BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16256_g3_i1 len=774 path=[1705:0-773]

Length=774
                                                                      Score     E

ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              296   3e-96   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             288   1e-92   
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like              286   3e-92   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              286   4e-92   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              285   9e-92   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              285   2e-91   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              284   4e-91   
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              284   5e-91   
ref|XP_007033589.1|  Peroxidase superfamily protein                     283   1e-90   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              282   1e-90   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              282   1e-90   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              281   3e-90   
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              281   4e-90   
gb|ACJ11762.1|  class III peroxidase                                    281   6e-90   Gossypium hirsutum [American cotton]
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              280   1e-89   
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like              280   1e-89   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              280   2e-89   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          279   2e-89   
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like              279   4e-89   
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              279   4e-89   
gb|KHN29529.1|  Cationic peroxidase 1                                   278   5e-89   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              277   2e-88   
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              277   2e-88   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              276   2e-88   
gb|AAB02554.1|  cationic peroxidase                                     276   3e-88   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like              276   4e-88   
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              276   4e-88   
ref|XP_010256954.1|  PREDICTED: cationic peroxidase 1-like              276   5e-88   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              275   1e-87   
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              273   4e-87   
gb|AIE12239.1|  peroxide                                                274   4e-87   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              273   4e-87   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              273   5e-87   
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g             273   5e-87   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              273   6e-87   
ref|XP_010683553.1|  PREDICTED: cationic peroxidase 1-like              273   6e-87   
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              273   8e-87   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   272   2e-86   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              271   2e-86   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              271   2e-86   
ref|XP_010093550.1|  Cationic peroxidase 1                              271   3e-86   
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             270   4e-86   
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              270   5e-86   
dbj|BAA77389.1|  peroxidase 3                                           270   9e-86   Scutellaria baicalensis [Baikal skullcap]
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              270   1e-85   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  269   1e-85   
gb|KHN40655.1|  Cationic peroxidase 1                                   270   2e-85   
gb|AII99880.1|  peroxidase                                              269   2e-85   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       269   2e-85   
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    269   3e-85   Arachis hypogaea [goober]
ref|XP_011070595.1|  PREDICTED: lignin-forming anionic peroxidase...    269   3e-85   
ref|XP_011070600.1|  PREDICTED: lignin-forming anionic peroxidase...    268   3e-85   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             268   4e-85   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              268   5e-85   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              268   6e-85   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              267   9e-85   
ref|XP_003623567.1|  Peroxidase                                         267   1e-84   
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like              267   1e-84   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              268   2e-84   
ref|XP_009371986.1|  PREDICTED: cationic peroxidase 1-like isofor...    266   2e-84   
ref|XP_011070596.1|  PREDICTED: lignin-forming anionic peroxidase...    266   4e-84   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       266   4e-84   
gb|KHN46100.1|  Cationic peroxidase 1                                   265   5e-84   
gb|AFK43134.1|  unknown                                                 265   6e-84   
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                265   6e-84   
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             265   7e-84   
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              265   8e-84   
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like              265   1e-83   
gb|AHL39176.1|  class III peroxidase                                    265   1e-83   
ref|XP_003623564.1|  Peroxidase                                         265   1e-83   
gb|AFR44628.1|  class III secretory peroxidase                          264   2e-83   
ref|XP_009371985.1|  PREDICTED: cationic peroxidase 1-like isofor...    264   2e-83   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like              265   3e-83   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              263   4e-83   
ref|NP_001289531.1|  lignin-forming anionic peroxidase precursor        263   4e-83   
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                263   6e-83   
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        263   7e-83   Vitis vinifera
ref|XP_010264471.1|  PREDICTED: cationic peroxidase 1-like              263   7e-83   
ref|XP_010066274.1|  PREDICTED: cationic peroxidase 1-like              262   9e-83   
gb|ACZ51443.1|  peroxidase protein                                      262   1e-82   
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   262   2e-82   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      261   2e-82   
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                261   2e-82   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like              261   5e-82   
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              260   5e-82   
ref|XP_007208188.1|  hypothetical protein PRUPE_ppa020902mg             261   6e-82   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  260   6e-82   Ricinus communis
gb|AFK46186.1|  unknown                                                 259   9e-82   
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              260   1e-81   
ref|XP_002319407.1|  peroxidase family protein                          259   1e-81   Populus trichocarpa [western balsam poplar]
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    259   1e-81   
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              259   2e-81   
ref|XP_004492537.1|  PREDICTED: cationic peroxidase 1-like              259   2e-81   
emb|CBI19220.3|  unnamed protein product                                261   2e-81   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        258   3e-81   Vitis vinifera
dbj|BAA77388.1|  peroxidase 2                                           259   3e-81   Scutellaria baicalensis [Baikal skullcap]
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor     259   3e-81   
ref|NP_001065566.1|  Os11g0112200                                       258   4e-81   Oryza sativa Japonica Group [Japonica rice]
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                258   4e-81   
ref|NP_001057822.1|  Os06g0547400                                       258   4e-81   Oryza sativa Japonica Group [Japonica rice]
dbj|BAM28609.1|  putative peroxidase                                    258   5e-81   
dbj|BAM28608.1|  putative peroxidase                                    258   5e-81   
dbj|BAJ95101.1|  predicted protein                                      258   6e-81   
ref|XP_009603345.1|  PREDICTED: lignin-forming anionic peroxidase...    258   7e-81   
ref|XP_006470886.1|  PREDICTED: lignin-forming anionic peroxidase...    257   7e-81   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       258   8e-81   
ref|XP_010683552.1|  PREDICTED: cationic peroxidase 1-like              258   8e-81   
ref|XP_006657042.1|  PREDICTED: peroxidase P7-like                      257   9e-81   
emb|CDP07980.1|  unnamed protein product                                257   1e-80   
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              257   1e-80   
ref|XP_009781728.1|  PREDICTED: lignin-forming anionic peroxidase...    256   1e-80   
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      257   1e-80   
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        256   1e-80   
ref|XP_009608056.1|  PREDICTED: lignin-forming anionic peroxidase       257   1e-80   
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              256   2e-80   
dbj|BAM28607.1|  putative peroxidase                                    256   2e-80   
ref|XP_011070598.1|  PREDICTED: lignin-forming anionic peroxidase...    256   2e-80   
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like              256   2e-80   
emb|CAH10839.1|  peroxidase                                             256   2e-80   Picea abies
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...    256   2e-80   
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       255   3e-80   
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          256   3e-80   Sorghum bicolor [broomcorn]
ref|XP_011070599.1|  PREDICTED: lignin-forming anionic peroxidase...    256   3e-80   
ref|XP_011070597.1|  PREDICTED: lignin-forming anionic peroxidase...    256   3e-80   
ref|NP_001060627.1|  Os07g0677100                                       256   3e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       256   3e-80   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       256   4e-80   
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              256   4e-80   
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       255   4e-80   
gb|ABR18139.1|  unknown                                                 256   4e-80   Picea sitchensis
ref|XP_010066439.1|  PREDICTED: cationic peroxidase 1-like              256   4e-80   
dbj|BAK03677.1|  predicted protein                                      255   4e-80   
gb|ACF08084.1|  class III peroxidase                                    255   4e-80   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      255   5e-80   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              255   5e-80   
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             255   6e-80   
ref|NP_001060629.1|  Os07g0677300                                       255   6e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228647.1|  PREDICTED: peroxidase 2-like                       255   7e-80   
sp|A2YPX3.2|PER2_ORYSI  RecName: Full=Peroxidase 2; Flags: Precursor    255   7e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       255   7e-80   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            255   8e-80   Vitis vinifera
gb|AAW52717.1|  peroxidase 3                                            254   9e-80   Triticum monococcum [einkorn wheat]
ref|XP_006351919.1|  PREDICTED: lignin-forming anionic peroxidase...    254   1e-79   
ref|XP_008465298.1|  PREDICTED: peroxidase 4-like                       254   1e-79   
ref|XP_002509733.1|  Lignin-forming anionic peroxidase precursor,...    254   1e-79   Ricinus communis
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           254   1e-79   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      254   2e-79   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      254   2e-79   
ref|XP_002461208.1|  hypothetical protein SORBIDRAFT_02g042850          254   2e-79   Sorghum bicolor [broomcorn]
emb|CAA59485.1|  peroxidase                                             254   2e-79   Triticum aestivum [Canadian hard winter wheat]
gb|AAP76387.1|  class III peroxidase                                    254   2e-79   Gossypium hirsutum [American cotton]
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              254   2e-79   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      254   2e-79   
ref|XP_006658123.1|  PREDICTED: peroxidase 2-like                       253   3e-79   
gb|AAC49819.1|  peroxidase                                              253   3e-79   Oryza sativa [red rice]
ref|XP_002509737.1|  Lignin-forming anionic peroxidase precursor,...    253   3e-79   Ricinus communis
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like              253   3e-79   
emb|CDX98835.1|  BnaC09g50000D                                          253   3e-79   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             253   3e-79   
ref|XP_010915493.1|  PREDICTED: peroxidase P7-like                      253   3e-79   
ref|XP_004958682.1|  PREDICTED: peroxidase 2-like                       253   4e-79   
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      253   4e-79   
ref|XP_004958681.1|  PREDICTED: peroxidase 2-like                       253   4e-79   
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           253   4e-79   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              253   4e-79   
emb|CAL25300.1|  properoxidase                                          253   4e-79   Picea abies
ref|XP_003562452.1|  PREDICTED: peroxidase 2-like                       253   4e-79   
ref|XP_006658125.1|  PREDICTED: peroxidase 2-like                       253   5e-79   
ref|XP_006361366.1|  PREDICTED: lignin-forming anionic peroxidase...    253   5e-79   
gb|KGN47223.1|  hypothetical protein Csa_6G216420                       252   5e-79   
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1            253   5e-79   
ref|XP_006658124.1|  PREDICTED: peroxidase 2-like                       253   6e-79   
gb|ABK23423.1|  unknown                                                 253   6e-79   Picea sitchensis
ref|XP_004150607.1|  PREDICTED: peroxidase 4-like                       253   6e-79   
emb|CAH10840.1|  peroxidase                                             253   6e-79   Picea abies
ref|NP_196153.1|  peroxidase 52                                         253   6e-79   Arabidopsis thaliana [mouse-ear cress]
gb|ACF70702.1|  root peroxidase                                         252   6e-79   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       252   7e-79   
gb|ACT35473.1|  peroxidase 52                                           252   7e-79   Brassica rapa
gb|KHN44723.1|  Peroxidase 4                                            252   7e-79   
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             252   8e-79   
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      252   8e-79   
emb|CDX70158.1|  BnaA10g25070D                                          252   8e-79   
emb|CAD67477.1|  peroxidase                                             252   9e-79   Asparagus officinalis
gb|KDP22793.1|  hypothetical protein JCGZ_00380                         251   9e-79   
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       252   9e-79   
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              252   1e-78   
ref|XP_011080818.1|  PREDICTED: uncharacterized protein LOC105163979    262   1e-78   
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                       252   1e-78   
ref|XP_003545648.1|  PREDICTED: peroxidase 4                            252   1e-78   
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg             252   1e-78   
dbj|BAJ86726.1|  predicted protein                                      251   1e-78   
ref|NP_001054096.1|  Os04g0651000                                       251   1e-78   Oryza sativa Japonica Group [Japonica rice]
emb|CBI19219.3|  unnamed protein product                                255   2e-78   
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    251   2e-78   
gb|AAW52715.1|  peroxidase 1                                            251   2e-78   Triticum monococcum [einkorn wheat]
gb|EMS51084.1|  Peroxidase 2                                            251   2e-78   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           251   2e-78   
gb|ACF70703.1|  root peroxidase                                         251   2e-78   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       251   2e-78   
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                251   2e-78   
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       251   2e-78   
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   251   2e-78   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         251   2e-78   
emb|CDP08160.1|  unnamed protein product                                251   3e-78   
gb|ACF08086.1|  class III peroxidase                                    251   3e-78   Triticum aestivum [Canadian hard winter wheat]
gb|ABF48527.1|  cell wall peroxidase                                    251   3e-78   Capsicum annuum
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       251   3e-78   
gb|ACF08085.1|  class III peroxidase                                    250   3e-78   Aegilops ventricosa
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      251   3e-78   
ref|XP_011032836.1|  PREDICTED: lignin-forming anionic peroxidase...    250   4e-78   
ref|XP_009801852.1|  PREDICTED: lignin-forming anionic peroxidase...    251   4e-78   
emb|CDP16309.1|  unnamed protein product                                250   4e-78   
gb|ACD87898.1|  class III peroxidase                                    250   6e-78   Aegilops ventricosa
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      250   6e-78   
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         250   7e-78   
gb|AAL93151.1|AF485265_1  class III peroxidase                          250   7e-78   Gossypium hirsutum [American cotton]
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       250   7e-78   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                250   7e-78   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       250   8e-78   
gb|ACF70708.1|  root peroxidase                                         249   9e-78   Triticum aestivum [Canadian hard winter wheat]
gb|ACF70706.1|  root peroxidase                                         249   9e-78   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008374518.1|  PREDICTED: peroxidase P7-like isoform X2           249   9e-78   
emb|CAD67478.1|  peroxidase                                             249   9e-78   Asparagus officinalis
gb|ACF08096.1|  class III peroxidase                                    249   9e-78   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      249   1e-77   
dbj|BAJ90866.1|  predicted protein                                      249   1e-77   
tpg|DAA64106.1|  TPA: peroxidase J                                      249   1e-77   
dbj|BAA82306.1|  peroxidase                                             249   1e-77   Nicotiana tabacum [American tobacco]
gb|ACF70705.1|  root peroxidase                                         249   1e-77   Triticum aestivum [Canadian hard winter wheat]
gb|ACF70710.1|  root peroxidase                                         249   1e-77   Triticum aestivum [Canadian hard winter wheat]
gb|ACF70701.1|  root peroxidase                                         249   1e-77   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008374548.1|  PREDICTED: peroxidase 4-like isoform X2            249   1e-77   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         249   1e-77   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      249   1e-77   
emb|CAA59484.1|  pox1                                                   249   1e-77   Triticum aestivum [Canadian hard winter wheat]
gb|ACF08094.1|  class III peroxidase                                    249   1e-77   Triticum aestivum [Canadian hard winter wheat]
gb|ACF70709.1|  root peroxidase                                         249   2e-77   Triticum aestivum [Canadian hard winter wheat]
gb|AAW52718.1|  peroxidase 4                                            249   2e-77   Triticum monococcum [einkorn wheat]
ref|NP_001060628.1|  Os07g0677200                                       249   2e-77   Oryza sativa Japonica Group [Japonica rice]
gb|ACF08087.1|  class III peroxidase                                    249   2e-77   Triticum aestivum [Canadian hard winter wheat]
gb|ACF08095.1|  class III peroxidase                                    249   2e-77   Triticum aestivum [Canadian hard winter wheat]
gb|EMT15847.1|  Peroxidase 2                                            249   2e-77   
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    249   2e-77   
ref|XP_004250402.1|  PREDICTED: lignin-forming anionic peroxidase       249   2e-77   
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           249   2e-77   
emb|CAD67479.1|  peroxidase                                             249   2e-77   Asparagus officinalis
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    248   2e-77   Brassica rapa subsp. rapa
gb|AFK49124.1|  unknown                                                 248   2e-77   
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                       249   2e-77   
ref|XP_008374993.1|  PREDICTED: peroxidase 4-like                       248   2e-77   
gb|ACF08090.1|  class III peroxidase                                    248   2e-77   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001169452.1|  uncharacterized protein LOC100383323 precursor     248   2e-77   Zea mays [maize]
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       249   3e-77   
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like              248   3e-77   Vitis vinifera
emb|CAA59486.1|  peroxidase                                             247   3e-77   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007011212.1|  Peroxidase superfamily protein                     248   3e-77   
ref|XP_007011229.1|  Peroxidase superfamily protein                     248   3e-77   
ref|XP_006658122.1|  PREDICTED: peroxidase 70-like                      248   3e-77   
gb|KHG18057.1|  Peroxidase 52 -like protein                             248   3e-77   
ref|XP_009620122.1|  PREDICTED: lignin-forming anionic peroxidase...    248   4e-77   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      248   4e-77   
ref|XP_006470943.1|  PREDICTED: lignin-forming anionic peroxidase...    248   4e-77   
gb|KHG09190.1|  Peroxidase 4                                            248   4e-77   
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...    248   4e-77   
gb|ACF70707.1|  root peroxidase                                         248   5e-77   Triticum aestivum [Canadian hard winter wheat]
emb|CAA46916.1|  peroxidase                                             248   5e-77   Oryza sativa [red rice]
ref|XP_006470944.1|  PREDICTED: lignin-forming anionic peroxidase...    248   5e-77   
gb|AAR31106.1|  peroxidase precursor                                    248   5e-77   Quercus suber [cork oak]
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       248   5e-77   
ref|XP_008463814.1|  PREDICTED: peroxidase 4-like                       248   5e-77   
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                      247   6e-77   
gb|ACM47317.1|  peroxidase                                              248   6e-77   Capsicum annuum
ref|XP_004140410.1|  PREDICTED: lignin-forming anionic peroxidase...    247   6e-77   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       247   7e-77   
gb|AHL39158.1|  class III peroxidase                                    247   7e-77   
ref|XP_002461210.1|  hypothetical protein SORBIDRAFT_02g042860          247   7e-77   Sorghum bicolor [broomcorn]
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      247   7e-77   
ref|XP_007132831.1|  hypothetical protein PHAVU_011G128200g             247   7e-77   
gb|EEC82681.1|  hypothetical protein OsI_27325                          247   7e-77   
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      247   8e-77   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            247   8e-77   
gb|ACD70388.1|  class III peroxidase                                    247   9e-77   
gb|KEH34417.1|  cationic peroxidase                                     247   9e-77   
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010          247   9e-77   
ref|XP_007219210.1|  hypothetical protein PRUPE_ppa017309mg             246   1e-76   
gb|EMS51676.1|  Peroxidase 2                                            249   1e-76   
ref|NP_001060631.1|  Os07g0677500                                       246   1e-76   
ref|XP_009363835.1|  PREDICTED: peroxidase 4-like                       247   1e-76   
ref|XP_006351920.1|  PREDICTED: lignin-forming anionic peroxidase...    247   1e-76   
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      247   1e-76   
gb|ABK21858.1|  unknown                                                 247   1e-76   
ref|XP_010246463.1|  PREDICTED: peroxidase P7-like                      246   1e-76   
ref|XP_009408893.1|  PREDICTED: peroxidase P7-like                      246   1e-76   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                      251   1e-76   
ref|XP_002974373.1|  hypothetical protein SELMODRAFT_101253             246   2e-76   
gb|ACF08083.1|  class III peroxidase                                    246   2e-76   
ref|XP_006379469.1|  hypothetical protein POPTR_0008s02330g             246   2e-76   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            246   2e-76   
gb|AAR31108.1|  peroxidase precursor                                    247   2e-76   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          246   2e-76   
ref|XP_009369253.1|  PREDICTED: peroxidase 4-like                       246   2e-76   
gb|AAF65464.2|AF247700_1  peroxidase POC1                               246   2e-76   
ref|XP_010030093.1|  PREDICTED: lignin-forming anionic peroxidase...    246   2e-76   
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                      246   2e-76   
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        246   2e-76   
gb|AAC49818.1|  peroxidase                                              246   2e-76   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            246   2e-76   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                       246   3e-76   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             246   3e-76   
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      246   3e-76   
ref|XP_002509738.1|  Lignin-forming anionic peroxidase precursor,...    246   3e-76   
ref|XP_004965567.1|  PREDICTED: peroxidase 4-like                       246   3e-76   
gb|KHG00581.1|  hypothetical protein F383_17561                         255   3e-76   
ref|XP_002521867.1|  Lignin-forming anionic peroxidase precursor,...    246   4e-76   
emb|CDY04948.1|  BnaAnng01300D                                          246   4e-76   
ref|XP_002311022.2|  hypothetical protein POPTR_0008s02340g             245   4e-76   
ref|XP_007017044.1|  Peroxidase 68                                      253   4e-76   
emb|CBI15847.3|  unnamed protein product                                243   4e-76   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             245   4e-76   
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           245   4e-76   
ref|XP_006848018.1|  hypothetical protein AMTR_s00029p00173190          245   5e-76   
ref|XP_002319968.2|  peroxidase family protein                          245   5e-76   
emb|CDY14118.1|  BnaC02g02350D                                          245   5e-76   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      245   5e-76   
gb|EAZ01280.1|  hypothetical protein OsI_23303                          245   5e-76   
ref|XP_006848008.1|  hypothetical protein AMTR_s00029p00168370          245   5e-76   
ref|XP_007048724.1|  Peroxidase superfamily protein                     245   5e-76   
ref|XP_002438534.1|  hypothetical protein SORBIDRAFT_10g021650          245   6e-76   
gb|AEX20390.1|  putative class III peroxidase                           243   6e-76   
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                      244   7e-76   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                       245   7e-76   
ref|XP_008385017.1|  PREDICTED: cationic peroxidase 1-like              244   7e-76   
dbj|BAJ90658.1|  predicted protein                                      244   7e-76   
dbj|BAM05634.1|  peroxidase 2                                           245   8e-76   
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       244   8e-76   
ref|XP_004150606.1|  PREDICTED: peroxidase 4-like                       244   8e-76   
gb|AAX53172.1|  peroxidase                                              244   8e-76   
dbj|BAD54117.1|  putative bacterial-induced peroxidase precursor        244   8e-76   
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             244   9e-76   
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      244   9e-76   
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       244   9e-76   
tpe|CAH69352.1|  TPA: class III peroxidase 110 precursor                244   1e-75   
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                      244   1e-75   
ref|XP_006348978.1|  PREDICTED: peroxidase 52-like                      244   1e-75   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      244   1e-75   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      244   1e-75   
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                      244   1e-75   
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           244   1e-75   
gb|AAB97854.1|  ferriprotein porphyrin-containing peroxidase            244   1e-75   
emb|CAN73051.1|  hypothetical protein VITISV_015511                     243   1e-75   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      244   1e-75   
ref|XP_008790007.1|  PREDICTED: peroxidase P7-like                      244   1e-75   
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           244   1e-75   
emb|CAA39486.1|  peroxidase                                             244   1e-75   
ref|XP_010261059.1|  PREDICTED: cationic peroxidase 1-like isofor...    244   1e-75   
ref|XP_008244108.1|  PREDICTED: peroxidase 4                            244   2e-75   
gb|EYU30097.1|  hypothetical protein MIMGU_mgv1a010056mg                244   2e-75   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             244   2e-75   
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             244   2e-75   
sp|Q05855.1|PER1_WHEAT  RecName: Full=Peroxidase; AltName: Full=W...    243   2e-75   
gb|AAA20473.1|  peroxidase                                              243   2e-75   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           243   2e-75   
gb|AAP42508.1|  anionic peroxidase swpb3                                243   2e-75   
ref|NP_001057821.2|  Os06g0547100                                       244   2e-75   
dbj|BAM05637.1|  peroxidase 2                                           244   2e-75   
emb|CDP06406.1|  unnamed protein product                                250   2e-75   
gb|KDP22794.1|  hypothetical protein JCGZ_00381                         243   3e-75   
dbj|BAM05635.1|  peroxidase 2                                           244   3e-75   
ref|XP_002461211.1|  hypothetical protein SORBIDRAFT_02g042870          243   3e-75   
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      243   3e-75   
ref|XP_004145303.1|  PREDICTED: cationic peroxidase 1-like              243   3e-75   
gb|ABK25962.1|  unknown                                                 243   3e-75   
ref|XP_008457311.1|  PREDICTED: cationic peroxidase 1-like              243   3e-75   
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       243   3e-75   
ref|NP_001057820.1|  Os06g0546500                                       243   4e-75   
emb|CBI18066.3|  unnamed protein product                                241   4e-75   
ref|XP_002467656.1|  hypothetical protein SORBIDRAFT_01g031740          243   4e-75   
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             243   4e-75   
emb|CAA62597.1|  korean-radish isoperoxidase                            243   4e-75   
ref|XP_007134676.1|  hypothetical protein PHAVU_010G066600g             243   4e-75   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       243   4e-75   
ref|XP_008465299.1|  PREDICTED: peroxidase 4-like                       243   5e-75   
ref|XP_002320417.1|  peroxidase family protein                          243   5e-75   
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...    243   5e-75   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          242   5e-75   
ref|XP_004958684.1|  PREDICTED: peroxidase 2-like                       242   5e-75   
ref|XP_011024237.1|  PREDICTED: lignin-forming anionic peroxidase...    242   5e-75   
ref|XP_010270786.1|  PREDICTED: lignin-forming anionic peroxidase...    242   6e-75   
emb|CAA59487.1|  peroxidase                                             242   6e-75   
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      242   6e-75   
gb|KEH29223.1|  class III peroxidase                                    243   6e-75   
gb|EYU30094.1|  hypothetical protein MIMGU_mgv1a0094071mg               243   6e-75   
gb|AAB97853.1|  ferriprotein porphyrin-containing peroxidase            242   7e-75   
emb|CDP04065.1|  unnamed protein product                                242   7e-75   
ref|XP_010270787.1|  PREDICTED: lignin-forming anionic peroxidase...    242   7e-75   
ref|XP_006652927.1|  PREDICTED: peroxidase 2-like                       242   7e-75   
ref|XP_004958685.1|  PREDICTED: peroxidase 66-like                      242   7e-75   
ref|XP_006370761.1|  Peroxidase 4 precursor family protein              242   8e-75   
ref|XP_011003587.1|  PREDICTED: cationic peroxidase 1-like              242   8e-75   
ref|NP_001147216.1|  LOC100280824 precursor                             242   8e-75   
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      242   8e-75   
ref|XP_003601028.1|  Peroxidase                                         242   1e-74   
gb|AFW86738.1|  peroxidase 52 isoform 1                                 241   1e-74   
ref|XP_006657041.1|  PREDICTED: peroxidase 4-like                       242   1e-74   
gb|KEH29221.1|  peroxidase family protein                               241   1e-74   
gb|EEE67815.1|  hypothetical protein OsJ_25569                          242   1e-74   
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       242   1e-74   
ref|XP_002323054.1|  hypothetical protein POPTR_0016s14030g             241   1e-74   
gb|ACG40622.1|  peroxidase 2 precursor                                  242   1e-74   
gb|KDP25492.1|  hypothetical protein JCGZ_20648                         241   1e-74   
gb|EAZ01279.1|  hypothetical protein OsI_23302                          241   1e-74   
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           241   1e-74   
ref|XP_010915492.1|  PREDICTED: peroxidase P7-like                      241   2e-74   
ref|XP_002299006.2|  hypothetical protein POPTR_0001s46290g             241   2e-74   
ref|XP_006468993.1|  PREDICTED: peroxidase 52-like                      241   2e-74   
gb|KHN46282.1|  Peroxidase 4                                            241   2e-74   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       241   2e-74   
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                       241   2e-74   
gb|EMT26113.1|  Peroxidase 4                                            241   2e-74   
ref|XP_009419858.1|  PREDICTED: cationic peroxidase 1-like              241   2e-74   
ref|XP_008455297.1|  PREDICTED: peroxidase P7-like                      241   2e-74   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             241   2e-74   
gb|ACI03401.1|  peroxidase 1                                            241   2e-74   
gb|KDP25488.1|  hypothetical protein JCGZ_20644                         241   2e-74   
gb|EYU30095.1|  hypothetical protein MIMGU_mgv1a021792mg                241   2e-74   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      241   2e-74   
ref|XP_009419701.1|  PREDICTED: cationic peroxidase 1-like              241   3e-74   
ref|XP_004958683.1|  PREDICTED: peroxidase 66-like                      240   3e-74   
gb|ACU24215.1|  unknown                                                 241   3e-74   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           241   3e-74   
gb|EEE67819.1|  hypothetical protein OsJ_25574                          240   3e-74   
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      241   3e-74   
ref|XP_008792262.1|  PREDICTED: peroxidase 4-like                       248   3e-74   
ref|XP_003540000.1|  PREDICTED: peroxidase 52                           241   3e-74   
emb|CAN81400.1|  hypothetical protein VITISV_038539                     240   3e-74   
gb|EYU30092.1|  hypothetical protein MIMGU_mgv1a010078mg                241   3e-74   
gb|EMT23342.1|  Peroxidase 1                                            240   3e-74   
ref|XP_010032327.1|  PREDICTED: peroxidase P7-like                      241   3e-74   
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       241   3e-74   
gb|KDO63401.1|  hypothetical protein CISIN_1g020966mg                   240   3e-74   
dbj|BAK02942.1|  predicted protein                                      240   4e-74   
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       242   4e-74   
gb|EEC82684.1|  hypothetical protein OsI_27330                          239   5e-74   
gb|KHG17773.1|  Peroxidase 52 -like protein                             240   5e-74   
ref|XP_004497330.1|  PREDICTED: cationic peroxidase 1-like              240   5e-74   
gb|EMT02792.1|  Peroxidase 52                                           240   5e-74   
ref|XP_011038117.1|  PREDICTED: lignin-forming anionic peroxidase...    240   5e-74   
emb|CDX80957.1|  BnaC03g02110D                                          240   5e-74   
gb|AAB48184.1|  peroxidase precursor                                    240   6e-74   
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      239   6e-74   
ref|XP_011013621.1|  PREDICTED: lignin-forming anionic peroxidase...    239   7e-74   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                240   8e-74   
gb|KDP25489.1|  hypothetical protein JCGZ_20645                         239   8e-74   
ref|XP_003596716.1|  Peroxidase                                         239   8e-74   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      239   8e-74   
gb|EPS58869.1|  peroxidase                                              239   9e-74   
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...    239   9e-74   
ref|NP_001167809.1|  hypothetical protein precursor                     239   1e-73   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            239   1e-73   
ref|XP_003602462.1|  Peroxidase                                         239   1e-73   
gb|EMS66092.1|  Peroxidase 52                                           240   1e-73   
gb|EEC78144.1|  hypothetical protein OsI_17703                          239   1e-73   
emb|CAB99487.1|  peroxidase                                             238   1e-73   
ref|XP_002517727.1|  Cationic peroxidase 1 precursor, putative          237   1e-73   
ref|XP_009369619.1|  PREDICTED: cationic peroxidase 1-like              246   1e-73   
gb|ABV24960.2|  putative secretory peroxidase                           239   1e-73   
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      239   1e-73   
dbj|BAK07852.1|  predicted protein                                      239   1e-73   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       239   1e-73   
ref|XP_004505714.1|  PREDICTED: lignin-forming anionic peroxidase...    238   1e-73   
ref|XP_009381204.1|  PREDICTED: peroxidase P7-like                      239   1e-73   
ref|XP_009405595.1|  PREDICTED: peroxidase 2-like                       238   1e-73   
gb|EAZ05133.1|  hypothetical protein OsI_27326                          239   1e-73   
ref|XP_004965566.1|  PREDICTED: peroxidase 52-like                      240   1e-73   
emb|CBI22007.3|  unnamed protein product                                242   1e-73   
emb|CAJ86184.1|  H0212B02.16                                            239   1e-73   
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                      239   2e-73   
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g             239   2e-73   
ref|XP_010270789.1|  PREDICTED: lignin-forming anionic peroxidase...    239   2e-73   
ref|XP_002521868.1|  Lignin-forming anionic peroxidase precursor,...    239   2e-73   
ref|XP_002437128.1|  hypothetical protein SORBIDRAFT_10g021610          238   2e-73   
gb|AAY89058.1|  class III peroxidase                                    239   2e-73   
ref|XP_008450825.1|  PREDICTED: peroxidase P7-like                      238   2e-73   
ref|XP_004958164.1|  PREDICTED: peroxidase 70-like                      239   2e-73   
gb|AAX44001.2|  putative secretory peroxidase                           238   2e-73   
ref|XP_010233996.1|  PREDICTED: peroxidase 2-like                       238   2e-73   
emb|CBI27505.3|  unnamed protein product                                238   2e-73   
gb|AFK41406.1|  unknown                                                 238   2e-73   
gb|ACU17608.1|  unknown                                                 238   3e-73   
ref|XP_006378807.1|  hypothetical protein POPTR_0010s24330g             238   3e-73   
gb|EPS73958.1|  peroxidase 3                                            238   3e-73   
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1                238   3e-73   
ref|NP_001106040.1|  peroxidase 70 precursor                            238   3e-73   
gb|AHL39166.1|  class III peroxidase                                    238   3e-73   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      238   3e-73   
ref|XP_010925617.1|  PREDICTED: peroxidase P7-like                      238   3e-73   
ref|XP_007045349.1|  Lignin-forming anionic peroxidase                  238   3e-73   
ref|XP_003522012.2|  PREDICTED: cationic peroxidase 1-like              240   4e-73   
ref|XP_002269058.1|  PREDICTED: lignin-forming anionic peroxidase...    238   4e-73   



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score =   296 bits (759),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 181/239 (76%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SSA  LS +FYS +CPN LS IKTAV++AV+S+    A+LL LHF DCF+NGCD SVLL 
Sbjct  19   SSAQSLSANFYSSSCPNVLSVIKTAVNSAVSSEARMGASLLRLHFHDCFVNGCDASVLLD  78

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T+N        P     RG +VI  IKTQ+E  C G+VSCADIL +A RD++V +GGPS
Sbjct  79   DTSNFTGEKTAGPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGPS  138

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W+V LGRRDSTT S  A ++ +PGP S+L+ LISSF+NKG TAR+MVALSGSHTIG+A C
Sbjct  139  WTVLLGRRDSTTASLSAANSNLPGPTSSLSALISSFSNKGLTAREMVALSGSHTIGQARC  198

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              FR R+YN+++I+AS+A  +++ CPQSGGD N  PLDIT+P  FDNAY+KNLQ QKGL
Sbjct  199  TTFRTRLYNEANINASFATTVKANCPQSGGDNNLSPLDITSPTSFDNAYYKNLQIQKGL  257



>ref|XP_007205557.1| hypothetical protein PRUPE_ppa008642mg [Prunus persica]
 gb|EMJ06756.1| hypothetical protein PRUPE_ppa008642mg [Prunus persica]
Length=324

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 178/235 (76%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FYS +CPNALSTIK+AV +AV+S+    A+LL LHF DCF+NGCD SVLL +T  
Sbjct  31   QLSPTFYSTSCPNALSTIKSAVASAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTAS  90

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IKTQLE LC  VVSCADILT+A RD+IV +GGP+++V 
Sbjct  91   LTGEKTAGPNANSLRGFDVIDTIKTQLESLCPKVVSCADILTVAARDSIVALGGPTYTVP  150

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S  A ++ IPGP  NL  LIS+F+NKGFTAR+MVALSGSHTIG+A C  FR
Sbjct  151  LGRRDATTASLSAANSNIPGPQLNLAALISAFSNKGFTAREMVALSGSHTIGQARCTTFR  210

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+YN+++I+AS+A  ++S+CP SGGD    PLD+T+P  FDNAY++NL SQKGL
Sbjct  211  NRLYNEANINASFATSVKSQCPSSGGDNTLSPLDVTSPTSFDNAYYRNLVSQKGL  265



>ref|XP_011095107.1| PREDICTED: cationic peroxidase 1-like [Sesamum indicum]
Length=321

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 174/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYS TCPN LS IKTAV +AV  D    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  28   QLSSNFYSSTCPNLLSIIKTAVDSAVRGDARMGASLLRLHFHDCFVNGCDASVLLDDTAN  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG +VI  IKTQ+E  C G+VSCADIL++A RD +V + GPSW+V+
Sbjct  88   FTGEKTAAPNVNSLRGFDVIDTIKTQVESSCPGIVSCADILSVAARDGVVALNGPSWAVA  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ IPGP  NL  LI+SF+NKGFTAR+MVALSGSHTIG+A C  FR
Sbjct  148  LGRRDSTTASLSAANSQIPGPNLNLNALITSFSNKGFTAREMVALSGSHTIGQARCTTFR  207

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYN+++I+AS+AA +R+ CPQSGG+ N  PLD+ +P +F+N YF+NL S +GL
Sbjct  208  NRIYNEANINASFAASVRANCPQSGGNNNLSPLDVVSPNVFNNDYFRNLLSLRGL  262



>ref|XP_008245160.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=324

 Score =   286 bits (733),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 176/235 (75%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FYS +CPNALSTIK+AV +AV+ +    A+LL LHF DCF+NGCD SVLL +T  
Sbjct  31   QLSPTFYSTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTAS  90

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  VI  IKTQLE LC  VVSCADILT+A RD+IV +GGP+++V 
Sbjct  91   LTGEKTAGPNANSLRGFEVIDTIKTQLESLCPKVVSCADILTVAARDSIVALGGPTYTVP  150

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S  A ++ IPGP  NL  LIS+F+NKGFTAR+MVALSGSHTIG+A C  FR
Sbjct  151  LGRRDATTASLSAANSNIPGPQLNLAALISAFSNKGFTAREMVALSGSHTIGQARCTTFR  210

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+YN+++I+AS+A  ++++CP SGGD    PLD+T+P  FDNAYF+NL SQKGL
Sbjct  211  NRLYNEANINASFATSVKTQCPSSGGDNTLSPLDVTSPTSFDNAYFRNLVSQKGL  265



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   285 bits (730),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 176/238 (74%), Gaps = 9/238 (4%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  L+ +FYS TCPN LS IKTAV++A++ +    A+LL LHF DCF+NGCD SVLL +
Sbjct  19   SSAELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDD  78

Query  265  TT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T+        NP     RG +VI  IKTQ+E  C GVVSCADIL +A RD++V +GGPSW
Sbjct  79   TSSFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSW  138

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S  A +  IP P  NL+ LISSF+NKGF AR+MVALSGSHTIG+A C 
Sbjct  139  NVLLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNAREMVALSGSHTIGQARCT  198

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR+R+YN+++I++S+   +++ CPQ+GGD N  PLD T+P  FDNAY+KNLQSQKG+
Sbjct  199  TFRDRLYNETNINSSFGTSIKANCPQNGGDNNLSPLD-TSPTTFDNAYYKNLQSQKGI  255



>ref|XP_010041557.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 174/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS +CP+ALSTIK+AV +AV S+    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  26   QLSSTFYSTSCPSALSTIKSAVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTAN  85

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+QLE  C GVVSCAD+LT+A RD++V +GGPSW+V 
Sbjct  86   FTGEKNATPNANSLRGFDVIDTIKSQLESACPGVVSCADLLTVAARDSVVALGGPSWTVP  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A ++ IP P  NL+ LI++F+NKGFT ++MVALSGSHTIG+A C +FR
Sbjct  146  LGRRDSTTASQSAANSNIPAPTLNLSGLITAFSNKGFTTKEMVALSGSHTIGQARCTSFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+ ++A  L++ CP SGGD N  PLD T+P  FDNAYFKNLQ Q+GL
Sbjct  206  ARLYNENNINTTFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQEGL  260



>ref|XP_010041464.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 173/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS +CP+ALSTIK+ V +AV S+    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  26   QLSSTFYSTSCPSALSTIKSGVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTAN  85

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG NVI  IK+QLE  C G+VSCAD+LT+A RD++V +GGPSW+V 
Sbjct  86   FTGEKNAGPNANSLRGFNVIDTIKSQLESACPGIVSCADLLTVAARDSVVALGGPSWTVP  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A ++ IP    +L+ LI++F+NKGFTA++MVALSGSHTIG+A C  FR
Sbjct  146  LGRRDSTTASQSAANSNIPAFTLSLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+A++A  L++ CP SGGD N  PLD T+P  FDNAYFKNLQ QKGL
Sbjct  206  TRLYNENNINATFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQKGL  260



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 178/235 (76%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY+KTCPNALSTIK+ V +AVN++    A+LL LHF DCF+ GCD SVLL +T++
Sbjct  49   QLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSS  108

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+++E LC GVVSCADIL +A RD++V +GG +W+V 
Sbjct  109  FTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTVQ  168

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  + ++ +PGP S+L+ LISSF+NKGF+++++VALSGSHTIG+A C++FR
Sbjct  169  LGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFR  228

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYND++ID+S+A  L+  CP +GGD N  PLD T+P  FDNAYFKNLQS+KGL
Sbjct  229  TRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGL  283



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 173/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS +FY+ TCP AL+TIK+AV +AV+ +    A+LL LHF DCF+NGCD S+LL    N
Sbjct  29   QLSSNFYATTCPRALATIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASILLDDTAN  88

Query  265  TTNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  VI  IK+QLE LC  VVSCADI+ +A RD++V +GGPSWSV 
Sbjct  89   ITGEKTAGPNNNSVRGYEVIDTIKSQLESLCPAVVSCADIVAVAARDSVVALGGPSWSVL  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S +A ++ IP P  +L+ LIS+F+NKGFTA++MVALSGSHTIG+A C  FR
Sbjct  149  LGRRDSTTASLNAANSNIPAPTLSLSGLISAFSNKGFTAKEMVALSGSHTIGQARCTTFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN++ ID S+A  LR+ CP +GGD N  PLD T+P  FDNAY+KNLQSQKGL
Sbjct  209  SRIYNETTIDPSFATSLRANCPSTGGDNNLSPLDTTSPTSFDNAYYKNLQSQKGL  263



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 172/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS +CP AL+TIK+AV +AV+S+    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  24   QLSSTFYSSSCPKALATIKSAVDSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTAN  83

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                          RG +V+  IK+QLE LC GV SC+DIL +A RD++V +GGPSW+V 
Sbjct  84   FTGEKTAGANANSLRGFDVVDTIKSQLESLCPGVFSCSDILAVAARDSVVALGGPSWTVQ  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A +T IP P  NL+ L++SF+NKGF A+++VALSGSHTIG+A C  FR
Sbjct  144  LGRRDSTTASLSAANTNIPAPTLNLSALLTSFSNKGFNAKELVALSGSHTIGQARCTTFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++ID+S+A  L++ CP SGGD N  PLD+TTP  FDNAYFKNL SQKGL
Sbjct  204  ARLYNEANIDSSFATSLKANCPSSGGDANLSPLDVTTPNKFDNAYFKNLVSQKGL  258



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 175/238 (74%), Gaps = 9/238 (4%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  L+ +FYS TCPN LS IKTAV++A++ +    A+LL LHF DCF+NGCD SVLL +
Sbjct  19   SSAELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDD  78

Query  265  TT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T+        NP     RG +VI  IKTQ+E  C GVVSCADIL +A RD++V +GGPSW
Sbjct  79   TSSFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSW  138

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S  A +  IP P  NL+ LISSF+NKGF +R+MVALSGSHTIG+A C 
Sbjct  139  NVLLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQARCT  198

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR+R+YN+++I++S+   +++ CPQ+GGD N  PLD T+P  FDN Y+KNLQSQKG+
Sbjct  199  TFRDRLYNETNINSSFGTTIKANCPQNGGDNNLSPLD-TSPTSFDNVYYKNLQSQKGI  255



>ref|XP_004240055.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=317

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 173/238 (73%), Gaps = 8/238 (3%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  L+ +FY+ +CPN LS IKTAV++A+  +    A+LL LHF DCF+NGCD SVLL +
Sbjct  21   SSAQLTSNFYNSSCPNVLSIIKTAVNSAIAKESRMGASLLRLHFHDCFVNGCDASVLLDD  80

Query  265  TT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T+        NP     RG +VI  IKTQ+E  C GVVSCADIL +A RD++V +GGPSW
Sbjct  81   TSSFTGEKTANPNSGSLRGFDVIDTIKTQIESSCAGVVSCADILAVAARDSVVKLGGPSW  140

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S    ++ IP P  NL+ LISSF+NKGF  R+MVALSGSHTIG+A C 
Sbjct  141  TVLLGRRDSTTASLSNANSDIPAPTLNLSSLISSFSNKGFNTREMVALSGSHTIGQARCT  200

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR+R++N++DI+AS+A  ++SKCPQSG D N  PLD T+P  FDN Y+KNL+ QKGL
Sbjct  201  TFRDRLHNETDINASFATSIKSKCPQSGSDNNVSPLDTTSPTTFDNIYYKNLRIQKGL  258



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 175/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY KTCPNALSTIK+ V +AVN++    A+LL LHF DCF+ GCD SVLL +T++
Sbjct  23   QLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSS  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG NVI  IK+++E LC GVVSCADIL +A RD++V +GGP+W+V 
Sbjct  83   FKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWTVQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  + ++ +P P S+L+ LISSF+NKGF+++++VALSGSHTIG+A C++FR
Sbjct  143  LGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYND++ID+S+A  L+  CP +GG     PLD T+P  FDNAYFKNLQS+KGL
Sbjct  203  TRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTFDNAYFKNLQSKKGL  257



>gb|ACJ11762.1| class III peroxidase [Gossypium hirsutum]
Length=323

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 172/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS TCP ALSTIK+AV++AV+++    A+L  LHF DCF+NGCDGS+LL +T N
Sbjct  30   QLSSTFYSTTCPRALSTIKSAVNSAVSNEARMGASLPRLHFHDCFVNGCDGSILLDDTAN  89

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI  IK+Q+E LC GVVSCADI+ +A RD++V +GGPSW V 
Sbjct  90   MTGEKTAVPNSNSARGFEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPSWIVL  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ IP P  NL+ LI++F+NKGFTA++MVALSGSHTIG+A C  FR
Sbjct  150  LGRRDSTTASLSAANSNIPAPTLNLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++ID+++A  LR+ CP +GGD +  PLD T+   FDNAYFKNLQ QKGL
Sbjct  210  TRIYNETNIDSTFATSLRANCPSNGGDNSLSPLDTTSSTSFDNAYFKNLQGQKGL  264



>ref|XP_009803848.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 172/239 (72%), Gaps = 9/239 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SSA  LS +FYS +CPN LS IKTAV +AV  +    A+LL LHF DCF+NGCD SVLL 
Sbjct  18   SSAQSLSANFYSSSCPNVLSVIKTAVDSAVTKEARMGASLLRLHFHDCFVNGCDASVLLD  77

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T+N        P     RG +VI  IKT++E  C GVVSCADIL +A RD++V +GGPS
Sbjct  78   DTSNFTGEKTANPNSGSLRGFDVIDTIKTKVEASCAGVVSCADILAVAARDSVVKLGGPS  137

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W+V LGRRDSTT S  A +  IP P  NL+ LISSF+ KG TAR+MVALSG HTIG+A C
Sbjct  138  WTVLLGRRDSTTASLSAANNNIPAPTLNLSGLISSFSTKGLTAREMVALSGGHTIGQARC  197

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              FRNR+YN+++I+AS+A  +++ CPQSGG+ N  PLD T+P  FDN YFKNLQ QKGL
Sbjct  198  TTFRNRLYNEANINASFATSVKANCPQSGGNNNLSPLD-TSPTSFDNVYFKNLQIQKGL  255



>ref|XP_004492538.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=317

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 173/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY+ TCP+ LSTIKT +  AVN +P   A+LL LHF DCF+ GCDGSVLL +T++
Sbjct  24   QLSSDFYATTCPDVLSTIKTQIDLAVNDEPRMGASLLRLHFHDCFVQGCDGSVLLDDTSS  83

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+++E LC  VVSCADIL++A RD++V +GGPSW+V 
Sbjct  84   FTGEKSAGPNANSLRGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGPSWTVQ  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S D+ +T +PGP S+LT+LI++F  KGFT ++MVALSGSHTIG+A C  FR
Sbjct  144  LGRRDSTTASLDSANTNLPGPTSDLTNLITAFDKKGFTTQEMVALSGSHTIGQASCRFFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+ +ID ++AA L++ CP SGGD N  PLD TTP  FDN+Y+ NLQSQ GL
Sbjct  204  SRIYNEDNIDPTFAASLQANCPTSGGDNNLSPLDTTTPDTFDNSYYTNLQSQMGL  258



>ref|XP_010066394.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 171/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYSK+CP+AL TIK+ V +AV+S+    A+LL LHF DCF+NGCD S+LL +TTN
Sbjct  26   QLSSTFYSKSCPSALRTIKSGVSSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTTN  85

Query  274  PMVAPP--------RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                          RG  VI  IK+ LE  C GVVSCADIL +A RD++V +GGPSW+V 
Sbjct  86   FTGEKTAGANNNSIRGYEVIDTIKSHLESSCPGVVSCADILAIAARDSVVALGGPSWTVL  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ IP P  +L+ LI+SF+NKGFTA++MVALSGSHTIG+A C +FR
Sbjct  146  LGRRDSTTASLTDANSDIPAPTLSLSDLITSFSNKGFTAKEMVALSGSHTIGQARCTSFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN++DI+A++A  L + CP SGGD N  PLD T+P  FDNAYFKNLQ+QKGL
Sbjct  206  TRLYNENDINATFATSLNANCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGL  260



>ref|XP_006842420.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
 gb|ERN04095.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
Length=315

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 176/235 (75%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY+ +CPNALSTI+TAV +AVN++    A+LL LHF DCF+NGCDGS+LL +   
Sbjct  22   QLSSTFYNSSCPNALSTIQTAVRSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDNAT  81

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  V+ +IK+QLE LC GVVSCADIL +A RD++VV+GGP+W+V 
Sbjct  82   FTGEKTARPNNNSVRGFEVVDNIKSQLESLCPGVVSCADILAVAARDSVVVLGGPTWTVL  141

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ IP P+ +L+ LI+SF+NKG ++ +MVALSGSHTIG+A C  FR
Sbjct  142  LGRRDSTTASLSTANSDIPAPSLSLSGLITSFSNKGLSSSEMVALSGSHTIGQARCTTFR  201

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              IYN+++ID++YA  L+S CP SGGD N  PLD+T+P +FDNAY+KNL ++KGL
Sbjct  202  THIYNETNIDSTYATSLKSNCPFSGGDNNLSPLDVTSPTVFDNAYYKNLVNKKGL  256



>ref|XP_008388322.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=323

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 173/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY K+CPNALSTIK+AV++AV+ +    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  30   QLSSTFYGKSCPNALSTIKSAVNSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTAN  89

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+QLE LC  VVSCADILT+A RD+IV +GGP+++V 
Sbjct  90   FTGEKTAGPNANSLRGFDVINTIKSQLESLCPKVVSCADILTVAARDSIVALGGPTYTVP  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ IP P  NL+ LI++F+NKGFTA+++VALSGSHTIG+  C +FR
Sbjct  150  LGRRDSTTASLSAANSNIPAPTLNLSGLITAFSNKGFTAKELVALSGSHTIGQVRCTSFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I  S+A  L+S CP  GGD N  PLD+T+P  FDNAYF+NL SQKGL
Sbjct  210  ARLYNETNISDSFATSLKSSCPTRGGDNNLSPLDVTSPTSFDNAYFRNLVSQKGL  264



>ref|XP_009371984.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=323

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 174/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY K+CPNALSTIK+AV++AV+ +    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  30   QLSSTFYGKSCPNALSTIKSAVNSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTPN  89

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+QLE LC  VVSCADILT+A RD+IV +GGP+++V 
Sbjct  90   FTGEKTAGPNANSLRGFDVINTIKSQLESLCPKVVSCADILTVAARDSIVALGGPTYTVP  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ +P P  NL  LI++F+NKGFTA+++VALSGSHTIG+A C +FR
Sbjct  150  LGRRDSTTASLSAANSNLPAPTLNLAGLITAFSNKGFTAKELVALSGSHTIGQAKCTSFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+ S+A  L+S CP  GGD N  PLD+T+P  FDNAYF+NL SQKGL
Sbjct  210  ARLYNETNINNSFATSLKSSCPTRGGDNNLSPLDVTSPTSFDNAYFRNLVSQKGL  264



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score =   278 bits (712),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 177/235 (75%), Gaps = 10/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY+KTCPNALSTIK+ V +AVN++    A+LL LHF DCF  GCD SVLL +T++
Sbjct  23   QLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCF--GCDASVLLDDTSS  80

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+++E LC GVVSCADIL +A RD++V +GG +W+V 
Sbjct  81   FTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTVQ  140

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  + ++ +PGP S+L+ LISSF+NKGF+++++VALSGSHTIG+A C++FR
Sbjct  141  LGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFR  200

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYND++ID+S+A  L+  CP +GGD N  PLD T+P  FDNAYFKNLQS+KGL
Sbjct  201  TRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGL  255



>ref|XP_006345522.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 172/238 (72%), Gaps = 8/238 (3%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  L+ +FY+ +CPN LS IKTAV++A+  +    A++L LHF DCF+NGCD SVLL +
Sbjct  21   SSAQLTSNFYNSSCPNILSIIKTAVNSAIAKESRMGASMLRLHFHDCFVNGCDASVLLDD  80

Query  265  TT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T+        NP     RG +VI  IKTQ+E  C GVVSCADIL +A RD++V +GGPSW
Sbjct  81   TSSFTGEKTANPNSGSLRGFDVIDTIKTQVESSCAGVVSCADILAVAARDSVVKLGGPSW  140

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S    ++ IP P  NL+ LISSF+NKGF AR+MVALSGSHTIG+A C 
Sbjct  141  TVLLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFNAREMVALSGSHTIGQARCT  200

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR+R+YN++DI+ S+A  ++SKCPQSG D N  PLD T+   FDN Y+KNL+ QKGL
Sbjct  201  TFRDRLYNETDINDSFATSVKSKCPQSGSDNNISPLDTTSANTFDNIYYKNLRIQKGL  258



>ref|XP_010041648.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 170/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CP+AL TIK+ V++AV+S+    A+LL LHF DCF+NGCD S+LL +TTN
Sbjct  26   RLSSTFYFTSCPSALHTIKSGVNSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTTN  85

Query  274  PMVAPP--------RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                          RG  VI  IK+QLE  C GVVSCADIL +A RD+IV +GGPSW V 
Sbjct  86   FTGEKTAGANDNSIRGYEVIDTIKSQLESSCPGVVSCADILAVAARDSIVALGGPSWRVL  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ IP P  +L+ LI++F+NKGFTA++MVALSGSHTIG+A C  F+
Sbjct  146  LGRRDSTTASLSAANSDIPAPTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQARCTTFQ  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+SDI++++A  L+  CP SGGD N  PLD T+P  FDNAYFKNLQ+QKGL
Sbjct  206  TRLYNESDINSTFATSLKENCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGL  260



>ref|XP_006345521.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 172/238 (72%), Gaps = 8/238 (3%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  L+ +FY+ +CPN LS IKT V++A+ ++    A+LL LHF DCF+NGCD SVLL +
Sbjct  21   SSAQLTSNFYNSSCPNVLSIIKTVVNSAIATESRMGASLLRLHFHDCFVNGCDASVLLDD  80

Query  265  TT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T+        NP     RG +VI  IKTQ+E  C G+VSCADIL +A RD++V +GG SW
Sbjct  81   TSSFTGEKTANPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGRSW  140

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S    ++ IP P  NL+ LISSF+NKGF +R+MVALSGSHTIG+A C 
Sbjct  141  TVLLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFNSREMVALSGSHTIGQARCT  200

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR+R+YN++DI+A++A  L+S CPQSG D N  PLD T+P  FDN Y+KNL+ QKGL
Sbjct  201  TFRDRLYNETDINATFATSLKSNCPQSGSDNNISPLDTTSPTTFDNIYYKNLRIQKGL  258



>gb|AAB02554.1| cationic peroxidase [Stylosanthes humilis]
Length=320

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 173/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FY+  CPNALSTIK+AV++AV+ +    A+LL LHF DCF+ GCD SVLL +T+ 
Sbjct  26   QLSSNFYATKCPNALSTIKSAVNSAVSKEARLGASLLRLHFHDCFVQGCDASVLLDDTST  85

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG +VI  IK+Q+E LC GVVSCADIL LA RD++V +GGPSW+V 
Sbjct  86   FTGEKTAFPNVNSARGFDVIDTIKSQVESLCPGVVSCADILALAARDSVVALGGPSWNVQ  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S ++ ++ +PGP+ NL+ LIS+F+ KGFTA+++V LSG+HTIG+A C  FR
Sbjct  146  LGRRDSTTASLNSANSDLPGPSFNLSGLISAFSKKGFTAKELVTLSGAHTIGQARCTTFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+S+ID SYA  L+  CP  GGD N  P D+TTP  FDNAY+ NL+++KGL
Sbjct  206  TRIYNESNIDPSYAKSLQGNCPSVGGDSNLSPFDVTTPNKFDNAYYINLKNKKGL  260



>ref|XP_010035984.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 171/233 (73%), Gaps = 8/233 (3%)
 Frame = +1

Query  100  SKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN--  273
            ++++Y+  CP AL TIK+AV +AV  +    A+LL LHF DCF+NGCD S+LL +T N  
Sbjct  29   NQNYYATRCPKALDTIKSAVKSAVAKEARMGASLLRLHFHDCFVNGCDASILLDDTANFT  88

Query  274  ------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLG  435
                  P V   RG NVI  IK+++E+LC GVVSCADIL +  RD++V +GG SW V LG
Sbjct  89   GEKTAFPNVNSARGFNVIDTIKSKVEKLCPGVVSCADILAVVARDSVVELGGRSWQVQLG  148

Query  436  RRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNR  615
            RRDSTT S +A +T +P P  NL+ LI+SF+NKGFTA++MVALSGSHTIG+A C  FRNR
Sbjct  149  RRDSTTASLNAANTNLPAPTLNLSALITSFSNKGFTAKEMVALSGSHTIGQARCVTFRNR  208

Query  616  IYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +YN++DI +S+A  L+++CP SGGD    PLDIT+P  FD+AYF NL SQKGL
Sbjct  209  LYNENDISSSFATSLKAQCPSSGGDNKLSPLDITSPTSFDSAYFSNLVSQKGL  261



>ref|XP_003551179.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
 gb|KHN48392.1| Cationic peroxidase 1 [Glycine soja]
Length=320

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 172/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY+ TCPNALSTIK+AV +AV  +    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  27   ELSSDFYASTCPNALSTIKSAVKSAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSS  86

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                      +   RG +VI DIK+QLE  C G+VSCADI+ +A RD++V +GGPSW++ 
Sbjct  87   FTGEKSAAANLNSLRGFDVIDDIKSQLESACPGIVSCADIVAVAARDSVVALGGPSWTIG  146

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SKDA ++ IP P  +L  LIS+F+NKGFT+++MV LSG+HT G+A C  FR
Sbjct  147  LGRRDSTTASKDAATSDIPSPLMDLNDLISAFSNKGFTSQEMVVLSGAHTTGQAKCQFFR  206

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++ID+ +A   +S CP + GD N  PLD+TT +LFDNAYFKNL ++KGL
Sbjct  207  GRIYNETNIDSDFATSAKSNCPSTDGDSNLSPLDVTTNVLFDNAYFKNLVNKKGL  261



>ref|XP_010256954.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=323

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 174/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  +YS +CP ALSTIK+AV +AV  +    A+LL LHF DCF+NGCDGS+LL +TT+
Sbjct  30   QLSSTYYSTSCPEALSTIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDTTS  89

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+Q+E +C GVVSCADIL +A RD++V +GGP+W+V 
Sbjct  90   FTGEKTATPNANSLRGFDVIDTIKSQVESVCAGVVSCADILAVAARDSVVALGGPTWTVQ  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S  A ++ IP P  +L+ LIS+F+NKGFTA++MVALSG+HTIG+A C +FR
Sbjct  150  LGRRDATTASLSAANSDIPAPTLDLSGLISAFSNKGFTAKEMVALSGAHTIGQARCTSFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++I++S+A  L+SKCP +GGD N  PLD T+   FDNAYF NL + KGL
Sbjct  210  DRIYNETNINSSFATSLKSKCPSAGGDNNLSPLDATSATTFDNAYFTNLVNNKGL  264



>ref|XP_010653358.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=325

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 167/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+ +FY+KTCPNALS IK+AV++AV S+    A+LL LHF DCF+NGCD S+LL +T+N
Sbjct  32   QLTTNFYAKTCPNALSIIKSAVNSAVKSEARMGASLLRLHFHDCFVNGCDASILLDDTSN  91

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  V+  IK+QLE  C GVVSCADIL +A RD++V + GPSW V 
Sbjct  92   FTGEKTAGPNANSVRGYEVVDTIKSQLEASCPGVVSCADILAVAARDSVVALRGPSWMVR  151

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ IP P  NL+ LIS+F NKGF AR+MVALSGSHTIG+A C  FR
Sbjct  152  LGRRDSTTASLSAANSNIPAPTLNLSGLISAFTNKGFNAREMVALSGSHTIGQARCTTFR  211

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++IDAS+   L++ CP SGGD    PLD  TP  FDNAY+ NL ++KGL
Sbjct  212  TRIYNEANIDASFKTSLQANCPSSGGDNTLSPLDTQTPTTFDNAYYTNLVNKKGL  266



>ref|XP_003538325.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=320

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 172/234 (74%), Gaps = 8/234 (3%)
 Frame = +1

Query  97   LSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-  273
            LS  FY+ TCPNALSTIK+AV +AV  +    A+LL LHF DCF+NGCD SVLL +T++ 
Sbjct  28   LSSDFYASTCPNALSTIKSAVKSAVAKERRMGASLLRLHFHDCFVNGCDASVLLDDTSSF  87

Query  274  -------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSL  432
                     +   RG +VI DIK+QLE  C G+VSCADI+ +A RD++V +GGPSW++ L
Sbjct  88   TGEKSAAANLNSLRGFDVIDDIKSQLESSCPGIVSCADIVAVAARDSVVALGGPSWTIGL  147

Query  433  GRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRN  612
            GRRDST  SK+A ++ IP P  +L+ LIS+F+NKGFT+++MV LSG+HT G+A C  FR 
Sbjct  148  GRRDSTAASKEAATSDIPSPLMDLSDLISAFSNKGFTSKEMVVLSGAHTTGQAKCQFFRG  207

Query  613  RIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            RIYN+++ID+ +A   +S CP + GD N  PLD+TT +LFDNAYFKNL ++KGL
Sbjct  208  RIYNETNIDSDFATSAKSNCPSTDGDSNLSPLDVTTNVLFDNAYFKNLVNKKGL  261



>gb|AIE12239.1| peroxide [Momordica charantia]
Length=324

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 173/240 (72%), Gaps = 9/240 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS  FYSKTCPN LST++  V +A+  +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  27   SSSAQLSTTFYSKTCPNLLSTVRAGVRSAIAKEARIGASLLRLHFHDCFVNGCDGSILLD  86

Query  262  NTTNPM---VAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   M    APP     RG +VI DIK+ +E++C  VVSCADILTL +RD++V++GGPS
Sbjct  87   DTPTFMGEQTAPPNNRSVRGFDVIKDIKSSVEKVCPSVVSCADILTLTSRDSVVILGGPS  146

Query  418  WSVSLGRRDSTTPSKDAGST-IIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            W V LGRRDS T S  A S+ +IP P S L++LI+ F   G + + MVALSG+HTIG+A 
Sbjct  147  WEVKLGRRDSKTVSFSAASSGVIPPPTSTLSNLINRFNAVGLSTKDMVALSGAHTIGQAR  206

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C +FRNRIYN+S+IDAS+A   +  CP+SGGD N  PLD+ TP LFDN Y+KNL +QKGL
Sbjct  207  CVSFRNRIYNESNIDASFAKLRQRNCPRSGGDDNLAPLDVVTPKLFDNYYYKNLLNQKGL  266



>ref|XP_010650833.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=307

 Score =   273 bits (698),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 168/234 (72%), Gaps = 8/234 (3%)
 Frame = +1

Query  97   LSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-  273
            LS  FYS  CP ALSTI+TAV+ AV ++    A+LL LHF DCF+NGCDGS+LL +T N 
Sbjct  15   LSSTFYSAKCPKALSTIRTAVNTAVANENRMGASLLRLHFHDCFVNGCDGSILLDDTANF  74

Query  274  -------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSL  432
                   P     RG  VI DIK+++E +C GVV+CADIL +A RD++V +GGP+W+V L
Sbjct  75   TGEKTAGPNADSVRGFEVIDDIKSRVESVCPGVVTCADILAVAARDSVVALGGPTWTVQL  134

Query  433  GRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRN  612
            GRRDSTT S     T IP PA +L  LIS+F++KGF+A++MVALSGSHTIG++ C  FR+
Sbjct  135  GRRDSTTASISDAETDIPSPALDLDDLISAFSDKGFSAKEMVALSGSHTIGQSRCLVFRD  194

Query  613  RIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            RIYND +ID+S+A  L+S CP + GD N   LD T+P++FDN YFKNL   KGL
Sbjct  195  RIYNDDNIDSSFAESLKSNCPDTDGDDNLSALDDTSPVIFDNGYFKNLVDNKGL  248



>ref|XP_010653359.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=326

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 170/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+ ++YS +CPNALS IK+AV+ AVN++    A+LL LHF DCF+NGCD S+LL +T+N
Sbjct  33   QLTTNYYSSSCPNALSIIKSAVNTAVNNEARMGASLLRLHFHDCFVNGCDASILLDDTSN  92

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+Q+E  C GVVSCADIL +  RD++V +GGPSW+V 
Sbjct  93   FTGEKTAVPNANSVRGFDVIDTIKSQVESSCPGVVSCADILAVVARDSVVALGGPSWTVR  152

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ IP P  NL+ LISSF+NKGF+A +MVALSGSHTIG+A C  FR
Sbjct  153  LGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFSANEMVALSGSHTIGQARCTNFR  212

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +R+YN+++IDAS+ + L++ CP SGGD N  PLD  +P  FDNAYF NL + KGL
Sbjct  213  DRLYNETNIDASFQSSLQANCPSSGGDNNLSPLDTKSPTTFDNAYFTNLVNNKGL  267



>ref|XP_007140134.1| hypothetical protein PHAVU_008G086800g [Phaseolus vulgaris]
 gb|ESW12128.1| hypothetical protein PHAVU_008G086800g [Phaseolus vulgaris]
Length=322

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 172/235 (73%), Gaps = 9/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS TC NALSTIKTAV +AV+++    A+LL LHF DCF+ GCDGSVLL +T++
Sbjct  30   QLSTDFYSTTCSNALSTIKTAVDSAVSNEARMGASLLRLHFHDCFVQGCDGSVLLNDTSS  89

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG  VI +IK+QLE LC GVVSCADIL +A RD++V +GG SW+V 
Sbjct  90   FTGEQTAFPNVNSLRGFGVIDNIKSQLESLCPGVVSCADILAVAARDSVVALGGQSWTVQ  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S ++ ++ +PGP  +L  L+ +F+ K FT  +MVALSG HTIG+A C++FR
Sbjct  150  LGRRDSTTASFNSANSDLPGPTFSLQQLVDAFSKKDFTTEEMVALSGGHTIGQAACSSFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYND++ID+S+A  L++ CP  GGD N  PLD T+P  FDNAYF++LQSQKGL
Sbjct  210  TRIYNDTNIDSSFATSLQANCPSVGGDRNLAPLD-TSPTTFDNAYFQDLQSQKGL  263



>ref|XP_009373126.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=324

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 171/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CPNALSTIK+AV +AV+ +    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  31   QLSSTFYGTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTAN  90

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                      V   RG +VI  IK+QLE LC  VVSCADILT+A RD+IV +GG +++V 
Sbjct  91   FTGEKTAGANVNSLRGFDVIDTIKSQLESLCPKVVSCADILTVAARDSIVALGGLTYTVP  150

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ IP P  NL+ LI++F+NKGFTA+++VALSGSHTIG+A C  FR
Sbjct  151  LGRRDSTTASLSAANSNIPAPTLNLSALITAFSNKGFTAKELVALSGSHTIGQARCTTFR  210

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+AS+A  L+S CP SGG  N  PLD+T+P  FDNAYF NL SQKGL
Sbjct  211  TRLYNEANINASFATSLKSSCPTSGGANNLSPLDVTSPTSFDNAYFTNLVSQKGL  265



>ref|XP_010683553.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=329

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 172/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYS +CPNALSTI++AV  AV ++    A+LL LHF DCF+NGCDGS+LL +T N
Sbjct  34   QLSSNFYSSSCPNALSTIQSAVQAAVKNESRMGASLLRLHFHDCFVNGCDGSILLDDTAN  93

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+Q+E +C GVVSCADIL +A RD++V +GG SW+V 
Sbjct  94   FTGEKNAAPNANSVRGFDVIDTIKSQVENVCSGVVSCADILAVAARDSVVALGGQSWTVL  153

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S+ A ++ IP P  NLT LI+ F+NKGFT +++VALSG+HTIG+A C +FR
Sbjct  154  LGRRDATTASQSAATSNIPAPTLNLTQLITFFSNKGFTTQELVALSGAHTIGQARCTSFR  213

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN++ I++++A  L++ CP +GGD N  PLD T+P  FDNAYF NL S +GL
Sbjct  214  SRIYNETSINSTFATSLQANCPSNGGDNNLSPLDKTSPTTFDNAYFTNLLSLEGL  268



>ref|XP_010685954.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=318

 Score =   273 bits (697),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 167/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL-----  258
             LS ++YSKTCP AL TIKTAVH AV ++    A+LL LHF DCF+NGCD SVLL     
Sbjct  25   QLSTNYYSKTCPRALFTIKTAVHKAVAAEHRMGASLLRLHFHDCFVNGCDASVLLNDSST  84

Query  259  ---VNTTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                 T        RG  VI DIK+Q+E +C GVVSCADIL +A RD++ ++GGP+W V 
Sbjct  85   FTGEQTAGGNAGSLRGFTVIDDIKSQVESVCPGVVSCADILAVAARDSVALLGGPTWPVQ  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ IP P  +L+ L+SSF+NKG TA++MVAL+G+HTIG+A C  FR
Sbjct  145  LGRRDSTTASLSIANSDIPSPTMDLSGLLSSFSNKGLTAKEMVALAGAHTIGQARCVVFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+YN+S+IDASY + ++  CP +GGD N  PLD  TP++FDN YFK+L S KGL
Sbjct  205  NRVYNESNIDASYVSSVKPNCPNNGGDNNLTPLDSNTPVIFDNGYFKDLVSNKGL  259



>ref|XP_004242492.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=314

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 170/234 (73%), Gaps = 8/234 (3%)
 Frame = +1

Query  97   LSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-  273
            LS  +Y K+CP A+ TIK AV NAV ++    A+LL LHF DCF+NGCD SVLL +TT+ 
Sbjct  22   LSSDYYEKSCPKAMYTIKNAVANAVTNERRMGASLLRLHFHDCFVNGCDASVLLDDTTDF  81

Query  274  -------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSL  432
                   P     RG +VI  IK+Q+E+LC G+VSCADI+ +A RD++V++GGPSW+V L
Sbjct  82   TGEKSAKPNSNSIRGFDVIDKIKSQIEKLCPGIVSCADIIAVAARDSVVLLGGPSWTVEL  141

Query  433  GRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRN  612
            GRRDSTT S D  ++ IP P+ +L  LI++FANKGFTA++MVALSG HTIGKA C  FR 
Sbjct  142  GRRDSTTASLDTANSDIPSPSLDLNDLITNFANKGFTAKEMVALSGGHTIGKAQCTTFRA  201

Query  613  RIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            R+YN+++ID+S A  L+S CP +GGD     LD TTP+LFDN ++KNL + KG+
Sbjct  202  RVYNETNIDSSLATSLKSNCPSTGGDDTLSSLDATTPVLFDNHFYKNLVNNKGI  255



>ref|XP_010035985.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 172/240 (72%), Gaps = 8/240 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S+SA   ++++Y K CP AL TI +AV +AV ++    A+LL LHF DCF+NGCDGS+LL
Sbjct  22   SASAQLSNQNYYEKGCPKALQTIGSAVKSAVANESRMGASLLRLHFHDCFVNGCDGSILL  81

Query  259  VNTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T N        P +   RG +V+  IK+++E+LC GVVSCADIL +  RD++V +GG 
Sbjct  82   DDTANFTGEKTAFPNLNSLRGFDVVDTIKSEVEKLCPGVVSCADILAIVARDSVVELGGQ  141

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW V LGRRDSTT S +  +T +P P  NL+ LI+SF+NKGFTA +MV LSGSHTIG++ 
Sbjct  142  SWQVQLGRRDSTTASLNTANTDLPAPTLNLSALITSFSNKGFTAEEMVTLSGSHTIGQSR  201

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C  FR R+YN+S+ID+S+A  L++ CP SGGD N  PLD+T+P  FDNAYF NL  QKGL
Sbjct  202  CVTFRARLYNESNIDSSFATTLKANCPSSGGDNNLSPLDVTSPTSFDNAYFTNLVCQKGL  261



>ref|XP_008370240.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=324

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 170/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CPNALSTIK+AV +AV+ +    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  31   QLSSTFYGTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTAN  90

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                          RG +VI  IK+QLE LC  VVSCADILT+A RD+IV +GG +++V 
Sbjct  91   FTGEKTAGANANSLRGFDVIDTIKSQLESLCPKVVSCADILTVAARDSIVALGGLTYTVP  150

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ IP P  NL+ LI++F+NKGFTA+++VALSGSHTIG+A C  FR
Sbjct  151  LGRRDSTTASLSAANSNIPAPTLNLSALITAFSNKGFTAKELVALSGSHTIGQARCTTFR  210

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+AS+A  L+S CP SGG+ N  PLD+T+P  FDNAYF NL SQ GL
Sbjct  211  TRLYNEANINASFATSLKSSCPTSGGBNNLSPLDVTSPTSFDNAYFSNLVSQXGL  265



>ref|XP_010093550.1| Cationic peroxidase 1 [Morus notabilis]
 gb|EXB54257.1| Cationic peroxidase 1 [Morus notabilis]
Length=322

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 172/235 (73%), Gaps = 10/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYS +CPNALS +K+AV  AV+++    A+LL LHF DCF  GCD S+LL +T+ 
Sbjct  31   QLSSNFYSSSCPNALSIVKSAVKTAVSNEARMGASLLRLHFHDCF--GCDASILLDDTST  88

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +V+  IKTQLE  C GVVSCADIL +A RD++V++GGPSW+V 
Sbjct  89   FTGEKNAGPNANSVRGFDVVDTIKTQLESACAGVVSCADILAVAARDSVVLLGGPSWTVQ  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S+ A  + IP P +NL+ LI++F+NKGFT +++VALSG HTIG+A C++FR
Sbjct  149  LGRRDATTASQSAAGSNIPAPTTNLSGLITAFSNKGFTTKELVALSGGHTIGQAKCSSFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+AS+A   +SKCP SG D N  PLD+T+P  FDNAYFKN+ S KGL
Sbjct  209  ARLYNENNIEASFATSTKSKCPNSGSDNNLSPLDVTSPTTFDNAYFKNVVSLKGL  263



>ref|XP_007206416.1| hypothetical protein PRUPE_ppa018664mg [Prunus persica]
 gb|EMJ07615.1| hypothetical protein PRUPE_ppa018664mg [Prunus persica]
Length=303

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 170/236 (72%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  +Y+ TCP ALS ++++V NAV  +    A+LL LHF DCF+NGCD SVLL +T+N
Sbjct  9    QLSSDYYATTCPRALSVVRSSVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSN  68

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG  VI  IK+QLE LC GVVSCADIL +A RD++++ GGPSW+V 
Sbjct  69   FTGEKTALPNVRSLRGFEVIDTIKSQLESLCPGVVSCADILAVAARDSVLLFGGPSWTVQ  128

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    +T +P P+ +L  LISSF+ KGF+A++MVALSGSHT+G+A C  FR
Sbjct  129  LGRRDSTTASLSDANTELPSPSLDLKDLISSFSTKGFSAKEMVALSGSHTMGQARCQMFR  188

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGG-DLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++I++ +A +L+S C QS G D N  PLDIT+P+ FDNAYFKNL   KGL
Sbjct  189  DRIYNETNINSEFATFLKSNCTQSSGTDDNLSPLDITSPVFFDNAYFKNLVDSKGL  244



>ref|XP_006596457.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=301

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 168/240 (70%), Gaps = 8/240 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S ++  L+ + Y  TCP ALS I+T V  AV  D    A+LL LHF DCF+NGCD SVLL
Sbjct  3    SMASSQLTSNCYESTCPQALSIIRTVVIGAVAKDHRMGASLLRLHFHDCFVNGCDASVLL  62

Query  259  VNTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             NT+           V   RG  VI DIKT++E  C GVVSCADIL +A RD++V +GGP
Sbjct  63   DNTSTFTGEKSAGANVNSLRGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVALGGP  122

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW+V LGRRDSTT SKD+ +T IP P  +L+ LISSF+ KGF  ++MVALSG+HT G+A 
Sbjct  123  SWNVGLGRRDSTTASKDSATTDIPSPLMDLSALISSFSKKGFNTKEMVALSGAHTTGQAR  182

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C  FR R+YN+S I++++A  L+S CP +GGD N  PLD+TT +LFD AYFKNL ++KGL
Sbjct  183  CQLFRGRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDVTTSVLFDTAYFKNLINKKGL  242



>dbj|BAA77389.1| peroxidase 3 [Scutellaria baicalensis]
Length=318

 Score =   270 bits (690),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 170/238 (71%), Gaps = 8/238 (3%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S   LS +FY+ TCPN L+ I+ AV++AV+SD    A+LL LHF DCF+NGCD SVLL +
Sbjct  22   SNAQLSANFYNTTCPNLLTIIRNAVNSAVSSDTRMGASLLRLHFHDCFVNGCDASVLLDD  81

Query  265  --------TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
                    T  P     RG +VI +IKT +E  C  +VSC+DIL++A RD +V +GGPSW
Sbjct  82   RTGFTGEKTAGPNANSLRGFDVIDNIKTLVEGSCPNIVSCSDILSVAARDGVVAVGGPSW  141

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V+LGRRDSTT S +A +T IPGP  NL  LI+SF+NKGFTAR+MVALSGSHTIG+A C 
Sbjct  142  AVALGRRDSTTASLNAANTQIPGPGLNLNALITSFSNKGFTAREMVALSGSHTIGQARCT  201

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR RIYND++I+ ++A  LR+ CP+SGGD N  PLD  +P  F+N Y++NL   +GL
Sbjct  202  TFRGRIYNDTNINGAFATGLRANCPRSGGDNNLAPLDNVSPARFNNDYYRNLIGLRGL  259



>ref|XP_004500339.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=318

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCP ALS I +AV +AV+ +    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  25   QLSSDFYGTTCPKALSIINSAVCSAVSKEQRMGASLLRLHFHDCFVNGCDASVLLDDTSS  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                      V   RG  VI DIKTQLE  C G+VSCADI+ +A RD++  +GGPSWSV 
Sbjct  85   FTGEKSAGANVNSLRGFEVIDDIKTQLETACPGIVSCADIVAVAARDSVKALGGPSWSVG  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SKDA +  IP P  +L+ LIS+F+NKGFT  +MV LSG+HT G+A C  FR
Sbjct  145  LGRRDSTTASKDAATNDIPSPLMDLSDLISAFSNKGFTTNEMVVLSGAHTTGQARCQLFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN++ ID+++A  ++S CP +GGD N   LD+TT +LFDNAYFKNL ++KGL
Sbjct  205  GRIYNETTIDSNFATSVKSNCPSTGGDSNLTSLDVTTNVLFDNAYFKNLVNKKGL  259



>pdb|1SCH|A Chain A, Peanut Peroxidase
 pdb|1SCH|B Chain B, Peanut Peroxidase
Length=294

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 169/234 (72%), Gaps = 8/234 (3%)
 Frame = +1

Query  97   LSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-  273
            LS +FY+  CPNALSTIK+AV++AV  +    A+LL LHF DCF+ GCD SVLL +T+N 
Sbjct  2    LSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNF  61

Query  274  -------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSL  432
                   P     RG  VI  IK+Q+E LC GVVSCADIL +A RD++V +GG SW+V L
Sbjct  62   TGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLL  121

Query  433  GRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRN  612
            GRRDSTT S  + ++ +P P  NL+ LIS+F+NKGFT +++V LSG+HTIG+A C AFR 
Sbjct  122  GRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFRT  181

Query  613  RIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            RIYN+S+ID +YA  L++ CP  GGD N  P D+TTP  FDNAY+ NL+++KGL
Sbjct  182  RIYNESNIDPTYAKSLQANCPSVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGL  235



>gb|KHN40655.1| Cationic peroxidase 1 [Glycine soja]
Length=334

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 175/253 (69%), Gaps = 26/253 (10%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFIN-------------  234
             LS  FY KTCPNALSTIK+ V +AVN++    A+LL LHF DCF+              
Sbjct  23   QLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQASQLSLCPFFHYD  82

Query  235  -----GCDGSVLLVNTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILT  375
                 GCD SVLL +T++        P     RG NVI  IK+++E LC GVVSCADIL 
Sbjct  83   LFSLSGCDASVLLDDTSSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADILA  142

Query  376  LATRDAIVVIGGPSWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQM  555
            +A RD++V +GGP+W+V LGRRDSTT S  + ++ +P P S+L+ LISSF+NKGF+++++
Sbjct  143  VAARDSVVALGGPTWTVQLGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKEL  202

Query  556  VALSGSHTIGKAHCAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFD  735
            VALSGSHTIG+A C++FR RIYND++ID+S+A  L+  CP +GG     PLD T+P  FD
Sbjct  203  VALSGSHTIGQAQCSSFRTRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTFD  262

Query  736  NAYFKNLQSQKGL  774
            NAYFKNLQS+KGL
Sbjct  263  NAYFKNLQSKKGL  275



>gb|AII99880.1| peroxidase [Cicer arietinum]
Length=306

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 172/238 (72%), Gaps = 13/238 (5%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY+ TCP+ LSTIKT +  AVN +P   A+LL LHF DCF  GCDGSVLL +T++
Sbjct  12   QLSSDFYATTCPDVLSTIKTQIDLAVNDEPRMGASLLRLHFHDCF--GCDGSVLLDDTSS  69

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+++E LC  VVSCADIL++A RD++V +GGPSW+V 
Sbjct  70   FTGEKSAGPNANSLRGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGPSWTVQ  129

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALS---GSHTIGKAHCA  600
            LGRRDSTT S D+ +T +PGP S+LT+LI++F  KGFT ++MVALS   GSHTIG+A C 
Sbjct  130  LGRRDSTTASLDSANTNLPGPTSDLTNLITAFDKKGFTTQEMVALSDVLGSHTIGQASCR  189

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR+RIYN+ +ID ++AA L++ CP SGGD N  PLD TTP  FDN+Y+ NLQSQ GL
Sbjct  190  FFRSRIYNEDNIDPTFAASLQANCPTSGGDNNLSPLDTTTPDTFDNSYYTNLQSQMGL  247



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 186/268 (69%), Gaps = 18/268 (7%)
 Frame = +1

Query  1    AAAAAEFRRFSYllliifnllllpfnSSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSD  180
            AAAA+ F  FS LLL+           SS+  LS +FYSK+CPN  +T+K+AV +A++ +
Sbjct  2    AAAASSFNTFSLLLLLFV--------GSSSAQLSTNFYSKSCPNVFTTVKSAVGSAISKE  53

Query  181  PGTAAALLHLHFRDCFINGCDGSVLLVNTTN--------PMVAPPRGLNVIVDIKTQLEE  336
                A+LL L F DCF+NGCDGS+L+ +T+N        P     RG NV+ DIK+++E+
Sbjct  54   RRMGASLLRLFFHDCFVNGCDGSILVDDTSNFTGEKNAAPNRNSVRGFNVVDDIKSKVEK  113

Query  337  LCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLI  516
            +C GVVSCADIL +A RD++V++GGPSW V LGRRD+ T S+ A +T IP P S+L++LI
Sbjct  114  VCPGVVSCADILAIAARDSVVILGGPSWKVKLGRRDARTASQAAANTSIPPPTSSLSNLI  173

Query  517  SSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYNDSDIDASYAAWLRSKCPQS--GGD  690
            SSF +KG + + MVALSGSHTIG+A C +FR RIYN+S+ID S+A   + KCP +   GD
Sbjct  174  SSFQSKGLSTKDMVALSGSHTIGQARCTSFRTRIYNESNIDGSFAKARQRKCPATSGSGD  233

Query  691  LNYVPLDITTPILFDNAYFKNLQSQKGL  774
             N  PLD+ TP  FDN YFKNL + KGL
Sbjct  234  NNLAPLDLQTPTAFDNNYFKNLINNKGL  261



>sp|P22195.2|PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: 
Precursor [Arachis hypogaea]
 gb|AAB06183.1| cationic peroxidase [Arachis hypogaea]
Length=316

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 169/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FY+  CPNALSTIK+AV++AV  +    A+LL LHF DCF+ GCD SVLL +T+N
Sbjct  23   QLSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSN  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI  IK+Q+E LC GVVSCADIL +A RD++V +GG SW+V 
Sbjct  83   FTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVL  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  + ++ +P P  NL+ LIS+F+NKGFT +++V LSG+HTIG+A C AFR
Sbjct  143  LGRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+S+ID +YA  L++ CP  GGD N  P D+TTP  FDNAY+ NL+++KGL
Sbjct  203  TRIYNESNIDPTYAKSLQANCPSVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGL  257



>ref|XP_011070595.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 163/236 (69%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNALSTI+T++  AV+ +   AA+L+ LHF DCF+ GCD S+LL  T  
Sbjct  28   QLSPSFYDTTCPNALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPT  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG  V+   K ++E +C GVVSCADILTLA RDA V +GGPSWSV 
Sbjct  88   IQSEKTAFPNVNSARGYEVVEAAKLEVERICPGVVSCADILTLAARDASVAVGGPSWSVK  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   ++ +PGP+S+L  LIS F NKG +AR MVALSG+HTIG+A C  FR
Sbjct  148  LGRRDSTTASRSLANSDLPGPSSSLDALISGFGNKGLSARDMVALSGAHTIGQAQCFLFR  207

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  R +CPQ+ GD N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  208  DRIYSNGTDIDAGFASTRRRQCPQNSGDANLAPLDLVTPNSFDNNYFKNLMQRKGL  263



>ref|XP_011070600.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=304

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 164/236 (69%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY+ TCPNALSTI+T++  AV+ +   AA+L+ LHF DCF+ GCD S+LL +T+ 
Sbjct  10   QLSPSFYNSTCPNALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDDTST  69

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI   K ++E +C GVVSCADILTLA RDA V +GGPSW+V 
Sbjct  70   IQSEKSAGPNANSARGFEVIEAAKREVERICPGVVSCADILTLAARDASVAVGGPSWTVR  129

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT ++   ++ +PGP S L  LISSF NKG  AR+MVALSG+HT+G+A C  FR
Sbjct  130  LGRRDSTTANRAQANSDLPGPFSTLDGLISSFTNKGLIAREMVALSGAHTLGQAQCFLFR  189

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIY N +DID  +A+  R +CPQ+GGD N  PLD+ TP  FDN YFKNLQ +KGL
Sbjct  190  ARIYSNGTDIDPGFASTRRRQCPQTGGDSNLAPLDLVTPNSFDNNYFKNLQQRKGL  245



>ref|XP_007146853.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
 gb|ESW18847.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
Length=318

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 170/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY+ +C +ALSTIK+ V +AV+ +    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  25   QLSSDFYATSCSSALSTIKSKVKSAVSKERRMGASLLRLHFHDCFVNGCDASVLLDDTSS  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                      V   RG +VI DIK+QLE  C G+VSCADIL +A RD++V +GG SW+V 
Sbjct  85   FTGEKSAAANVDSLRGFDVIDDIKSQLETDCPGIVSCADILAVAARDSVVSLGGSSWTVG  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SKDA +T IP P  +L+ LI++F+NKGFT ++MV LSG+HT G+A C  FR
Sbjct  145  LGRRDSTTASKDAATTDIPSPQLDLSDLITAFSNKGFTTKEMVVLSGAHTTGQAKCQFFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++ID+ +A   +S CP + GD N  PLD+TT +LFDN+YFKNL ++KGL
Sbjct  205  GRIYNETNIDSDFATSTQSNCPSTDGDSNLSPLDVTTNVLFDNSYFKNLVNKKGL  259



>ref|XP_008229747.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=319

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 167/236 (71%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  +Y+ TCP ALS +K+AV NAV  +    A+LL LHF DCF+NGCD S+LL +T+N
Sbjct  25   QLSSDYYATTCPRALSVVKSAVINAVVKEHRMGASLLRLHFHDCFVNGCDASILLDDTSN  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG  VI  IK+QLE +C GVVSCADIL +A RD+++  GGPSW+V 
Sbjct  85   FTGEKTALPNVGSLRGFEVIDTIKSQLESICPGVVSCADILAIAARDSVLSFGGPSWTVQ  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    +T +P P+ +L  LISSF+ KGF+A ++VALSGSHT+G+A C  FR
Sbjct  145  LGRRDSTTASLSDANTELPSPSLDLKDLISSFSTKGFSAEELVALSGSHTMGQARCRMFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGG-DLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYN+++I++ +A +L+S C QS G D N  PLDIT+P+ FDN YFKNL   KGL
Sbjct  205  NRIYNETNINSEFATFLKSNCTQSSGTDDNLSPLDITSPVFFDNTYFKNLVDSKGL  260



>ref|XP_011021015.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=316

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 169/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY+ TCP ALSTI+TAV  AV  +    A+LL LHF DCF+NGCD SVLL +T  
Sbjct  23   QLSTNFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSS  82

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IK+QLE +C GVVSCADIL +A RD++V + GPSW+V 
Sbjct  83   FTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTVQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ +P P  +L+ LI+SF+NKGFTA++MVALSGSHTIG+A C  FR
Sbjct  143  LGRRDSTTASLSAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLMFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+YN++ +D++ A  L+S CP +G D +   LD TTP+ FDN+YFKNL + KGL
Sbjct  203  NRVYNETSLDSTLATSLKSNCPDTGSDDSLSSLDATTPVTFDNSYFKNLVNNKGL  257



>ref|XP_004294750.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=318

 Score =   267 bits (683),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 171/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  +Y+  CP ALST++TAV NAV  +    A+LL LHF DCF+NGCD SVLL +T N
Sbjct  25   QLSSDYYATRCPRALSTVRTAVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTAN  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG +V+  IK+QLE +C GVVSCADIL +A RD++V +GGPSW V 
Sbjct  85   FTGEKTALPNLNSLRGFDVVDTIKSQLESICPGVVSCADILAIAARDSVVSLGGPSWIVQ  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ +P P+ ++  LIS+F+NKGF+A+++VALSGSHT+G+A C  FR
Sbjct  145  LGRRDSTTASLSAANSELPSPSLDVNDLISAFSNKGFSAKELVALSGSHTMGQAKCVLFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN++ I+++++  L+S CP SG D N  PLD+T+P+ FDNAY+KNL + KGL
Sbjct  205  DRIYNETSINSAFSTSLKSNCPNSGSDDNLSPLDVTSPVFFDNAYYKNLVNSKGL  259



>ref|XP_003623567.1| Peroxidase [Medicago truncatula]
 gb|AES79785.1| class III peroxidase [Medicago truncatula]
Length=312

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FYS TC + LSTIK  + +AV ++    A++L LHF DCF+ GCD SVLL +T  
Sbjct  19   QLSTDFYSTTCSDVLSTIKREIDSAVGNEARMGASILRLHFHDCFVQGCDASVLLDDTSS  78

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A       RG +VI  IKT+LE LC   VSCADIL++A RD++V +GGPSW+V 
Sbjct  79   FTGEKTAGANANSLRGFDVIDTIKTELESLCPNTVSCADILSVAARDSVVALGGPSWTVQ  138

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDS T S    ++ +PGP S+L+ LI+SF NKGFT ++MVALSGSHTIG+A C  FR
Sbjct  139  LGRRDSITASLSLANSDLPGPGSDLSGLITSFDNKGFTPKEMVALSGSHTIGQASCRFFR  198

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYND +ID+S+A  L++ CP +GGD N  PLD TTP  FDN+YF+NLQSQKGL
Sbjct  199  TRIYNDDNIDSSFATSLQANCPTTGGDDNLSPLDTTTPNTFDNSYFQNLQSQKGL  253



>ref|XP_010066359.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 166/233 (71%), Gaps = 8/233 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS +CP+ALSTIK++V +AV ++    A+LL LHF DCF+NGCD S+LL +TTN
Sbjct  26   QLSSTFYSTSCPSALSTIKSSVSSAVKNEARMGASLLRLHFHDCFVNGCDASILLDDTTN  85

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI  IK++LE  C  +VSCADIL +  RD+IV +GGPSW+V+
Sbjct  86   FTGEKNAGPNANSMRGFEVIDTIKSELESKCPSIVSCADILAVVARDSIVALGGPSWTVN  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A +  IP P  NL+ LIS+F+NKGFTA++MVAL GSHTIG+A C  FR
Sbjct  146  LGRRDSTTASQSAANISIPPPTLNLSGLISTFSNKGFTAKEMVALLGSHTIGQARCLTFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQK  768
              +YN+++IDA++A  L++ CP SGGD    P D T+P  FDNA+FKNLQ+ K
Sbjct  206  EHLYNENNIDATFATSLKANCPSSGGDSKLFPFDTTSPTSFDNAFFKNLQTHK  258



>ref|XP_010685963.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=365

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 169/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS ++Y+KTCP ALSTI+ AV  AV+++    A+LL LHF DCF+NGCD S+LL +T  
Sbjct  72   QLSANYYAKTCPKALSTIQNAVRKAVSAERRMGASLLRLHFHDCFVNGCDASILLNDTST  131

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A       RG  V+  IK+Q+E +C GVVSCADIL +A RD++V +GGP+W V 
Sbjct  132  FTGEQTAGANAGSLRGYTVVDSIKSQVESVCPGVVSCADILAVAARDSVVSLGGPTWQVQ  191

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ IP P  +L+ L+SSF++KG TA++MVAL+G+HTIG+A C  FR
Sbjct  192  LGRRDSTTASLSTANSDIPSPTMDLSGLLSSFSDKGLTAKEMVALAGAHTIGQARCVVFR  251

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+YN+S+IDAS+   +++ CP SGGD N  PLD TTP+ FDN YFK+L + KGL
Sbjct  252  NRVYNESNIDASFVTSVKTNCPSSGGDNNLTPLDSTTPVAFDNGYFKDLVNNKGL  306



>ref|XP_009371986.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Pyrus x bretschneideri]
Length=312

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 171/239 (72%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS  FY  +CPNALSTIK+AV++AV+ +    A LL + F DCF+NGCD SVLL 
Sbjct  15   SSSGQLSSTFYETSCPNALSTIKSAVNSAVSKEARMGAFLLRIQFHDCFVNGCDASVLLD  74

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T N        P     RG +VI  IK+QLE +C  VV+CADI+ +A RD+IV +GGP+
Sbjct  75   DTPNFTGEKTADPNAKSLRGFDVIDTIKSQLERICPKVVTCADIIAVAARDSIVALGGPA  134

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            + V LGRRDSTT S  A ++ IP P  NLT LI++F+NKGFTA+ +VALSGSHTIG A C
Sbjct  135  YKVPLGRRDSTTASLSAANSNIPAPTLNLTGLITAFSNKGFTAKDLVALSGSHTIGLARC  194

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              FR R+YN+++I+AS+A  L+  CP SGGD N  PLD+T+P  F+NAYF+NL +Q+GL
Sbjct  195  TNFRARLYNETNINASFATSLKPSCPTSGGDNNLYPLDVTSPTTFNNAYFRNLVNQRGL  253



>ref|XP_011070596.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 163/236 (69%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNALSTI+T++  AV+ +   AA+L+ LHF DCF+ GCD S+LL  T  
Sbjct  28   QLSPSFYDTTCPNALSTIRTSIRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPT  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG  V+   K ++E +C GVVSCADILTLA RDA V +GGPSW+V 
Sbjct  88   IQSEKTAFPNVNSARGYEVVEAAKREVERICPGVVSCADILTLAARDASVAVGGPSWNVK  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   ++ +PGP+S+L  LIS F NKG +AR MVALSG+HTIG+A C  FR
Sbjct  148  LGRRDSTTASRALANSDLPGPSSSLDALISGFGNKGLSARDMVALSGAHTIGQAQCFLFR  207

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  R +CPQ+ GD N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  208  DRIYSNGTDIDAGFASTRRRQCPQNSGDGNLAPLDLVTPNSFDNNYFKNLMQRKGL  263



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 171/241 (71%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            S +  LS +FYSKTCPN  +T+K+AV +A++ +    A+LL L F DCF+NGCDGS+LL 
Sbjct  22   SCSAQLSTNFYSKTCPNVFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSILLD  81

Query  262  NTT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T+        NP     RG +V+ DIK+++E++C GVVSCADIL +A RD++V++GG S
Sbjct  82   DTSSFTGEKNANPNRNSARGFDVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGTS  141

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W+V LGRRDS T S+ A +  IP P SNL +LISSF +KG + + MVALSG HTIG+A C
Sbjct  142  WNVKLGRRDSKTASQSAANNNIPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQARC  201

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
              FR RIYN+S+I++S+A   + +CP S   GD N  PLD+ TP  FDN YFKNL +QKG
Sbjct  202  TNFRARIYNESNIESSFAKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFKNLINQKG  261

Query  772  L  774
            L
Sbjct  262  L  262



>gb|KHN46100.1| Cationic peroxidase 1 [Glycine soja]
Length=300

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 166/235 (71%), Gaps = 10/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+ + Y  TCP ALS IKTAV  AV  +    A+LL LHF DCF  GCD SVLL +T+ 
Sbjct  8    QLTSNCYESTCPQALSIIKTAVIGAVAKEHRMGASLLRLHFHDCF--GCDASVLLDDTST  65

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                      V   RG  VI DIKT++E  C GVVSCADIL +A RD++V +GGPSW+V 
Sbjct  66   FTGEKSAAANVNSLRGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVTLGGPSWNVG  125

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SKDA +T IP P  +L+ LISSF+NKGF  ++MVALSG+HT G+A C  FR
Sbjct  126  LGRRDSTTASKDAATTDIPSPLMDLSALISSFSNKGFNTKEMVALSGAHTTGQARCQLFR  185

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+S I++++A  L+S CP +GGD N  PLD+TT ++FDNAYFKNL ++KGL
Sbjct  186  GRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDVTTNVVFDNAYFKNLINKKGL  240



>gb|AFK43134.1| unknown [Medicago truncatula]
Length=312

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FYS TC + LSTIK  + +AV ++    A++L LHF DCF+ GCD SVLL +T  
Sbjct  19   QLSTDFYSTTCSDVLSTIKREIDSAVGNEARMGASILRLHFHDCFVQGCDASVLLDDTSS  78

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A       RG +VI  IKT+LE LC   VSCADIL++A RD++V +GGPSW+V 
Sbjct  79   FTGEKTAGANANSLRGFDVIDTIKTELESLCPNTVSCADILSVAARDSVVALGGPSWTVQ  138

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDS T S    ++ +PGP S+L+ LI+SF NKGFT ++MVALSGSHTIG+A C  FR
Sbjct  139  LGRRDSITASLSLANSDLPGPGSDLSGLITSFDNKGFTPKEMVALSGSHTIGQASCRFFR  198

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIY+D +ID+S+A  L++ CP +GGD N  PLD TTP  FDN+YF+NLQSQKGL
Sbjct  199  TRIYDDDNIDSSFATSLQANCPTTGGDDNLSPLDTTTPNTFDNSYFQNLQSQKGL  253



>gb|EYU41993.1| hypothetical protein MIMGU_mgv1a010225mg [Erythranthe guttata]
Length=318

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 164/235 (70%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYS TCPN L+ I+TAV+ AVN+DP   A+LL LHF DCF+ GCDGSVLL + T 
Sbjct  25   QLSPNFYSTTCPNLLTIIRTAVNTAVNNDPRMGASLLRLHFHDCFVQGCDGSVLLDDVTG  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IKTQ+E  C G+VSCADILT+A RD  V   GPSW++S
Sbjct  85   FTGEKTAAPNANSLRGFDVIDTIKTQVEAACPGIVSCADILTVAARDGTVARSGPSWALS  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    +  +PGP S+L +LI+SF+NKGFT R+MVALSGSHTIG A C+ FR
Sbjct  145  LGRRDSTTASLTGANGQLPGPGSSLNNLITSFSNKGFTTREMVALSGSHTIGLARCSTFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYN ++ID ++A   R+ CP +GG+ N  PLD  +P  F+N Y+ NL + +GL
Sbjct  205  NRIYNAANIDPAFATTRRANCPPTGGNNNLAPLDTLSPTTFNNDYYTNLVNLRGL  259



>ref|XP_007142069.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
 gb|ESW14063.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
Length=318

 Score =   265 bits (678),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 168/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+   Y  TCP ALS I+++V +AV  +    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  25   QLTSICYQSTCPQALSIIRSSVISAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSS  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                      V   RG  VI DIKT++E +C GVVSCADI+ +A RD++V +GGPSW+V 
Sbjct  85   FTGEKSAGANVNSLRGFEVIDDIKTKVEAVCPGVVSCADIVAVAARDSVVALGGPSWNVG  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SKDA +  IP P  +L+ LIS+FANKGF +++MVALSG+HT G A C  FR
Sbjct  145  LGRRDSTTASKDAATKDIPSPLMDLSALISAFANKGFNSKEMVALSGAHTTGLARCQLFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN++ I++++A  L+S CP +GGD N  PLD+TT + FDNAYFKNL +QKGL
Sbjct  205  GRVYNETSIESNFATSLKSNCPSTGGDTNLSPLDVTTSVQFDNAYFKNLINQKGL  259



>ref|XP_009622973.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=320

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 8/238 (3%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  LS  +Y K+CP A+ TIK AV NAV  +    A+LL LHF DCF+NGCDGSVLL +
Sbjct  24   SSAQLSSDYYEKSCPKAIYTIKDAVTNAVAKEHRMGASLLRLHFHDCFVNGCDGSVLLDD  83

Query  265  T---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T   T    A P     RG ++I  IK+Q+E+LC G+VSCADI+ +A RD++ ++GGPSW
Sbjct  84   TSDFTGEKTAKPNSNSLRGFDLIDTIKSQVEKLCPGIVSCADIIAIAARDSVAILGGPSW  143

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S  + ++ IP P  +LT LI++FANKGFTA++MVAL+G+HTIG+A C 
Sbjct  144  TVQLGRRDSTTASLSSANSDIPSPLMDLTDLITNFANKGFTAKEMVALAGAHTIGQAQCT  203

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR R+YN++ ID+S A  L+S CP +GGD +   LD  TP +FDN YF NL+  KG+
Sbjct  204  TFRERVYNETTIDSSLATSLKSNCPSTGGDDSLSALDAATPAIFDNHYFNNLKKNKGI  261



>ref|XP_010035986.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 168/233 (72%), Gaps = 8/233 (3%)
 Frame = +1

Query  100  SKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN--  273
            ++ +Y++ CP AL TI++AV +AV ++    A+LL LHF DCF+NGCD S+LL +T N  
Sbjct  29   NQDYYTQRCPRALETIQSAVRSAVANETRMGASLLRLHFHDCFVNGCDASILLDDTVNFT  88

Query  274  ------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLG  435
                  P V   RG +VI  IK ++E+LC G+VSCADIL +A RD++V++ GPSW V LG
Sbjct  89   GEKTAFPNVNSVRGFDVIDTIKLKVEKLCPGIVSCADILAVAARDSVVILDGPSWQVQLG  148

Query  436  RRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNR  615
            RRDSTT S +  +  +P P  NL+ L++SF+NKGFTA++MV LSGSHTIG+A C  FR R
Sbjct  149  RRDSTTASLNDANIDLPAPTLNLSGLVASFSNKGFTAKEMVTLSGSHTIGQARCVTFRTR  208

Query  616  IYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +YN+S+I  S+A  L+S CP SGG+ N  PL+IT+P  FDNAYF NL SQ+GL
Sbjct  209  LYNESNISPSFAMSLKSNCPSSGGNNNLSPLNITSPTFFDNAYFGNLVSQEGL  261



>gb|AHL39176.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 167/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY+ TCP ALSTI+TAV  AV  +    A+LL LHF DCF+ GCD SVLL +T  
Sbjct  23   QLSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVQGCDASVLLDDTSS  82

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IK+QLE +C GVVSCADIL +A RD++V + GPSW+V 
Sbjct  83   FTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTVQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ +P P  +L+ LI+SF+NKGFTA++MVALSGSHTIG+A C  FR
Sbjct  143  LGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLLFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+YN++ +D++ A  L+S CP +G D +   LD TTP+ FDN+YFKNL + KGL
Sbjct  203  NRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGL  257



>ref|XP_003623564.1| Peroxidase [Medicago truncatula]
 gb|AES79782.1| cationic peroxidase [Medicago truncatula]
Length=316

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 171/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FY +TCP  LSTIK  V +A+ ++    A+LL LHF DCF+ GCD SVLL +T++
Sbjct  23   QLSSNFYFRTCPLVLSTIKKEVISALINERRMGASLLRLHFHDCFVQGCDASVLLDDTSS  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+++E+LC   VSCADIL +A RD++V +GG SW+V 
Sbjct  83   FRGEKTAGPNANSLRGFDVIDKIKSEVEKLCPNTVSCADILAVAARDSVVALGGLSWTVQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ +PGP S+L+ LI++F NKGFT ++MVALSGSHTIG+A C  FR
Sbjct  143  LGRRDSTTASFGLANSDLPGPGSDLSGLINAFNNKGFTPKEMVALSGSHTIGEASCRFFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++ID+S+A  L+S CP++GGDLN  PLD T+P  FDNAYFKNLQ+QKGL
Sbjct  203  TRIYNENNIDSSFANSLQSSCPRTGGDLNLSPLDTTSPNTFDNAYFKNLQNQKGL  257



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 170/240 (71%), Gaps = 9/240 (4%)
 Frame = +1

Query  82   SSAY-HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            +SAY  LS  FY+K+CPN LST+K+AV  AV  +    A+LL LHF DCF+NGCDGS+LL
Sbjct  18   TSAYGQLSPTFYAKSCPNVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSILL  77

Query  259  VNTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +++         P     RG +VI +IK+Q+E +C GVVSCADILT+A RD++V +GGP
Sbjct  78   DDSSTLTGEKTAVPNANSARGFDVIDNIKSQVEAVCSGVVSCADILTIAARDSVVELGGP  137

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW+V LGRRDS T S    +  IP P S+L +L+S F  +G + + MVAL+G HTIG+A 
Sbjct  138  SWAVPLGRRDSRTASLSGANNNIPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTIGQAR  197

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C +FR  IYND++ID +YA  L++KCP++G D N  PLD+ TP  FDN YFKNL+++KGL
Sbjct  198  CTSFRAHIYNDTNIDTTYANSLKAKCPRTGSDNNISPLDVVTPTSFDNNYFKNLRAKKGL  257



>ref|XP_009371985.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Pyrus x bretschneideri]
Length=325

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 168/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CPNALSTIK+AV++AV+ +    A LL + F DCF+NGCD SVLL +T N
Sbjct  32   QLSSTFYETSCPNALSTIKSAVNSAVSKEARMGAFLLRIQFHDCFVNGCDASVLLDDTPN  91

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+QLE +C  VV+CADI+ +A RD+IV +GGP++ V 
Sbjct  92   FTGEKTADPNAKSLRGFDVIDTIKSQLERICPKVVTCADIIAVAARDSIVALGGPAYKVP  151

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ IP P  NLT LI++F+NKGFTA+ +VALSGSHTIG A C  FR
Sbjct  152  LGRRDSTTASLSAANSNIPAPTLNLTGLITAFSNKGFTAKDLVALSGSHTIGLARCTNFR  211

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+AS+A  L+  CP SGGD N  PLD+T+P  F+NAYF+NL +Q+GL
Sbjct  212  ARLYNETNINASFATSLKPSCPTSGGDNNLYPLDVTSPTTFNNAYFRNLVNQRGL  266



>ref|XP_010685962.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=365

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 169/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS ++Y+KTCP ALSTI+ AV  AV+++    A+LL LHF DCF+NGCD SVLL +T  
Sbjct  72   QLSANYYAKTCPKALSTIRNAVRKAVSAESRMGASLLRLHFHDCFVNGCDASVLLNDTST  131

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A       RG  V+  IK+Q+E +C GVVSCADIL +A R+++V + GP+W V 
Sbjct  132  FTGEQTAGANAGSLRGYTVVDSIKSQVESVCPGVVSCADILAVAARESVVSLRGPTWQVQ  191

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ IP P+ +L  L+SSF++KG TA++MVAL+G+HTIG+A C  FR
Sbjct  192  LGRRDSTTASLSTANSDIPSPSMDLRGLLSSFSDKGLTAKEMVALAGAHTIGQARCVVFR  251

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+YN+S+IDAS+   ++S CP SGGD N  PLD TTP++FDN YFK+L + KGL
Sbjct  252  NRVYNESNIDASFVTSVKSNCPSSGGDNNLSPLDSTTPVVFDNGYFKDLVNNKGL  306



>ref|XP_006468149.1| PREDICTED: cationic peroxidase 1-like [Citrus sinensis]
Length=305

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 164/235 (70%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS + Y  TCP ALSTIK+ VHNAV  +    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  12   QLSSNHYDNTCPKALSTIKSIVHNAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSS  71

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                          RG  VI  +K+++E LC GVVSCADIL +A RD++V  GGPSW+V 
Sbjct  72   FTGEKSASANANSIRGFEVIDSVKSKVESLCPGVVSCADILAVAARDSVVAFGGPSWTVQ  131

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A +T IP P  +L  LIS+FA KG +A++MVALSG+HTIG+A C  FR
Sbjct  132  LGRRDSTTASSSAVNTNIPSPLMDLNDLISNFAKKGLSAKEMVALSGAHTIGQARCLLFR  191

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++ID+ +A  L+S CP SGGD N   LD T+P+LFDN YF++L + KG+
Sbjct  192  QRIYNETNIDSEFATSLKSNCPSSGGDDNLSSLDATSPVLFDNGYFRDLVNNKGV  246



>ref|NP_001289531.1| lignin-forming anionic peroxidase precursor [Nicotiana sylvestris]
 sp|Q02200.1|PERX_NICSY RecName: Full=Lignin-forming anionic peroxidase; Flags: Precursor 
[Nicotiana sylvestris]
 gb|AAA34050.1| anionic peroxidase [Nicotiana sylvestris]
Length=322

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 162/236 (69%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNAL+TI+T+V  A++S+   AA+L+ LHF DCF+ GCD S+LL  T +
Sbjct  28   QLSATFYDNTCPNALNTIRTSVRQAISSERRMAASLIRLHFHDCFVQGCDASILLDETPS  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  +I D K ++E++C GVVSCADILT+A RDA   +GGPSW+V 
Sbjct  88   IESEKTALPNLGSARGFGIIEDAKREVEKICPGVVSCADILTVAARDASAAVGGPSWTVK  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SK    T +PGP   L  LISSFA+KG + R MVALSG+HTIG+A C  FR
Sbjct  148  LGRRDSTTASKTLAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFR  207

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  R +CPQ G + N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  208  DRIYSNGTDIDAGFASTRRRQCPQEGENGNLAPLDLVTPNQFDNNYFKNLIQKKGL  263



>gb|EYU41994.1| hypothetical protein MIMGU_mgv1a010221mg [Erythranthe guttata]
Length=318

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 163/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYS TCPN L+ I+TAV+ AV +DP   A+LL LHF DCF+ GCDGSVLL + T 
Sbjct  25   QLSPNFYSTTCPNLLTIIRTAVNTAVTNDPRMGASLLRLHFHDCFVQGCDGSVLLDDVTG  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IKTQ+E  C G+VSCADILT+A RD  V   GPSW++S
Sbjct  85   FTGEKTAAPNANSLRGFDVIDTIKTQVEAACPGIVSCADILTVAARDGTVARSGPSWALS  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    +  +PGP S+L +LI+SF+NKGFT R+MVALSGSHTIG A C+ FR
Sbjct  145  LGRRDSTTASLTGANGQLPGPGSSLNNLITSFSNKGFTTREMVALSGSHTIGLARCSTFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYN ++ID ++A   R+ CP +GG+ N  PLD  +P  F+N Y+ NL + +GL
Sbjct  205  NRIYNAANIDPAFATTRRANCPPTGGNNNLAPLDTVSPTTFNNDYYTNLVNLRGL  259



>ref|XP_002285723.1| PREDICTED: cationic peroxidase 1 isoform X1 [Vitis vinifera]
Length=317

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 171/235 (73%), Gaps = 9/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY+ +CP ALSTI+ AV+NAV  +    A+LL LHF DCF+ GCD S+LL +T  
Sbjct  23   QLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTAS  82

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  VI  IK+Q+E LC GVVSCADI+ +A RD++V +GGP+W++ 
Sbjct  83   FTGEKTAGPNKDSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWTLQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ +PGPAS+L+ LIS F+NKGFT ++MVALSG+HTIGKA C +FR
Sbjct  143  LGRRDSTTASLSTANSDLPGPASDLSTLISRFSNKGFTTKEMVALSGTHTIGKARCTSFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++IDA++A   +  CP +GGD N   LD TT + FDN YF+NL+++KGL
Sbjct  203  SRIYNETNIDAAFATSKQKICPSTGGDNNLSDLDETTTV-FDNVYFRNLKAKKGL  256



>ref|XP_010264471.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=320

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 170/237 (72%), Gaps = 8/237 (3%)
 Frame = +1

Query  88   AYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT  267
            A  LS  FY  +CP ALSTIKTAV  AV ++    A+LL LHF DCF+NGCD S+LLV+ 
Sbjct  25   AQLLSPTFYDTSCPTALSTIKTAVDAAVAAEARMGASLLRLHFHDCFVNGCDASILLVDN  84

Query  268  ---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWS  423
               T    APP     RG  VI  IK+QLE +C  VVSCADIL +A RD++V +GG SW+
Sbjct  85   ATFTGEQTAPPNNNSVRGFEVINSIKSQLESICPSVVSCADILAVAARDSVVSLGGASWT  144

Query  424  VSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAA  603
            V LGRRDSTT +    +T +P P+ NLT LI++FANKGFT  +M ALSGSHTIG+A C+ 
Sbjct  145  VQLGRRDSTTANLTGANTDLPSPSLNLTDLITAFANKGFTTGEMAALSGSHTIGQARCSV  204

Query  604  FRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            FR+RIYN+++I+++YAA L++ CP+S GD N  PLD TTP +FDNAYF NL + KGL
Sbjct  205  FRDRIYNETNINSTYAASLQANCPRSDGDDNLSPLDTTTPNVFDNAYFTNLLNMKGL  261



>ref|XP_010066274.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   262 bits (670),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 163/233 (70%), Gaps = 8/233 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS +CP+ALSTIK++V +AV ++    A+LL L F DCF+NGCD S+LL +TTN
Sbjct  26   QLSSTFYSTSCPSALSTIKSSVSSAVKNEARMGASLLRLDFHDCFVNGCDASILLDDTTN  85

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI  IK++LE  C G+VSCADIL +  RD+IV + GPSW+VS
Sbjct  86   FTGEKNAGPNANSMRGFEVIDTIKSELESKCPGIVSCADILAVVARDSIVAVSGPSWTVS  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A +  IP P  NL  LIS+F+NKGFTA++MVAL GSHTIG+A C  FR
Sbjct  146  LGRRDSTTASQTAANISIPPPTLNLRGLISAFSNKGFTAKEMVALLGSHTIGQARCLTFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQK  768
              +YN+++ID ++A  L++ CP SGGD    P D T+P  FDNA+FKNLQ+ K
Sbjct  206  EHLYNENNIDTTFATSLKANCPSSGGDSKLFPFDTTSPTSFDNAFFKNLQTHK  258



>gb|ACZ51443.1| peroxidase protein [Mikania micrantha]
Length=321

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FY+ +CPN  S I +AV++AV+++    A+LL LHF DCF+NGCD SVLL +TTN
Sbjct  28   QLSANFYATSCPNFSSIISSAVNSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDDTTN  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+QLE  C GVVSCAD+L  A RD++V +GGPSW+++
Sbjct  88   FTGEKTAGPNNNSLRGFDVIDTIKSQLESSCPGVVSCADLLATAARDSVVALGGPSWNLA  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
             GRRDS T S  A ++ IP P  NL+ LI+SF+N GFTA +MVALSGSHTIG+A C  FR
Sbjct  148  FGRRDSITASLSAANSNIPAPTLNLSGLITSFSNLGFTANEMVALSGSHTIGQARCTVFR  207

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I++S+A  LR+ CP SGGD N  PLD+ +P  FDN YF NL +Q GL
Sbjct  208  ARIYNENNINSSFATSLRANCPSSGGDNNLSPLDVVSPTSFDNTYFTNLLNQNGL  262



>ref|XP_003634480.1| PREDICTED: cationic peroxidase 1 [Vitis vinifera]
Length=318

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 169/237 (71%), Gaps = 9/237 (4%)
 Frame = +1

Query  88   AYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT  267
            A++LS +FY+++CP AL TI+TAV+ AV  +    A+LL LHF DCF+ GCD S+LL +T
Sbjct  22   AHYLSPNFYARSCPRALPTIRTAVNKAVAKEKRMGASLLRLHFHDCFVLGCDASILLDDT  81

Query  268  ---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWS  423
               T    A P     RG  VI  IK+Q+E LC GVVSCADI+ +A RD++V +GGP+W+
Sbjct  82   ATFTGEKTAGPNNNSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWT  141

Query  424  VSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAA  603
            V LGRRDSTT S  A  T +PGP  NL+ LIS+F+ KG T ++MV LSG+HTIGKA C +
Sbjct  142  VRLGRRDSTTASFSAARTDLPGPNLNLSQLISAFSKKGLTTKEMVVLSGTHTIGKARCTS  201

Query  604  FRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            FRN IYND+DID ++AA  +  CP+SGGD N  PLD TT + FDN YF+ L+ +KGL
Sbjct  202  FRNHIYNDTDIDPAFAASKQKICPRSGGDDNLSPLDGTTTV-FDNVYFRGLKEKKGL  257



>ref|XP_009408894.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=318

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 163/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPN  S +++A+  AVN +P   A++L L F DCF+NGCDGS+LL +T++
Sbjct  25   QLSPTFYGSTCPNLQSIVRSAMRQAVNKEPRMGASILRLFFHDCFVNGCDGSILLDDTSS  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI  IK+ +E  C   VSCADIL LA RD +V++GGP+W+V 
Sbjct  85   FTGEKSAGPNANSARGFEVIDTIKSNVEAACKATVSCADILALAARDGVVLLGGPTWTVQ  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S+ A ++ +PGP S+L+ LISSFA KG +AR M ALSG+HTIG+A C +FR
Sbjct  145  LGRRDATTASQSAANSNLPGPGSSLSQLISSFAAKGLSARDMTALSGAHTIGQARCTSFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            + IYND++++AS+AA  +  CP SGGD N  PLD+ TP  FDN Y++NL  +KGL
Sbjct  205  SHIYNDANVNASFAALRKQNCPSSGGDGNLAPLDLQTPTTFDNKYYQNLVVRKGL  259



>gb|EYU41992.1| hypothetical protein MIMGU_mgv1a010234mg [Erythranthe guttata]
Length=318

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FYS  CPN L+ ++TAV+ AV +D    A+LL LHF DCF+ GCDGSVLL +   
Sbjct  25   QLSPNFYSTRCPNLLTIVRTAVNTAVANDRRMGASLLRLHFHDCFVQGCDGSVLLDDVAG  84

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IKT++E  C G+VSCADILT+A RD  V + GPSW++S
Sbjct  85   FTGEKTAAPNANSLRGFDVIDTIKTRVEAACPGIVSCADILTIAARDGTVAVSGPSWALS  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S +  ++ +PGP S+L +LI+SFANKGFT R+MVALSGSHTIG A C+ FR
Sbjct  145  LGRRDSTTASLNGANSQLPGPGSSLNNLITSFANKGFTTREMVALSGSHTIGLARCSTFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYN ++ID ++A   R+ CP++GGD N  PLD  +   F+N Y+ NL S++GL
Sbjct  205  NRIYNAANIDPAFATARRANCPRTGGDNNLAPLDTVSSNTFNNDYYTNLVSRRGL  259



>ref|XP_010683551.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=343

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 169/235 (72%), Gaps = 9/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYS +CPNALSTI++AV +AVN++    A+LL LHF DCF+NGCDGS+LL +T N
Sbjct  27   QLSPNFYSSSCPNALSTIQSAVQSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDTAN  86

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  VI  IK+Q+E +C GVVSCADIL +A RD++V +GGPSW+V 
Sbjct  87   FTGEKTAIPNLNSVRGFEVIDTIKSQVENVCAGVVSCADILAVAARDSVVALGGPSWTVL  146

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT +  A + I+P P  N+T LI+ F+  GFT + +VALSG+HTIG+A C  FR
Sbjct  147  LGRRDSTTANISAANAILPAPTLNITQLITLFSGLGFTNQDLVALSGAHTIGQARCTTFR  206

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++I++++A  L++ CP SGGD N  PLD  TP  FDN YF +L + +G+
Sbjct  207  SRIYNETNINSTFATSLQANCPSSGGDNNTSPLD-KTPTTFDNTYFNDLLTLQGV  260



>ref|XP_006664869.1| PREDICTED: cationic peroxidase 1-like [Oryza brachyantha]
Length=317

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 165/235 (70%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY K+CPNALSTI+TAV +A+  +    A+LL LHF DCF+ GCDGSVLL +T  
Sbjct  24   QLSANFYDKSCPNALSTIRTAVRSAITKENRMGASLLRLHFHDCFVKGCDGSVLLDDTPT  83

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI +IK Q+E +C  VVSCADIL +A RD++V +GGP+W V 
Sbjct  84   FTGEKTAAPNNNSLRGFDVIDNIKAQIEGICPQVVSCADILAVAARDSVVALGGPTWVVQ  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S DA +  IP P  +L  L  SF+NKG +A  M+ALSG+HTIG+A C  FR
Sbjct  144  LGRRDSTTASLDAANNDIPAPTLDLGDLNKSFSNKGLSATDMIALSGAHTIGQARCVNFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIY++++ID+S A  L+S CP + GD N  PLD +TP +FDN Y+KNL  +KG+
Sbjct  204  NRIYSETNIDSSLATSLKSNCPNTTGDNNISPLDASTPYVFDNFYYKNLLKKKGV  258



>ref|XP_007208188.1| hypothetical protein PRUPE_ppa020902mg [Prunus persica]
 gb|EMJ09387.1| hypothetical protein PRUPE_ppa020902mg [Prunus persica]
Length=326

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 170/237 (72%), Gaps = 11/237 (5%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             LS  FY K CPNALSTIK+AV +AV  +    A+LL LHF DCF+NGCD S+LL +T  
Sbjct  32   ELSASFYDKNCPNALSTIKSAVDSAVYKEARMGASLLRLHFHDCFVNGCDASLLLDDTAT  91

Query  271  ----NPMVAPP---RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   VA     RG  VI +IK +LE LC  +VSCADIL +A RD+IV +GGP+++V+
Sbjct  92   FKGEKTSVANANSLRGFEVIDNIKAELESLCPNMVSCADILAVAARDSIVALGGPTYTVA  151

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDST  +  A +  +P P  N+T LI++F+ KGFT ++MVALSG+HTIG+A CA FR
Sbjct  152  LGRRDSTAANVTA-TEDLPSPFVNVTKLIAAFSKKGFTVKEMVALSGAHTIGQARCAFFR  210

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YND+DI+AS+AA +R+KCP SG  GD N   LD+TTP  FD++YFKN+ SQKGL
Sbjct  211  GRLYNDTDINASFAAAVRAKCPGSGGSGDNNMSELDVTTPTTFDSSYFKNVMSQKGL  267



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 161/240 (67%), Gaps = 8/240 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S S   LS +FYSK+CPN  ST+K  V +A+N +    A+L+ L F DCF+NGCDGS+LL
Sbjct  20   SISNAQLSTNFYSKSCPNLFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSILL  79

Query  259  VNT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T   T    A P     RG  VI  IK+ +E+ C GVVSCADIL +A RD+  ++GGP
Sbjct  80   DDTSSFTGEQTAVPNRNSVRGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGP  139

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW+V LGRRD+ T S  A +  IP P SNL  LIS F+  G + R +VALSG+HTIG+A 
Sbjct  140  SWNVKLGRRDARTASLSAANNGIPAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQAR  199

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C  FR RIYND++ID+S+A   RS CP +GGD N  PLD+ TP  FDN YFKNL  QKGL
Sbjct  200  CTNFRTRIYNDTNIDSSFAQTRRSNCPSTGGDNNLAPLDLQTPTSFDNNYFKNLLVQKGL  259



>gb|AFK46186.1| unknown [Lotus japonicus]
Length=316

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 169/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY+KTCP  L+TIKT V+ AV  +    A+LL LHF DCF+ GCD S+LL +T  
Sbjct  23   QLSSTFYAKTCPLVLATIKTQVNLAVAKEARMGASLLRLHFHDCFVQGCDASILLDDTSS  82

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IK+++E LC GVVSCADI+ +A RD++V +GG SW+V 
Sbjct  83   FTGEKTAGPNANSVRGYDVIDTIKSKVESLCPGVVSCADIVAVAARDSVVALGGFSWAVP  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  + ++ +PGP+SNL  L ++F+NKGFT R+MVALSGSHTIG+A C  FR
Sbjct  143  LGRRDSTTASLSSANSELPGPSSNLDGLNTAFSNKGFTTREMVALSGSHTIGQARCLFFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++ID+++A  L+  CP +GGD N  PLD T+P  FD+ Y++NLQS+KGL
Sbjct  203  TRIYNETNIDSTFAKNLQGNCPFNGGDSNLSPLDTTSPTTFDDGYYRNLQSKKGL  257



>ref|XP_010264472.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=325

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  +Y  +CP A STIK+ V  AV  +    A+LL LHF DCF+NGCDGS+LL +T  
Sbjct  32   QLSSTYYDTSCPKAFSTIKSGVTAAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSS  91

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A       RG +VI  IK+++E +C GVVSCADIL +A RD++V +GGPSW+V 
Sbjct  92   FTGEKTATANANSVRGFDVIDTIKSKVESVCPGVVSCADILAVAARDSVVALGGPSWTVQ  151

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S  A ++ IP P  +L+ L S+F+ KG TA++MVALSG+HTIG+A C +FR
Sbjct  152  LGRRDATTASLSAANSDIPAPTLDLSDLTSAFSKKGLTAKEMVALSGAHTIGQARCTSFR  211

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++I++S A  L+S CP +GGD N  PLD T+P  FDNAYFKNL + KGL
Sbjct  212  SRIYNETNINSSLATSLKSNCPSTGGDSNLSPLDATSPTAFDNAYFKNLVNNKGL  266



>ref|XP_002319407.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE95330.1| peroxidase family protein [Populus trichocarpa]
Length=302

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 166/235 (71%), Gaps = 9/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY+ TCP ALSTI+TAV  AV  +    A+LL LHF DCF  GCD SVLL +T  
Sbjct  10   QLSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCF-QGCDASVLLDDTSS  68

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IK+QLE +C GVVSCADIL +A RD++V + GPSW+V 
Sbjct  69   FTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTVQ  128

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ +P P  +L+ LI+SF+NKGFTA++MVALSGSHTIG+A C  FR
Sbjct  129  LGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLLFR  188

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+YN++ +D++ A  L+S CP +G D +   LD TTP+ FDN+YFKNL + KGL
Sbjct  189  NRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGL  243



>ref|XP_010263838.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010263839.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Nelumbo nucifera]
Length=318

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 168/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FY+ +CP+ALS IK+AV +AV  +    A+LL LHF DCF+NGCD S+LL +T++
Sbjct  25   QLSSNFYATSCPSALSIIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDASILLDDTSS  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+QLE  C GVVSCADIL +A+RD++V +GG SW+V 
Sbjct  85   FTGEKTAAPNANSARGFDVIDTIKSQLESACPGVVSCADILAVASRDSVVALGGTSWTVQ  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S D  +  +P P  +L+ LIS+FANKGFTA+++V LSG H+IG+A C+ FR
Sbjct  145  LGRRDSTTASLDDANNNLPSPFLDLSDLISAFANKGFTAKELVVLSGGHSIGQARCSLFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN++++D+S+A  ++S CP +GGD     LD TT  +FDNAYF NL + KGL
Sbjct  205  SRIYNETNVDSSFAKSIKSNCPSAGGDNTLANLDTTTSTVFDNAYFTNLLNNKGL  259



>ref|XP_004977590.1| PREDICTED: cationic peroxidase 1-like [Setaria italica]
Length=317

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 164/235 (70%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             L+ +FY K+CPNAL TI+TAV +AV  +    A+LL LHF DCF+NGCDGSVLL +T  
Sbjct  24   QLTANFYDKSCPNALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTPT  83

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IK Q+E +C  VVSCADIL +A RD++V +GGP+W V+
Sbjct  84   FTGEKTAVPNNNSIRGFDVIDSIKAQIEGICPQVVSCADILAVAARDSVVTLGGPTWVVN  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S DA +  IP P  +L+ L  SF+NKG TA  M+ALSG HTIG+A C  FR
Sbjct  144  LGRRDSTTASLDAANNDIPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARCVNFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIY++++ID S A  L+S CP   GD N  PLD +TP +FDN Y+KNL ++KG+
Sbjct  204  NRIYSEANIDTSLATSLKSNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGV  258



>ref|XP_004492537.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=316

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 169/239 (71%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            +++  LS +FY KTCP  L+TIK+ V  AVN++    A+LL LHF DCF+ GCD SVLL 
Sbjct  19   TTSAQLSSNFYLKTCPLVLATIKSEVTLAVNNERRMGASLLRLHFHDCFVQGCDASVLLD  78

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T++        P     RG +VI  IK+++E+LC   VSCADIL++A RD++V +GGPS
Sbjct  79   DTSSFTGEKSAGPNANSLRGFDVIDTIKSKVEKLCPNTVSCADILSVAARDSVVALGGPS  138

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            WSV LGRRDSTT S    ++ +PGP+S+L+ L ++F+NKGFT  ++VALSGSHTIG+  C
Sbjct  139  WSVQLGRRDSTTASLSIANSDLPGPSSDLSDLKTAFSNKGFTLEELVALSGSHTIGEGSC  198

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              FR RIYN+ +ID ++A  L+  CP +GGD N  PLD TTP  FDNAY++NLQ  KGL
Sbjct  199  RFFRARIYNEKNIDPTFATLLQGNCPSTGGDSNLSPLDTTTPNTFDNAYYRNLQKLKGL  257



>emb|CBI19220.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 171/235 (73%), Gaps = 9/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY+ +CP ALSTI+ AV+NAV  +    A+LL LHF DCF+ GCD S+LL +T  
Sbjct  23   QLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTAS  82

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  VI  IK+Q+E LC GVVSCADI+ +A RD++V +GGP+W++ 
Sbjct  83   FTGEKTAGPNKDSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWTLQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ +PGPAS+L+ LIS F+NKGFT ++MVALSG+HTIGKA C +FR
Sbjct  143  LGRRDSTTASLSTANSDLPGPASDLSTLISRFSNKGFTTKEMVALSGTHTIGKARCTSFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++IDA++A   +  CP +GGD N   LD TT + FDN YF+NL+++KGL
Sbjct  203  SRIYNETNIDAAFATSKQKICPSTGGDNNLSDLDETTTV-FDNVYFRNLKAKKGL  256



>ref|XP_002284007.1| PREDICTED: cationic peroxidase 1 isoform X2 [Vitis vinifera]
Length=316

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 166/235 (71%), Gaps = 9/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  +YS +CP+ALSTI+TAV+NAV  +    A+LL LHF DCF+ GCD S+LL +T N
Sbjct  23   QLSSDYYSSSCPSALSTIQTAVNNAVADESRMGASLLRLHFHDCFVLGCDASILLDDTAN  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+Q+E LC GVVSCADI+ +A RD++V +GGP+W+V 
Sbjct  83   FTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTVQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ +P P S+L  LIS F+NKGFT ++MV LSG+HTIGKA C+ FR
Sbjct  143  LGRRDSTTASFSTANSDLPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKAQCSKFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++IDA++A   ++ CP SGGD N   LD TT + FDN YF NL  +KGL
Sbjct  203  DRIYNETNIDATFATSKQAICPSSGGDENLSDLDETTTV-FDNVYFTNLIEKKGL  256



>dbj|BAA77388.1| peroxidase 2 [Scutellaria baicalensis]
Length=325

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 164/240 (68%), Gaps = 10/240 (4%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S   LS  FY  TCPNA+STI+T++  AV+++   AA+L+ LHF DCF+ GCD S+LL  
Sbjct  26   SEAQLSATFYDSTCPNAVSTIRTSIRQAVSAERRMAASLIRLHFHDCFVQGCDASILLDE  85

Query  265  TTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T+         P     RG  VI   KT +E LC GVVSCADILTLA RDA V +GGPSW
Sbjct  86   TSTIQSEKTAGPNAGSVRGFQVIDAAKTAVERLCPGVVSCADILTLAARDASVAVGGPSW  145

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT ++   +T +PGP S LT LI+ F  KG  AR+MVALSG+HT+G++ C 
Sbjct  146  TVRLGRRDSTTANRAQANTDLPGPTSTLTQLITRFDAKGLNAREMVALSGAHTLGQSQCG  205

Query  601  AFRNRIY-NDSDIDASYAAWLRSKCPQSG-GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR RIY N SDI+A++A+  R +CPQ G GD N  PLD+ TP  FDN Y++NL +++GL
Sbjct  206  NFRARIYSNGSDIEANFASTRRRQCPQDGSGDSNLAPLDLVTPNSFDNNYYRNLVARRGL  265



>ref|NP_001242089.1| uncharacterized protein LOC100815671 precursor [Glycine max]
 gb|ACU22965.1| unknown [Glycine max]
Length=322

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 168/238 (71%), Gaps = 9/238 (4%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  LS  FYS TCPNALSTIK+AV +AV+++    A+LL LHF DCF+ GCD SVLL +
Sbjct  27   SSSQLSSDFYSTTCPNALSTIKSAVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLND  86

Query  265  TTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T++          V   RG  VI +IK+Q+E LC GVVSCADILT+A RD++V +GGPSW
Sbjct  87   TSSFTGEQTAAGNVNSIRGFGVIDNIKSQVESLCPGVVSCADILTVAARDSVVALGGPSW  146

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S  + ++ +P    +L  L  +F NKG T  +MVALSG HTIG+A C+
Sbjct  147  TVQLGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSGGHTIGQAKCS  206

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR RIYN+++ID+S+A  L++ CP  GGD N  PLD +    FDNAYFK+LQSQKGL
Sbjct  207  TFRTRIYNETNIDSSFATSLQANCPSVGGDSNLAPLD-SNQNTFDNAYFKDLQSQKGL  263



>ref|NP_001065566.1| Os11g0112200 [Oryza sativa Japonica Group]
 tpe|CAH69373.1| TPA: class III peroxidase 131 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27411.1| Os11g0112200 [Oryza sativa Japonica Group]
Length=317

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 163/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY K+CPNALSTI+TAV +AV  +    A+LL LHF DCF+NGCDGSVLL +T  
Sbjct  24   QLSANFYDKSCPNALSTIRTAVRSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTPT  83

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI +IK Q+E +C  VVSCADIL +A RD++  +GGP+W V 
Sbjct  84   FTGEKTAAPNNNSLRGFDVIDNIKAQVEGICPQVVSCADILAVAARDSVFALGGPTWVVQ  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S D  +  IP P  +L  L  SF+NKG +A  M+ALSG+HTIG+A C  FR
Sbjct  144  LGRRDSTTASLDTANNDIPAPTLDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIY++++ID S A  L+S CP + GD N  PLD +TP  FDN Y+KNL ++KG+
Sbjct  204  NRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYTFDNFYYKNLLNKKGV  258



>gb|EYU46001.1| hypothetical protein MIMGU_mgv1a018175mg [Erythranthe guttata]
Length=309

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 168/242 (69%), Gaps = 11/242 (5%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            +++  LS + YS +CP AL+TIKT V   +  D    A+LL LHF DCF+NGCD SVLL 
Sbjct  5    ATSAQLSANHYSTSCPKALTTIKTTVLKTLLKDRRMGASLLRLHFHDCFVNGCDASVLLD  64

Query  262  NTTNPM---VAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T++ +    A P     RG  VI  IK+QLE +C GVVSCADIL ++ RD++V +GGPS
Sbjct  65   DTSSMIGEKTAAPNNNSLRGFEVIDSIKSQLETICPGVVSCADILAVSARDSVVAVGGPS  124

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDSTT S D+ +T IP P  +L  LIS+F+NKGFT ++MVALSG+HTIG+A C
Sbjct  125  WGVQLGRRDSTTASIDSANTDIPSPTLDLPELISAFSNKGFTPKEMVALSGAHTIGQARC  184

Query  598  AAFRNRIYNDS---DIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQK  768
              FR RIYN+    +I AS+A  L+S CP +GGD N  PLD T+ + FD AYFKNL S K
Sbjct  185  VVFRERIYNNETNDNIPASFATSLKSNCPLTGGDDNLSPLDATSSLSFDTAYFKNLVSNK  244

Query  769  GL  774
            GL
Sbjct  245  GL  246



>ref|NP_001057822.1| Os06g0547400 [Oryza sativa Japonica Group]
 dbj|BAD54122.1| putative bacterial-induced peroxidase precursor [Oryza sativa 
Japonica Group]
 tpe|CAH69328.1| TPA: class III peroxidase 86 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF19736.1| Os06g0547400 [Oryza sativa Japonica Group]
 gb|EEC80780.1| hypothetical protein OsI_23305 [Oryza sativa Indica Group]
 gb|EEE65851.1| hypothetical protein OsJ_21628 [Oryza sativa Japonica Group]
Length=324

 Score =   258 bits (660),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 164/237 (69%), Gaps = 8/237 (3%)
 Frame = +1

Query  88   AYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT  267
            A  LS +FYS+TCPN  + +++ + +AV ++P   A++L L F DCF+NGCDGS+LL +T
Sbjct  29   AQQLSPNFYSRTCPNLATIVRSGMASAVRTEPRMGASILRLFFHDCFVNGCDGSILLDDT  88

Query  268  T--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWS  423
            +         P     RG  VI  IKTQ+E  C   VSCADIL LA RD + ++GGP+WS
Sbjct  89   STFTGEKSAGPNANSARGFEVIDAIKTQVEASCKATVSCADILALAARDGVNLLGGPTWS  148

Query  424  VSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAA  603
            V+LGR+DS T S+ A ++ +PGP S+L  LIS F N+G +AR M ALSG+HTIG+A C  
Sbjct  149  VALGRKDSRTASQSAANSNLPGPGSSLATLISMFGNQGLSARDMTALSGAHTIGRAQCQF  208

Query  604  FRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            FR+RIY + +I+AS+A+  +  CP+SGGD N  P D+ TP  FDNAY++NL SQ+GL
Sbjct  209  FRSRIYTERNINASFASLRQQTCPRSGGDANLAPFDVQTPDAFDNAYYQNLVSQRGL  265



>dbj|BAM28609.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 161/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  +Y  +CP ALSTI++ V +A+  +    A+LL LHF DCF+NGCDGSVLL +T N
Sbjct  23   QLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTAN  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG +VI  IK  +E +C GVVSCADIL +  RD++V +GG SW+V 
Sbjct  83   FTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTVL  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A +  IP P  NL+ LISSF+NKG T  +MVALSG+HTIG A C  FR
Sbjct  143  LGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCTTFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++ID+SYA  L+  CP SGG  N  PLD T+P  FDNAYFK+L + KGL
Sbjct  203  SRIYNETNIDSSYATSLKKTCPTSGGGNNTAPLDTTSPYTFDNAYFKDLINLKGL  257



>dbj|BAM28608.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 161/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  +Y  +CP ALSTI++ V +A+  +    A+LL LHF DCF+NGCDGSVLL +T N
Sbjct  23   QLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTAN  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG +VI  IK  +E +C GVVSCADIL +  RD++V +GG SW+V 
Sbjct  83   FTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTVL  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A +  IP P  NL+ LISSF+NKG T  +MVALSG+HTIG A C  FR
Sbjct  143  LGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCTTFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++ID+SYA  L+  CP SGG  N  PLD T+P  FDNAYFK+L + KGL
Sbjct  203  SRIYNETNIDSSYATSLKKTCPTSGGGNNTAPLDTTSPYTFDNAYFKDLINLKGL  257



>dbj|BAJ95101.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 164/240 (68%), Gaps = 8/240 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S++   LS  FY  +CP+AL  I+TAV  AVNS+P   A+L+ LHF DCF++GCDGSVLL
Sbjct  17   SAAWAQLSPTFYLASCPSALFIIQTAVQAAVNSEPRMGASLVRLHFHDCFVDGCDGSVLL  76

Query  259  VNTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T +        P     RG+NVI  IK Q+E +C   VSCADIL +A RD++V +GGP
Sbjct  77   ADTGSFVGEQGAAPNAGSIRGMNVIDSIKAQVEAVCAQTVSCADILAVAARDSVVALGGP  136

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW V LGRRDSTT SK      +P P  +L +L +SFANK  T   MVALSG+HTIG++ 
Sbjct  137  SWPVLLGRRDSTTASKTNAENDLPPPTFDLQNLTTSFANKQLTLTDMVALSGAHTIGQSQ  196

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C  FRNRIYN+++I+ ++A  L++ CPQSGGD +  PLD TT   FDNAY+ NL SQKGL
Sbjct  197  CRFFRNRIYNEANINTAFATALKANCPQSGGDSSLAPLDTTTANAFDNAYYSNLISQKGL  256



>ref|XP_009603345.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
tomentosiformis]
Length=322

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 162/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             L+  FY+KTCP ALSTI+  V  AV+ +   AA+L+ LHF DCF+ GCD S+LL    N
Sbjct  29   QLTTSFYAKTCPKALSTIQKVVSRAVSRERRMAASLIRLHFHDCFVQGCDASILLDEASN  88

Query  265  TTNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T+   A P     RG +V+   K +LE++C GVVSCADILT+A RDA + + GPSW V 
Sbjct  89   ITSEKTAIPNQGSVRGFDVVETAKRELEKICPGVVSCADILTVAARDASIAVCGPSWKVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDST  ++   +  IP P  NL  LIS FA KG +A++MVALSG+HTIG++ C++FR
Sbjct  149  LGRRDSTMANRTLANIDIPRPFDNLDTLISRFAKKGLSAKEMVALSGAHTIGQSQCSSFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYN SDIDAS+A+  R +CP++GG+    PLD+ T   FDN YFKNL  +KGL
Sbjct  209  NRIYNASDIDASFASIRRRQCPRNGGNGTLAPLDLVTDKKFDNNYFKNLMQKKGL  263



>ref|XP_006470886.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=317

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 159/236 (67%), Gaps = 10/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCP AL TI+T + NAV+ +   AA+LL LHF DCF+ GCD S+LL ++++
Sbjct  24   QLSPAFYDATCPRALKTIRTGIRNAVSRERRMAASLLRLHFHDCFVQGCDASILLDDSSS  83

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI  +K+QLE +C GVVSCADI+ +A RDA   +GGPSW+V 
Sbjct  84   IDSEKNALPNFKSVRGFEVIDSVKSQLESVCPGVVSCADIVAVAARDASFAVGGPSWAVK  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+      +P     L  LIS+FA KGFTAR +VALSG+HTIG+A CA FR
Sbjct  144  LGRRDSTTASRSLAEN-LPSFTDGLDKLISTFATKGFTARDLVALSGAHTIGQAQCAFFR  202

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N SDIDA +A+  R +CP SGGD N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  203  DRIYSNQSDIDAGFASSRRRQCPASGGDSNLSPLDLVTPDSFDNNYFKNLVQKKGL  258



>ref|XP_006468162.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
 gb|KDO41521.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=323

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 172/241 (71%), Gaps = 11/241 (5%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  LS +FYSKTCP  L+T+K+AV +AV+ +    A+LL LHF DCF+NGCDGS+LL +
Sbjct  24   SSAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDD  83

Query  265  TTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T++        P +   RG  V+ DIK+++E++C GVVSCADIL +A R ++ ++GGPSW
Sbjct  84   TSSFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILGGPSW  143

Query  421  SVSLGRRDSTTPS-KDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            +V LGRRDS T S   A S +IP P S L++LI+ F  KG +A+ MVALSG+HTIG+A C
Sbjct  144  NVKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARC  203

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             AFRNRIYN+S+I++S+A   R  CP++   GD N  PLD  +P  FDN Y+K+L +QKG
Sbjct  204  VAFRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKHLLNQKG  263

Query  772  L  774
            L
Sbjct  264  L  264



>ref|XP_010683552.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 168/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN---  264
             LS  FYS +CPN LSTI++AV +A++++    A+LL LHF DCF+NGCDGS+LL +   
Sbjct  32   QLSSTFYSSSCPNVLSTIQSAVQSAIDTESRMGASLLRLHFHDCFVNGCDGSILLDDNAT  91

Query  265  -----TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                 T  P V   RG +VI  IK+Q+E +C GVVSCADIL +A RD++V +GG SW+V 
Sbjct  92   FTGEKTALPNVNSVRGYDVIDTIKSQVENVCPGVVSCADILAVAARDSVVALGGQSWTVQ  151

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ IP P  +L+ L+ SF N+GFT +++V LSG+HTIG+A C  FR
Sbjct  152  LGRRDSTTASLSTANSNIPAPTLDLSQLLDSFNNQGFTPQELVVLSGAHTIGQARCTTFR  211

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++I++++A  L++ CP +GGD N  PLD T+P  FDNAYF +L S +GL
Sbjct  212  SRIYNETNINSTFATSLQANCPSNGGDNNLSPLDQTSPTTFDNAYFTHLTSLQGL  266



>ref|XP_006657042.1| PREDICTED: peroxidase P7-like, partial [Oryza brachyantha]
Length=307

 Score =   257 bits (656),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 165/240 (69%), Gaps = 8/240 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            ++ A  LS +FYS+TCPN  S +++ + +AV ++P   A++L L F DCF+NGCDGS+LL
Sbjct  9    AAEAQQLSPNFYSRTCPNLASIVRSGMASAVRNEPRMGASILRLFFHDCFVNGCDGSILL  68

Query  259  VNTT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T+         P     RG  VI  IKTQ+E  C   VSCADIL LA RD + ++GGP
Sbjct  69   DDTSTFTGEKGAGPNANSARGFEVIDAIKTQVEASCKATVSCADILALAARDGVNLLGGP  128

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            +WSV LGR+DS T S+ A ++ +PGP S+L  LIS F N+G +AR M ALSG+HTIG++ 
Sbjct  129  TWSVPLGRKDSRTASQSAANSNLPGPGSSLATLISMFGNQGLSARDMTALSGAHTIGRSQ  188

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C  FR+RIY +S+I+AS+AA  +  CP+SGGD N  P D+ T   FDNAY++NL SQ+GL
Sbjct  189  CQFFRSRIYTESNINASFAALRQQTCPRSGGDANLAPFDVQTADAFDNAYYQNLVSQRGL  248



>emb|CDP07980.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 161/238 (68%), Gaps = 13/238 (5%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNAL+TI+T + +A++ +   AA+L+ LHF DCF+ GCDGSVLL  T  
Sbjct  27   QLSPTFYDTTCPNALTTIRTTIRSAISRERRMAASLIRLHFHDCFVQGCDGSVLLDET--  84

Query  274  PMVAPP----------RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWS  423
            P +             RG NVI D KT +E++C GVVSCADIL +A RD+   +GGPSW+
Sbjct  85   PTIQSEKTSLANRQSARGFNVIEDAKTAVEKICPGVVSCADILAVAARDSSAAVGGPSWT  144

Query  424  VSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAA  603
            V LGRRDSTT S+    + +P P   L+ LIS F+NKGFT R+MVALSG+HT+G+A C  
Sbjct  145  VKLGRRDSTTASRSLADSDLPAPFHQLSTLISLFSNKGFTPREMVALSGAHTVGQAQCRT  204

Query  604  FRNRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            FR RIY N +DID  +A+  + +CP +GGD N  PLD+ TP  FDN Y+KNL  +KGL
Sbjct  205  FRGRIYSNGADIDTGFASTRQRQCPSTGGDSNLAPLDLVTPNQFDNNYYKNLVQKKGL  262



>ref|XP_010261061.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=317

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 167/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN---  264
             LS +FY+ +CP ALS I++AV  AV  +    A+LL LHF DCF+NGCD S+LL +   
Sbjct  24   QLSPNFYASSCPRALSIIRSAVSIAVARERRMGASLLRLHFHDCFVNGCDASILLDDNST  83

Query  265  -----TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                 T  P     RG +V+  IK+QLE  C GVVSCADIL +A RD++V +GG SW+V 
Sbjct  84   FTGEKTAAPNANSVRGFDVVDTIKSQLESACPGVVSCADILAVAARDSVVALGGSSWTVQ  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S +A +  +P P S+L+ L+S+F+NKGFTA+++VALSGSHTIG+A C  FR
Sbjct  144  LGRRDSTTASLNAANNNLPSPFSDLSALLSAFSNKGFTAKELVALSGSHTIGQARCTIFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++I+++YA  L++ CP SGGD N   LD +T  +FDNAYF NL + +GL
Sbjct  204  SRIYNETNINSAYATSLKANCPSSGGDNNLAGLDASTSTVFDNAYFTNLLNNRGL  258



>ref|XP_009781728.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
Length=313

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 159/235 (68%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+  FY  TCP ALSTI+ AV  AV+ +   AA+L+ LHF DCF+ GCD S+LL  T+N
Sbjct  20   QLTPTFYENTCPKALSTIQKAVSQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETSN  79

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +V+   K +LE++C GVVSCADILT+A RDA V + GPSW V 
Sbjct  80   ITSEKTAVPNQGSVRGFDVVEAAKRELEKICPGVVSCADILTVAARDASVAVCGPSWKVK  139

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDS T ++   +  IP P  NL  LIS FA KG +A+ MV LSG+HTIG++ C++FR
Sbjct  140  LGRRDSRTANRTLANIDIPSPFDNLDTLISRFAKKGLSAKDMVVLSGAHTIGQSQCSSFR  199

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYN SDIDAS+A+  R +CP++GG+    PLD+ T  +FDN YFKNL  +KGL
Sbjct  200  NRIYNASDIDASFASITRRQCPKNGGNGTLAPLDLVTDKIFDNNYFKNLMQKKGL  254



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 167/237 (70%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYS +CPN LST+K+ V +AVN++    A+LL L F DCF+NGCDGSVLL +T++
Sbjct  28   QLSTNFYSSSCPNLLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVLLDDTSS  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +V+  IKT +E+ C GVVSCADIL ++ RD++V++GGP+W+V 
Sbjct  88   FTGEKNAFPNAGSLRGFDVVDQIKTAVEKACPGVVSCADILAISARDSVVILGGPTWNVK  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S+ A +T IP P ++L+ LI SF+++G +   MVALSG+HTIG+A C  FR
Sbjct  148  LGRRDATTASQSAANTNIPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIGQARCTTFR  207

Query  610  NRIYNDSDIDASYAAWLRSKCP--QSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+S+IDAS+A   ++ CP   + G  N  PLDI TP  FDN Y+ NL +QKGL
Sbjct  208  TRIYNESNIDASFAKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYYNNLVNQKGL  264



>ref|XP_010664359.1| PREDICTED: cationic peroxidase 1 isoform X3 [Vitis vinifera]
Length=316

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 165/235 (70%), Gaps = 9/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FY+ +CP ALSTI+ AV+NAV  +    A+LL LHF DCF+ GCD S+LL +T N
Sbjct  23   QLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTAN  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+Q+E LC GVVSCADI+ +A RD++V +GGP+W+V 
Sbjct  83   FTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTVQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ +P P S+L  LIS F+NKGFT ++MV LSG+HTIGKA C+ FR
Sbjct  143  LGRRDSTTASFSTANSDLPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKAQCSKFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++IDA++A   ++ CP SGGD N   LD TT + FDN YF NL  +KGL
Sbjct  203  DRIYNETNIDATFATSKQAICPSSGGDENLSDLDETTTV-FDNVYFTNLIEKKGL  256



>ref|XP_009608056.1| PREDICTED: lignin-forming anionic peroxidase [Nicotiana tomentosiformis]
Length=319

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 161/236 (68%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNAL+TI+T++  A++++   AA+L+ LHF DCF+ GCD S+LL  T +
Sbjct  25   QLSATFYDNTCPNALNTIRTSIRQAISNERRMAASLIRLHFHDCFVQGCDASILLDETPS  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  +I D K ++E++C  VVSCADILT+A RDA   +GGPSW+V 
Sbjct  85   IESEKTALPNLGSARGFGIIEDAKREVEKICPEVVSCADILTVAARDASAAVGGPSWTVK  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SK    T +PGP   L  LISSFA+KG + R MVALSG+HTIG+A C  FR
Sbjct  145  LGRRDSTTASKTLAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFR  204

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  + +CPQ G + N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  205  DRIYGNGTDIDAGFASTRKRQCPQEGENGNLAPLDLVTPNQFDNNYFKNLIQKKGL  260



>ref|XP_008782619.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=320

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 166/236 (70%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY  +CP ALSTI++AV  AV  +    A+LL LHF DCF+ GCDGSVLL +T  
Sbjct  26   QLSPTFYDTSCPKALSTIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDDTST  85

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IK+++E +C   VSCADIL +A RD++V +GGPSW+V 
Sbjct  86   FTGEKTAGPNNNSIRGFDVIDTIKSRVEAVCKQTVSCADILAVAARDSVVALGGPSWTVQ  145

Query  430  LGRRDSTTPSKDAGSTIIPGP-ASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAF  606
            LGRRDSTT S    ++ IP P  S+L+ LIS+F+ KG     MVALSG+HTIG+A C +F
Sbjct  146  LGRRDSTTASLSLANSDIPSPITSDLSALISAFSKKGLATSDMVALSGAHTIGQARCTSF  205

Query  607  RNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            RNRIYN+++ID+S+A  L+S CP SGGD N  PLD++TP +FDN Y++NL ++KGL
Sbjct  206  RNRIYNETNIDSSFATSLQSNCPVSGGDSNLAPLDVSTPTIFDNFYYRNLLNKKGL  261



>dbj|BAM28607.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 162/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  +Y  +CP ALSTI++ V +A+  +    A+LL LHF DCF+NGCDGSVLL +T N
Sbjct  23   QLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTAN  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG +VI  IK  +E +C GVVSCADIL +  RD++V +GG SW+V 
Sbjct  83   FTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTVL  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A +  IP P  NL+ LISSF+NKG T  +MVALSG+HTIG A C  FR
Sbjct  143  LGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCVTFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++I +SYAA L+  CP + G  N  PLDITTP +FDNAYFK+L + +GL
Sbjct  203  SRIYNETNIKSSYAASLKKNCPTNDGGNNTAPLDITTPFIFDNAYFKDLINLEGL  257



>ref|XP_011070598.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 160/236 (68%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY + CPNA + I+T++  AV+ +   AA+L+ LHF DCF+ GCD S+LL  T+ 
Sbjct  28   QLSTTFYDRACPNATAIIRTSIQRAVSLERRMAASLIRLHFHDCFVQGCDASILLDETST  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG  VI   K ++E +C GVVSCADILTLA  DA V +GGPSW+V 
Sbjct  88   IQSEKTAFPNVNSVRGYQVIEAAKREVERVCPGVVSCADILTLAALDASVAVGGPSWNVR  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   +T +P P + L  LISSFANKG +AR MVALSG+HTIG+A C  FR
Sbjct  148  LGRRDSTTASRSQANTDLPSPFAGLDALISSFANKGLSARDMVALSGAHTIGQAQCFLFR  207

Query  610  NRI-YNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RI  N +DIDA +A+  R +CPQSGGD N  PLD+ TP  FDN YFKNL  ++GL
Sbjct  208  SRINSNGTDIDARFASIRRRQCPQSGGDANLAPLDLVTPNSFDNNYFKNLMQRRGL  263



>ref|XP_003552299.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=322

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 165/235 (70%), Gaps = 9/235 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS TCPNALSTIK+ V +AV+++    A+LL LHF DCF+ GCD SVLL +TT+
Sbjct  30   QLSSDFYSTTCPNALSTIKSVVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLNDTTS  89

Query  274  PM--------VAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                      V   RG  VI +IK+Q+E LC GVVSCADIL +A RD++V +GGPSW+V 
Sbjct  90   FTGEQTARGNVNSIRGFGVIDNIKSQVESLCPGVVSCADILAVAARDSVVALGGPSWTVQ  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  + ++ +P    +L  L  +F NKG T  +MVALSG HTIG+A C+ FR
Sbjct  150  LGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSGGHTIGQAQCSTFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++ID+S+A  L++ CP  GGD N  PLD ++   FDNAYFK+LQSQKGL
Sbjct  210  TRIYNETNIDSSFATSLQANCPSVGGDSNLAPLD-SSQNTFDNAYFKDLQSQKGL  263



>emb|CAH10839.1| peroxidase [Picea abies]
Length=317

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 160/235 (68%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN---  264
             L+  FY+K CP ALS +K AV+ AVN++    A+LL LHF DCF+NGCDGS+LL +   
Sbjct  24   QLTSTFYNKLCPTALSIVKAAVNKAVNNEKRMGASLLRLHFHDCFVNGCDGSILLDDNST  83

Query  265  -----TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                 T  P     RG +VI  IKTQ+E  C GVVSCADIL +  RD++V +GGP+W+V 
Sbjct  84   FTGEKTALPNANSVRGFDVIDTIKTQVEAACSGVVSCADILAIVARDSVVQLGGPTWTVL  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A +  IP PASNL+ LISSF   G + + +VALSG HTIG+A C  FR
Sbjct  144  LGRRDSTTASLSAANNNIPSPASNLSALISSFTAHGLSTKDLVALSGGHTIGQARCTTFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+S+ID S+A  ++S CP +GGD    PLD+ TP  FDN Y+ +L ++KGL
Sbjct  204  ARIYNESNIDTSFATSVKSSCPSAGGDNTLSPLDLATPTTFDNKYYTDLGNRKGL  258



>ref|XP_006470885.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=317

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 159/236 (67%), Gaps = 10/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCP AL TI+T + NAV+ +   AA+LL LHF DCF+ GCD S+LL ++++
Sbjct  24   QLSPTFYDATCPRALKTIRTGIRNAVSGERRMAASLLRLHFHDCFVQGCDASILLDDSSS  83

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI  +K+QLE +C GVVSCADI+ +A RDA   +GGPSW+V 
Sbjct  84   IDSEKNALPNFKSVRGFEVIDSVKSQLESVCPGVVSCADIVAVAARDASFAVGGPSWTVK  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+      +P     L  LIS+FA KGF+AR +VALSG+HTIG+A CA FR
Sbjct  144  LGRRDSTTASRSLAEN-LPSFTDGLDRLISTFATKGFSARDLVALSGAHTIGQAQCAFFR  202

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N SDIDA +A+  R +CP SGGD N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  203  DRIYSNQSDIDAGFASTRRRECPASGGDSNLSPLDLVTPDSFDNNYFKNLVQKKGL  258



>gb|KGN47222.1| hypothetical protein Csa_6G216410 [Cucumis sativus]
Length=302

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 161/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FY KTCP  L+T++  +H+AV  +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  5    SSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILLE  64

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG +VI  IK  +E++C GVVSCADILTL+ RD++VV+GGPS
Sbjct  65   DTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPS  124

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S    +  IP P S L  LI+ F  KG + R +VALSG+HTIG+A C
Sbjct  125  WKVKLGRRDSKTASFSDVTGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARC  184

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              F+NRIYN+++ID S+A   +  CP +GGD N  PLD  TP LFDN Y+KNL  +K L
Sbjct  185  LFFKNRIYNETNIDESFAEERQRTCPTNGGDDNRAPLDFRTPKLFDNYYYKNLLEKKAL  243



>ref|XP_002450134.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
 gb|EES09122.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
Length=317

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 164/235 (70%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             L+ +FY K+CPNAL TI+TAV +AV  +    A+LL LHF DCF+NGCDGSVLL +T  
Sbjct  24   QLNANFYDKSCPNALYTIQTAVRSAVARENRMGASLLRLHFHDCFVNGCDGSVLLDDTPT  83

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IK QLE +C  VVSCADI+ +A RD++V +GGP+W+V+
Sbjct  84   FTGEKTAVPNNNSLRGFDVIDSIKAQLERICPQVVSCADIVAVAARDSVVALGGPTWAVN  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDS T S DA +  IP P  +LT L  SF+NKG +A  M+ALSG HTIG+A C  FR
Sbjct  144  LGRRDSLTASLDAANNDIPAPTLDLTDLTKSFSNKGLSASDMIALSGGHTIGQARCVNFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY++++ID S A  L++ CP   GD N  PLD +TP +FDN Y+KNL ++KG+
Sbjct  204  DRIYSEANIDTSLATSLKTNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGV  258



>ref|XP_011070599.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=321

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 159/236 (67%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNA + I+T++  A++ +   AA+L+ LHF DCF+ GCD S+LL  T  
Sbjct  28   QLSPTFYDTTCPNATAIIRTSIRRAISRERRMAASLIRLHFHDCFVQGCDASILLDETPT  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  VI   K ++E +C GVVSCAD+LTLA RDA V +GGPSW+V 
Sbjct  88   IQSEKTAFPNINSARGYEVIEAAKREVERVCPGVVSCADVLTLAARDASVAVGGPSWNVK  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   +T +P P + L  LIS+FANKG +AR MVALSG+HTIG+A C  FR
Sbjct  148  LGRRDSTTASRSQANTDLPSPFAGLDTLISAFANKGLSARDMVALSGAHTIGQAQCFLFR  207

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIY N +DIDA +A+  R +CPQ+GGD N   LD+ TP  FDN YFKNL  +KGL
Sbjct  208  GRIYSNGTDIDAGFASTRRRQCPQNGGDGNLAALDLVTPNSFDNNYFKNLMQRKGL  263



>ref|XP_011070597.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 161/236 (68%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY +TCPNA + I+ ++  A++ +   AA+L+ LHF DCF+ GCD S+LL  T+ 
Sbjct  28   QLSFTFYDRTCPNATAIIRASILRAISRERRMAASLIRLHFHDCFVQGCDASILLDETST  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P V   RG  VI   K ++E +C GVVSCADILTLA RDA V +GGPSW+V 
Sbjct  88   IQSEKTAFPNVNSVRGYQVIEAAKREVERVCPGVVSCADILTLAARDASVAVGGPSWNVK  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   +T +P P + +  LISSFANKG +AR MVALSG+HTIG+A C  FR
Sbjct  148  LGRRDSTTASRSQANTDLPSPFAGVDALISSFANKGLSARDMVALSGAHTIGQAQCFLFR  207

Query  610  NRI-YNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RI  N +DIDA +A+  R +CPQ+GGD N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  208  SRINSNGTDIDARFASIRRRQCPQTGGDANLAPLDLVTPNSFDNNYFKNLMQRKGL  263



>ref|NP_001060627.1| Os07g0677100 [Oryza sativa Japonica Group]
 dbj|BAC83102.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAF22541.1| Os07g0677100 [Oryza sativa Japonica Group]
 dbj|BAG95220.1| unnamed protein product [Oryza sativa Japonica Group]
Length=315

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 161/235 (69%), Gaps = 10/235 (4%)
 Frame = +1

Query  100  SKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT---T  270
            S  FY  +CP AL+TIK+AV  AVN++P   A+LL LHF DCF+ GCD SVLL +T   T
Sbjct  22   SPTFYDTSCPRALATIKSAVTAAVNNEPRMGASLLRLHFHDCFVQGCDASVLLADTATFT  81

Query  271  NPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLG  435
                A P     RG NV+  IKTQLE +C   VSCADIL +A RD++V +GGPSW+V LG
Sbjct  82   GEQNALPNKNSLRGFNVVDSIKTQLEGICSQTVSCADILAVAARDSVVALGGPSWTVGLG  141

Query  436  RRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNR  615
            RRDSTT S D+ +  +P P  +L +LI +F +KGF+   MVALSG+HTIG+A C  FR R
Sbjct  142  RRDSTTASMDSANNDLPPPFFDLENLIKAFGDKGFSVTDMVALSGAHTIGQAQCTNFRGR  201

Query  616  IYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            IYN+++IDA YAA LR+ CP +   GD N   LD TTP  FDNAY+ NL S KGL
Sbjct  202  IYNETNIDAGYAASLRANCPPTAGTGDSNLAALDTTTPYSFDNAYYSNLLSNKGL  256



>ref|XP_004172441.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 161/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FY KTCP  L+T++  +H+AV  +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  16   SSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILLE  75

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG +VI  IK  +E++C GVVSCADILTL+ RD++VV+GGPS
Sbjct  76   DTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPS  135

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S    +  IP P S L  LI+ F  KG + R +VALSG+HTIG+A C
Sbjct  136  WKVKLGRRDSKTASFSDVTGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARC  195

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              F+NRIYN+++ID S+A   +  CP +GGD N  PLD  TP LFDN Y+KNL  +K L
Sbjct  196  LFFKNRIYNETNIDESFAEERQRTCPTNGGDDNRAPLDFKTPKLFDNYYYKNLLEKKAL  254



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 168/241 (70%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FYSKTCPN  ST++  + +A++S+    A++L L F DCF+NGCDGS+LL 
Sbjct  21   SSSAQLSTNFYSKTCPNLFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLLLD  80

Query  262  NTT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T+        NP     RG +VI  IK  +E+ C GVVSCADIL ++ RD++V++GGP+
Sbjct  81   DTSSFTGEKTANPNRNSARGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGPN  140

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W+V LGRRD+ T S    +  IP P S+L++LIS F+ +G +A +MVALSG+HTIG+A C
Sbjct  141  WNVKLGRRDARTASLSGANNNIPPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQARC  200

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             +FR RIYND++ID S+A   RS CP +   GD N  PLD+ TP  FDN YFKNL +QKG
Sbjct  201  TSFRARIYNDTNIDGSFAKTRRSNCPSTSGNGDNNLAPLDLQTPTSFDNDYFKNLVNQKG  260

Query  772  L  774
            L
Sbjct  261  L  261



>ref|XP_010263840.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=318

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 162/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CP ALS IK+AV +AV+S+    A+LL LHF DCF+NGCD S+LL +T+ 
Sbjct  25   QLSSTFYDTSCPRALSIIKSAVDSAVSSERRMGASLLRLHFHDCFVNGCDASILLDDTST  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI  IK+QLE  C GVVSCADIL +A RD++V +GG SW+V 
Sbjct  85   FTGEKTALPNANSVRGFDVIDTIKSQLESACPGVVSCADILAVAARDSVVALGGTSWTVQ  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S +  +  +P P  +L+ LIS+FANKGFTA ++V LSG+HTIG+A C  FR
Sbjct  145  LGRRDSTTASLNDANNDLPAPFLDLSALISAFANKGFTANELVVLSGAHTIGQARCTTFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RI+N+++ID+ +A  ++S CP SGGD N   LD TT   FDN +F NL S KGL
Sbjct  205  DRIHNETNIDSQFATSMKSNCPSSGGDNNLANLDTTTATTFDNVFFTNLLSNKGL  259



>ref|XP_004149366.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 161/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FY KTCP  L+T++  +H+AV  +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  16   SSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILLE  75

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG +VI  IK  +E++C GVVSCADILTL+ RD++VV+GGPS
Sbjct  76   DTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPS  135

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S    +  IP P S L  LI+ F  KG + R +VALSG+HTIG+A C
Sbjct  136  WKVKLGRRDSKTASFSDVTGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARC  195

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              F+NRIYN+++ID S+A   +  CP +GGD N  PLD  TP LFDN Y+KNL  +K L
Sbjct  196  LFFKNRIYNETNIDESFAEERQRTCPTNGGDDNRAPLDFRTPKLFDNYYYKNLLEKKAL  254



>gb|ABR18139.1| unknown [Picea sitchensis]
Length=327

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 161/241 (67%), Gaps = 9/241 (4%)
 Frame = +1

Query  79   SSSAY-HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVL  255
            S+S Y  L   FY K+CPN LS + + V  AV  +    A+LL LHF DCF+NGCDGS+L
Sbjct  28   STSVYGQLCPDFYDKSCPNVLSIVNSVVMQAVAKEKRMGASLLRLHFHDCFVNGCDGSIL  87

Query  256  LVNTT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGG  411
            L +T+        NP     RG +VI  IKTQ+E  C GVVSCADI+ +A RD++V +GG
Sbjct  88   LDDTSTFTGEKTANPNNNSVRGFDVIDTIKTQVEATCSGVVSCADIVAIAARDSVVQLGG  147

Query  412  PSWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKA  591
            P+W+V LGRRDST+ SK A +  IP P SNL+ LIS F  +G T   MVALSGSHTIG+A
Sbjct  148  PTWTVMLGRRDSTSASKSAANNNIPPPTSNLSALISFFQAQGLTTEDMVALSGSHTIGQA  207

Query  592  HCAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             C  FRNRIYN+S+I   +A   ++ CP +GGD N  PLD+ TP  FDN+Y+ NLQ Q G
Sbjct  208  RCTNFRNRIYNESNIALLFAGLRKANCPVTGGDNNLAPLDLFTPTAFDNSYYNNLQFQNG  267

Query  772  L  774
            L
Sbjct  268  L  268



>ref|XP_010066439.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=322

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 165/235 (70%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS +CP+AL TIK+ V +AV+S+     +LL LHF DCF+NGCD S+LL +T N
Sbjct  29   RLSSTFYSTSCPSALHTIKSGVSSAVSSEASMDGSLLRLHFHDCFVNGCDASILLDDTMN  88

Query  274  PMVAPP--------RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                           G  VI  IK+QLE  C GVVSCADIL +A RD++V +GGPSW+V 
Sbjct  89   FTGEKTADANDNSIHGYEVIDKIKSQLESSCPGVVSCADILAVAARDSVVALGGPSWTVL  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S  A ++ +P    +L+ LI++F+NKGFTA++MVALSGSHTIG+A C  FR
Sbjct  149  LGRRDSTTASLSAANSDLPASTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQARCTTFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+SDI++ YA  L++ C  SGGD N  PLD  +P  FDNAYFKNLQ+QKGL
Sbjct  209  TRLYNESDINSMYATSLKANCQSSGGDNNLSPLDTMSPTYFDNAYFKNLQTQKGL  263



>dbj|BAK03677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 166/236 (70%), Gaps = 4/236 (2%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            ++++  LS  FYS +CP AL+TIK+AV  AV+ DP   A+LL LHF DCF+ GCD SVLL
Sbjct  18   TAASAQLSPTFYSASCPGALATIKSAVAAAVSRDPRMGASLLRLHFHDCFVQGCDASVLL  77

Query  259  V-NTTN--PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
              N  N  P     RG +VI  IK Q+E +C   VSCADIL +A RD++V +GGPSW+V 
Sbjct  78   SGNEQNAGPNAGSLRGFDVIDSIKAQVEAVCRQTVSCADILAVAARDSVVALGGPSWTVP  137

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT +    ++ +PGP S+   L ++F  KG     MVALSG+HTIG+A C++FR
Sbjct  138  LGRRDSTTANAGLANSDLPGPGSSRAQLEAAFLKKGLNTVDMVALSGAHTIGRAQCSSFR  197

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY  D++I+A+YAA LR+ CPQSGG+ N   LD TTP  FDNAY+K+L SQKGL
Sbjct  198  SRIYGGDTNINAAYAASLRANCPQSGGNGNLASLDTTTPNTFDNAYYKDLLSQKGL  253



>gb|ACF08084.1| class III peroxidase [Triticum aestivum]
Length=314

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 158/231 (68%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG +VI  IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFSVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP S+ + L ++F  K      MVALSG+HTIGKA C+ FRNRIY 
Sbjct  144  STTASASLANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRNRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNSNLANLDTTTPNAFDNAYYTNLLSQKGL  254



>ref|XP_010491069.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 169/237 (71%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FYS +CPN LST++TAV +AV S+     ++L L F DCF+NGCDGS+LL +T+ 
Sbjct  29   QLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTSS  88

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IK+ +E+ C GVVSCADIL +A RD++V +GGP+W+V 
Sbjct  89   FTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IPGP S+L+ LISSF+  G + R MVALSG+HTIG+A C +FR
Sbjct  149  VGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQARCTSFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I+A++A   +  CP++   GD N  PLD+TT   FDN YFKNL +QKGL
Sbjct  209  ARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGL  265



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 170/237 (72%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FYS +CPN LST+++AV +AVNS+    A+++ L F DCF+NGCDGS+LL +T+ 
Sbjct  29   QLTPNFYSTSCPNLLSTVQSAVKSAVNSEARMGASIVRLFFHDCFVNGCDGSILLDDTSS  88

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IK  +E+ C GVVSCADIL +A RD++VV+GGP+W+V 
Sbjct  89   FTGEQNANPNRNSARGFNVIDNIKAAVEKACPGVVSCADILAIAARDSVVVLGGPNWTVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C +FR
Sbjct  149  VGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I+A++A   +  CP++   GD N  PLD+TT   FDN YFKNL +Q+GL
Sbjct  209  TRIYNETNINAAFATTRQRTCPRTSGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGL  265



>ref|XP_006288218.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
 gb|EOA21116.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
Length=324

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 171/237 (72%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FY+ +CPN LST++ AV +AVNS+    A++L L F DCF+NGCDGS+LL +T+ 
Sbjct  29   QLTTNFYATSCPNLLSTVQAAVKSAVNSERRMGASILRLFFHDCFVNGCDGSILLDDTSS  88

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IK+ +E+ C GVVSCADIL +A RD++VV+GGP+W+V 
Sbjct  89   FTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IPGP S+L+ LISSF+  G + R MVALSG+HTIG++ C +FR
Sbjct  149  VGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I+A++A   +  CP++   GD N  PLD+TT   FDN YFKNL +Q+GL
Sbjct  209  ARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQRGL  265



>ref|NP_001060629.1| Os07g0677300 [Oryza sativa Japonica Group]
 sp|Q0D3N0.1|PER2_ORYSJ RecName: Full=Peroxidase 2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA03911.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAC79528.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAC83104.1| peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69354.1| TPA: class III peroxidase 112 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF22543.1| Os07g0677300 [Oryza sativa Japonica Group]
 dbj|BAG93552.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67816.1| hypothetical protein OsJ_25570 [Oryza sativa Japonica Group]
Length=314

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 159/227 (70%), Gaps = 5/227 (2%)
 Frame = +1

Query  109  FYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VNTTNPM  279
            FY  +CPNALSTIK+AV  AVNS+P   A+L+ LHF DCF+ GCD SVLL        P 
Sbjct  29   FYDTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVLLSGQEQNAGPN  88

Query  280  VAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRDSTTPS  459
                RG NV+ +IKTQ+E +C   VSCADIL +A RD++V +GGPSW+V LGRRDSTT +
Sbjct  89   AGSLRGFNVVDNIKTQVEAICSQTVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTAN  148

Query  460  KDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYNDSDID  639
            +   +T +P P+S+L  LI +F+ KG     MVALSG+HTIG+A C  FR+R+YN+++ID
Sbjct  149  ESQANTDLPAPSSSLAELIGNFSRKGLDVTDMVALSGAHTIGQAQCQNFRDRLYNETNID  208

Query  640  ASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +S+A  L++ CP+    GD N  PLD TTP  FD+AY+ NL S KGL
Sbjct  209  SSFATALKANCPRPTGSGDSNLAPLDTTTPNAFDSAYYTNLLSNKGL  255



>ref|XP_010228647.1| PREDICTED: peroxidase 2-like [Brachypodium distachyon]
Length=325

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 163/230 (71%), Gaps = 8/230 (3%)
 Frame = +1

Query  109  FYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-----  273
            FY  +CP+AL+TIK+AV  AV+ +P   A+LL LHF DCF+ GCD SVLL +T N     
Sbjct  37   FYDASCPSALATIKSAVTAAVSKEPRMGASLLRLHFHDCFVQGCDASVLLADTANFTGEQ  96

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P     RGL+VI  +K Q+E +C  +VSCADIL +A RD++V +GGPS++V LGRRD
Sbjct  97   TAFPNANSIRGLDVIDTVKAQVEAVCTQIVSCADILAVAARDSVVTLGGPSYTVPLGRRD  156

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT S    +  +P P S+L  L+ +F+ KG +   MVALSG+HTIG+A C  F++RIY 
Sbjct  157  STTASLSLANNDLPPPTSDLADLVGNFSRKGLSTTDMVALSGAHTIGQAACTNFQSRIYG  216

Query  625  DSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +S+I+A+YAA L++ CPQSGGD N+ PLD+ TP  FDNAY+ NL SQ+GL
Sbjct  217  ESNINAAYAASLQANCPQSGGDGNFAPLDVATPNAFDNAYYGNLVSQQGL  266



>sp|A2YPX3.2|PER2_ORYSI RecName: Full=Peroxidase 2; Flags: Precursor [Oryza sativa Indica 
Group]
 gb|AAC49821.1| peroxidase [Oryza sativa Indica Group]
 gb|EEC82682.1| hypothetical protein OsI_27327 [Oryza sativa Indica Group]
Length=314

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 159/227 (70%), Gaps = 5/227 (2%)
 Frame = +1

Query  109  FYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VNTTNPM  279
            FY  +CPNALSTIK+AV  AVNS+P   A+L+ LHF DCF+ GCD SVLL        P 
Sbjct  29   FYDTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVLLSGQEQNAGPN  88

Query  280  VAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRDSTTPS  459
                RG NV+ +IKTQ+E +C   VSCADIL +A RD++V +GGPSW+V LGRRDSTT +
Sbjct  89   AGSLRGFNVVDNIKTQVEAICSQTVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTAN  148

Query  460  KDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYNDSDID  639
            +   +T +P P+S+L  LI +F+ KG     MVALSG+HTIG+A C  FR+R+YN+++ID
Sbjct  149  ESQANTDLPAPSSSLAELIGNFSRKGLDVTDMVALSGAHTIGQAQCQNFRDRLYNETNID  208

Query  640  ASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +S+A  L++ CP+    GD N  PLD TTP  FD+AY+ NL S KGL
Sbjct  209  SSFATALKANCPRPTGSGDSNLAPLDTTTPNAFDSAYYTNLLSNKGL  255



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 169/242 (70%), Gaps = 11/242 (5%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            S++  LS +FYSK+CPN LST K+ V +AV+ +    A+LL L F DCF+NGCDGS+LL 
Sbjct  23   SASAQLSTNFYSKSCPNVLSTAKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLD  82

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T++        P     RG NVI  IK+++E  C GVVSCADI+ +A RD++V++GGPS
Sbjct  83   DTSSFQGEKTAGPNQNSVRGYNVIDQIKSKVESACPGVVSCADIVAIAARDSVVLLGGPS  142

Query  418  WSVSLGRRDSTTPS-KDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            W V LGRRD+ T S   A S +IP P S L++LIS F  +G + R MVALSGSHTIG+A 
Sbjct  143  WEVKLGRRDARTASLSRANSGVIPPPTSTLSNLISRFKAQGLSTRDMVALSGSHTIGQAR  202

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQK  768
            C +FR RIYNDS+ID+S++   + KCP++   GD N  PLD+ +P  FDNAYFKNL S K
Sbjct  203  CISFRPRIYNDSNIDSSFSKTRQGKCPRTAGSGDNNLSPLDLQSPTAFDNAYFKNLLSNK  262

Query  769  GL  774
            GL
Sbjct  263  GL  264



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 166/241 (69%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FYSKTCP    T+K+ V +AV+ +    A+LL L F DCF+NGCD SVLL 
Sbjct  22   SSSAQLSTNFYSKTCPKVFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVLLD  81

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RGLNVI +IK+Q+E +C GVVSCADI+ +A RD++V++GGP 
Sbjct  82   DTSSFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPD  141

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S    +  IP P S+L++LIS F  +G + R MVALSG+HTIG+A C
Sbjct  142  WDVKLGRRDSKTASLSGANNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQARC  201

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             +FR RIYN+++ID+S+A   ++ CP +   GD N  PLD+ TP  FDN Y+KNL +QKG
Sbjct  202  TSFRARIYNETNIDSSFAKTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYKNLINQKG  261

Query  772  L  774
            L
Sbjct  262  L  262



>gb|AAW52717.1| peroxidase 3 [Triticum monococcum]
 gb|ACF08082.1| class III peroxidase [Triticum aestivum]
Length=314

 Score =   254 bits (650),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI +IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDNIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP+S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASASLANSDLPGPSSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNTNLANLDTTTPNAFDNAYYTNLLSQKGL  254



>ref|XP_006351919.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=319

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 159/236 (67%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY +TCPNAL+TI+T++  A++S+   AA+L+ LHF DCF+ GCD S+LL  T  
Sbjct  25   QLSSTFYDRTCPNALTTIRTSIRQAISSERRMAASLIRLHFHDCFVQGCDASLLLDETPT  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  +I D K ++E+ C GVVSCADIL +A RDA  ++GGPSW+V 
Sbjct  85   IVSEKTALPNLGSVRGFGIIEDAKREVEKTCPGVVSCADILAVAARDASSLVGGPSWTVK  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S     T +PGP   L+ LIS FANKG + R MVALSGSH+IG+A C  FR
Sbjct  145  LGRRDSTTASHTLAETDLPGPFDPLSRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFR  204

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  R +CPQ   + N  PLD+ TP   DN YFKNL+ +KGL
Sbjct  205  DRIYGNGTDIDAGFASTRRRRCPQEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGL  260



>ref|XP_008465298.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=324

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 161/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FY K+CP  L+T++  +H AV  +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  27   SSSAQLSTNFYYKSCPKLLNTVRAGIHAAVAKEARMGASLLRLHFHDCFVNGCDGSILLE  86

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG +VI  IK  +E++C GVVSCADILTL+ RDA+VV+GGPS
Sbjct  87   DTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDAVVVLGGPS  146

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S    +  IP P S L  LI+ F  KG + R +VALSG+HTIG+A C
Sbjct  147  WKVKLGRRDSKTASFSDVTGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARC  206

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              F+NRIYN+++ID S+A   +  CP +GGD N  PLD+ TP LFDN Y+KNL  +K L
Sbjct  207  LFFKNRIYNETNIDESFAEERQRICPTNGGDDNRAPLDLRTPKLFDNYYYKNLLEKKAL  265



>ref|XP_002509733.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51120.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=321

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 163/236 (69%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY  TCPNAL+TIK+A+  A+ S+   AA+L+ LHF DCF+ GCDGSVLLV+T  
Sbjct  27   QLSSNFYDNTCPNALTTIKSAIDAAIESEQRMAASLIRLHFHDCFVQGCDGSVLLVDTPT  86

Query  268  -TNPMVA-----PPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A       RG NVI D K Q+E +C G+VSCADIL +A RDA V  GGPSW+V+
Sbjct  87   FTGEKSARNNANSIRGENVIDDAKAQVESICPGIVSCADILAVAARDASVAAGGPSWTVN  146

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ +PG +  L  LIS F++KG   R MVALSG+HTIG+A C  FR
Sbjct  147  LGRRDSTTASLAQANSDLPGFSDPLNRLISLFSDKGLNERDMVALSGAHTIGQAQCVTFR  206

Query  610  NRIYND-SDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+ SDID  +AA  R  CPQ+GG+ N  PLD+ TP  FDN Y+ NL +++GL
Sbjct  207  DRIYNNASDIDPDFAATRRGNCPQTGGNGNLAPLDLVTPNNFDNNYYSNLMAKRGL  262



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 166/237 (70%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+ +FYS +CPN LST+++A+ +AVN +    A++L L F DCF+NGCDGS+LL +T+N
Sbjct  29   QLTTNFYSSSCPNLLSTVRSAMQSAVNREARAGASILRLFFHDCFVNGCDGSILLDDTSN  88

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +VI +IKT +E  C GVVSCADIL +A RD +V++GGP+W+V 
Sbjct  89   FTGEKNANPNRNSARGFDVIDNIKTAVERACPGVVSCADILAVAARDGVVLLGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+ T S+   ++ IP P S+L+ LISSF N G + R MVALSG HTIG+A C +FR
Sbjct  149  LGRRDARTASQSGANSNIPAPTSSLSQLISSFGNVGLSTRDMVALSGGHTIGQARCTSFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I++++A   +  CP++   GD N  PLDI TP  F+N YFKNL +Q+GL
Sbjct  209  TRIYNETNINSAFATTRQQTCPRTAGSGDGNLAPLDIQTPANFNNDYFKNLMAQRGL  265



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 169/237 (71%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FYS +CPN LST++TAV +AV S+     ++L L F DCF+NGCDGS+LL +T+ 
Sbjct  29   QLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTSS  88

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IK+ +E+ C GVVSCADIL +A RD++V +GGP+W+V 
Sbjct  89   FTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IPGP S+L+ LISSF+  G + R MVALSG+HTIG++ C +FR
Sbjct  149  VGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I+A++A   +  CP++   GD N  PLD+TT   FDN YFKNL +QKGL
Sbjct  209  ARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGL  265



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 167/241 (69%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS   L+ +FYSK+CPN L+T+ + V +A+N +    A+LL L F DCF+NGCDGS+LL 
Sbjct  23   SSNAQLTTNFYSKSCPNLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSILLD  82

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T++        P     RG  VI  IK+ +E+ C GVVSCADILT+  RD++V++GGP+
Sbjct  83   DTSSFTGEKTALPNSGSVRGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGGPT  142

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W+V LGRRD+ T S+ A +  IP P  +L+ L+SSF+N+G +   MVAL+G HTIG+A C
Sbjct  143  WNVKLGRRDARTASRTAANNNIPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQARC  202

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             +FR RIYN+S+IDAS+A   ++ CP+S   G  N  PLD+ TP  FDN Y+KNL SQKG
Sbjct  203  TSFRTRIYNESNIDASFAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNLVSQKG  262

Query  772  L  774
            L
Sbjct  263  L  263



>ref|XP_002461208.1| hypothetical protein SORBIDRAFT_02g042850 [Sorghum bicolor]
 gb|EER97729.1| hypothetical protein SORBIDRAFT_02g042850 [Sorghum bicolor]
Length=319

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 161/239 (67%), Gaps = 12/239 (5%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CPNALSTIK+AV+ AV  +    A+LL LHF DCF+ GCD SVLL +   
Sbjct  22   QLSPTFYDTSCPNALSTIKSAVNAAVQKENRMGASLLRLHFHDCFVQGCDASVLLADNAA  81

Query  274  ----------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWS  423
                      P     RG +VI +IKTQ+E +C   VSCADIL +A RD++V +GGPSW+
Sbjct  82   TGFTGEQGALPNAGSLRGFDVIANIKTQVEAICKQTVSCADILAVAARDSVVALGGPSWT  141

Query  424  VSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAA  603
            V LGRRDSTT S    ++ +P P+ NL  LI +F NKGFTA +M  LSG+HTIG+A C  
Sbjct  142  VPLGRRDSTTASLSLANSDLPPPSFNLEQLIKAFGNKGFTATEMATLSGAHTIGQAQCQF  201

Query  604  FRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            FR+ IYND++I++++A  L++ CP+S   GD N  PLD TTP  FDNAY+ NL +QKGL
Sbjct  202  FRDHIYNDTNINSAFATSLKANCPRSTGSGDGNLAPLDTTTPYKFDNAYYSNLLNQKGL  260



>emb|CAA59485.1| peroxidase [Triticum aestivum]
Length=314

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI +IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDNIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP+S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASASLANSDLPGPSSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNTNLENLDTTTPNAFDNAYYTNLLSQKGL  254



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 165/241 (68%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            S+   LS +FYSK+CPN LST+K+ V +A+N +    A+LL L F DCF+NGCDGSVLL 
Sbjct  31   STNAQLSTNFYSKSCPNLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLD  90

Query  262  NTT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T+        NP     RG +V+ +IK+ +E +C GVVSCADIL +A RD++ ++GGP 
Sbjct  91   DTSSFTGEKNANPNRNSSRGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVEILGGPK  150

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W+V LGRRD+ + S+ A +  IP P SNL  L S F   G + R +VALSG+HTIG+A C
Sbjct  151  WAVKLGRRDARSASQSAANNGIPPPTSNLNRLTSRFNALGLSTRDLVALSGAHTIGQARC  210

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             +FR RIYN+S+IDAS+A   +  CP++   GD N  PLDI TP  FDN YFKNL SQ+G
Sbjct  211  TSFRARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLISQRG  270

Query  772  L  774
            L
Sbjct  271  L  271



>ref|XP_010921098.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=319

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             LS  FY  +CPNALSTI++AV  AV  +    A+LL LHF DCF+ GCDGSVLL +T+ 
Sbjct  26   QLSSTFYDTSCPNALSTIQSAVKAAVAKEARMGASLLRLHFHDCFVQGCDGSVLLDDTST  85

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG +VI  IK+Q+E +C   VSCADIL +A RD++V +GGPSW+V 
Sbjct  86   FTGEKTAKPNINSIRGFDVIDTIKSQVEAVCNQTVSCADILAVAARDSVVALGGPSWTVL  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ IP P S+L+ LIS+F+ KG +   MVALSGSHTIG+A C +FR
Sbjct  146  LGRRDSTTASLSLANSDIPPPTSDLSALISAFSKKGLSTSDMVALSGSHTIGQARCTSFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++ID+SYA  L+S CP SGGD N  PLD++TP  FDN Y++NL ++KGL
Sbjct  206  ARIYNETNIDSSYATSLQSNCPVSGGDNNLSPLDVSTPTTFDNFYYRNLVNKKGL  260



>ref|XP_010246464.1| PREDICTED: peroxidase P7-like [Nelumbo nucifera]
Length=319

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 159/235 (68%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY+ TCPN  + ++  +  AVN +    A++L L F DCF+NGCD S+LL +T  
Sbjct  26   QLSTNFYANTCPNLPTIVRNGMRQAVNRERRLGASILRLFFHDCFVNGCDASILLDDTAT  85

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  VI  IK+Q+E  C   VSCADIL LA RD +V++GGP+W+V 
Sbjct  86   FTGEKNAAPNRNSARGFEVIDSIKSQVEASCNATVSCADILALAARDGVVLLGGPTWNVP  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+ T S+   ++ IPGP+ NL+ LIS FA KG +AR M  LSG+HTIG+A C  FR
Sbjct  146  LGRRDARTASQSGANSQIPGPSENLSSLISKFAAKGLSARDMTVLSGAHTIGQAQCRTFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYND++IDA++AA  R+ CP +GGD N  PLDI TP  FDN Y+ NL +++GL
Sbjct  206  NRIYNDTNIDANFAATRRANCPATGGDANLAPLDIQTPARFDNNYYGNLVARRGL  260



>ref|XP_006658123.1| PREDICTED: peroxidase 2-like [Oryza brachyantha]
Length=316

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 161/235 (69%), Gaps = 10/235 (4%)
 Frame = +1

Query  100  SKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT---T  270
            S  FY  +CP AL+TIK+AV  AVN++    A+LL LHF DCF+ GCD SVLL +T   T
Sbjct  23   SPTFYDTSCPRALATIKSAVTAAVNNEARMGASLLRLHFHDCFVQGCDASVLLADTATFT  82

Query  271  NPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLG  435
                A P     RG NVI  IKTQLE +C   VSCADIL +A RD++V +GGPSW+V LG
Sbjct  83   GEQNALPNKNSLRGFNVIDSIKTQLEGMCKQTVSCADILAVAARDSVVALGGPSWTVGLG  142

Query  436  RRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNR  615
            RRDSTT S ++ +  +P P  +L +L+ +F +KGF+   MVALSG+HTIG+A C  FR R
Sbjct  143  RRDSTTASMNSANNDLPPPFFDLENLVKAFGDKGFSVTDMVALSGAHTIGQAQCTNFRGR  202

Query  616  IYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            IYN+++IDA YAA LR+ CP +   GD N   LD TTP  FDNAYF NL S+KGL
Sbjct  203  IYNETNIDAGYAASLRANCPATAGTGDGNLAALDTTTPYTFDNAYFSNLLSKKGL  257



>gb|AAC49819.1| peroxidase [Oryza sativa Indica Group]
Length=315

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 160/235 (68%), Gaps = 10/235 (4%)
 Frame = +1

Query  100  SKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT---T  270
            S  FY  +CP AL+TIK+AV  AVN++P   A+LL LHF DCF+ GCD SVLL +T   T
Sbjct  22   SPTFYDTSCPRALATIKSAVTAAVNNEPRMGASLLRLHFHDCFVQGCDASVLLADTATFT  81

Query  271  NPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLG  435
                A P     RG NV+  IKTQLE +C   VSCADIL +A RD++V +GGPSW+V LG
Sbjct  82   GEQNALPNKNSLRGFNVVDSIKTQLEGICSQTVSCADILAVAARDSVVALGGPSWTVGLG  141

Query  436  RRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNR  615
            RRDSTT S D+ +  +P P  +L +LI +F +KGF+   MVALSG+HTIG+A C  FR R
Sbjct  142  RRDSTTASMDSANNDLPPPFFDLENLIKAFGDKGFSVTDMVALSGAHTIGQAQCTNFRGR  201

Query  616  IYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            IYN+++IDA YAA LR+ CP +   GD N   LD TTP  FD AY+ NL S KGL
Sbjct  202  IYNETNIDAGYAASLRANCPPTAGTGDSNLAALDTTTPYSFDTAYYSNLLSNKGL  256



>ref|XP_002509737.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51124.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=322

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 163/236 (69%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY  TCPNAL+TIK+A+  A+ S+   AA+L+ LHF DCF+ GCDGSVLLV+T  
Sbjct  28   QLSSNFYDNTCPNALTTIKSAIDAAIESEQRMAASLIRLHFHDCFVQGCDGSVLLVDTPT  87

Query  268  -TNPMVA-----PPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A       RG NVI D K Q+E +C G+VSCADIL +A RDA V  GGPSW+V+
Sbjct  88   FTGEKSARNNANSIRGENVIDDAKAQVESICPGIVSCADILAVAARDASVAAGGPSWTVN  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S    ++ +PG +  L  LIS F++KG   R MVALSG+HTIG+A C  FR
Sbjct  148  LGRRDSTTASLAQANSDLPGFSDPLNRLISLFSDKGLNERDMVALSGAHTIGQAQCVTFR  207

Query  610  NRIYND-SDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+ SDID  +AA  R  CPQ+GG+ N  PLD+ TP  FDN Y+ NL +++GL
Sbjct  208  DRIYNNASDIDPDFAATRRGNCPQTGGNGNLAPLDLVTPNNFDNNYYSNLIAKRGL  263



>ref|XP_009775239.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=320

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 165/238 (69%), Gaps = 8/238 (3%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  LS  +Y K+CP A+ TIK AV NAV  +    A+LL LHF DCF+NGCD S+LL +
Sbjct  24   SSARLSADYYEKSCPKAIYTIKNAVTNAVAKERRMGASLLRLHFHDCFVNGCDASILLDD  83

Query  265  T---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T   T    A P     RG ++I  IK+Q+E+LC G+VSCADI+ +A RD++ ++GG +W
Sbjct  84   TSDFTGEKTAKPNSNSLRGFDLIDTIKSQVEKLCPGIVSCADIIAIAARDSVEILGGSTW  143

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S  + ++ IP P  +L+ LI+ F NKGFTA++MVAL+G+HTIG+A C 
Sbjct  144  NVLLGRRDSTTASLSSANSDIPSPLMDLSDLITKFDNKGFTAKEMVALAGAHTIGQAQCT  203

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR R+YN++ ID+S A  L+S CP +GGD +   LD  TP +FDN YFKNL   KG+
Sbjct  204  TFRERVYNETTIDSSLATSLKSNCPSTGGDDSLSALDAATPAIFDNHYFKNLVKNKGI  261



>emb|CDX98835.1| BnaC09g50000D [Brassica napus]
Length=325

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 169/237 (71%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FYS +CPN LST+++ V +AV+S P T A++L L F DCF+NGCDGS+LL +T+ 
Sbjct  30   QLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTSS  89

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IKT +E  C GVVSCADIL +A RD++V++GGP+W+V 
Sbjct  90   FTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNVK  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  150  VGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+A++A   +  CP++   GD N  PLD+ +   FDN+YFKNL +Q+GL
Sbjct  210  TRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANFFDNSYFKNLVAQRGL  266



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 170/237 (72%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+ +FYS +CPN LST+++AV +AVNS+    A++L L F DCF+NGCDGS+LL +T++
Sbjct  29   QLTTNFYSTSCPNLLSTVQSAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTSS  88

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG NVI +IK+ +E+ C GVVSCADIL +A RD++VV+GGP+W+V 
Sbjct  89   FTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  149  VGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I+A++A   +  CP++   GD N  PLD+TT   FDN YFKNL +Q+GL
Sbjct  209  ARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGL  265



>ref|XP_010915493.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 162/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY+K+CPN  S +++ +  AV+++P   A++L L F DCF+NGCDGS+LL +T  
Sbjct  23   QLSPTFYAKSCPNVQSIVRSGMAQAVSAEPRMGASILRLFFHDCFVNGCDGSILLADTAT  82

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  VI  IK ++E  C   VSCADIL LA RD + ++GGP+W+V 
Sbjct  83   FTGEQNAGPNKNSVRGFGVIDTIKARVEAACKATVSCADILALAARDGVNLLGGPTWTVQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S+ A +  +P PAS+L+ LIS FA +G +A++M ALSGSHTIG+A C  FR
Sbjct  143  LGRRDATTASQSAANNNLPSPASSLSILISKFAAQGLSAQEMTALSGSHTIGQAQCKNFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              IYND+DI+ S+AA  +  CP SGGD N  PLD+ TP  FDNAY++NL +QKGL
Sbjct  203  AHIYNDTDINPSFAALRKRNCPASGGDTNLAPLDVQTPNGFDNAYYQNLVAQKGL  257



>ref|XP_004958682.1| PREDICTED: peroxidase 2-like [Setaria italica]
Length=312

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 164/237 (69%), Gaps = 6/237 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S ++  LS  FY  +CPNALSTI+TAV+ AV  +    A+LL LHF DCF+ GCD SVLL
Sbjct  17   SGASAQLSPTFYDTSCPNALSTIRTAVNAAVAQEARMGASLLRLHFHDCFVQGCDASVLL  76

Query  259  VNTTNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWS  423
             +T     A P     RG  VI +IK Q+E LC   VSCADILT+A RD++V +GGPSW+
Sbjct  77   NDTNGEQSAGPNVGSLRGFGVIDNIKAQVEALCPQTVSCADILTVAARDSVVALGGPSWT  136

Query  424  VSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAA  603
            V LGRRDST+   +  +T +P P S+L +LI +F NK  +A  MVALSG+HTIG+A C  
Sbjct  137  VLLGRRDSTSSFPNQANTDLPAPQSSLRNLIDAFGNKTLSATDMVALSGAHTIGQAQCTN  196

Query  604  FRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            FR+ I  +S+I+ ++AA LR+ CP +GGD N  PLD+TTP  FDNAY+ NL SQ+GL
Sbjct  197  FRDHI-TESNINPAFAASLRTSCPATGGDTNLAPLDVTTPNTFDNAYYNNLLSQRGL  252



>ref|XP_004234419.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=320

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 160/240 (67%), Gaps = 8/240 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S S   LS +FY  +CPN  + ++ A+  AVN +    A++L L F DCF+NGCD S+LL
Sbjct  22   SFSNAQLSANFYGTSCPNLQTIVRNAMTQAVNREARLGASILRLFFHDCFVNGCDASILL  81

Query  259  VNTT--------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T+        NP     RG  VI  IKTQ+E  C  V+SCADIL LA R+  V++GGP
Sbjct  82   DDTSTFIGEKNANPNRNSARGYEVIDTIKTQVEAACPNVISCADILALAAREGTVLLGGP  141

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW+V LGRRD+ T S+ A +T IP P+S+L  LIS F+ KG +AR M ALSGSHTIG+A 
Sbjct  142  SWAVPLGRRDARTASQSAANTQIPAPSSSLATLISMFSAKGLSARDMTALSGSHTIGQAR  201

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C  FRNRIYND++ID  +AA  R+ CP SGGD N  PLDI TP  FDN Y++NL  ++GL
Sbjct  202  CTTFRNRIYNDTNIDPQFAATRRATCPASGGDANLAPLDIQTPNRFDNDYYQNLVVRRGL  261



>ref|XP_004958681.1| PREDICTED: peroxidase 2-like [Setaria italica]
Length=311

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 161/233 (69%), Gaps = 6/233 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CPNALSTIK+AV  AV  +    A+LL LHF DCF+ GCD SVLL +   
Sbjct  20   QLSPTFYDTSCPNALSTIKSAVTAAVKKENRMGASLLRLHFHDCFVQGCDASVLLDSGGE  79

Query  274  ----PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRR  441
                P     RG NVI +IK Q+E +C   VSCADIL +A RD++V +GGPSW+V LGRR
Sbjct  80   QGAIPNAGSLRGFNVIANIKAQVEAICKQTVSCADILAVAARDSVVALGGPSWTVPLGRR  139

Query  442  DSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY  621
            DST+ S    ++ +P P  NL+ LI SF+NKGF+A +MVALSG+HTIG+A C  FR+ IY
Sbjct  140  DSTSGSAALANSDLPPPFFNLSDLIGSFSNKGFSATEMVALSGAHTIGQAQCLNFRDHIY  199

Query  622  NDSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            ND++I+A +A+ L++ CP+    GD N  PLD +TP  FDNAY+ NL SQKGL
Sbjct  200  NDTNINAGFASSLKANCPRPTGNGDGNLAPLDTSTPYTFDNAYYSNLLSQKGL  252



>ref|XP_008374511.1| PREDICTED: peroxidase P7-like isoform X1 [Malus domestica]
Length=318

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 160/235 (68%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+++FY   CP ALS ++  V  A+ ++    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  24   ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  274  ---PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                  A P     RG  V+  IK +LE+ C GVVSCAD+L LA RD+ V +GGPSW V 
Sbjct  84   FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A +T +P P SN++ LISSF+ +G + R +VALSGSHTIG A C  FR
Sbjct  144  LGRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYNDS IDA++A  L+  CP+SG D N   LD+ TP  FDN Y+KNL  +KGL
Sbjct  204  SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGL  258



>ref|XP_009358287.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=319

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 165/239 (69%), Gaps = 9/239 (4%)
 Frame = +1

Query  85   SAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN  264
            S+  LS + Y  TCP AL  ++ AV NAV  +    A+LL LHF DCF+NGCD SVLL +
Sbjct  22   SSAQLSSNHYETTCPLALFIVRNAVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDD  81

Query  265  TTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSW  420
            T N        P     RG  VI  IK++LE  C GVVSCADIL +A RD+++++GGPSW
Sbjct  82   TANFTGEKTALPNTNSLRGFEVIDTIKSELESACPGVVSCADILAIAARDSVLLLGGPSW  141

Query  421  SVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCA  600
            +V LGRRDSTT S  A +T +P P+ NL  LIS F+ KGFT +++VALSGSHT+G+A C 
Sbjct  142  TVQLGRRDSTTASLSAANTELPSPSLNLNDLISFFSTKGFTTKELVALSGSHTMGQARCL  201

Query  601  AFRNRIYNDSDIDASYAAWLRSKCPQSGG-DLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             FR RI+N+++ID+S+AA L+  C  S G D N   LD+T+P++FDNAYFKNL + KGL
Sbjct  202  LFRERIHNETNIDSSFAASLKLNCTASSGTDDNLSSLDVTSPVIFDNAYFKNLVNSKGL  260



>emb|CAL25300.1| properoxidase [Picea abies]
Length=310

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 163/237 (69%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVN---  264
             LS  FY+++CP ALS +K AV  AV ++    A+LL LHF DCF+NGCDGSVLL +   
Sbjct  15   QLSSTFYAQSCPTALSVVKAAVRQAVANEKRMGASLLRLHFHDCFVNGCDGSVLLDDSST  74

Query  265  -----TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                 T NP     RG +VI  IK+ +E+ C GVVSCADIL ++ RD++V +GGPSW+V 
Sbjct  75   ITGEKTANPNANSARGFDVIDTIKSNVEKACSGVVSCADILAISARDSVVELGGPSWTVM  134

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SK+  +  IP P S+L++LIS F  +G + ++MVALSG HTIG+A C  FR
Sbjct  135  LGRRDSTTASKNGANNNIPPPTSSLSNLISLFQAQGLSTKEMVALSGGHTIGQARCVNFR  194

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              IYN+++ID++Y+  L+SKCP +   GD N  PLD  TP  FD  Y+ NL+S+KGL
Sbjct  195  AHIYNETNIDSTYSTSLQSKCPSTAGSGDSNLSPLDYVTPTAFDKNYYSNLKSKKGL  251



>ref|XP_003562452.1| PREDICTED: peroxidase 2-like [Brachypodium distachyon]
Length=320

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 161/237 (68%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CP AL TIKTAV  AV+S+    A+LL LHF DCF++GCD SVLL +T +
Sbjct  24   QLSSTFYDTSCPKALDTIKTAVTAAVSSEARMGASLLRLHFHDCFVDGCDASVLLADTGS  83

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RGLNVI +IKTQ+E +C   VSCADIL +A RD++V +GGPSW+V 
Sbjct  84   FVGEQTAAPNAGSIRGLNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVTLGGPSWTVL  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SK      +P P  +L +L  +FANK  +   MVALSG HTIG++ C  FR
Sbjct  144  LGRRDSTTASKTNAENDLPPPTFDLKNLTDNFANKQLSVTDMVALSGGHTIGQSQCLNFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++IDA++AA L+S CP+  S G+ +  PLD+ TP  FDN YF NLQ+ KGL
Sbjct  204  DRIYNETNIDAAFAASLKSNCPRSTSSGNTSLAPLDVATPTAFDNKYFVNLQANKGL  260



>ref|XP_006658125.1| PREDICTED: peroxidase 2-like [Oryza brachyantha]
Length=313

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 167/237 (70%), Gaps = 5/237 (2%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S ++  LS  FY  +CP+ALSTI++AV  AVNS+P   A+LL LHF DCF+ GCD SVLL
Sbjct  18   SPASAQLSATFYDTSCPSALSTIRSAVTAAVNSEPRMGASLLRLHFHDCFVQGCDASVLL  77

Query  259  V-NTTN--PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
              N  N  P     RG +VI  IKTQ+E +C   VSCADIL +A RD++V +GGPSW+V 
Sbjct  78   AGNEQNAIPNAGSLRGFSVIDSIKTQVEAVCSQTVSCADILAVAARDSVVALGGPSWTVL  137

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   ++ +P P+S+L  LI +F+NKG     MVALSG+HTIG++ C  FR
Sbjct  138  LGRRDSTTASEALANSDLPPPSSDLASLIGNFSNKGLDVTDMVALSGAHTIGQSQCKNFR  197

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++ID+++A  L++ CP++   GD N  PLD TTP  FDNAY+ NL S +GL
Sbjct  198  DRIYNETNIDSNFATALQANCPRATGTGDGNLTPLDTTTPNAFDNAYYTNLLSNQGL  254



>ref|XP_006361366.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=319

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 158/236 (67%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY +TCPNAL+TI+T++  A++ +   AA+L+ LHF DCF+ GCD S+LL  T  
Sbjct  25   QLSSTFYDRTCPNALTTIRTSIRQAISRERRMAASLIRLHFHDCFVQGCDASLLLDETPT  84

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  +I D K ++E+ C G+VSCADIL +A RDA  ++GGPSW+V 
Sbjct  85   IVSEKTALPNLGSVRGFGIIEDAKREVEKTCPGIVSCADILAVAARDASTLVGGPSWTVK  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S     T +PGP   L+ LIS FANKG + R MVALSGSH+IG+A C  FR
Sbjct  145  LGRRDSTTASHTLAETDLPGPFDPLSRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFR  204

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  R +CPQ   + N  PLD+ TP   DN YFKNL+ +KGL
Sbjct  205  DRIYGNGTDIDAGFASTRRRQCPQEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGL  260



>gb|KGN47223.1| hypothetical protein Csa_6G216420 [Cucumis sativus]
Length=311

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 160/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            +S+ HLS +FY  TCPN LS ++  V +AV  +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  14   TSSAHLSPNFYHNTCPNLLSLVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILLD  73

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T        A P     RG NVI +IK ++E++C GVVSCADILTL+ RD++V +GGPS
Sbjct  74   DTPTFLGEQTAAPNNRSVRGFNVIANIKEKIEKICPGVVSCADILTLSARDSVVALGGPS  133

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S    +  IP P S L  LI+ F  KG + + +VALSG+HTIGKA C
Sbjct  134  WKVKLGRRDSKTASFSDVTGAIPPPTSTLATLINRFNTKGLSPKDLVALSGAHTIGKARC  193

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              F+NRIYN+++ID S+A   +  CP++GGD N  P D  TP LFDN Y+KNL  +K L
Sbjct  194  LFFKNRIYNETNIDKSFAKKRQKNCPRNGGDDNRTPFDFRTPNLFDNNYYKNLLEKKAL  252



>ref|XP_008374539.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=318

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 160/235 (68%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+++FY   CP ALS ++  V  A+ ++    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  24   ELTQNFYKSKCPKALSIVQEGVIAAIKNETRXGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  274  ---PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                  A P     RG  V+  IK +LE+ C GVVSCAD+L LA RD+ V +GGPSW V 
Sbjct  84   FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A +T +P P SN++ LISSF+ +G + R +VALSGSHTIG A C  FR
Sbjct  144  LGRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYNDS IDA++A  L+  CP+SG D N   LD+ TP  FDN Y+KNL  +KGL
Sbjct  204  SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNXYYKNLLKEKGL  258



>ref|XP_006658124.1| PREDICTED: peroxidase 2-like [Oryza brachyantha]
Length=313

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 164/237 (69%), Gaps = 5/237 (2%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S ++  LS  FY  +CPNALSTI++ V  AVNS+P   A+LL LHF DCF+ GCD SVLL
Sbjct  18   SPASAQLSATFYDTSCPNALSTIRSVVTAAVNSEPRMGASLLRLHFHDCFVQGCDASVLL  77

Query  259  VNTTN---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG NVI + KT++E +C   VSCADIL +A RD++V +GGPSW+V 
Sbjct  78   SGQEQNAFPNAGSLRGFNVIDNAKTRVEAICNRTVSCADILAVAARDSVVALGGPSWTVL  137

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   ++ +P P+S+L  LI +F+NKG     MVALSG+HTIG+A C  FR
Sbjct  138  LGRRDSTTASQALANSDLPPPSSDLASLIGNFSNKGLDVTDMVALSGAHTIGQAQCQNFR  197

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+++I++++A  LR+ CP++   GD N  PLD TTP  FDNAY+ NL S +GL
Sbjct  198  DRIYNETNINSAFATSLRANCPRASGTGDGNLAPLDATTPNAFDNAYYTNLMSNRGL  254



>gb|ABK23423.1| unknown [Picea sitchensis]
Length=318

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 165/235 (70%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             L+  FYS++CP ALS ++ AV  AV  +    A+LL LHF DCF+NGCDGS+LL +   
Sbjct  25   QLTSTFYSESCPRALSIVQAAVEQAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDNST  84

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IKTQ+E  C GVVSCADI+ +A RD++V +GGP+W+V 
Sbjct  85   FTGEKTATPNNNSVRGYDVIDTIKTQVEAACSGVVSCADIVAIAARDSVVALGGPTWTVL  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S +A ++ IP PASNL+ LISSF +   + + +VALSG+HTIG+A C +FR
Sbjct  145  LGRRDSTTASFNAANSSIPSPASNLSTLISSFRSHNLSPKDLVALSGAHTIGQARCTSFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+S+ID S A  ++ KCP++GGD    PLD+ TPI FD  Y+ NL+S+KGL
Sbjct  205  ARIYNESNIDTSLATAVKPKCPRTGGDNTLSPLDLATPITFDKHYYCNLRSKKGL  259



>ref|XP_004150607.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=326

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 160/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            +S+ HLS +FY  TCPN LS ++  V +AV  +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  29   TSSAHLSPNFYHNTCPNLLSLVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILLD  88

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T        A P     RG NVI +IK ++E++C GVVSCADILTL+ RD++V +GGPS
Sbjct  89   DTPTFLGEQTAAPNNRSVRGFNVIANIKEKIEKICPGVVSCADILTLSARDSVVALGGPS  148

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S    +  IP P S L  LI+ F  KG + + +VALSG+HTIGKA C
Sbjct  149  WKVKLGRRDSKTASFSDVTGAIPPPTSTLATLINRFNTKGLSPKDLVALSGAHTIGKARC  208

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              F+NRIYN+++ID S+A   +  CP++GGD N  P D  TP LFDN Y+KNL  +K L
Sbjct  209  LFFKNRIYNETNIDKSFAKKRQKNCPRNGGDDNRTPFDFRTPNLFDNNYYKNLLEKKAL  267



>emb|CAH10840.1| peroxidase [Picea abies]
Length=320

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 158/235 (67%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL-----  258
             LS  FY+K+CP   S +KT V  AV  +    A+L+ LHF DCF+NGCDGS+LL     
Sbjct  27   QLSSTFYAKSCPRVQSIVKTVVKQAVAKEKRMGASLVRLHFHDCFVNGCDGSILLDDNAT  86

Query  259  ---VNTTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                 T  P     RG +VI  IKTQ+E  C GVVSCADILT+A RD+IV + GP+W+V 
Sbjct  87   FTGEKTAGPNANSARGFDVIDTIKTQVEAACSGVVSCADILTIAARDSIVELQGPTWTVM  146

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDS T S  A +  IP PAS+L+ LI+SF N G + + +VALSG+HTIG++ CA FR
Sbjct  147  LGRRDSPTASLSAANNNIPSPASSLSTLITSFQNHGLSTKDLVALSGAHTIGQSRCAFFR  206

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+S+I+A++A  ++  CP +GGD    PLD+ TP  FDN Y+ NL+ QKGL
Sbjct  207  TRIYNESNINAAFATSVKPNCPSAGGDNTLSPLDVVTPTTFDNKYYSNLKVQKGL  261



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 169/237 (71%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+ +FYS +CPN LST++TAV +AVNS+    A++L L F DCF+NGCDGS+LL +T++
Sbjct  29   QLTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTSS  88

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG NVI +IK+ +E+ C GVVSCADIL +A RD++V +GGP+W+V 
Sbjct  89   FTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  149  VGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I+A++A   +  CP++   GD N  PLD+TT   FDN YFKNL +Q+GL
Sbjct  209  ARIYNETNINAAFATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGL  265



>gb|ACF70702.1| root peroxidase [Triticum aestivum]
Length=314

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 157/231 (68%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SV L     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVPLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG +VI  IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFSVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP S+ + L ++F  K      MVALSG+HTIGKA C+ FRNRIY 
Sbjct  144  STTASASLANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRNRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNSNLANLDTTTPNAFDNAYYTNLLSQKGL  254



>ref|XP_008364165.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   252 bits (644),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 159/235 (68%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+++FY   CP ALS ++  V  A+ ++    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  24   ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  274  ---PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                  A P     RG  V+  IK +LE+ C GVVSCAD+L LA RD+ V +GGPSW V 
Sbjct  84   FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A +T  P P SN++ LISSF+ +G + R +VALSGSHTIG A C  FR
Sbjct  144  LGRRDSTTASRSAANTXJPXPTSNISALISSFSAQGLSJRDLVALSGSHTIGLARCTXFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYNDS IDA++A  L+  CP+SG D N   LD+ TP  FDN Y+KNL  +KGL
Sbjct  204  SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGL  258



>gb|ACT35473.1| peroxidase 52, partial [Brassica rapa]
Length=306

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 168/237 (71%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FYS +CPN LST+++ V +AV+S P T A++L L F DCF+NGCDGS+LL +T+ 
Sbjct  11   QLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTSS  70

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IKT +E  C GVVSCADIL +A RD++V++GGP+W+V 
Sbjct  71   FTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNVK  130

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A +  IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  131  VGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFR  190

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+A++A   +  CP++   GD N  PLD+ +   FDN+YFKNL +Q+GL
Sbjct  191  TRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGL  247



>gb|KHN44723.1| Peroxidase 4 [Glycine soja]
Length=314

 Score =   252 bits (644),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 159/240 (66%), Gaps = 8/240 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            ++S   L   FYS TCPN L  +K  V  A+  +P   A+LL LHF DCF+NGCD S+LL
Sbjct  16   TASGAELCADFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHDCFVNGCDASILL  75

Query  259  VNTTNPMVAP--------PRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T+N +            RG NVI DIK  +E+ C  VVSCADIL L+ RD++V +GGP
Sbjct  76   DDTSNFIGEQTAAANNQSARGFNVINDIKASVEKECPRVVSCADILALSARDSVVYLGGP  135

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW V LGRRDSTT S+   +  IPGP  +LT LI++FAN+G +   +VALSG+HTIG A 
Sbjct  136  SWEVGLGRRDSTTASRSDANNSIPGPFLSLTALINNFANQGLSVTDLVALSGAHTIGLAE  195

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C  FR  IYNDS++D SY  +L+SKCP+SG D    PLD  TPI FDN YF+NL S+K L
Sbjct  196  CKNFRAHIYNDSNVDPSYRKFLQSKCPRSGNDKTLEPLDHQTPIHFDNLYFQNLVSKKAL  255



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 169/237 (71%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FYS +CPN LST++TAV +AV+S     A++L L F DCF+NGCDGS+LL +T+ 
Sbjct  29   QLTTNFYSSSCPNLLSTVQTAVKSAVSSQNRMGASILRLFFHDCFVNGCDGSILLDDTSS  88

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IK+ +E+ C GVVSCADIL +A RD++V++GGP+W+V 
Sbjct  89   FTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVILGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+ T S+ A ++ IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  149  LGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+A++A   +  CP++   GD N  PLD+ +   FDN+YFKNL +Q+GL
Sbjct  209  ARVYNETNINAAFATLRQRSCPRTAGSGDGNLAPLDVNSAASFDNSYFKNLMAQRGL  265



>ref|XP_009122142.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Brassica rapa]
Length=325

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 168/237 (71%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FYS +CPN LST+++ V +AV+S P T A++L L F DCF+NGCDGS+LL +T+ 
Sbjct  30   QLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTSS  89

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IKT +E  C GVVSCADIL +A RD++V++GGP+W+V 
Sbjct  90   FTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNVK  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A +  IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  150  VGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+A++A   +  CP++   GD N  PLD+ +   FDN+YFKNL +Q+GL
Sbjct  210  TRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGL  266



>emb|CDX70158.1| BnaA10g25070D [Brassica napus]
Length=325

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 168/237 (71%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+ +FYS +CPN LST+++ V +AV+S P T A++L L F DCF+NGCDGS+LL +T+ 
Sbjct  30   QLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTSS  89

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IKT +E  C GVVSCADIL +A RD++V++GGP+W+V 
Sbjct  90   FTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNVK  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A +  IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  150  VGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFR  209

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+A++A   +  CP++   GD N  PLD+ +   FDN+YFKNL +Q+GL
Sbjct  210  TRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGL  266



>emb|CAD67477.1| peroxidase [Asparagus officinalis]
Length=315

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 162/241 (67%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS   LS  FYS +CPN  +TIK  + +A+  +    A++L L F DCF+NGCDGS+LL 
Sbjct  16   SSNAQLSTTFYSNSCPNVFTTIKPVLQHAIEKEKRMGASILRLFFHDCFVNGCDGSILLA  75

Query  262  NT--------TNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T         NP     RG  VI  IKT +E+ C GVVSCADIL +A RD++V++GGP+
Sbjct  76   DTPHFVGEQHANPNNRSARGFKVIDRIKTAVEKACPGVVSCADILAIAARDSVVILGGPN  135

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T +K A +  IP P S+L +L S FA KG + + MVALSG+HTIG+A C
Sbjct  136  WDVKLGRRDSRTANKTAANNEIPPPTSSLANLTSLFAAKGLSTKDMVALSGAHTIGQARC  195

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCP-QSG-GDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             +FR+ IYNDSDID S+A   +S CP QSG GD+N  PLD+ TP  FDN Y++NL  +KG
Sbjct  196  TSFRSHIYNDSDIDPSFATLRKSNCPKQSGSGDMNLAPLDLQTPTTFDNNYYRNLVVKKG  255

Query  772  L  774
            L
Sbjct  256  L  256



>gb|KDP22793.1| hypothetical protein JCGZ_00380 [Jatropha curcas]
Length=293

 Score =   251 bits (641),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 167/232 (72%), Gaps = 7/232 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FYS TCP ALSTI +AV +A++ +    A+LL LHF DCF+NGCDGSVLL   + 
Sbjct  5    QLSPTFYSTTCPAALSTINSAVTSAISKEARMGASLLRLHFHDCFVNGCDGSVLLDGASG  64

Query  274  PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGR  438
               AP      RG  VI  IK+QLE  C GVVSCADIL +A RD++V +GGPSW+V LGR
Sbjct  65   EKTAPANNNSIRGFEVIDSIKSQLESSCAGVVSCADILAVAARDSVVALGGPSWTVQLGR  124

Query  439  RDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRI  618
            RDSTT S  A S+ +P P S+L+ LIS+F++KGFT ++MVALSG+HTIG+A C  F  RI
Sbjct  125  RDSTTASFSAASSSLPSPFSDLSVLISNFSSKGFTTKEMVALSGAHTIGQARCTVFATRI  184

Query  619  YNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            YN+++I+ ++A  L++ CP +GG+ N  PLD TT   FDNAYFK+L +QKGL
Sbjct  185  YNETNINTAFATSLKANCPSTGGN-NLAPLDSTTRT-FDNAYFKDLLAQKGL  234



>ref|XP_008374568.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 161/234 (69%), Gaps = 8/234 (3%)
 Frame = +1

Query  97   LSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-  273
            L+++FY   CP ALS ++  V  A+ ++    A+LL LHF DCF+NGCD SVLL +T++ 
Sbjct  25   LTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSSF  84

Query  274  --PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSL  432
                 A P     RG  V+  IK +LE+ C GVVSCAD+L LA RD+ V +GGPSW V L
Sbjct  85   VGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVGL  144

Query  433  GRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRN  612
            GRRDSTT S+ A +T IP P SN++ LISSF+ +G + R +VALSGSHTIG A C +FR+
Sbjct  145  GRRDSTTASRSAANTSIPPPTSNISALISSFSAQGLSIRDLVALSGSHTIGLARCTSFRS  204

Query  613  RIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            RIYNDS IDA++A  L+  CP+SG D N   LD+ TP  FDN Y+KNL  +KGL
Sbjct  205  RIYNDSAIDATFAQSLQGICPRSGNDNNLASLDLQTPTHFDNKYYKNLLKEKGL  258



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 161/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY  +CP AL TI+ AV  AV  +    A+LL LHF DCF+NGCDGS+LL +T  
Sbjct  23   QLSPTFYETSCPGALYTIQNAVRAAVFKERRMGASLLRLHFHDCFVNGCDGSILLDDTPT  82

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI  IK+Q+E +C  VVSCADIL +A RD++V +GGPSW+V 
Sbjct  83   FTGEKTAGPNNNSVRGFDVIDTIKSQVEAICTQVVSCADILAVAARDSVVALGGPSWAVQ  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+TT S    ++ IP P S+L+ LIS+F+ KG +   MVALSG+HTIG+A C  FR
Sbjct  143  LGRRDATTASFSGANSDIPSPTSDLSALISAFSKKGLSTTDMVALSGAHTIGQARCTVFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++IDAS A  L+S CP SGGD N  PLD  TP + DN Y+K+L ++KGL
Sbjct  203  TRLYNETNIDASLATSLKSNCPSSGGDDNLSPLDAITPTIVDNFYYKDLVNKKGL  257



>ref|XP_011080818.1| PREDICTED: uncharacterized protein LOC105163979 [Sesamum indicum]
Length=700

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS + YS +CP AL TIK  V  AV  +   AA+LL LHF DCF+NGCD SVLL +T  
Sbjct  141  QLSTNHYSTSCPRALFTIKAGVLKAVAKERRMAASLLRLHFHDCFVNGCDASVLLDDTSS  200

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  VI  IK++LE LC GVVSCADIL ++ RD++  +GGP W+V 
Sbjct  201  FTGEKTAGPNNNSLRGFEVIDSIKSELESLCPGVVSCADILAVSARDSVAAVGGPFWAVP  260

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S DA +T IP P  +L+ LIS+F+NKGF+A++MVALSG+HTIG+A C  FR
Sbjct  261  LGRRDSTTASLDAANTDIPSPVMDLSDLISAFSNKGFSAKEMVALSGAHTIGQARCVVFR  320

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYN+S+I AS+A  L+S CP SG D +  P+D TTP  FDN+YFKNL S KGL
Sbjct  321  DRIYNESNIFASFATSLKSNCPSSGSDDSLSPIDATTPGSFDNSYFKNLVSNKGL  375


 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 151/222 (68%), Gaps = 11/222 (5%)
 Frame = +1

Query  142  TIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN--------PMVAPPRG  297
            T  + V +A+  +    A+LL LHF DCF+ GCDGS+LL +T++        P     RG
Sbjct  420  TGSSVVKDAIAKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFRGEKTAGPNNNSVRG  479

Query  298  LNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRDSTTPS-KDAGS  474
             +V+ DIK+++E +C GVVSC+DIL +A RD++V++GGP+W+V LGRRDS T S   A S
Sbjct  480  FDVVDDIKSEVESVCPGVVSCSDILAIAARDSVVLLGGPNWNVKLGRRDSKTASLSAANS  539

Query  475  TIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYNDSDIDASYAA  654
             +IP P S L +L++ F  +G + + MV LSG+HTIG+A C  FR+R+YN+++ID S+A 
Sbjct  540  GVIPPPTSTLNNLVNRFQARGLSTKDMVVLSGAHTIGQARCTLFRDRVYNETNIDTSFAR  599

Query  655  WLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              ++ CP++   GD N  PLD  +P  FDN+Y+KNL ++KGL
Sbjct  600  TRQTNCPRNSGSGDNNLAPLDHKSPTFFDNSYYKNLINKKGL  641



>ref|XP_008343635.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 160/235 (68%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+++FY   CP ALS ++  V  A+ ++    A+LL LHF DCF+NGCD SVLL +T++
Sbjct  24   ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  274  ---PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                  A P     RG  V+  IK +LE+ C GVVSCAD+L LA RD+ V +GGPSW V 
Sbjct  84   FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A +T +P P SN++ LISSF+ +G + R +VALSGSHTIG A C  FR
Sbjct  144  LGRRDSTTASRSAANTXLPXPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYNDS IDA++A  L+  CP+SG D N   LD+ TP  FDN Y+KNL  +KGL
Sbjct  204  SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGL  258



>ref|XP_003545648.1| PREDICTED: peroxidase 4 [Glycine max]
Length=325

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 159/240 (66%), Gaps = 8/240 (3%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            ++S   L   FYS TCPN L  +K  V  A+  +P   A+LL LHF DCF+NGCD S+LL
Sbjct  27   TASGAELCADFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHDCFVNGCDASILL  86

Query  259  VNTTNPMVAP--------PRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T+N +            RG NVI DIK  +E+ C  VVSCADIL L+ RD++V +GGP
Sbjct  87   DDTSNFIGEQTAAANNQSARGFNVINDIKASVEKECPRVVSCADILALSARDSVVYLGGP  146

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW V LGRRDSTT S+   +  IPGP  +LT LI++FAN+G +   +VALSG+HTIG A 
Sbjct  147  SWEVGLGRRDSTTASRSDANNSIPGPFLSLTALINNFANQGLSVTDLVALSGAHTIGLAE  206

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            C  FR  IYNDS++D SY  +L+SKCP+SG D    PLD  TPI FDN YF+NL S+K L
Sbjct  207  CKNFRAHIYNDSNVDPSYRKFLQSKCPRSGNDKTLEPLDHQTPIHFDNLYFQNLVSKKAL  266



>ref|XP_007205551.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
 gb|EMJ06750.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
Length=325

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 164/242 (68%), Gaps = 11/242 (5%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FYSK+CP     +K+ V +AVN +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  24   SSSAQLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSILLD  83

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG  V+ +IK+Q+E+ C GVVSCADIL +A RD++ ++GGPS
Sbjct  84   DTSSFTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPGVVSCADILAIAARDSVKILGGPS  143

Query  418  WSVSLGRRDSTTPS-KDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            W+V LGRRDS T S   A S +IP P S L+ L + F   G   R +VALSG+HTIG+A 
Sbjct  144  WNVKLGRRDSKTASLAAANSGVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGQAR  203

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQK  768
            C +FR RIYN+++IDAS+A   +SKCP +   GD N  PLD+ TP  FD AYFKNL +QK
Sbjct  204  CTSFRARIYNETNIDASFAKARQSKCPSTVGSGDNNLAPLDVQTPNTFDTAYFKNLINQK  263

Query  769  GL  774
            GL
Sbjct  264  GL  265



>dbj|BAJ86726.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 158/232 (68%), Gaps = 5/232 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNALSTIK AV  AVN +    A+LL LHF DCF+ GCD SVLL     
Sbjct  22   QLSPTFYQTTCPNALSTIKAAVTAAVNKENRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  81

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IK +LE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  82   NAAPNVMSLRGFEVIDSIKAKLETMCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  141

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            ST  ++ A ++ +P P  +L +L  SF NKGFT   MVALSG+HTIG+A C  FR+R+YN
Sbjct  142  STNANEAAANSDLPPPFFDLVNLTQSFGNKGFTVTDMVALSGAHTIGQAQCQNFRDRLYN  201

Query  625  DSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++I++ +A  L++ CP+    GD N   LD++TP  FDNAY+ NL+SQKGL
Sbjct  202  ETNINSGFATSLKANCPRPTGSGDRNLANLDVSTPYSFDNAYYSNLKSQKGL  253



>ref|NP_001054096.1| Os04g0651000 [Oryza sativa Japonica Group]
 emb|CAE04507.2| OSJNBb0059K02.17 [Oryza sativa Japonica Group]
 tpe|CAH69299.1| TPA: class III peroxidase 57 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF16010.1| Os04g0651000 [Oryza sativa Japonica Group]
 dbj|BAG98582.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 161/236 (68%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY +TCP+AL  I++AV +AV+ +    A+LL LHF DCF+NGCDGSVLL +T  
Sbjct  25   QLSTDFYDETCPDALDIIESAVRDAVSKESRMGASLLRLHFHDCFVNGCDGSVLLDDTAA  84

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  V+ DIK+QLE+ C  VVSCADIL +A RD++V +GGP+W V 
Sbjct  85   ITGEKNAKPNKNSLRGFEVVDDIKSQLEDACEQVVSCADILAVAARDSVVALGGPTWDVE  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD TT S DA +  +P P S+L  LI SF++KG TA  M+ALSG+HTIG+A C  FR
Sbjct  145  LGRRDGTTASLDAANNDLPPPTSDLADLIKSFSDKGLTASDMIALSGAHTIGQARCTNFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQ-SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN++++DA+ A  L+  CP  +GGD N  PLD  T  +FDN Y++NL   KGL
Sbjct  205  GRLYNETNLDATLATSLKPSCPNPTGGDDNTAPLDPATSYVFDNFYYRNLLRNKGL  260



>emb|CBI19219.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 168/237 (71%), Gaps = 11/237 (5%)
 Frame = +1

Query  88   AYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT  267
            A++LS +FY+++CP AL TI+TAV+ AV  +    A+LL LHF DCF  GCD S+LL +T
Sbjct  22   AHYLSPNFYARSCPRALPTIRTAVNKAVAKEKRMGASLLRLHFHDCF--GCDASILLDDT  79

Query  268  ---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWS  423
               T    A P     RG  VI  IK+Q+E LC GVVSCADI+ +A RD++V +GGP+W+
Sbjct  80   ATFTGEKTAGPNNNSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWT  139

Query  424  VSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAA  603
            V LGRRDSTT S  A  T +PGP  NL+ LIS+F+ KG T ++MV LSG+HTIGKA C +
Sbjct  140  VRLGRRDSTTASFSAARTDLPGPNLNLSQLISAFSKKGLTTKEMVVLSGTHTIGKARCTS  199

Query  604  FRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            FRN IYND+DID ++AA  +  CP+SGGD N  PLD TT + FDN YF+ L+ +KGL
Sbjct  200  FRNHIYNDTDIDPAFAASKQKICPRSGGDDNLSPLDGTTTV-FDNVYFRGLKEKKGL  255



>gb|KFK24955.1| hypothetical protein AALP_AA8G047500 [Arabis alpina]
Length=324

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 167/237 (70%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+ +FYS +CPN LST++TAV +AV S+    A++L L F DCF+NGCDGS+LL +T++
Sbjct  29   QLTTNFYSTSCPNLLSTVQTAVKSAVKSEARMGASILRLFFHDCFVNGCDGSILLDDTSS  88

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG NVI +IK  +E+ C GVVSCAD+L +A RD++V +GGP+W+V 
Sbjct  89   FTGEQNAAPNRNSARGFNVIDNIKAAVEKACPGVVSCADVLAIAARDSVVALGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  149  VGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I+A++A   +  CP++   GD N  PLD+ TP  FDN YFKNL +QKGL
Sbjct  209  TRIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVATPASFDNNYFKNLLTQKGL  265



>gb|AAW52715.1| peroxidase 1 [Triticum monococcum]
Length=312

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 157/230 (68%), Gaps = 3/230 (1%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  23   QLSPTFYDTSCPRALATIKSGVMAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  82

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P     RG  VI  IKTQ+E +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  83   NALPNNGSLRGFGVIDSIKTQIEAICAQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  142

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            S   ++ A ++ +PGP S+ + L  +F+NKG     MVALSG+HTIG+A C  F++RIYN
Sbjct  143  SIDANEAAANSDLPGPTSSRSDLELAFSNKGLLTVDMVALSGAHTIGQAQCGTFKDRIYN  202

Query  625  DSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++ID ++A  LR+ CP+SGGD +   LD TT   FDNAY+ NL SQKGL
Sbjct  203  ETNIDTTFATSLRANCPRSGGDGSLANLDTTTANTFDNAYYTNLMSQKGL  252



>gb|EMS51084.1| Peroxidase 2 [Triticum urartu]
Length=313

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 158/232 (68%), Gaps = 5/232 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CPNALSTIK AV  AVN +    A+LL LHF DCF+ GCD SVLL     
Sbjct  21   QLSPTFYQTSCPNALSTIKAAVTAAVNKENRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  80

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IK +LE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  81   NAFPNVMSLRGFEVIDSIKAKLETMCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  140

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            ST  ++ A ++ +P P  +L +L  SF +KGFT   MVALSG+HTIG+A C  FR+R+YN
Sbjct  141  STNANEAAANSDLPPPFFDLVNLTQSFGDKGFTVTDMVALSGAHTIGQAQCQNFRDRLYN  200

Query  625  DSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++I++ +A  L++ CPQ    GD N   LD++TP  FDNAY+ NL+SQKGL
Sbjct  201  ETNINSGFATSLKANCPQPTGSGDRNLANLDVSTPYSFDNAYYSNLKSQKGL  252



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 167/237 (70%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             L+  FYS +CPN LST++TAV +AV S+     ++L L F DCF+NGCDGS+LL +T+ 
Sbjct  29   QLTTTFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTSS  88

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG NVI +IK+ +E+ C GVVSCADIL +A RD++V +GGP+W+V 
Sbjct  89   FTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVK  148

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IP P S+L+ LISSF+  G + R MVALSG+HTIG++ C +FR
Sbjct  149  VGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFR  208

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN+++I+A++A   +  CP++   GD N  PLD+TT   FDN YFKNL +QKGL
Sbjct  209  ARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGL  265



>gb|ACF70703.1| root peroxidase [Triticum aestivum]
Length=314

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 156/231 (68%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV---N  264
             LS  FY  +CP AL+ IK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALAAIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLTGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI +IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDNIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP+S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASASLANSDLPGPSSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD  TP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNTNLANLDTMTPNAFDNAYYTNLLSQKGL  254



>ref|XP_008244444.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=322

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 159/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FYSK+CP     +K+ V +AV  +    A+LL LHF DCF+ GCDGSVLL 
Sbjct  24   SSSAQLSTNFYSKSCPKVFHAVKSVVRSAVKKEKRIGASLLRLHFHDCFVKGCDGSVLLD  83

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG  V+  IK+++E+ C GVVSCADIL +A RD++ ++GGPS
Sbjct  84   DTSSFTGEKTAAPNNNSLRGFKVVDKIKSKVEKRCPGVVSCADILAIAARDSVKILGGPS  143

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S  A +  +P P S L+ L + F   G   R +VALSG+HTIGKA C
Sbjct  144  WKVKLGRRDSKTASLAAANRSLPAPTSTLSQLKTGFRAVGLNERDLVALSGAHTIGKAKC  203

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             +FR RIYN+++IDAS+A   + KCP++ GD N  PLD+ TP  FD AYFKNL +QKGL
Sbjct  204  TSFRVRIYNETNIDASFAKARQRKCPRTAGDNNLAPLDVQTPHTFDTAYFKNLINQKGL  262



>tpe|CAH69378.1| TPA: class III peroxidase 136 precursor [Oryza sativa Japonica 
Group]
Length=317

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 161/235 (69%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS +FY K+CPNAL TI+ AV +A+  +    A+LL LHF DCF+NGCDGSVLL +T  
Sbjct  24   QLSANFYDKSCPNALPTIRIAVRSAIARENRMGASLLRLHFHDCFVNGCDGSVLLDDTPT  83

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +VI +IK  +E +C  VVSCADIL +A R+++V +GGP+W V 
Sbjct  84   FTGEKTAAPNNNSLRGFDVIDNIKAHIEGICPQVVSCADILAVAARESVVALGGPTWVVQ  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S D  +  IP P  +L  L  SF+NKG +A  M+ALSG+HTIG+A C  FR
Sbjct  144  LGRRDSTTASLDTANNDIPAPTFDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIY++++ID S A  L+S CP + GD N  PLD +TP  FDN Y+KNL ++KG+
Sbjct  204  NRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYAFDNFYYKNLLNKKGV  258



>ref|XP_006466288.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 157/235 (67%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS ++Y  TCP ALS ++  +  A+ ++    A+LL LHF DCF+NGCDGSVLL +T N
Sbjct  26   QLSTNYYKSTCPKALSIVRAGIIAAIKNETRVGASLLRLHFHDCFVNGCDGSVLLDDTAN  85

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG NV+  IK  LE+ C  VVSCADIL +A RD++VV GGPSW V 
Sbjct  86   FIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVVFGGPSWKVR  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A +T IP P SNL+ LISSF+ +G + + MVAL+G HT+GKA C +FR
Sbjct  146  LGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              IYNDS+ID S+A  L+ +CP+ G D     LD  TP  FDN Y+KNL ++KGL
Sbjct  206  GHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDNLYYKNLLNKKGL  260



>gb|KDO60611.1| hypothetical protein CISIN_1g020951mg [Citrus sinensis]
Length=319

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 157/235 (67%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS ++Y  TCP ALS ++  +  A+ ++    A+LL LHF DCF+NGCDGSVLL +T N
Sbjct  26   QLSTNYYKSTCPKALSIVRAGIIAAIKNETRVGASLLRLHFHDCFVNGCDGSVLLDDTAN  85

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG NV+  IK  LE+ C  VVSCADIL +A RD++VV GGPSW V 
Sbjct  86   FIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVVFGGPSWKVR  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A +T IP P SNL+ LISSF+ +G + + MVAL+G HT+GKA C +FR
Sbjct  146  LGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              IYNDS+ID S+A  L+ +CP+ G D     LD  TP  FDN Y+KNL ++KGL
Sbjct  206  GHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDNLYYKNLLNKKGL  260



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 162/242 (67%), Gaps = 10/242 (4%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S++   LS  FYSK+CPN  STIK  V +A+N +    A+L+ L F DCF+NGCDGSVLL
Sbjct  25   STTNAQLSTSFYSKSCPNLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVLL  84

Query  259  VNTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T++        P     RG  VI  IK+ +E+ C GVVSCADIL +A RD+ V++GGP
Sbjct  85   DDTSSFTGEKTALPNRNSARGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGGP  144

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            +W+V LGRRD+ T S  A +  IP P SNL  LIS F   G + R +VAL+GSHTIG+A 
Sbjct  145  TWNVKLGRRDARTASLSAANNGIPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQAR  204

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQK  768
            C +FR RIYN+++ID S+A   RS CP++   GD N  PLD+ TP  FDN YFKNL +QK
Sbjct  205  CTSFRARIYNETNIDNSFAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNLLNQK  264

Query  769  GL  774
            GL
Sbjct  265  GL  266



>emb|CDP08160.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 162/238 (68%), Gaps = 11/238 (5%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
            +LS  FY  TCP ALSTI++++  AV+ +   AA+L+ LHF DCF+ GCDGSVLL  T++
Sbjct  27   YLSPKFYDGTCPKALSTIRSSIRRAVSRERRMAASLIRLHFHDCFVQGCDGSVLLDATSS  86

Query  274  ---PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                  AP      RG  VI   K ++E++C GVVSCADIL++A RDA V +GGP+W V 
Sbjct  87   FQSEKTAPANRNSVRGFEVIEAAKREVEKICPGVVSCADILSVAARDASVAVGGPTWQVK  146

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S     T +P P ++L+ LIS FA KG +AR+MVALSGSHTIG+A C  FR
Sbjct  147  LGRRDSTTASFSLAQTDLPSPFASLSDLISKFAAKGLSAREMVALSGSHTIGQAQCFVFR  206

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIY N +DIDA +A+  R +CP +   GD    PLD+ TP  FDN YFKNL  +KGL
Sbjct  207  NRIYSNGTDIDAGFASTRRRQCPAANGVGDSKLAPLDLVTPNSFDNNYFKNLMRKKGL  264



>gb|ACF08086.1| class III peroxidase [Triticum aestivum]
Length=316

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 158/230 (69%), Gaps = 8/230 (3%)
 Frame = +1

Query  109  FYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-----  273
            FY  +CPNAL+TIK  V  AV ++    A+L+ LHF DCF++GCDGSVLL +T +     
Sbjct  27   FYDTSCPNALATIKAGVTTAVQNEARMGASLVRLHFHDCFVDGCDGSVLLADTGSFIGEQ  86

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P     RG+NVI +IKTQ+E +C   VSCADIL +A RD++V +GGP+W+V LGRRD
Sbjct  87   GAAPNNNSIRGMNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVALGGPTWTVLLGRRD  146

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT SK      +P P  +L +L + F NK  +   MVALSG+HTIG++ C  FRNRIYN
Sbjct  147  STTASKTNAENDLPPPTFDLQNLTTLFGNKQLSMTDMVALSGAHTIGQSQCRFFRNRIYN  206

Query  625  DSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++I+ ++A  LR+ CPQSGGD +  PLD  TP  FDNAY+ NL SQKGL
Sbjct  207  ETNINTTFATSLRANCPQSGGDSSLAPLDTQTPNGFDNAYYTNLMSQKGL  256



>gb|ABF48527.1| cell wall peroxidase [Capsicum annuum]
 gb|ABG73021.1| cell wall peroxidase [Capsicum annuum]
Length=322

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 156/236 (66%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY + CPNAL+TI+ +V  AV+++   AA+L+ LHF DCF+ GCD S+LL  T  
Sbjct  28   QLSSTFYDRACPNALNTIRKSVRQAVSAERRMAASLIRLHFHDCFVQGCDASILLDETPT  87

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  +I D K +LE+ C G+VSCADIL +A RDA  ++GGPSW+V 
Sbjct  88   IVSEKTALPNLGSVRGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPSWTVK  147

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S     T +PGP   LT LIS FA KG + R MVALSGSH+IG+A C  FR
Sbjct  148  LGRRDSTTASHTLAETDLPGPFDPLTRLISGFAKKGLSTRDMVALSGSHSIGQAQCFLFR  207

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  R +CPQ   + N  PLD+ TP   DN YFKNL+ +KGL
Sbjct  208  DRIYSNGTDIDAGFASTRRRRCPQEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGL  263



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 168/242 (69%), Gaps = 11/242 (5%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            S++  LS +FYSK+CPN LST+K+ V +AV+ +    A+LL L F DCF+NGCDGS+LL 
Sbjct  23   SASAQLSTNFYSKSCPNVLSTVKSVVRSAVSKERRMGASLLRLFFHDCFVNGCDGSILLD  82

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T++        P     RG NVI  IK+++E  C GVVSCADI+ +A RD++V++GGPS
Sbjct  83   DTSSFQGEKTAGPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPS  142

Query  418  WSVSLGRRDSTTPSKD-AGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            W V LGRRD+ T S   A S  +P P S L++L S F  +G + R MVALSGSHTIG+A 
Sbjct  143  WEVKLGRRDARTASFSLANSGALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQAR  202

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQK  768
            C +FR+RIYNDS+ID+S++   + KCP +   GD N  PLD+ +P  FDNAYFKNL S K
Sbjct  203  CISFRSRIYNDSNIDSSFSKTRQRKCPSTVGSGDQNLAPLDLQSPTAFDNAYFKNLLSNK  262

Query  769  GL  774
            GL
Sbjct  263  GL  264



>gb|ACF08085.1| class III peroxidase [Aegilops ventricosa]
Length=314

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASASLANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD  TP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNSNLANLDTXTPNTFDNAYYTNLLSQKGL  254



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 165/242 (68%), Gaps = 10/242 (4%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S+++  LS +FYS +CP   ST+K+ V +A+  +    A+LL LHF DCF+NGCDGS+LL
Sbjct  19   STTSAQLSTNFYSSSCPRLFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLLL  78

Query  259  VNTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T++        P     RG +V+ +IK+ +E +C GVVSCADIL +A RD++V +GGP
Sbjct  79   DDTSSFTGEKNAAPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLGGP  138

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            SW+V LGRRD+ T S+ A +  IP P  NL  LIS+F+  G + R +VALSGSHTIG+A 
Sbjct  139  SWNVKLGRRDARTASQAAANNNIPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQAR  198

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQK  768
            C +FR RIYN++++D+S A   RS CP++   GD N  PLD+ TP  FDN YFKNL   K
Sbjct  199  CTSFRPRIYNETNLDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQNK  258

Query  769  GL  774
            GL
Sbjct  259  GL  260



>ref|XP_011032836.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=318

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 155/235 (66%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  +CPNALS I+TA+ +A+  D   AA+L+ LHF DCF+ GCD S+LL  T++
Sbjct  25   QLSPAFYDSSCPNALSAIRTAIRSAIAGDRRMAASLIRLHFHDCFVQGCDASILLDETSS  84

Query  274  PM--------VAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                      +   RG NVI   KT++E++C GVVSCADI+ +A RDA   +GGPS++V 
Sbjct  85   IQSEKTALGNLNSARGYNVIEKAKTEVEKICPGVVSCADIIAVAARDASSYVGGPSYAVK  144

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   +  +P    +L  LIS F  KG TAR MVALSGSHT+G+A C  FR
Sbjct  145  LGRRDSTTASRTLANAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFR  204

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYNDS+IDA +A+  R +CP+ G D    PLD+ TP  FDN YFKNL   KGL
Sbjct  205  ERIYNDSNIDAGFASTRRRRCPRVGSDATLAPLDLVTPNSFDNNYFKNLMRNKGL  259



>ref|XP_009801852.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
 ref|XP_009801853.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
Length=324

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 158/236 (67%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY +TCPNAL+TI+T+V  AV+ +   AA+L+ LHF DCF+ GCD S+LL  T  
Sbjct  30   QLSSTFYDRTCPNALNTIRTSVRQAVSRERRMAASLIRLHFHDCFVQGCDASILLDETPT  89

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  +I D K +LE+ C G+VSCADIL +A RDA  ++GGP+W+V 
Sbjct  90   IVSEKTALPNLGSARGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPTWAVK  149

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S     T +PGP   L  LISSFA+KG + R MVALSG+H+IG+A C  FR
Sbjct  150  LGRRDSTTASHTLAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHSIGQAQCFLFR  209

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  R +CP+   + N  PLD+ TP   DN YFKNL+ +KGL
Sbjct  210  DRIYGNGTDIDAGFASTRRRQCPKEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGL  265



>emb|CDP16309.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 157/238 (66%), Gaps = 11/238 (5%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCP AL TI+T++  AV+ +   AA+L+ LHF DCF+ GCDGSVLL  T+ 
Sbjct  26   QLSPTFYDATCPRALDTIRTSIRRAVSRERRMAASLIRLHFHDCFVQGCDGSVLLDQTST  85

Query  274  PMVAP--------PRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                          RG  VI   K ++E++C GVVSCADIL++A RDA V +GGP+W V 
Sbjct  86   IQSEKTALANNNSARGFEVIEAAKLEVEKICPGVVSCADILSVAARDASVAVGGPTWQVK  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+ A  + +P P +NL  LI+ F NKG + R MVALSGSHTIG+A C  FR
Sbjct  146  LGRRDSTTASRSAADSNLPSPFANLGDLITKFQNKGLSPRDMVALSGSHTIGQAQCFVFR  205

Query  610  NRIY-NDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NR+Y N +DIDA +A+  R +CP +   GD N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  206  NRVYSNGTDIDAGFASTRRRQCPSAIGNGDSNLAPLDLVTPNSFDNNYFKNLMRKKGL  263



>gb|ACD87898.1| class III peroxidase [Aegilops ventricosa]
Length=314

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV---N  264
             LS  FY  +CP AL  IK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALVAIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLTGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI +IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDNIKTQLESVCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP+S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASASLANSDLPGPSSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD  TP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNTNLANLDTMTPNAFDNAYYTNLLSQKGL  254



>ref|XP_010925616.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/235 (50%), Positives = 160/235 (68%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FYS+ CPN  S +++ +  AV  +P  AA++L L F DCF+NGCDGS+LL +T  
Sbjct  24   QLSPTFYSRNCPNLQSIVRSVMAQAVQKEPRMAASILRLFFHDCFVNGCDGSILLDDTPT  83

Query  268  ------TNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI  IKTQ+E  C   VSCADIL LA RD + ++GGP+W+V 
Sbjct  84   FTGEKNAGPNANSARGFEVIDAIKTQVEAACKATVSCADILALAARDGVALVGGPNWNVL  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+ T S+ A ++ +PGP S+L+ LIS FA +G  A+++ ALSG+HTIG+A C  FR
Sbjct  144  LGRRDARTASQSAANSNLPGPGSSLSTLISMFAAQGLNAQELTALSGAHTIGRARCLFFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRI+N+++++AS+AA  +  CP SGGD N  P DI TP  FDNAY+++L +Q+GL
Sbjct  204  NRIFNEANVNASFAALRKQTCPASGGDSNLAPFDIRTPDRFDNAYYQDLVNQQGL  258



>gb|KDP21683.1| hypothetical protein JCGZ_03354 [Jatropha curcas]
Length=316

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 158/234 (68%), Gaps = 8/234 (3%)
 Frame = +1

Query  97   LSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL------  258
            LS  +YS+TCP ALS ++  V  A+ ++    A+LL LHF DCF+NGCDGS+LL      
Sbjct  24   LSPDYYSRTCPKALSVVEAGVKKAIKNETRIGASLLRLHFHDCFVNGCDGSILLDDNATF  83

Query  259  --VNTTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSL  432
                T  P     RG NVI DIK++LE+ C GVVSCADI+ LA RD+ V +GGPSW V L
Sbjct  84   IGEKTAAPNNNSVRGFNVIDDIKSKLEKACPGVVSCADIVALAARDSAVYLGGPSWKVGL  143

Query  433  GRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRN  612
            GR+DS T S+   +T IP P SNL+ LI+SF+ +G + R MVALSGSHTIG A C ++R 
Sbjct  144  GRKDSLTASRALANTSIPPPTSNLSALITSFSAQGLSLRDMVALSGSHTIGLARCTSYRG  203

Query  613  RIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             IYNDS+ID S+A  L+  CP+SG D    PLD  TP  FDN Y+KNL ++KGL
Sbjct  204  HIYNDSNIDPSFAKSLQQICPRSGKDNVLAPLDRQTPTRFDNLYYKNLLNKKGL  257



>gb|AAL93151.1|AF485265_1 class III peroxidase [Gossypium hirsutum]
Length=320

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 165/243 (68%), Gaps = 11/243 (5%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            S S   LS +FYSK+CP  LST++  V  AV+ +    A+LL L F DCF+NGCDGSVLL
Sbjct  19   SGSYAQLSTNFYSKSCPKVLSTVELVVETAVSKEQRLGASLLRLFFHDCFVNGCDGSVLL  78

Query  259  VNT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T   T    A P     RG  V+ +IK ++E++C GVVSCADIL +A RD++V++GGP
Sbjct  79   DDTSSFTGEQTATPNNGSLRGFEVVDEIKAKVEKVCPGVVSCADILAIAARDSVVILGGP  138

Query  415  SWSVSLGRRDSTTPS-KDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKA  591
             W V LGRRDS T S  DA S ++P  ++NL+ LIS F  +G + + MVALSG+HTIGKA
Sbjct  139  DWDVKLGRRDSKTASFSDANSGVLPLGSANLSQLISLFQAQGLSTKDMVALSGAHTIGKA  198

Query  592  HCAAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQ  765
             C  FRNRIYND+ ID S+A   RS CP++   GD N  PLD+ TP  FD+ YF+NL ++
Sbjct  199  RCLVFRNRIYNDTIIDTSFAKTRRSSCPRTRGSGDNNLAPLDLATPNSFDSKYFENLLNK  258

Query  766  KGL  774
            KGL
Sbjct  259  KGL  261



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 161/237 (68%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYSKTCPN  +T+K+ V  A+N +    A+LL L F DCF+NGCDGS+LL +T+ 
Sbjct  36   QLSTNFYSKTCPNVFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSILLDDTST  95

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG +V+ +IK+ +E++C GVVSCAD+L +  RD+ V++GGPSW+V 
Sbjct  96   FTGEKNAAPNKNSARGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPSWNVK  155

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A +  IP P SNL +LIS F N G + R MVALSGSHTIG+A C  FR
Sbjct  156  VGRRDARTASQAAANNSIPPPTSNLNNLISFFQNVGLSTRDMVALSGSHTIGQARCTNFR  215

Query  610  NRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN++++D+S A   +S CP++   GD N  PLD+ TP  FDN Y+KNL   KGL
Sbjct  216  TRIYNETNLDSSLAKTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYKNLLQNKGL  272



>gb|EYU20115.1| hypothetical protein MIMGU_mgv1a025851mg [Erythranthe guttata]
Length=318

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 166/241 (69%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS  +YSK+CPN  +T+KT V +A+ ++    A+LL L F DCF+NGCDGS+LL 
Sbjct  17   SSSAQLSTDYYSKSCPNLFTTVKTVVRSAIQNEARMGASLLRLFFHDCFVNGCDGSILLD  76

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG N++ +IK+ +E++C  VVSCADIL +A+RD++V++GGP 
Sbjct  77   DTSSFTGEKTALPNRNSVRGFNIVDNIKSAVEKVCPNVVSCADILAVASRDSVVILGGPD  136

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRDS T S  A +  IP P SNL  LISSF + G + + +V LSGSHTIG+A C
Sbjct  137  WKVKLGRRDSRTASLAAANNSIPPPTSNLNTLISSFNSLGLSTKDLVVLSGSHTIGQARC  196

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             +FR RIYN++++DAS+A   R  CP++   GD N  PLD+ TP  FDN YFKNL S++G
Sbjct  197  TSFRARIYNETNLDASFAQTRRGNCPRAAGAGDNNLAPLDVQTPANFDNNYFKNLISRRG  256

Query  772  L  774
            L
Sbjct  257  L  257



>ref|XP_009369543.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 165/242 (68%), Gaps = 11/242 (5%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS +FYSK+CP    T+K+ V +AV+ +    A+LL LHF DCF+NGCDGS+LL 
Sbjct  27   SSSAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLD  86

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG  V+  IK+Q+E+ C GVVSCADIL +A+RD++ ++GGPS
Sbjct  87   DTSSFTGEKTAGPNNNSARGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPS  146

Query  418  WSVSLGRRDSTTPS-KDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            W V LGRRDS T S   A S +IP P + L  L++ F   G + R +VALSG+HTIG+A 
Sbjct  147  WEVKLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQAR  206

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQK  768
            C  FR RIYN+++IDAS+A   ++ CP++   GD N  PLD+TTP  FD AYFKNL +QK
Sbjct  207  CTTFRARIYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNQK  266

Query  769  GL  774
            GL
Sbjct  267  GL  268



>gb|ACF70708.1| root peroxidase [Triticum aestivum]
Length=314

 Score =   249 bits (637),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP S+ + L ++F  K      MVAL G+HTIGKA C+ FR RIY 
Sbjct  144  STTASAALANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALPGAHTIGKAQCSNFRTRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNGNLANLDTTTPNTFDNAYYTNLLSQKGL  254



>gb|ACF70706.1| root peroxidase [Triticum aestivum]
Length=314

 Score =   249 bits (637),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IKTQLE +C   VSCADILT+A RD++V +GGP W+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPPWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY-  621
            STT S    ++ +PGP S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASAALANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  622  NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             D++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GDTNINTAFATSLKANCPQSGGNGNLANLDTTTPNTFDNAYYTNLLSQKGL  254



>ref|XP_008374518.1| PREDICTED: peroxidase P7-like isoform X2 [Malus domestica]
Length=317

 Score =   249 bits (637),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 161/234 (69%), Gaps = 9/234 (4%)
 Frame = +1

Query  97   LSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-  273
            L+++FY   CP ALS ++  +  A+ ++    A+LL LHF+DCF+NGCD SVLL +T++ 
Sbjct  25   LTQNFYKSKCPKALSIVQGVIA-AIKNETRVGASLLRLHFQDCFVNGCDASVLLDDTSSF  83

Query  274  --PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSL  432
                 A P     RG  V+  IK +LE+ C GVVSCAD+L LA RD+ V +GGPSW V L
Sbjct  84   VGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVGL  143

Query  433  GRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRN  612
            GRRDSTT S+ A +T +P P SN++ LISSF+ +G + R +VALSGSHTIG A C  FR+
Sbjct  144  GRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFRS  203

Query  613  RIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            RIYNDS IDA++A  L+  CP+SG D N   LD+ TP  FDN Y+KNL  +KGL
Sbjct  204  RIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGL  257



>emb|CAD67478.1| peroxidase [Asparagus officinalis]
Length=301

 Score =   249 bits (635),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 160/241 (66%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+ HLS +FYS +CP   STIK  + +A+  +    A++L L F DCF+NGCDGS+LL 
Sbjct  2    SSSAHLSTNFYSSSCPKVFSTIKPVLQSAIAKEKRMGASILRLFFHDCFVNGCDGSILLA  61

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T N        P     RG  VI  IKT +E  C GVVSCADIL +A RD++V++GGP 
Sbjct  62   DTANFRGEQHAGPNNGSVRGFKVIDKIKTAVENACPGVVSCADILAVAARDSVVILGGPD  121

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W V LGRRD+ T S    +  IP P S+L++LIS FA +G + + MVALSG+HTIG+A C
Sbjct  122  WKVKLGRRDARTASATLANNNIPPPTSSLSNLISKFAAQGLSTKDMVALSGAHTIGQARC  181

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
             +FR  IYND+DIDAS+A+  +  CP+    GD N  PLD+ TP  FDN Y+KNL ++KG
Sbjct  182  TSFRGHIYNDADIDASFASLRQKICPRKSGSGDTNLAPLDLQTPTAFDNNYYKNLINKKG  241

Query  772  L  774
            L
Sbjct  242  L  242



>gb|ACF08096.1| class III peroxidase [Triticum aestivum]
Length=313

 Score =   249 bits (636),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 158/232 (68%), Gaps = 5/232 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNAL+TIK+AV  AVN +    A+LL LHF DCF+ GCD SVLL     
Sbjct  21   QLSPTFYDTTCPNALATIKSAVTAAVNKENRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  80

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IK +LE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  81   NAFPNVMSLRGFEVIDSIKAKLETMCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  140

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            ST  ++   ++ +P P  +L +L  SF +KGFT   MVALSG+HTIG+A C  FR+R+YN
Sbjct  141  STNANEAVANSDLPPPFFDLVNLTQSFGDKGFTVTDMVALSGAHTIGQAQCQNFRDRLYN  200

Query  625  DSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++I++ +A  L++ CPQ    GD N   LD++TP  FDNAY+ NL+SQKGL
Sbjct  201  ETNINSGFATSLKANCPQPTGSGDRNLANLDVSTPYSFDNAYYSNLKSQKGL  252



>ref|XP_009790966.1| PREDICTED: peroxidase P7-like [Nicotiana sylvestris]
Length=319

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 155/235 (66%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTT-  270
             LS +FY  +C N  + + +A+  AVN +P   A++L L F DCF+NGCD S+LL +T  
Sbjct  26   QLSANFYGTSCRNLQTIVSSAMRQAVNREPRLGASILRLFFHDCFVNGCDASILLDDTAT  85

Query  271  -------NPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                   NP     RG  VI  IKTQ+E  C   VSCADIL LA R+ +V++GGPSW+V 
Sbjct  86   FTGEKNANPNRNSARGFEVIDTIKTQVEAACPNAVSCADILALAAREGVVLLGGPSWAVP  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+ T S+ A +T IP P S+L+ L+S F+ KG  AR M ALSG HTIG+A C  FR
Sbjct  146  LGRRDARTASQSAANTQIPAPTSSLSTLLSMFSAKGLNARDMTALSGGHTIGQARCTTFR  205

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYND++IDA +AA  R+ CP S GD N  PLDI TP  FDN Y++NL +++GL
Sbjct  206  TRIYNDTNIDAQFAATRRATCPSSSGDANLAPLDIQTPNRFDNDYYQNLVARRGL  260



>dbj|BAJ90866.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92895.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 157/232 (68%), Gaps = 5/232 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNALSTIK  V  AVN +    A+LL LHF DCF+ GCD SVLL     
Sbjct  21   QLSPTFYQTTCPNALSTIKAGVTAAVNKENRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  80

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IK +LE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  81   NAAPNVMSLRGFEVIDSIKAKLETMCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  140

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            ST  ++ A ++ +P P  +L +L  SF +KGFT   MVALSG+HTIG+A C  FR+R+YN
Sbjct  141  STNANEAAANSDLPPPFFDLVNLTQSFGDKGFTVTDMVALSGAHTIGQAQCLNFRDRLYN  200

Query  625  DSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++ID+  AA L++ CP+    GD N   LD++TP  FDNAY+ NL+SQKGL
Sbjct  201  ETNIDSGLAASLKANCPRPTGSGDGNLANLDVSTPYSFDNAYYSNLKSQKGL  252



>tpg|DAA64106.1| TPA: peroxidase J [Zea mays]
Length=320

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 160/239 (67%), Gaps = 12/239 (5%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FY  +CPNALSTIK+AV+ AV  +    A+LL LHF DCF+ GCD SVLL +   
Sbjct  23   QLSPTFYDSSCPNALSTIKSAVNAAVQKENRMGASLLRLHFHDCFVQGCDASVLLADNAA  82

Query  268  ---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWS  423
               T    A P     RG +VI +IK Q+E +C   VSCADIL +A RD++V +GGPSW+
Sbjct  83   TGFTGEQGAAPNAGSLRGFDVIANIKAQVEAVCKQTVSCADILAVAARDSVVALGGPSWT  142

Query  424  VSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAA  603
            V LGRRDSTT S    ++ +P P  NL  LI++F NKGFTA +M  LSG+HTIG+A C  
Sbjct  143  VPLGRRDSTTASLSLANSDLPPPFFNLGQLITAFGNKGFTATEMATLSGAHTIGQAQCKN  202

Query  604  FRNRIYNDSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            FR+ IYND++I+  +A+ L++ CP+    GD N  PLD TTP  FDNAY+ NL SQKGL
Sbjct  203  FRDHIYNDTNINQGFASSLKANCPRPTGSGDGNLAPLDTTTPYSFDNAYYSNLLSQKGL  261



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 168/242 (69%), Gaps = 11/242 (5%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS  FYSK+CP    T+K+AV +A+N +    A+LL L F DCF+NGCDGS+LL 
Sbjct  21   SSSAQLSTGFYSKSCPKLYQTVKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLD  80

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T++        P V   RG  VI +IK+ +E++C GVVSCADIL +  RD++V++GGP+
Sbjct  81   DTSSFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPN  140

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W+V LGRRDS T S+ A ++ IP   SNL  LISSF+  G + + MVALSG+HTIG+A C
Sbjct  141  WNVKLGRRDSRTASQSAANSGIPPATSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARC  200

Query  598  AAFRNRIYNDS-DIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQK  768
             +FR RIYN++ ++DAS+A   +S CP+S   GD N  PLD+ TP  FDN YFKNL  +K
Sbjct  201  TSFRARIYNETNNLDASFARTRQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFKNLVDKK  260

Query  769  GL  774
            GL
Sbjct  261  GL  262



>gb|ACF70705.1| root peroxidase [Triticum aestivum]
 gb|ACF70711.1| root peroxidase [Triticum aestivum]
 gb|ACF70712.1| root peroxidase [Triticum aestivum]
Length=314

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT S    ++ +PGP S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASAALANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  625  D-SDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              ++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GATNINTAFATSLKANCPQSGGNGNLANLDTTTPNTFDNAYYTNLLSQKGL  254



>gb|ACF70710.1| root peroxidase [Triticum aestivum]
Length=314

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT S    ++ +PGP S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASAALANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  625  D-SDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              ++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GATNINTAFATSLKANCPQSGGNGNLANLDTTTPNTFDNAYYTNLLSQKGL  254



>gb|ACF70701.1| root peroxidase [Triticum aestivum]
Length=314

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT S    ++ +PGP S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASAALANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  625  D-SDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              ++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GATNINTAFATSLKANCPQSGGNGNLANLDTTTPNTFDNAYYTNLLSQKGL  254



>ref|XP_008374548.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=317

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 161/234 (69%), Gaps = 9/234 (4%)
 Frame = +1

Query  97   LSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-  273
            L+++FY   CP ALS ++  +  A+ ++    A+LL LHF+DCF+NGCD SVLL +T++ 
Sbjct  25   LTQNFYKSKCPKALSIVQGVIA-AIKNETRVGASLLRLHFQDCFVNGCDASVLLDDTSSF  83

Query  274  --PMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSL  432
                 A P     RG  V+  IK +LE+ C GVVSCAD+L LA RD+ V +GGPSW V L
Sbjct  84   VGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVGL  143

Query  433  GRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRN  612
            GRRDSTT S+ A +T +P P SN++ LISSF+ +G + R +VALSGSHTIG A C  FR+
Sbjct  144  GRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFRS  203

Query  613  RIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            RIYNDS IDA++A  L+  CP+SG D N   LD+ TP  FDN Y+KNL  +KGL
Sbjct  204  RIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNXYYKNLLKEKGL  257



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 166/242 (69%), Gaps = 11/242 (5%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            SS+  LS  FYSK+CP    T+K  V +A++ +    A+L+ L F DCF+ GCDGS+LL 
Sbjct  28   SSSAQLSTGFYSKSCPKLFETVKPVVADAISKERRMGASLVRLFFHDCFVKGCDGSILLE  87

Query  262  NT---TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T   T    A P     RG NVI +IK ++E++C GVVSCADIL +A RD+ V +GGP+
Sbjct  88   DTASFTGEQTAGPNNNSVRGFNVINNIKAKVEKVCPGVVSCADILAIAARDSTVTLGGPN  147

Query  418  WSVSLGRRDSTTPS-KDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
            W+V LGRRDS T S   A S +IP P S L++LI+ F  KG +AR MVALSG+HTIG+A 
Sbjct  148  WAVKLGRRDSKTASFSAANSGVIPPPTSTLSNLINRFKAKGLSARDMVALSGAHTIGQAR  207

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQK  768
            C  FRNRIYN+++ID+S+A+  +  CP++   GD N  PLD+ TP  FDN YFKNL +QK
Sbjct  208  CVIFRNRIYNETNIDSSFASTRQRNCPRATGSGDNNLAPLDVQTPNAFDNNYFKNLLNQK  267

Query  769  GL  774
            GL
Sbjct  268  GL  269



>ref|XP_010041552.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=322

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 163/237 (69%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS  FYSK+CP+A + +K+ V +AV+ +PG  A+LL L F DCF+NGCDGSVLL +T  
Sbjct  27   QLSPDFYSKSCPDAFTGVKSQVESAVSKEPGIGASLLRLFFHDCFVNGCDGSVLLDDTPT  86

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG  VI D+K+ +E++C GVVSCAD+L +  RD++V++GGPSWSV 
Sbjct  87   FTGEKNAAPNRNSARGFEVIDDVKSAVEKVCPGVVSCADLLAITARDSVVLLGGPSWSVK  146

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRD+ T S+ A ++ +P PASNLT LISSF + G +   +VALSGSH+IG+A CA FR
Sbjct  147  LGRRDARTASQAAANSSLPSPASNLTDLISSFESAGLSTTDLVALSGSHSIGQAKCANFR  206

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             RIYN++D+D S+    R  CP S   GD N   LD+ +P+ +DN Y+ NL   KGL
Sbjct  207  ARIYNETDLDRSFGEIRRKNCPSSAGPGDNNLASLDLQSPVAYDNTYYTNLLQFKGL  263



>emb|CAA59484.1| pox1 [Triticum aestivum]
Length=316

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 158/230 (69%), Gaps = 8/230 (3%)
 Frame = +1

Query  109  FYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-----  273
            FY  +CPNAL+TIK  V  AV ++    A+L+ LHF DCF++GCDGSVLL +T +     
Sbjct  27   FYDTSCPNALATIKAGVTTAVQNEARMGASLVRLHFHDCFVDGCDGSVLLADTGSFIGEQ  86

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P     RG+NVI +IKTQ+E +C   VSCADIL +A RD++V +GGP+W+V LGRRD
Sbjct  87   GAAPNNNSIRGMNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVALGGPTWTVLLGRRD  146

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT SK      +P P  +L +L + F NK  +   MVALSG+HTIG++ C  FR+RIYN
Sbjct  147  STTASKTNAENDLPPPTFDLQNLTTLFGNKQLSMTDMVALSGAHTIGQSQCRFFRDRIYN  206

Query  625  DSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++I+ ++A  LR+ CPQSGGD +  PLD  TP  FDNAY+ NL SQKGL
Sbjct  207  ETNINTTFATSLRANCPQSGGDSSLAPLDTQTPNGFDNAYYTNLMSQKGL  256



>gb|ACF08094.1| class III peroxidase [Triticum aestivum]
Length=321

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 164/233 (70%), Gaps = 10/233 (4%)
 Frame = +1

Query  106  HFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT---TNP  276
             FY+K+CP AL+TIK+AV  AV S+P   A+LL LHF DCF+ GCD SVLL +T   T  
Sbjct  30   QFYAKSCPRALATIKSAVTAAVRSEPRMGASLLRLHFHDCFVQGCDASVLLSDTATFTGE  89

Query  277  MVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRR  441
              A P     RG+NVI +IK Q+E +C   VSCADIL +A RD++V +GGPSW+V LGRR
Sbjct  90   QGAAPNARSIRGMNVIDNIKAQVEAVCRQTVSCADILAVAARDSVVALGGPSWTVPLGRR  149

Query  442  DSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY  621
            DSTT S    ++ +P P+ +L +L ++FA KG +   MVALSG HTIG++ C  FR+R+Y
Sbjct  150  DSTTASLSLANSDLPAPSFDLANLTANFAAKGLSVTDMVALSGGHTIGQSQCRFFRSRLY  209

Query  622  NDSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            N+++IDA++A  L++ CP+  S G+ +  PLD TTP  FDNAY+ NL SQKGL
Sbjct  210  NETNIDAAFATSLKANCPRTTSSGNSSLAPLDTTTPNGFDNAYYSNLMSQKGL  262



>gb|ACF70709.1| root peroxidase [Triticum aestivum]
Length=314

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CP AL+TIK+ V  AV+SDP   A+LL LHF DCF+ GCD SVLL     
Sbjct  24   QLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  83

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IKTQLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  84   NAGPNVGSLRGFGVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  143

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT S    ++ +PGP S+ + L ++F  K      MVALSG+HTIGKA C+ FR RIY 
Sbjct  144  STTASAALANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYG  203

Query  625  D-SDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              ++I+ ++A  L++ CPQSGG+ N   LD TTP  FDNAY+ NL SQKGL
Sbjct  204  GATNINTAFATSLKANCPQSGGNGNLANLDTTTPNTFDNAYYTNLLSQKGL  254



>gb|AAW52718.1| peroxidase 4 [Triticum monococcum]
Length=313

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 158/232 (68%), Gaps = 5/232 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNAL+TIK+AV  AVN +    A+LL LHF DCF+ GCD SVLL     
Sbjct  21   QLSPTFYDTTCPNALATIKSAVTAAVNKENRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  80

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IK QLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  81   NAIPNVMSLRGFEVIDSIKAQLETMCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  140

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            ST  ++ A +  +P P  +L +L  SF +KGFT   MVALSG+HTIG+A C  FR+R+YN
Sbjct  141  STNANEAAANNELPPPFFDLVNLTQSFGDKGFTVTDMVALSGAHTIGQAQCQNFRDRLYN  200

Query  625  DSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++I++ +A  L++ CPQ    GD N   LD++TP  FDNAY+ NL+SQKGL
Sbjct  201  ETNINSGFATSLKANCPQPTGSGDRNLANLDVSTPYSFDNAYYSNLKSQKGL  252



>ref|NP_001060628.1| Os07g0677200 [Oryza sativa Japonica Group]
 dbj|BAC83103.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAF22542.1| Os07g0677200 [Oryza sativa Japonica Group]
 dbj|BAG93342.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96895.1| unnamed protein product [Oryza sativa Japonica Group]
Length=317

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 158/232 (68%), Gaps = 5/232 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL---VN  264
             LS  FY  +CPNALSTIK+ +  AVNS+    A+LL LHF DCF+ GCD SVLL     
Sbjct  26   QLSATFYDTSCPNALSTIKSVITAAVNSEARMGASLLRLHFHDCFVQGCDASVLLSGQEQ  85

Query  265  TTNPMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG +VI + K ++E +C   VSCADIL +A RD++V +GGPSW+V LGRRD
Sbjct  86   NAGPNVGSLRGFSVIDNAKARVEAICNQTVSCADILAVAARDSVVALGGPSWTVLLGRRD  145

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT S+   +T +P P+S+L  LI +F+ KG  A  MVALSG+HTIG+A C  FR+RIYN
Sbjct  146  STTASEALANTDLPAPSSSLAELIGNFSRKGLDATDMVALSGAHTIGQAQCQNFRDRIYN  205

Query  625  DSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++ID+++A   ++ CP+    GD N  PLD TTP  FDNAY+ NL S KGL
Sbjct  206  ETNIDSAFATQRQANCPRPTGSGDSNLAPLDTTTPNAFDNAYYSNLLSNKGL  257



>gb|ACF08087.1| class III peroxidase [Triticum aestivum]
Length=316

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 159/230 (69%), Gaps = 8/230 (3%)
 Frame = +1

Query  109  FYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN-----  273
            FY  +CPNAL+TIK  V  A+N++    A+L+ LHF DCF++GCDGSVLL +T +     
Sbjct  27   FYDTSCPNALATIKAGVTAALNTETRMGASLVRLHFHDCFVDGCDGSVLLADTGSFIGEQ  86

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P     RG+NVI +IKTQ+E +C   VSCADIL +A RD++V +GGP+W+V LGRRD
Sbjct  87   GAAPNNNSIRGMNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVALGGPTWTVLLGRRD  146

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            STT SK      +P P  +L +L + F NK  +   MVALSG+HTIG++ C  FR+RIYN
Sbjct  147  STTASKTNAENDLPPPTFDLQNLTTLFGNKQLSMTDMVALSGAHTIGQSQCRFFRDRIYN  206

Query  625  DSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++I+ ++A  LR+ CPQSGGD +  PLD  TP  FDN+Y+ NL SQKGL
Sbjct  207  ETNINTTFATSLRANCPQSGGDSSLAPLDTATPNAFDNSYYTNLMSQKGL  256



>gb|ACF08095.1| class III peroxidase [Triticum aestivum]
Length=321

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 163/233 (70%), Gaps = 10/233 (4%)
 Frame = +1

Query  106  HFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT---TNP  276
             FY+K+CP AL+TIK+AV  AV S+P   A+LL LHF DCF+ GCD SVLL +T   T  
Sbjct  30   QFYAKSCPRALATIKSAVTAAVRSEPRMGASLLRLHFHDCFVQGCDASVLLSDTATFTGE  89

Query  277  MVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRR  441
              A P     RG+NVI +IK Q+E +C   VSCADIL +A RD++V +GGPSW+V LGRR
Sbjct  90   QGAAPNARSIRGMNVIDNIKAQVEAVCRQTVSCADILAVAARDSVVALGGPSWTVPLGRR  149

Query  442  DSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIY  621
            DSTT S    ++ +P P+ +L +L ++FA KG +   MVALSG HTIG++ C  FR+R+Y
Sbjct  150  DSTTASLSLANSDLPAPSFDLANLTANFAAKGLSVTDMVALSGGHTIGQSQCRFFRSRLY  209

Query  622  NDSDIDASYAAWLRSKCPQSGGDLN--YVPLDITTPILFDNAYFKNLQSQKGL  774
            N+++IDA++AA L++ CP+S G  N    PLD  TP  FDNAY+ NL SQKGL
Sbjct  210  NETNIDAAFAASLKANCPRSTGSGNSSLAPLDTNTPNGFDNAYYSNLMSQKGL  262



>gb|EMT15847.1| Peroxidase 2 [Aegilops tauschii]
Length=314

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 157/232 (68%), Gaps = 5/232 (2%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY  TCPNAL+TIK AV  AVN +    A+LL LHF DCF+ GCD SVLL     
Sbjct  22   QLSPTFYQTTCPNALATIKAAVTAAVNKENRMGASLLRLHFHDCFVQGCDASVLLSGMEQ  81

Query  274  ---PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVSLGRRD  444
               P V   RG  VI  IK QLE +C   VSCADILT+A RD++V +GGPSW+V LGRRD
Sbjct  82   NAIPNVMSLRGFEVIDSIKAQLETMCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRD  141

Query  445  STTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFRNRIYN  624
            ST  ++ A +  +P P  +L +L  SF +KGFT   MVALSG+HTIG+A C  FR+R+YN
Sbjct  142  STNANEAAANNELPPPFFDLVNLTQSFGDKGFTVTDMVALSGAHTIGQAQCQNFRDRLYN  201

Query  625  DSDIDASYAAWLRSKCPQ--SGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +++I++ +A  L++ CPQ    GD N   LD++TP  FDNAY+ NL+SQKGL
Sbjct  202  ETNINSGFATSLKANCPQPTGSGDRNLANLDVSTPYSFDNAYYSNLKSQKGL  253



>ref|XP_008460239.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis melo]
Length=316

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 155/235 (66%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY +TCP AL+TI+T +  A++ +   AA+L+ LHF DCF+ GCD S+LL +T +
Sbjct  23   QLSSSFYDQTCPTALTTIRTVIRQAISQERRMAASLIRLHFHDCFVQGCDASILLDDTPS  82

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI   KT++E++C GVVSCADIL +A RDA   +GGPSW+V 
Sbjct  83   MIGEQNAAPNRNSARGYGVIHKAKTEVEKICPGVVSCADILAVAARDASFAVGGPSWTVK  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT SK      +P   + L  LIS F+NKG + R MVALSGSHTIG+A C  FR
Sbjct  143  LGRRDSTTASKTLAENELPHFQAGLDRLISIFSNKGLSTRDMVALSGSHTIGQAQCFLFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            NRIYN ++IDA +A+  R  CP S G+ N  PLD+ TP  FDN YFKNL  +KGL
Sbjct  203  NRIYNQTNIDAGFASTRRRNCPTSSGNGNLAPLDLVTPNSFDNNYFKNLVQRKGL  257



>ref|XP_004250402.1| PREDICTED: lignin-forming anionic peroxidase [Solanum lycopersicum]
Length=320

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 155/236 (66%), Gaps = 9/236 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS  FY +TCP AL+TI+T++  AV+S+   AA+L+ LHF DCF+ GCD S+LL  T  
Sbjct  26   QLSSTFYDRTCPTALTTIRTSIRQAVSSERRMAASLIRLHFHDCFVQGCDASILLDETPT  85

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P +   RG  +I D K +LE+ C G+VSCADIL +A RDA  ++GGPSW+V 
Sbjct  86   IVSEKTALPNLGSARGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPSWTVK  145

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDS T S     T +PGP   L  LIS FANKG + R MVALSGSH+IG+A C  FR
Sbjct  146  LGRRDSATASHTLAETDLPGPFDPLDRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFR  205

Query  610  NRIY-NDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIY N +DIDA +A+  R +CPQ   + N  PLD+ TP   DN Y+KNL  +KGL
Sbjct  206  DRIYSNGTDIDAGFASTRRRQCPQEDQNGNLAPLDLVTPNQLDNNYYKNLIQRKGL  261



>ref|XP_011076613.1| PREDICTED: peroxidase P7 [Sesamum indicum]
Length=321

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 165/242 (68%), Gaps = 10/242 (4%)
 Frame = +1

Query  79   SSSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLL  258
            SSS+  LS  FYSK+CPN  +T+K+ VH+AV ++    A+LL L F DCF+NGCDGS+LL
Sbjct  21   SSSSAQLSPDFYSKSCPNLFATVKSVVHSAVQNEARMGASLLRLFFHDCFVNGCDGSILL  80

Query  259  VNTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGP  414
             +T++        P     RG +V+  IK+ +E+ C GVVSCAD+L +A RD++V++GGP
Sbjct  81   DDTSSFTGEKGAVPNRNSARGFDVVDQIKSAVEKACPGVVSCADVLAIAARDSVVILGGP  140

Query  415  SWSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAH  594
             W+V LGRRD+ T S+ A +  IP P SNL  LIS F   G + + +VALSGSHTIG+A 
Sbjct  141  DWNVKLGRRDAKTASRAAANNGIPPPTSNLNALISRFNALGLSTKDLVALSGSHTIGQAR  200

Query  595  CAAFRNRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQK  768
            C +FR RIYN+S++D S A   +  CP++   GD N  PLD+ TP  FDN YFKNL S++
Sbjct  201  CTSFRARIYNESNLDTSLAQTRKGNCPRASGVGDNNLAPLDLQTPTNFDNNYFKNLVSRR  260

Query  769  GL  774
            GL
Sbjct  261  GL  262



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 167/241 (69%), Gaps = 10/241 (4%)
 Frame = +1

Query  82   SSAYHLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLV  261
            +S+  L+ +FYS +CP    TIK+ V +A++S+    A+LL L F DCF+NGCDGS+LL 
Sbjct  21   ASSAQLTPNFYSSSCPTLFPTIKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLLLD  80

Query  262  NTTN--------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPS  417
            +T++        P     RG +VI  IKT +E+ C GVVSCADIL +  RD++V++GGP+
Sbjct  81   DTSSFTGEKNAIPNKGSVRGFDVIDKIKTAVEQACPGVVSCADILAVTARDSVVLLGGPT  140

Query  418  WSVSLGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHC  597
            W+V LGRRDS T S+   +  IP P S+L++LIS F+ +G +A++MVAL G+HTIG+A C
Sbjct  141  WNVKLGRRDSRTASQSGANNNIPPPTSSLSNLISKFSAQGLSAKEMVALVGAHTIGQARC  200

Query  598  AAFRNRIYNDSDIDASYAAWLRSKCPQS--GGDLNYVPLDITTPILFDNAYFKNLQSQKG  771
              FR  +YND+DIDA++A   +S CP +   GD N  PLD+ TP+ FDN YFKNL S+KG
Sbjct  201  TNFRAHVYNDTDIDATFAKTRQSNCPSTSGSGDNNLAPLDLQTPVAFDNNYFKNLVSKKG  260

Query  772  L  774
            L
Sbjct  261  L  261



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 167/237 (70%), Gaps = 10/237 (4%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             L+ +FYS +CPN LST+K+ V +AV+S P   A++L L F DCF+NGCDGS+LL +T++
Sbjct  1    QLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSS  60

Query  274  --------PMVAPPRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
                    P     RG  VI DIK+ +E+ C GVVSCADIL +A RD++V +GGP+W+V 
Sbjct  61   FTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVK  120

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            +GRRD+ T S+ A ++ IP P+ +L+ LISSF+  G + R MVALSG+HTIG++ C  FR
Sbjct  121  VGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFR  180

Query  610  NRIYNDSDIDASYAAWLRSKCPQSG--GDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
             R+YN+++I+A++A   +  CP++   GD N  PLDI +   FDN+YFKNL +Q+GL
Sbjct  181  ARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGL  237



>gb|AFK49124.1| unknown [Lotus japonicus]
Length=316

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 155/235 (66%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNTTN  273
             LS +FYS +CP  L  +   V  A+  +    A+LL LHF DCF+NGCD S+LL +T N
Sbjct  23   ELSTNFYSCSCPKLLPIVNNGVAKAIQKEARIGASLLRLHFHDCFVNGCDASILLDDTNN  82

Query  274  PMVAP--------PRGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             +            RG NVI  IK  LE+ C GVVSCAD+L LA RD++V +GGPSW V 
Sbjct  83   FIGEQTAAANNRSARGFNVIDGIKANLEKQCPGVVSCADVLALAARDSVVQLGGPSWEVG  142

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDSTT S+   +  IPGP  +L+ LI++FAN+G +   +VALSG+HTIG A C  FR
Sbjct  143  LGRRDSTTASRGTANNTIPGPFLSLSGLITNFANQGLSVTDLVALSGAHTIGLAQCKNFR  202

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
              IYNDS+IDASYA +L+SKCP+SG D    PLD  TPI FDN YFKNL  +K L
Sbjct  203  AHIYNDSNIDASYAKFLKSKCPRSGNDDLNEPLDRQTPIHFDNLYFKNLMDKKVL  257



>ref|XP_010256951.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=318

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 157/235 (67%), Gaps = 8/235 (3%)
 Frame = +1

Query  94   HLSKHFYSKTCPNALSTIKTAVHNAVNSDPGTAAALLHLHFRDCFINGCDGSVLLVNT--  267
             LS + YS TCP ALS +  AV  A+  +    A+LL LHF DCF+NGCDGS+LL +T  
Sbjct  24   KLSSNHYSSTCPEALSIVNNAVIAAIKKETRIGASLLRLHFHDCFVNGCDGSILLDDTAS  83

Query  268  -TNPMVAPP-----RGLNVIVDIKTQLEELCVGVVSCADILTLATRDAIVVIGGPSWSVS  429
             T    A P     RG +V+ DIK++LE+ C GVVSCADIL LA RD++V +GGPSW+V 
Sbjct  84   FTGEKTAVPNNNSVRGFDVVDDIKSRLEKKCPGVVSCADILALAARDSVVYLGGPSWTVE  143

Query  430  LGRRDSTTPSKDAGSTIIPGPASNLTHLISSFANKGFTARQMVALSGSHTIGKAHCAAFR  609
            LGRRDS T +  A ++ IP P SNL+ L + FA KG + + MVALSGSHTIG A C  FR
Sbjct  144  LGRRDSITANLTAANSDIPAPTSNLSVLETRFAAKGLSVKDMVALSGSHTIGLARCTTFR  203

Query  610  NRIYNDSDIDASYAAWLRSKCPQSGGDLNYVPLDITTPILFDNAYFKNLQSQKGL  774
            +RIYNDS+ID + A  L+ KCP+SG D     LD  TP  FDN Y+KNL   KGL
Sbjct  204  SRIYNDSNIDGTLAMSLQRKCPRSGNDNKLAGLDAQTPTYFDNYYYKNLLKGKGL  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1376900468608