ZAT10-like        52.8    9e-06   
ref|XP_010277065.1|  PREDICTED: zinc finger protein ZAT10             52.0    1e-05   
gb|ADD09582.1|  kruppel-like zinc finger protein                      52.0    1e-05   Trifolium repens [creeping white clover]
gb|AAD26942.1|AF119050_1  zinc-finger protein 1                       52.0    1e-05   Datisca glomerata
ref|XP_011017126.1|  PREDICTED: zinc finger protein ZAT10             51.6    2e-05   
gb|KFK24883.1|  hypothetical protein AALP_AA8G037100                  50.8    3e-05   
ref|XP_002300263.2|  hypothetical protein POPTR_0001s30260g           51.2    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002301152.2|  hypothetical protein POPTR_0002s12010g           50.8    3e-05   Populus trichocarpa [western balsam poplar]
emb|CDX68559.1|  BnaC01g26370D                                        50.4    4e-05   
ref|XP_008445557.1|  PREDICTED: zinc finger protein ZAT10-like        50.4    4e-05   
ref|XP_007200425.1|  hypothetical protein PRUPE_ppa011060mg           50.4    4e-05   
ref|XP_003525928.1|  PREDICTED: zinc finger protein ZAT10             50.4    4e-05   
ref|XP_010538141.1|  PREDICTED: zinc finger protein ZAT10-like        50.4    5e-05   
ref|XP_007042625.1|  Zinc-finger DNA binding protein, putative        50.4    5e-05   
dbj|BAG15864.1|  zinc-finger protein                                  50.4    5e-05   Bruguiera gymnorhiza [Burma mangrove]
dbj|BAA05076.1|  zinc-finger DNA binding protein                      50.4    5e-05   Petunia x hybrida [garden petunia]
ref|XP_002510108.1|  zinc finger protein, putative                    50.1    6e-05   Ricinus communis
emb|CDP01211.1|  unnamed protein product                              50.1    7e-05   
dbj|BAA05077.1|  zinc-finger DNA binding protein                      50.1    8e-05   Petunia x hybrida [garden petunia]
ref|XP_011012430.1|  PREDICTED: zinc finger protein ZAT10             49.7    8e-05   
ref|XP_007136747.1|  hypothetical protein PHAVU_009G070800g           49.7    8e-05   
emb|CAB77055.1|  putative TFIIIA (or kruppel)-like zinc finger pr...  49.7    9e-05   Medicago sativa [alfalfa]
gb|KFK34259.1|  hypothetical protein AALP_AA5G121600                  49.3    9e-05   
ref|XP_002320035.1|  zinc-finger family protein                       49.3    1e-04   Populus trichocarpa [western balsam poplar]
gb|ADZ99348.1|  C2H2 zinc finger protein                              49.7    1e-04   
dbj|BAA05078.1|  zinc-finger DNA binding protein                      49.3    1e-04   Petunia x hybrida [garden petunia]
gb|AAU12056.1|  zinc-finger protein                                   49.7    1e-04   Solanum chacoense
gb|ABQ53549.1|  zinc finger protein                                   49.3    1e-04   
ref|XP_004142888.1|  PREDICTED: zinc finger protein ZAT10-like        48.9    1e-04   
gb|ABX10821.1|  SCOF-1                                                46.6    2e-04   Glycine max [soybeans]
gb|ABX10819.1|  SCOF-1                                                46.6    2e-04   Glycine soja [wild soybean]
ref|NP_001265993.1|  zinc finger protein ZAT10-like                   48.5    2e-04   
ref|XP_009769205.1|  PREDICTED: zinc finger protein ZAT10-like        48.1    2e-04   
gb|ADD09568.1|  kruppel-like zinc finger protein                      48.1    3e-04   Trifolium repens [creeping white clover]
dbj|BAA05079.1|  zinc-finger protein                                  48.1    3e-04   Petunia x hybrida [garden petunia]
ref|XP_010426524.1|  PREDICTED: zinc finger protein AZF1-like         47.4    4e-04   
ref|XP_007047505.1|  Zinc-finger DNA binding protein, putative        47.4    5e-04   
ref|XP_010530491.1|  PREDICTED: zinc finger protein ZAT10-like        47.4    5e-04   
emb|CDY23027.1|  BnaC07g31600D                                        46.6    5e-04   
ref|XP_009599610.1|  PREDICTED: zinc finger protein ZAT10-like        47.8    5e-04   
ref|XP_006422839.1|  hypothetical protein CICLE_v10029065mg           47.8    5e-04   
gb|EPS57985.1|  cys2/his2-type zinc finger transcription factor       47.4    5e-04   
emb|CDX83103.1|  BnaA01g21030D                                        47.4    5e-04   
gb|ABX10820.1|  SCOF-1                                                45.1    5e-04   Glycine soja [wild soybean]
gb|KCW63619.1|  hypothetical protein EUGRSUZ_G01247                   47.0    6e-04   
ref|XP_009101548.1|  PREDICTED: zinc finger protein AZF1-like         47.0    7e-04   
ref|XP_010065906.1|  PREDICTED: zinc finger protein ZAT10-like        47.0    7e-04   
ref|XP_009136527.1|  PREDICTED: zinc finger protein AZF1 isoform X3   45.4    7e-04   
ref|NP_001275233.1|  uncharacterized protein LOC102577828             47.0    8e-04   
emb|CDX68558.1|  BnaC01g26360D                                        46.6    8e-04   
gb|AFK36438.1|  unknown                                               46.6    8e-04   
ref|NP_190562.1|  C2H2-type zinc finger-containing protein            46.6    9e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074364.1|  PREDICTED: zinc finger protein ZAT10-like        46.6    9e-04   
gb|ACJ84409.1|  unknown                                               46.6    9e-04   Medicago truncatula
ref|XP_004290960.1|  PREDICTED: zinc finger protein ZAT10-like        47.0    0.001   
ref|XP_009630807.1|  PREDICTED: zinc finger protein ZAT10-like        46.6    0.001   



>ref|XP_004141285.1| PREDICTED: zinc finger protein ZAT10-like [Cucumis sativus]
 ref|XP_004173443.1| PREDICTED: zinc finger protein ZAT10-like [Cucumis sativus]
 gb|KGN55265.1| Zinc-finger protein 1 [Cucumis sativus]
Length=262

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 51/85 (60%), Gaps = 14/85 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVH------GLKKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+ S    T P+P +  DD +        K+KRTKRPRG ++P    PTEEE YLA
Sbjct  1    MALEALNSP---TTPSPALHYDDPNLNSFESWSKRKRTKRPRGFDNP----PTEEE-YLA  52

Query  246  LCLIMLARGEDPSRRQRDAPAEAKV  320
            LCLIMLARG   +    D P + +V
Sbjct  53   LCLIMLARGGATANSDSDHPLDYEV  77



>ref|XP_008452639.1| PREDICTED: zinc finger protein ZAT10-like [Cucumis melo]
Length=263

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 52/85 (61%), Gaps = 14/85 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDD--VHGL----KKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+ S    T P+P +  DD  ++      K+KRTKRPRG ++P    PTEEE YLA
Sbjct  1    MALEALNSP---TTPSPALHYDDPSLNSFESWSKRKRTKRPRGFDNP----PTEEE-YLA  52

Query  246  LCLIMLARGEDPSRRQRDAPAEAKV  320
            LCLIMLARG   +    D P + +V
Sbjct  53   LCLIMLARGGATATSDSDHPLDYEV  77



>ref|XP_009347118.1| PREDICTED: zinc finger protein ZAT10-like [Pyrus x bretschneideri]
Length=241

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 21/82 (26%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEV-----DDVHG----------LKKKRTKRPRGDESPALPP  218
            MALEA+KS++  T P+P +       D  HG           K+KR+KRPR ++     P
Sbjct  1    MALEALKSASTTTTPSPSLSSFEKVEDRRHGNHQIHSKEPWAKRKRSKRPRSED-----P  55

Query  219  PTEEERYLALCLIMLARGEDPS  284
            PTEEE YLALCLIMLARG   S
Sbjct  56   PTEEE-YLALCLIMLARGTTSS  76



>ref|XP_008348887.1| PREDICTED: zinc finger protein ZAT10-like [Malus domestica]
Length=241

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 47/82 (57%), Gaps = 21/82 (26%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEV-----DDVHG----------LKKKRTKRPRGDESPALPP  218
            MALEA+KS++  T P+P         D  HG           K+KR+KRPR ++     P
Sbjct  1    MALEALKSASTTTTPSPPFSSFEKVEDRRHGNHQIHSKEPWAKRKRSKRPRSED-----P  55

Query  219  PTEEERYLALCLIMLARGEDPS  284
            PTEEE YLALCLIMLARG   S
Sbjct  56   PTEEE-YLALCLIMLARGTTSS  76



>gb|KDP44482.1| hypothetical protein JCGZ_16315 [Jatropha curcas]
Length=243

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 41/67 (61%), Gaps = 11/67 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALCLIML  263
            MALEA+ S    TP       +D    K+KR+KRPRG+      PPTEEE YLALCLIML
Sbjct  1    MALEALNSPTTATP----FNYEDT-WTKRKRSKRPRGES-----PPTEEE-YLALCLIML  49

Query  264  ARGEDPS  284
            ARG   S
Sbjct  50   ARGGSTS  56



>ref|XP_004501530.1| PREDICTED: zinc finger protein ZAT10-like [Cicer arietinum]
Length=244

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (56%), Gaps = 7/70 (10%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVD-------DVHGLKKKRTKRPRGDESPALPPPTEEERYL  242
            MALE++KS   VT      E++       D    K+KR+KR R D        TEEE YL
Sbjct  1    MALESLKSPTTVTHSFTSFEIEEPNHSYIDTPWTKRKRSKRSRMDSHNHQSSCTEEEEYL  60

Query  243  ALCLIMLARG  272
            ALCLIMLARG
Sbjct  61   ALCLIMLARG  70



>ref|XP_002527502.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34900.1| zinc finger protein, putative [Ricinus communis]
Length=252

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 42/65 (65%), Gaps = 10/65 (15%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALCLIML  263
            MALEA+ S    TP       +D    K+KR+KRPR  ESPA   PTEEE YLALCLIML
Sbjct  1    MALEALNSPTTATP----FNYEDTW-TKRKRSKRPR-SESPA---PTEEE-YLALCLIML  50

Query  264  ARGED  278
            ARG +
Sbjct  51   ARGGN  55



>ref|XP_008236445.1| PREDICTED: zinc finger protein ZAT10-like [Prunus mume]
Length=241

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 45/71 (63%), Gaps = 14/71 (20%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVE-VDDVH-------GLKKKRTKRPRGDESPALPPPTEEERY  239
            MALEA+KS +  +P     E V+D H         K+KR+KRPR D+     PPTEEE Y
Sbjct  1    MALEALKSPSTPSPRFSSFEEVEDRHLNQSQEPWAKRKRSKRPRVDD-----PPTEEE-Y  54

Query  240  LALCLIMLARG  272
            LALCLIMLARG
Sbjct  55   LALCLIMLARG  65



>ref|XP_008364438.1| PREDICTED: zinc finger protein ZAT10-like [Malus domestica]
 gb|ADL36636.1| C2H2L domain class transcription factor [Malus domestica]
Length=246

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 47/78 (60%), Gaps = 21/78 (27%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCV----EVDD-------VHG----LKKKRTKRPRGDESPALPP  218
            MALEA+KS++  T  +P      E DD       +H      K+KR+KRPR ++     P
Sbjct  1    MALEALKSASTTTNTSPPFSSFEEADDRRQANHQIHSKEPWAKRKRSKRPRSED-----P  55

Query  219  PTEEERYLALCLIMLARG  272
            PTEEE YLALCLIMLARG
Sbjct  56   PTEEE-YLALCLIMLARG  72



>gb|ACO54857.1| zinc finger protein ZF1 [Cicer arietinum]
Length=244

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 7/70 (10%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDD-VHGL------KKKRTKRPRGDESPALPPPTEEERYL  242
            MALE++KS   VT      E+++  H        K+KR+KR R D        TEEE YL
Sbjct  1    MALESLKSPTTVTHSFTSFEIEEPNHSYINTPWTKRKRSKRSRMDSHNHQSSCTEEEEYL  60

Query  243  ALCLIMLARG  272
            ALCLIMLARG
Sbjct  61   ALCLIMLARG  70



>gb|AAC06243.1| osmotic stress-induced zinc-finger protein [Nicotiana tabacum]
Length=273

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 44/74 (59%), Gaps = 12/74 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAP--CVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLA  245
            M LEA+KS    TP  P    + D++H L    K KR+KRPR D      PPTEEE YLA
Sbjct  1    MTLEALKSPTAATPTLPPRYEDDDEIHNLDSWAKGKRSKRPRIDA-----PPTEEE-YLA  54

Query  246  LCLIMLARGEDPSR  287
            LCLIMLAR    +R
Sbjct  55   LCLIMLARSGTGTR  68



>ref|XP_009772006.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana sylvestris]
Length=272

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 42/68 (62%), Gaps = 12/68 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAP--CVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLA  245
            M LEA+KS    TP  P    + D++H L    K KR+KRPR D      PPTEEE YLA
Sbjct  1    MTLEALKSPTAATPTLPPRYEDDDEIHNLDSWAKGKRSKRPRIDA-----PPTEEE-YLA  54

Query  246  LCLIMLAR  269
            LCLIMLAR
Sbjct  55   LCLIMLAR  62



>ref|XP_010556440.1| PREDICTED: zinc finger protein ZAT10-like [Tarenaya hassleriana]
Length=259

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 11/69 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPA--PCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+ S   V  P      E  ++H L    K+KR+KRPR D+     P T EE YLA
Sbjct  1    MALEALNSPTAVAAPKLLHFEEAANLHSLEPWTKRKRSKRPRFDQ-----PSTSEEEYLA  55

Query  246  LCLIMLARG  272
            LCL+MLARG
Sbjct  56   LCLVMLARG  64



>ref|XP_010272343.1| PREDICTED: zinc finger protein ZAT10 [Nelumbo nucifera]
Length=242

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 43/67 (64%), Gaps = 11/67 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TP     ++D +H L    K+KRTKRPR +      PPTEEE YLALC
Sbjct  1    MALEALNSPRTATPSLHYDDMD-LHCLEPWAKRKRTKRPRLEN-----PPTEEE-YLALC  53

Query  252  LIMLARG  272
            LIMLARG
Sbjct  54   LIMLARG  60



>ref|XP_006433625.1| hypothetical protein CICLE_v10002297mg [Citrus clementina]
 gb|ESR46865.1| hypothetical protein CICLE_v10002297mg [Citrus clementina]
 gb|KDO81542.1| hypothetical protein CISIN_1g038669mg [Citrus sinensis]
Length=244

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 13/67 (19%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TPP    E  ++H L    K+KR+KRP         PPTEEE YLALC
Sbjct  1    MALEALNSPTTSTPPFH-FEEANLHCLEPWTKRKRSKRPHN-------PPTEEE-YLALC  51

Query  252  LIMLARG  272
            L+MLARG
Sbjct  52   LVMLARG  58



>gb|AGQ03803.1| Cys2/His2-type zinc finger protein [Citrus trifoliata]
Length=244

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 13/67 (19%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TPP    E  ++H L    K+KR+KRP         PPTEEE YLALC
Sbjct  1    MALEALNSPTTSTPPFH-FEEANLHCLEPWTKRKRSKRPHN-------PPTEEE-YLALC  51

Query  252  LIMLARG  272
            L+MLARG
Sbjct  52   LVMLARG  58



>ref|XP_006472288.1| PREDICTED: zinc finger protein ZAT10-like [Citrus sinensis]
Length=244

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 13/67 (19%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TPP    E  ++H L    K+KR+KRP         PPTEEE YLALC
Sbjct  1    MALEALNSPTTSTPPFH-FEEANLHCLEPWTKRKRSKRPHN-------PPTEEE-YLALC  51

Query  252  LIMLARG  272
            L+MLARG
Sbjct  52   LVMLARG  58



>ref|XP_010687351.1| PREDICTED: zinc finger protein ZAT10-like [Beta vulgaris subsp. 
vulgaris]
Length=242

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALCLIML  263
            MALEA+ SS   TPP    E  ++   KKKR+KRPR D SP    P+EEE YLALCL+ML
Sbjct  1    MALEALNSS---TPPLNTDE--NMLMTKKKRSKRPRLDSSP----PSEEE-YLALCLVML  50

Query  264  ARG  272
            ARG
Sbjct  51   ARG  53



>gb|AFH57271.1| ZFP [Gossypium hirsutum]
Length=233

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 6/64 (9%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKK-KRTKRPRGDESPALPPPTEEERYLALCLIM  260
            MALEA+ S  + TP     + DD+   KK KR+KR R D SP  P  T EE YLALCLIM
Sbjct  1    MALEALNSPTMPTPFTN--KYDDIDNWKKGKRSKRLRTD-SPTTP--TTEEEYLALCLIM  55

Query  261  LARG  272
            LARG
Sbjct  56   LARG  59



>ref|XP_009335384.1| PREDICTED: zinc finger protein ZAT10-like [Pyrus x bretschneideri]
Length=246

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 21/78 (27%)
 Frame = +3

Query  84   MALEAMKSSAVVT---PPAPCVE--------VDDVHG----LKKKRTKRPRGDESPALPP  218
            MALEA+KS++  T   PP    E           +H      K+KR+KRPR ++     P
Sbjct  1    MALEALKSASTTTNTSPPFSSFEEAEDRRQANHQIHSKEPWAKRKRSKRPRSED-----P  55

Query  219  PTEEERYLALCLIMLARG  272
            PTEEE YLALCLIMLARG
Sbjct  56   PTEEE-YLALCLIMLARG  72



>emb|CBI22466.3| unnamed protein product [Vitis vinifera]
Length=161

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S   ++P     E  ++H L    K+KR++RPR +       P+ EE YLALC
Sbjct  1    MALEALNSPTTMSPTFK-FEEAELHSLEPWTKRKRSRRPRFEN------PSTEEEYLALC  53

Query  252  LIMLARGEDPSRRQ  293
            LIMLARG   +R +
Sbjct  54   LIMLARGGATTREE  67



>ref|XP_002264302.1| PREDICTED: zinc finger protein ZAT10 [Vitis vinifera]
Length=235

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 11/81 (14%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S   ++P     E  ++H L    K+KR++RPR +       P+ EE YLALC
Sbjct  1    MALEALNSPTTMSPTFK-FEEAELHSLEPWTKRKRSRRPRFEN------PSTEEEYLALC  53

Query  252  LIMLARGEDPSRRQRDAPAEA  314
            LIMLARG   +R +   P  A
Sbjct  54   LIMLARGGATTREESPMPLRA  74



>emb|CAN61394.1| hypothetical protein VITISV_013327 [Vitis vinifera]
Length=233

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 11/67 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TP +   E   +H L    K+KR+KRPR D  P       EE YLALC
Sbjct  1    MALEALNSPTTPTP-SFHYEQPSLHSLESWAKRKRSKRPRFDNQPT------EEEYLALC  53

Query  252  LIMLARG  272
            LIMLARG
Sbjct  54   LIMLARG  60



>ref|XP_002285260.1| PREDICTED: zinc finger protein ZAT10-like [Vitis vinifera]
Length=233

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 38/67 (57%), Gaps = 11/67 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TP     E   +H L    K+KR+KRPR D  P       EE YLALC
Sbjct  1    MALEALNSPTTPTPSFH-YEQPSLHSLESWAKRKRSKRPRFDNQPT------EEEYLALC  53

Query  252  LIMLARG  272
            LIMLARG
Sbjct  54   LIMLARG  60



>emb|CAN61204.1| hypothetical protein VITISV_013668 [Vitis vinifera]
Length=324

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 11/81 (14%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S   ++P     E  ++H L    K+KR++RPR         P+ EE YLALC
Sbjct  90   MALEALNSPTTMSPTFK-FEEAELHSLEPWTKRKRSRRPR------FENPSTEEEYLALC  142

Query  252  LIMLARGEDPSRRQRDAPAEA  314
            LIMLARG   +R +   P  A
Sbjct  143  LIMLARGGATTREESPMPLRA  163



>ref|XP_006486925.1| PREDICTED: zinc finger protein ZAT10-like [Citrus sinensis]
Length=266

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 44/79 (56%), Gaps = 7/79 (9%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTE---EERYLALCL  254
            MALEA+ S    T        +D    K++R+KRPR DESP LP       EE Y+ALCL
Sbjct  1    MALEALNSPTTSTHNHHPFRYEDS-WTKRRRSKRPRTDESPQLPAAAAAPTEEEYMALCL  59

Query  255  IMLARGEDPSRRQRDAPAE  311
            IMLARG   +     APAE
Sbjct  60   IMLARG---TTTANTAPAE  75



>ref|XP_010906283.1| PREDICTED: zinc finger protein 1-like [Elaeis guineensis]
Length=247

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDD------VHGL-KKKRTKRPRGDESPALPPPTEEERYL  242
            MA++A++++A  TPP    E  D      V G  K+KR+KR  G       PPTEEE YL
Sbjct  1    MAVDALETTAASTPPPTATETSDEQFPHHVEGWAKRKRSKRHHGFFDH---PPTEEE-YL  56

Query  243  ALCLIMLARGEDPSR  287
            ALCL+MLARG    R
Sbjct  57   ALCLVMLARGGSGHR  71



>ref|XP_009625229.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana tomentosiformis]
Length=272

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 12/68 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAP--CVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+KS    TP  P    +VD++H L    K KR+KRPR D      PPTEEE YLA
Sbjct  1    MALEALKSPTTATPTLPPRYEDVDEIHNLDSWAKGKRSKRPRIDT-----PPTEEE-YLA  54

Query  246  LCLIMLAR  269
            LCLIMLAR
Sbjct  55   LCLIMLAR  62



>ref|XP_010277065.1| PREDICTED: zinc finger protein ZAT10 [Nelumbo nucifera]
Length=242

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 43/69 (62%), Gaps = 15/69 (22%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDD--VHGL----KKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+ S       AP +  DD  +H L    K+KR+KRPR +      PPTEEE YLA
Sbjct  1    MALEALNSPRTA---APSLHYDDMDLHCLEPWAKRKRSKRPRLEN-----PPTEEE-YLA  51

Query  246  LCLIMLARG  272
            LCLIMLARG
Sbjct  52   LCLIMLARG  60



>gb|ADD09582.1| kruppel-like zinc finger protein [Trifolium repens]
Length=239

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 9/74 (12%)
 Frame = +3

Query  84   MALEAMKSSAVVTP----PAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALC  251
            MA+EA+ S    TP    P P  +  D    K KR+KR R D+S      TEEE YLALC
Sbjct  1    MAMEALNSPTTATPFTPFPEPNHDYIDAPWTKGKRSKRSRMDQSSC----TEEE-YLALC  55

Query  252  LIMLARGEDPSRRQ  293
            LIMLARG + +  +
Sbjct  56   LIMLARGGNGNNNK  69



>gb|AAD26942.1|AF119050_1 zinc-finger protein 1 [Datisca glomerata]
Length=247

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 45/85 (53%), Gaps = 15/85 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDD--VHGL----KKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+ S    TP       DD  ++ L    K+KR+KR R      L  P  EE YLA
Sbjct  1    MALEALNSPTTATP---VFHYDDPSLNYLEPWTKRKRSKRTR------LDSPHTEEEYLA  51

Query  246  LCLIMLARGEDPSRRQRDAPAEAKV  320
             CLIMLARG   S  +RD+ +  ++
Sbjct  52   FCLIMLARGRVASANRRDSQSSIQI  76



>ref|XP_011017126.1| PREDICTED: zinc finger protein ZAT10 [Populus euphratica]
Length=252

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 12/68 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL-----KKKRTKRPRGDESPALPPPTEEERYLAL  248
            MALEA+ S    TP     E    H +     K+KR+KRPR D  P       EE YLAL
Sbjct  1    MALEALNSPTTATPSFQ-FEDSSTHYMVEPWAKRKRSKRPRLDHQPT------EEEYLAL  53

Query  249  CLIMLARG  272
            CL+MLARG
Sbjct  54   CLVMLARG  61



>gb|KFK24883.1| hypothetical protein AALP_AA8G037100 [Arabis alpina]
Length=233

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 12/79 (15%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDV---HGLKKKRTKRPRGD-ESPALPPPTEEERYLALC  251
            MALEA+ S  + +P  P +  D V   HG K KR+KR R D + P+L    +E+ Y+ALC
Sbjct  1    MALEALNSPRLASP-IPTLFQDSVVGFHGSKGKRSKRSRSDFDRPSL----KEDEYIALC  55

Query  252  LIMLARGEDPSRRQRDAPA  308
            L++LAR  D   R RD PA
Sbjct  56   LMLLARDGD---RTRDLPA  71



>ref|XP_002300263.2| hypothetical protein POPTR_0001s30260g [Populus trichocarpa]
 gb|EEE85068.2| hypothetical protein POPTR_0001s30260g [Populus trichocarpa]
Length=286

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 11/67 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALCLIML  263
            MALEA+ S     P       ++   +K+KR+KRPR +       P+ EE YLALCLIML
Sbjct  47   MALEALNSPTTAAP----FNYEETW-IKRKRSKRPRSES------PSTEEEYLALCLIML  95

Query  264  ARGEDPS  284
            ARG  P+
Sbjct  96   ARGGSPA  102



>ref|XP_002301152.2| hypothetical protein POPTR_0002s12010g [Populus trichocarpa]
 gb|ABK96630.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE80425.2| hypothetical protein POPTR_0002s12010g [Populus trichocarpa]
Length=252

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 12/68 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL-----KKKRTKRPRGDESPALPPPTEEERYLAL  248
            MALEA+ S    TP     E    H +     K+KR+KRPR D  P       EE YLAL
Sbjct  1    MALEALNSPTTATPSFQ-FEESSTHCVVEPWAKRKRSKRPRLDHQPT------EEEYLAL  53

Query  249  CLIMLARG  272
            CL+MLARG
Sbjct  54   CLVMLARG  61



>emb|CDX68559.1| BnaC01g26370D [Brassica napus]
Length=225

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 6/78 (8%)
 Frame = +3

Query  84   MALEAMKS-SAVVTPPAPCV-EVDDVH-GLKKKRTKRPRGDESPALPPPTEEERYLALCL  254
            MAL+ + S ++  T P+P + E +++    K+KRTKR R D+     PP+EEE YLALCL
Sbjct  1    MALDTLNSPNSTTTAPSPFLTEPENLEPWTKRKRTKRHRIDDKSN--PPSEEE-YLALCL  57

Query  255  IMLARGEDPSRRQRDAPA  308
            +MLARG   +    D P+
Sbjct  58   LMLARGSSSTNDGNDHPS  75



>ref|XP_008445557.1| PREDICTED: zinc finger protein ZAT10-like [Cucumis melo]
Length=236

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 14/69 (20%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL-------KKKRTKRPRGDESPALPPPTEEERYL  242
            MAL+A+ S  +   P P    D+V  L       K+KR++RP  D+SP+      EE YL
Sbjct  1    MALQALNSPTMAVAP-PTFHFDEVSFLQPLKPWAKRKRSRRPSFDDSPS------EEEYL  53

Query  243  ALCLIMLAR  269
            ALCLIMLAR
Sbjct  54   ALCLIMLAR  62



>ref|XP_007200425.1| hypothetical protein PRUPE_ppa011060mg [Prunus persica]
 gb|EMJ01624.1| hypothetical protein PRUPE_ppa011060mg [Prunus persica]
Length=225

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 46/71 (65%), Gaps = 14/71 (20%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVE-VDDVH-------GLKKKRTKRPRGDESPALPPPTEEERY  239
            MALEA+KS +  +PP    E V+D H         K+KR+KRPR D+     PPTEEE Y
Sbjct  1    MALEALKSPSTPSPPFSSFEEVEDRHLNQSQEPWAKRKRSKRPRVDD-----PPTEEE-Y  54

Query  240  LALCLIMLARG  272
            LALCLIMLARG
Sbjct  55   LALCLIMLARG  65



>ref|XP_003525928.1| PREDICTED: zinc finger protein ZAT10 [Glycine max]
 gb|AFH53181.1| C2H2 zinc-finger protein, partial [Glycine max]
Length=233

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 39/68 (57%), Gaps = 6/68 (9%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL-----KKKRTKRPRGDESPALPPPTEEERYLAL  248
            MALEA++S    TP     E   +  L     K KR+KR R ++    P  TEEE YLAL
Sbjct  1    MALEALQSPTTATPSFSPFEETSLSYLETPWTKGKRSKRSRTEQQLQHPSCTEEE-YLAL  59

Query  249  CLIMLARG  272
            CLIMLARG
Sbjct  60   CLIMLARG  67



>ref|XP_010538141.1| PREDICTED: zinc finger protein ZAT10-like [Tarenaya hassleriana]
Length=268

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 10/76 (13%)
 Frame = +3

Query  81   DMALEAMKSSAVVTP-PAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALCLI  257
            +MALEA+ S  + +P P+   +    HG+K+KR+KR R D          EE YLA+CL+
Sbjct  36   NMALEALSSPRLASPIPSLFEDSTSFHGVKRKRSKRNRSDNR------LTEEEYLAVCLM  89

Query  258  MLARGEDPSRRQRDAP  305
            +LAR  D   R+R +P
Sbjct  90   LLARDGD---RKRQSP  102



>ref|XP_007042625.1| Zinc-finger DNA binding protein, putative [Theobroma cacao]
 gb|EOX98456.1| Zinc-finger DNA binding protein, putative [Theobroma cacao]
Length=267

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 38/67 (57%), Gaps = 10/67 (15%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    T  +   E  D + L    K KR+KRPR +       PT EE YLALC
Sbjct  1    MALEALNSPTTATTFSNKYEDIDNNYLETWKKGKRSKRPRSES------PTTEEEYLALC  54

Query  252  LIMLARG  272
            LIMLARG
Sbjct  55   LIMLARG  61



>dbj|BAG15864.1| zinc-finger protein [Bruguiera gymnorhiza]
Length=252

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 37/69 (54%), Gaps = 12/69 (17%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVE------VDDVHGLKKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+ S A   P     E      ++     K+KR+KRPR D  P       EE YLA
Sbjct  1    MALEALNSPATAAPSFHFAEDSSPQYLNGESWAKRKRSKRPRVDHQPT------EEEYLA  54

Query  246  LCLIMLARG  272
            LCL+MLARG
Sbjct  55   LCLVMLARG  63



>dbj|BAA05076.1| zinc-finger DNA binding protein [Petunia x hybrida]
Length=277

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 48/92 (52%), Gaps = 13/92 (14%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDV------HGLKKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+KS    TP  P    D V        +K KR+KRPR +      PP+EEE YLA
Sbjct  1    MALEALKSPTAATPTLPPRYEDQVDMSNLDSWVKGKRSKRPRIET-----PPSEEE-YLA  54

Query  246  LCLIMLAR-GEDPSRRQRDAPAEAKVVSKESE  338
            LCLIMLAR G   +        +   +SKE E
Sbjct  55   LCLIMLARSGNGTTPSSIPGSTDTTTISKEPE  86



>ref|XP_002510108.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF52295.1| zinc finger protein, putative [Ricinus communis]
Length=256

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALCLIML  263
            MALEA+ S    TP     +   +H L +  TKR R   S     PTEEE YLALCL+ML
Sbjct  1    MALEALNSPTTATPTFQFEDSSSLHCLAEPWTKRKRSKRSHH-HQPTEEE-YLALCLVML  58

Query  264  ARG  272
            ARG
Sbjct  59   ARG  61



>emb|CDP01211.1| unnamed protein product [Coffea canephora]
Length=255

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVH----GLKKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TP  P       H      K KR+KRPR  + P    PTEEE YLALC
Sbjct  1    MALEALNSPTTPTPSFPFDNPSLRHLTEPWAKGKRSKRPRSLDHPQ---PTEEE-YLALC  56

Query  252  LIMLARG  272
            LIMLARG
Sbjct  57   LIMLARG  63



>dbj|BAA05077.1| zinc-finger DNA binding protein [Petunia x hybrida]
Length=274

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 12/68 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAP-----CVEVDDVHG-LKKKRTKRPRGDESPALPPPTEEERYLA  245
            MALEA+KS    TP  P      V+++++   +K KR+KRPR +      PP+EEE YLA
Sbjct  1    MALEALKSPTAATPSLPPRYEDHVDMNNLDSWVKGKRSKRPRIET-----PPSEEE-YLA  54

Query  246  LCLIMLAR  269
            LCLIMLAR
Sbjct  55   LCLIMLAR  62



>ref|XP_011012430.1| PREDICTED: zinc finger protein ZAT10 [Populus euphratica]
Length=251

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 11/63 (17%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALCLIML  263
            MALEA+ S     P       ++   +K+KR+KRPR +       P+ EE YLALCLIML
Sbjct  1    MALEALNSPTTAAP----FNYEETW-IKRKRSKRPRSES------PSTEEEYLALCLIML  49

Query  264  ARG  272
            ARG
Sbjct  50   ARG  52



>ref|XP_007136747.1| hypothetical protein PHAVU_009G070800g [Phaseolus vulgaris]
 gb|ESW08741.1| hypothetical protein PHAVU_009G070800g [Phaseolus vulgaris]
Length=243

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 6/69 (9%)
 Frame = +3

Query  84   MALEAMKSSAVVTPP-APCVEVD----DVHGLKKKRTKRPRGDESPALPPPT-EEERYLA  245
            MALEA++S     P  +P  E +    D    K+KR+KR R D+   L  P+  EE YLA
Sbjct  1    MALEALQSPTTANPSFSPFEEANLSYLDTPWAKRKRSKRARMDQQLQLQHPSCTEEEYLA  60

Query  246  LCLIMLARG  272
            LCLIMLARG
Sbjct  61   LCLIMLARG  69



>emb|CAB77055.1| putative TFIIIA (or kruppel)-like zinc finger protein [Medicago 
sativa subsp. x varia]
Length=235

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 9/93 (10%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVH----GLKKKRTKRPRGDESPALPPPTEEERYLALC  251
            MA+EA+ S    TP  P  E +  +      K KR+KR R D+S      TEEE YLALC
Sbjct  1    MAMEALNSPTTATPFTPFEEPNLSYLETPWTKGKRSKRSRMDQSSC----TEEE-YLALC  55

Query  252  LIMLARGEDPSRRQRDAPAEAKVVSKESETVSL  350
            LIMLAR  + + ++ D+ A      K S   S+
Sbjct  56   LIMLARSGNNNDKKSDSVATPLTTVKLSHKCSV  88



>gb|KFK34259.1| hypothetical protein AALP_AA5G121600 [Arabis alpina]
Length=220

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +3

Query  165  KKKRTKRPRGDESPALPPPTEEERYLALCLIMLARG  272
            K+KRTKR R D      PP+EEE YLALCL+MLARG
Sbjct  31   KRKRTKRHRTDHQHQSNPPSEEE-YLALCLLMLARG  65



>ref|XP_002320035.1| zinc-finger family protein [Populus trichocarpa]
 gb|EEE98350.1| zinc-finger family protein [Populus trichocarpa]
Length=238

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 16/74 (22%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVH-------GLKKKRTKRPRGDESPALPPPTEEERYL  242
            MALEA+ +S    PP+   + +D+         +K+KR+KRPR D  P       EE YL
Sbjct  1    MALEAL-NSPTTAPPS--FQFEDLSLPCAGEPWVKRKRSKRPRLDHQPT------EEEYL  51

Query  243  ALCLIMLARGEDPS  284
            ALCL+MLARG   S
Sbjct  52   ALCLVMLARGHQKS  65



>gb|ADZ99348.1| C2H2 zinc finger protein [Gossypium hirsutum]
Length=272

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 45/74 (61%), Gaps = 11/74 (15%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPC----VEVDDVHGLKK-KRTKRPRGDESPALPPP------TEE  230
            MALEA+KS  + T P       ++ + V   KK KR+KR R DES + PPP      T E
Sbjct  1    MALEALKSPTMATAPYSNKYEDIDNNYVDTWKKGKRSKRQRDDESSSSPPPPPPPPPTNE  60

Query  231  ERYLALCLIMLARG  272
            E YLALCLIMLARG
Sbjct  61   EEYLALCLIMLARG  74



>dbj|BAA05078.1| zinc-finger DNA binding protein [Petunia x hybrida]
Length=253

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 16/70 (23%)
 Frame = +3

Query  84   MALEAMKSSA--------VVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERY  239
            M LE +KSS+        +  PP P  +  D+H  K+KR+KRPR +      PP+E+E +
Sbjct  1    MTLETLKSSSTPKTSKPTIPLPPKPINDAIDIH--KRKRSKRPRIET-----PPSEKE-F  52

Query  240  LALCLIMLAR  269
            LALCLIMLAR
Sbjct  53   LALCLIMLAR  62



>gb|AAU12056.1| zinc-finger protein [Solanum chacoense]
Length=273

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 12/66 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            M +EA+KS     PP    E+DD H L    K KR+KRPR D      PPT ++ YLALC
Sbjct  1    MPIEALKSPTAALPPLE--EIDDSHNLDSWAKGKRSKRPRIDN-----PPTRDQ-YLALC  52

Query  252  LIMLAR  269
            L+MLA 
Sbjct  53   LLMLAN  58



>gb|ABQ53549.1| zinc finger protein [Arachis diogoi]
Length=261

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 38/68 (56%), Gaps = 8/68 (12%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL-----KKKRTKRPRGDESPALPPPTEEERYLAL  248
            MALEA+KS     P     E +++  L     K+KR+KR    E   LP    EE YLAL
Sbjct  1    MALEALKSPTAAGPSFSFEETNNLSYLEAPWAKRKRSKRANRME---LPHNCSEEEYLAL  57

Query  249  CLIMLARG  272
            CLIMLARG
Sbjct  58   CLIMLARG  65



>ref|XP_004142888.1| PREDICTED: zinc finger protein ZAT10-like [Cucumis sativus]
 ref|XP_004168832.1| PREDICTED: zinc finger protein ZAT10-like [Cucumis sativus]
Length=240

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 14/69 (20%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL-------KKKRTKRPRGDESPALPPPTEEERYL  242
            MAL+A+ S  +   P P    D+V  L       K+KR++RP  D+SP+      EE YL
Sbjct  1    MALQALNSPTMAVAPPP-FHFDEVSFLQPLKPWAKRKRSRRPSLDDSPS------EEEYL  53

Query  243  ALCLIMLAR  269
            ALCLIMLAR
Sbjct  54   ALCLIMLAR  62



>gb|ABX10821.1| SCOF-1 [Glycine max]
Length=87

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 13/73 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDD--VHGLKKKRTKRPRGDESPALPPPTEEERYLALCLI  257
            MALEA+ S     P  P    DD  +   K+KR+KR R         P+EEE YLALCLI
Sbjct  1    MALEALNSPTTTAPSFP---FDDPTIPWAKRKRSKRSRDH-------PSEEE-YLALCLI  49

Query  258  MLARGEDPSRRQR  296
            MLARG   +   R
Sbjct  50   MLARGGTTTVNNR  62



>gb|ABX10819.1| SCOF-1 [Glycine soja]
Length=93

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 13/73 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDD--VHGLKKKRTKRPRGDESPALPPPTEEERYLALCLI  257
            MALEA+ S     P  P    DD  +   K+KR+KR R         P+EEE YLALCLI
Sbjct  1    MALEALNSPTTTAPSFP---FDDPTIPWAKRKRSKRSRDH-------PSEEE-YLALCLI  49

Query  258  MLARGEDPSRRQR  296
            MLARG   +   R
Sbjct  50   MLARGGTTTVNNR  62



>ref|NP_001265993.1| zinc finger protein ZAT10-like [Cicer arietinum]
 gb|ACD13216.1| zinc finger protein [Cicer arietinum]
Length=280

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 10/76 (13%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHG----LKKKRTKRPRGDESPALPPPTEEERYLALC  251
            + LEA  SS     P P    +++      +K+KR+KRPR        PPTEEE YLALC
Sbjct  3    LELEAFNSSPPTNSPFPTFNKEEIRESESLVKRKRSKRPRISN-----PPTEEE-YLALC  56

Query  252  LIMLARGEDPSRRQRD  299
            LIMLA+  +    + D
Sbjct  57   LIMLAQSGNNRNNKND  72



>ref|XP_009769205.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana sylvestris]
Length=222

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 15/93 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TPP+   E   ++ L    K KR+KRPR   S     PTEEE YLA C
Sbjct  1    MALEALNSPRTPTPPSFQYENTTLNYLESWTKGKRSKRPR---SIMEQQPTEEE-YLAFC  56

Query  252  LIMLARGEDPSRRQRDAPAEAKVVSKESETVSL  350
            L+MLA       R  ++     ++S  SE+ +L
Sbjct  57   LLMLA-------RSGNSTNSTNLISTSSESKNL  82



>gb|ADD09568.1| kruppel-like zinc finger protein [Trifolium repens]
Length=243

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (58%), Gaps = 9/66 (14%)
 Frame = +3

Query  84   MALEAMKSSAVVTP----PAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALC  251
            MA+EA+ S    TP    P P  +  D    K KR+KR R D+S      TEEE YLALC
Sbjct  1    MAMEALNSPTTATPFTPFPEPNHDYIDAPWTKGKRSKRSRMDQSSC----TEEE-YLALC  55

Query  252  LIMLAR  269
            LIMLAR
Sbjct  56   LIMLAR  61



>dbj|BAA05079.1| zinc-finger protein [Petunia x hybrida]
Length=253

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 39/75 (52%), Gaps = 9/75 (12%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TPP+   E + +  L    K KR+KR R     ++     EE YLALC
Sbjct  1    MALEALNSPTTTTPPSFQFENNGLKYLESWTKGKRSKRQR-----SMERQCTEEEYLALC  55

Query  252  LIMLARGEDPSRRQR  296
            LIMLAR +      R
Sbjct  56   LIMLARSDGSVNNSR  70



>ref|XP_010426524.1| PREDICTED: zinc finger protein AZF1-like [Camelina sativa]
Length=221

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 4/36 (11%)
 Frame = +3

Query  165  KKKRTKRPRGDESPALPPPTEEERYLALCLIMLARG  272
            K+KRTKR R D+S    PP+EEE YLALCL+MLARG
Sbjct  40   KRKRTKRHRTDQSN---PPSEEE-YLALCLLMLARG  71



>ref|XP_007047505.1| Zinc-finger DNA binding protein, putative [Theobroma cacao]
 gb|EOX91662.1| Zinc-finger DNA binding protein, putative [Theobroma cacao]
Length=233

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 11/67 (16%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALE M +S    PP    +  D+H      K+KRTKRPR +      PPTEEE YLALC
Sbjct  1    MALE-MLNSPTSAPPLLHHDDIDLHSTEPWTKRKRTKRPRIEN-----PPTEEE-YLALC  53

Query  252  LIMLARG  272
            L+MLA+G
Sbjct  54   LLMLAQG  60



>ref|XP_010530491.1| PREDICTED: zinc finger protein ZAT10-like [Tarenaya hassleriana]
Length=214

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 14/66 (21%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S  ++       E  ++H L    K+KR+KRPR D+      PT EE YLALC
Sbjct  1    MALEALSSPKLLDLE----ENANLHSLEPSTKRKRSKRPRFDQ------PTAEEEYLALC  50

Query  252  LIMLAR  269
            L+MLAR
Sbjct  51   LVMLAR  56



>emb|CDY23027.1| BnaC07g31600D [Brassica napus]
Length=170

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDV--HGLKKKRTKRPRG-DESPALPPPTEEERYLALCL  254
            MAL+ + S    T P P +   +      K+KRTKR R  D+S    PP+EEE YLA+CL
Sbjct  1    MALDTLNSPTSTTAPPPFLTKPENLESWTKRKRTKRHRTVDQSH---PPSEEE-YLAICL  56

Query  255  IMLARGEDPSRRQRDAPA  308
            +MLARG   +    D P+
Sbjct  57   LMLARGSSSTNDGNDHPS  74



>ref|XP_009599610.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana tomentosiformis]
Length=262

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +3

Query  84   MALEAMKS-SAVVTPPAPCV--EVDDVHGLKKKRTKRPRGDESPALPPPTEEERYLALCL  254
            MALEA+KS +   TP  P +  +V+     K+KR+KRPR +  P       EE +LALCL
Sbjct  1    MALEALKSPTTESTPTIPPIYDQVNLDSNTKRKRSKRPRNEIQPT------EEEFLALCL  54

Query  255  IMLAR  269
            IMLAR
Sbjct  55   IMLAR  59



>ref|XP_006422839.1| hypothetical protein CICLE_v10029065mg [Citrus clementina]
 gb|ESR36079.1| hypothetical protein CICLE_v10029065mg [Citrus clementina]
 gb|KDO57873.1| hypothetical protein CISIN_1g024499mg [Citrus sinensis]
Length=267

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 45/79 (57%), Gaps = 7/79 (9%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGLKKKRTKRPRGDESPALPPPTE---EERYLALCL  254
            MALEA+ S    T        +D    K++R+KRPR DESP LPP      EE Y+ALCL
Sbjct  1    MALEALNSPTTNTHNHHPFRYEDS-WTKRRRSKRPRTDESPPLPPAVAAPTEEEYMALCL  59

Query  255  IMLARGEDPSRRQRDAPAE  311
            IMLARG   +     APAE
Sbjct  60   IMLARG---TTTANTAPAE  75



>gb|EPS57985.1| cys2/his2-type zinc finger transcription factor [Genlisea aurea]
Length=221

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 12/85 (14%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ +S   +P A   + + +  L    K KR+KRPR +E         EE YLALC
Sbjct  1    MALEAL-NSPTGSPAAFNFDAERLRYLESWTKGKRSKRPRSNE-------LTEEEYLALC  52

Query  252  LIMLARGEDPSRRQRDAPAEAKVVS  326
            L+MLAR   P ++++   A A+V++
Sbjct  53   LVMLARSTPPEKKKKMETAAAEVIA  77



>emb|CDX83103.1| BnaA01g21030D [Brassica napus]
Length=222

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 6/66 (9%)
 Frame = +3

Query  84   MALEAMKS-SAVVTPPAPCV-EVDDVH-GLKKKRTKRPRGDESPALPPPTEEERYLALCL  254
            MAL+ + S ++  T P+P + E +++    K+KRTKR R D+     PP+EEE YLALCL
Sbjct  1    MALDTLNSPNSTTTAPSPFLTEPENLEPWTKRKRTKRHRIDDKSN--PPSEEE-YLALCL  57

Query  255  IMLARG  272
            +MLARG
Sbjct  58   LMLARG  63



>gb|ABX10820.1| SCOF-1 [Glycine soja]
 gb|ABX10822.1| SCOF-1 [Glycine max]
Length=78

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 37/65 (57%), Gaps = 12/65 (18%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDD--VHGLKKKRTKRPRGDESPALPPPTEEERYLALCLI  257
            MALEA+ S     P  P    DD  +   K+KR+KR   D       P+EEE YLALCLI
Sbjct  1    MALEALNSPTTTAPSFP---FDDPTIPWAKRKRSKRCSRDH------PSEEE-YLALCLI  50

Query  258  MLARG  272
            MLARG
Sbjct  51   MLARG  55



>gb|KCW63619.1| hypothetical protein EUGRSUZ_G01247, partial [Eucalyptus grandis]
Length=210

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (60%), Gaps = 13/67 (19%)
 Frame = +3

Query  84   MALEAMKS-SAVVTPPAPCVEVDDVHG---LKKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S +A  T        DD  G    K+KR+KRPR D       P+EEE YLALC
Sbjct  1    MALEALNSPTAAAT-----FGHDDADGHPWAKRKRSKRPRADPQDQ---PSEEE-YLALC  51

Query  252  LIMLARG  272
            LIMLARG
Sbjct  52   LIMLARG  58



>ref|XP_009101548.1| PREDICTED: zinc finger protein AZF1-like [Brassica rapa]
Length=221

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 6/66 (9%)
 Frame = +3

Query  84   MALEAMKS-SAVVTPPAPCV-EVDDVH-GLKKKRTKRPRGDESPALPPPTEEERYLALCL  254
            MAL+ + S ++  T P+P + E +++    K+KRTKR R D+     PP+EEE YLALCL
Sbjct  1    MALDTLNSPNSTTTAPSPFLTEPENLEPWTKRKRTKRHRIDDKSN--PPSEEE-YLALCL  57

Query  255  IMLARG  272
            +MLARG
Sbjct  58   LMLARG  63



>ref|XP_010065906.1| PREDICTED: zinc finger protein ZAT10-like [Eucalyptus grandis]
Length=244

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHG---LKKKRTKRPRGDESPALPPPTEEERYLALCL  254
            MALEA+ S       A     DD  G    K+KR+KRPR D       P+EEE YLALCL
Sbjct  1    MALEALNSPTA----AATFGHDDADGHPWAKRKRSKRPRADPQDQ---PSEEE-YLALCL  52

Query  255  IMLARG  272
            IMLARG
Sbjct  53   IMLARG  58



>ref|XP_009136527.1| PREDICTED: zinc finger protein AZF1 isoform X3 [Brassica rapa]
Length=124

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 7/66 (11%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCV-EVDDVHGL-KKKRTKRPRG-DESPALPPPTEEERYLALCL  254
            MAL+ + S    T P P + E +++    K+KRTKR R  D+S    PP+EEE YLA+CL
Sbjct  1    MALDTLNSPTSTTAPPPFLTEPENLESWTKRKRTKRHRTVDQSH---PPSEEE-YLAICL  56

Query  255  IMLARG  272
            +MLARG
Sbjct  57   LMLARG  62



>ref|NP_001275233.1| uncharacterized protein LOC102577828 [Solanum tuberosum]
 gb|ABK78777.1| zinc finger protein [Solanum tuberosum]
Length=266

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 11/66 (17%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            M++EA+KS      P P  E+DD H L    K KR+KRPR +      PPT ++ YLALC
Sbjct  1    MSIEALKSPTAAALP-PLEEIDDSHNLDSWAKGKRSKRPRIEN-----PPTPDQ-YLALC  53

Query  252  LIMLAR  269
            L+MLA 
Sbjct  54   LLMLAN  59



>emb|CDX68558.1| BnaC01g26360D [Brassica napus]
Length=222

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 6/66 (9%)
 Frame = +3

Query  84   MALEAMKS-SAVVTPPAPCV-EVDDVH-GLKKKRTKRPRGDESPALPPPTEEERYLALCL  254
            MAL+ + S ++  T P+P + E +++    K+KRTKR R D+     PP+EEE Y ALCL
Sbjct  1    MALDTLNSPNSTTTAPSPFLTEPENLEPWTKRKRTKRHRIDDQSN--PPSEEE-YFALCL  57

Query  255  IMLARG  272
            +MLARG
Sbjct  58   LMLARG  63



>gb|AFK36438.1| unknown [Medicago truncatula]
Length=236

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 10/82 (12%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVH----GLKKKRTKRPRGDESPALPPPTEEERYLALC  251
            MA+EA+ S    TP  P  E +  +      K KR+KR R D+S      TEEE YLALC
Sbjct  1    MAMEALNSPTTATPFTPFEEPNLSYLETPWTKGKRSKRSRMDQSSC----TEEE-YLALC  55

Query  252  LIMLAR-GEDPSRRQRDAPAEA  314
            LIMLAR G +   +    P  A
Sbjct  56   LIMLARSGNNNDNKTESVPVPA  77



>ref|NP_190562.1| C2H2-type zinc finger-containing protein [Arabidopsis thaliana]
 emb|CAB62101.1| zinc-finger-like protein [Arabidopsis thaliana]
 gb|ABK32191.1| At3g49930 [Arabidopsis thaliana]
 gb|AEE78608.1| C2H2-type zinc finger-containing protein [Arabidopsis thaliana]
Length=215

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 3/36 (8%)
 Frame = +3

Query  165  KKKRTKRPRGDESPALPPPTEEERYLALCLIMLARG  272
            K+KRTKR R D+    PPP+EEE YLALCL+MLARG
Sbjct  38   KRKRTKRHRIDQPN--PPPSEEE-YLALCLLMLARG  70



>ref|XP_011074364.1| PREDICTED: zinc finger protein ZAT10-like [Sesamum indicum]
Length=247

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 40/75 (53%), Gaps = 18/75 (24%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRG-----DESPALPPPTEEER  236
            MALEA+ S    T P P  + D         K KRTKRPR      D++P+      EE 
Sbjct  1    MALEALNSP---TAPPPSFKFDAATYFEPWTKGKRTKRPRSLGRLHDDAPS------EEE  51

Query  237  YLALCLIMLARGEDP  281
            YLALCL+MLARG  P
Sbjct  52   YLALCLVMLARGGAP  66



>gb|ACJ84409.1| unknown [Medicago truncatula]
 gb|KEH35805.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=236

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 10/82 (12%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVH----GLKKKRTKRPRGDESPALPPPTEEERYLALC  251
            MA+EA+ S    TP  P  E +  +      K KR+KR R D+S      TEEE YLALC
Sbjct  1    MAMEALNSPTTATPFTPFEEPNLSYLETPWTKGKRSKRSRMDQSSC----TEEE-YLALC  55

Query  252  LIMLAR-GEDPSRRQRDAPAEA  314
            LIMLAR G +   +    P  A
Sbjct  56   LIMLARSGNNNDNKTESVPVPA  77



>ref|XP_004290960.1| PREDICTED: zinc finger protein ZAT10-like [Fragaria vesca subsp. 
vesca]
Length=265

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +3

Query  165  KKKRTKRPRGDESPALPPPTEEERYLALCLIMLARGED  278
            K+KR+KRPR  E  A P    EE YLALCLIMLARG +
Sbjct  31   KRKRSKRPRSVEQAAAP--VSEEEYLALCLIMLARGGN  66



>ref|XP_009630807.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana tomentosiformis]
Length=230

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 11/94 (12%)
 Frame = +3

Query  84   MALEAMKSSAVVTPPAPCVEVDDVHGL----KKKRTKRPRGDESPALPPPTEEERYLALC  251
            MALEA+ S    TPP+   E   ++ L    K KR+KRPR   +     PTEEE YLA C
Sbjct  1    MALEALNSPRAPTPPSFQYENTTLNCLESWTKGKRSKRPR---TIMEQQPTEEE-YLAFC  56

Query  252  LIMLARGED---PSRRQRDAPAEAKVVSKESETV  344
            L+MLAR       S + +  P +   ++ +S+ +
Sbjct  57   LLMLARSNGNYTTSTKNQQPPQQISTLTSDSKNL  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510693543822