BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16256_g1_i1 len=368 path=[1:0-367]

Length=368
                                                                      Score     E

ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like            99.0    3e-22   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like            96.3    3e-21   
gb|KHN48387.1|  Peroxidase 52                                         95.5    4e-21   
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor   95.5    6e-21   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like            94.4    1e-20   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                    94.4    2e-20   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like            94.0    2e-20   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1          94.0    2e-20   
ref|XP_004240264.1|  PREDICTED: cationic peroxidase 1-like            90.9    2e-20   
ref|XP_003602463.1|  Peroxidase                                       93.6    3e-20   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                     93.2    4e-20   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg           92.8    4e-20   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like            92.8    4e-20   
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...  92.8    5e-20   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like            92.8    5e-20   
ref|XP_010543687.1|  PREDICTED: peroxidase 52                         92.8    5e-20   
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like            92.4    6e-20   
gb|AEX20390.1|  putative class III peroxidase                         92.0    6e-20   
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like            92.4    7e-20   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                     92.0    8e-20   
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like            91.7    1e-19   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                    91.3    2e-19   
gb|ACU17608.1|  unknown                                               91.3    2e-19   Glycine max [soybeans]
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                    91.3    2e-19   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like            91.3    2e-19   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like            90.9    2e-19   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like            90.9    2e-19   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                     90.9    2e-19   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                    90.9    2e-19   
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g           90.9    2e-19   
emb|CDP13933.1|  unnamed protein product                              90.9    3e-19   
gb|AAP76387.1|  class III peroxidase                                  90.9    3e-19   Gossypium hirsutum [American cotton]
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                    90.5    3e-19   
ref|XP_002517727.1|  Cationic peroxidase 1 precursor, putative        90.1    3e-19   Ricinus communis
ref|XP_009786874.1|  PREDICTED: peroxidase P7                         90.5    3e-19   
ref|XP_003616748.1|  Peroxidase                                       90.1    4e-19   
ref|XP_006350928.1|  PREDICTED: cationic peroxidase 1-like            90.1    4e-19   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                    89.7    5e-19   
gb|KDP22793.1|  hypothetical protein JCGZ_00380                       89.7    5e-19   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g           89.7    5e-19   
gb|ADN96693.1|  peroxidase 6                                          89.7    5e-19   
gb|KHN33229.1|  Cationic peroxidase 1                                 89.4    6e-19   
dbj|BAA82306.1|  peroxidase                                           89.7    7e-19   Nicotiana tabacum [American tobacco]
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                    89.7    7e-19   
ref|XP_010032327.1|  PREDICTED: peroxidase P7-like                    89.4    7e-19   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like            89.4    8e-19   
gb|KHG18057.1|  Peroxidase 52 -like protein                           89.4    8e-19   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                    89.4    8e-19   
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like            89.4    9e-19   
ref|XP_011076613.1|  PREDICTED: peroxidase P7                         89.0    1e-18   
gb|KDP45730.1|  hypothetical protein JCGZ_17337                       88.2    1e-18   
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like            89.0    1e-18   
ref|XP_007033589.1|  Peroxidase superfamily protein                   89.0    1e-18   
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg           89.0    1e-18   
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1              88.6    1e-18   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                     88.6    2e-18   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350            88.6    2e-18   
ref|NP_001106040.1|  peroxidase 70 precursor                          88.2    2e-18   Zea mays [maize]
gb|AFR44628.1|  class III secretory peroxidase                        88.2    2e-18   
gb|ACJ11762.1|  class III peroxidase                                  88.2    2e-18   Gossypium hirsutum [American cotton]
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1      88.2    2e-18   Vitis vinifera
ref|XP_010066439.1|  PREDICTED: cationic peroxidase 1-like            88.2    2e-18   
gb|AAP42508.1|  anionic peroxidase swpb3                              88.2    2e-18   Ipomoea batatas [batate]
gb|KHG25850.1|  Peroxidase 4                                          88.2    2e-18   
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g           87.8    3e-18   
gb|KEH34417.1|  cationic peroxidase                                   87.8    3e-18   
ref|XP_010685964.1|  PREDICTED: peroxidase 4-like                     87.8    3e-18   
gb|KDO63401.1|  hypothetical protein CISIN_1g020966mg                 87.8    3e-18   
ref|XP_007011229.1|  Peroxidase superfamily protein                   87.8    3e-18   
ref|XP_009371986.1|  PREDICTED: cationic peroxidase 1-like isofor...  87.8    3e-18   
ref|XP_009371985.1|  PREDICTED: cationic peroxidase 1-like isofor...  87.8    3e-18   
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like            87.4    3e-18   
gb|KHN29529.1|  Cationic peroxidase 1                                 87.4    3e-18   
gb|ABR23054.1|  basic peroxidase swpb4                                87.4    4e-18   Ipomoea batatas [batate]
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like            87.4    4e-18   
ref|XP_006662662.1|  PREDICTED: peroxidase 4-like                     87.4    4e-18   
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                     87.4    4e-18   
gb|KHN40655.1|  Cationic peroxidase 1                                 87.4    4e-18   
emb|CDX80957.1|  BnaC03g02110D                                        87.4    4e-18   
dbj|BAJ91992.1|  predicted protein                                    87.4    4e-18   
ref|XP_011003587.1|  PREDICTED: cationic peroxidase 1-like            87.0    4e-18   
ref|XP_002323054.1|  hypothetical protein POPTR_0016s14030g           87.0    5e-18   Populus trichocarpa [western balsam poplar]
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                 87.0    5e-18   
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like            87.4    5e-18   
ref|XP_009773428.1|  PREDICTED: peroxidase 4-like                     85.9    5e-18   
ref|NP_001065568.2|  Os11g0112400                                     84.7    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008356153.1|  PREDICTED: cationic peroxidase 1-like            84.3    5e-18   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like            87.0    6e-18   
ref|XP_010066382.1|  PREDICTED: cationic peroxidase 1-like            84.3    6e-18   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                       87.0    6e-18   
emb|CAD67479.1|  peroxidase                                           86.7    6e-18   Asparagus officinalis
ref|XP_006378807.1|  hypothetical protein POPTR_0010s24330g           86.7    7e-18   
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like            86.7    7e-18   
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                     86.7    7e-18   
ref|XP_004502855.1|  PREDICTED: peroxidase 52-like                    86.7    7e-18   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                     86.7    8e-18   
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                     86.7    8e-18   
ref|XP_009776128.1|  PREDICTED: peroxidase 4-like                     85.5    8e-18   
dbj|BAA77389.1|  peroxidase 3                                         86.3    9e-18   Scutellaria baicalensis [Baikal skullcap]
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                     86.3    9e-18   
ref|XP_010093550.1|  Cationic peroxidase 1                            86.3    1e-17   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444           86.3    1e-17   
gb|ABR17414.1|  unknown                                               82.8    1e-17   Picea sitchensis
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7    86.3    1e-17   
ref|XP_010925617.1|  PREDICTED: peroxidase P7-like                    85.9    1e-17   
ref|XP_010264471.1|  PREDICTED: cationic peroxidase 1-like            85.9    1e-17   
ref|XP_004305595.1|  PREDICTED: lignin-forming anionic peroxidase...  85.9    1e-17   
ref|XP_006468993.1|  PREDICTED: peroxidase 52-like                    85.9    1e-17   
gb|KHN29528.1|  Cationic peroxidase 1                                 85.5    1e-17   
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg              85.9    1e-17   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                    85.9    1e-17   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like            85.9    1e-17   
gb|ABV24960.2|  putative secretory peroxidase                         85.9    1e-17   Catharanthus roseus [chatas]
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                     85.9    2e-17   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                    85.9    2e-17   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                         85.9    2e-17   
ref|XP_007208188.1|  hypothetical protein PRUPE_ppa020902mg           85.9    2e-17   
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7    85.5    2e-17   
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor   85.5    2e-17   
ref|XP_006842425.1|  hypothetical protein AMTR_s00077p00020210        84.3    2e-17   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                    85.5    2e-17   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                     85.5    2e-17   
gb|ACT35473.1|  peroxidase 52                                         85.1    2e-17   Brassica rapa
ref|XP_004983933.1|  PREDICTED: peroxidase 70-like                    85.5    2e-17   
gb|AHL39166.1|  class III peroxidase                                  85.1    2e-17   
ref|XP_003602462.1|  Peroxidase                                       85.1    2e-17   
ref|XP_008369411.1|  PREDICTED: peroxidase P7-like                    85.1    2e-17   
emb|CDX70158.1|  BnaA10g25070D                                        85.1    2e-17   
gb|KHN40654.1|  Cationic peroxidase 1                                 84.7    2e-17   
gb|ABR18139.1|  unknown                                               85.1    2e-17   Picea sitchensis
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor              85.1    3e-17   
gb|EPS67183.1|  peroxidase                                            82.8    3e-17   
gb|AEX12221.1|  hypothetical protein 0_7393_01                        82.4    3e-17   
gb|AEX12217.1|  hypothetical protein 0_7393_01                        82.4    3e-17   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like            85.1    3e-17   
ref|XP_007048724.1|  Peroxidase superfamily protein                   85.1    3e-17   
ref|NP_001065971.1|  Os12g0112000                                     85.1    3e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79693.1|  hypothetical protein OsI_34840                        85.1    3e-17   Oryza sativa Indica Group [Indian rice]
gb|KHG17773.1|  Peroxidase 52 -like protein                           85.1    3e-17   
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like            84.7    3e-17   
emb|CAA62597.1|  korean-radish isoperoxidase                          84.7    3e-17   Raphanus sativus
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like            84.7    3e-17   
gb|AAX53172.1|  peroxidase                                            84.7    3e-17   Populus alba x Populus glandulosa
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor      84.7    3e-17   Gossypium hirsutum [American cotton]
ref|XP_003557955.1|  PREDICTED: peroxidase P7-like                    84.7    3e-17   
gb|KHN08839.1|  Cationic peroxidase 1                                 84.3    3e-17   
dbj|BAJ97638.1|  predicted protein                                    84.7    3e-17   
gb|EPS73958.1|  peroxidase 3                                          84.7    4e-17   
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like            84.7    4e-17   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                    84.7    4e-17   
gb|AFG67580.1|  hypothetical protein 0_12973_01                       82.0    4e-17   
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                    84.7    4e-17   
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like            84.3    4e-17   
emb|CAH10839.1|  peroxidase                                           84.7    4e-17   Picea abies
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like            84.7    4e-17   
emb|CAH10841.1|  peroxidase                                           84.3    4e-17   Picea abies
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010        84.7    4e-17   Sorghum bicolor [broomcorn]
ref|XP_004958164.1|  PREDICTED: peroxidase 70-like                    84.7    4e-17   
gb|ABK21858.1|  unknown                                               84.7    4e-17   Picea sitchensis
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                     84.7    4e-17   
ref|XP_003623567.1|  Peroxidase                                       84.3    4e-17   
ref|NP_196153.1|  peroxidase 52                                       84.3    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004243276.1|  PREDICTED: peroxidase P7-like                    84.3    5e-17   
ref|XP_006470943.1|  PREDICTED: lignin-forming anionic peroxidase...  84.3    5e-17   
emb|CDX98835.1|  BnaC09g50000D                                        84.3    5e-17   
gb|KHG09190.1|  Peroxidase 4                                          84.3    5e-17   
ref|XP_009419858.1|  PREDICTED: cationic peroxidase 1-like            84.3    5e-17   
ref|XP_006470944.1|  PREDICTED: lignin-forming anionic peroxidase...  84.3    5e-17   
emb|CAH10842.1|  peroxidase                                           84.3    5e-17   Picea abies
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                    84.3    5e-17   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like            84.0    6e-17   
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...  84.0    6e-17   Brassica rapa subsp. rapa
ref|XP_008228933.1|  PREDICTED: peroxidase P7-like                    84.0    6e-17   
ref|XP_007215699.1|  hypothetical protein PRUPE_ppa008808mg           84.0    6e-17   
gb|EMT04397.1|  Peroxidase 4                                          82.4    6e-17   
ref|XP_010915492.1|  PREDICTED: peroxidase P7-like                    84.0    7e-17   
ref|XP_009777403.1|  PREDICTED: peroxidase-like                       82.4    7e-17   
gb|EMT00634.1|  Peroxidase 4                                          82.4    7e-17   
ref|XP_009125598.1|  PREDICTED: peroxidase P7                         84.0    7e-17   
emb|CDY04948.1|  BnaAnng01300D                                        84.0    7e-17   
emb|CDY14118.1|  BnaC02g02350D                                        84.0    7e-17   
ref|XP_008457311.1|  PREDICTED: cationic peroxidase 1-like            84.0    7e-17   
gb|EMS48893.1|  Peroxidase 52                                         84.0    7e-17   
ref|XP_011070600.1|  PREDICTED: lignin-forming anionic peroxidase...  83.6    7e-17   
gb|AFK46186.1|  unknown                                               84.0    7e-17   
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg              83.6    8e-17   
ref|XP_002451848.1|  hypothetical protein SORBIDRAFT_04g008620        83.6    8e-17   Sorghum bicolor [broomcorn]
gb|KDP25490.1|  hypothetical protein JCGZ_20646                       83.6    8e-17   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like            83.6    8e-17   
gb|ACM47317.1|  peroxidase                                            83.6    8e-17   Capsicum annuum
ref|XP_010915491.1|  PREDICTED: peroxidase P7-like                    83.6    8e-17   
ref|XP_010689732.1|  PREDICTED: peroxidase P7-like                    83.6    9e-17   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg              83.6    9e-17   
dbj|BAM28608.1|  putative peroxidase                                  83.6    9e-17   
gb|AEX12219.1|  hypothetical protein 0_7393_01                        80.9    1e-16   
gb|AFG67570.1|  hypothetical protein 0_12973_01                       80.9    1e-16   
emb|CAH10840.1|  peroxidase                                           83.6    1e-16   Picea abies
gb|AFG67576.1|  hypothetical protein 0_12973_01                       80.9    1e-16   
gb|AFG67567.1|  hypothetical protein 0_12973_01                       80.9    1e-16   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like            83.6    1e-16   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                    83.2    1e-16   
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                    83.2    1e-16   
gb|AEW07847.1|  hypothetical protein 0_12973_01                       80.5    1e-16   
ref|XP_002320417.1|  peroxidase family protein                        83.2    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                    83.2    1e-16   
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                    83.2    1e-16   
gb|AFG67571.1|  hypothetical protein 0_12973_01                       80.5    1e-16   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                         83.2    1e-16   Vitis vinifera
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                    83.2    1e-16   
ref|XP_003522126.2|  PREDICTED: cationic peroxidase 1                 82.8    1e-16   
gb|ABK59095.1|  peroxidase 1                                          83.2    1e-16   Sesbania rostrata
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010        83.2    1e-16   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                    84.7    1e-16   
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                     83.2    1e-16   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                     83.2    1e-16   
gb|AEX12220.1|  hypothetical protein 0_7393_01                        80.5    2e-16   
gb|KGN45822.1|  hypothetical protein Csa_6G013940                     82.8    2e-16   
ref|XP_010915489.1|  PREDICTED: peroxidase P7-like                    82.8    2e-16   
gb|KHN44724.1|  Peroxidase 4                                          82.8    2e-16   
ref|XP_010915490.1|  PREDICTED: peroxidase P7-like                    82.8    2e-16   
ref|XP_004298191.1|  PREDICTED: lignin-forming anionic peroxidase...  82.8    2e-16   
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                    82.8    2e-16   
ref|XP_004510041.1|  PREDICTED: peroxidase 52-like                    82.8    2e-16   
ref|XP_002441702.1|  hypothetical protein SORBIDRAFT_08g000980        80.5    2e-16   Sorghum bicolor [broomcorn]
gb|AII99880.1|  peroxidase                                            82.8    2e-16   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like            82.8    2e-16   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                          82.8    2e-16   Vitis vinifera
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                    82.8    2e-16   
ref|XP_008780505.1|  PREDICTED: peroxidase P7-like                    82.4    2e-16   
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                     82.8    2e-16   
ref|XP_009365290.1|  PREDICTED: peroxidase P7-like                    82.8    2e-16   
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like            82.8    2e-16   
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...  82.4    2e-16   
ref|XP_004297785.1|  PREDICTED: lignin-forming anionic peroxidase...  82.4    2e-16   
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                    82.4    2e-16   
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like            82.4    2e-16   
ref|XP_006348978.1|  PREDICTED: peroxidase 52-like                    82.4    2e-16   
gb|KDO41520.1|  hypothetical protein CISIN_1g020615mg                 82.4    2e-16   
ref|XP_002438530.1|  hypothetical protein SORBIDRAFT_10g021630        82.4    2e-16   Sorghum bicolor [broomcorn]
gb|KDO57833.1|  hypothetical protein CISIN_1g024722mg                 82.0    2e-16   
gb|EPS63041.1|  hypothetical protein M569_11749                       82.4    2e-16   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                     82.4    3e-16   
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                     82.4    3e-16   
ref|XP_003522012.2|  PREDICTED: cationic peroxidase 1-like            83.2    3e-16   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000        82.0    3e-16   
dbj|BAM28609.1|  putative peroxidase                                  82.0    3e-16   
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like            82.0    3e-16   
gb|AFG61207.1|  hypothetical protein 0_13032_02                       79.7    3e-16   
ref|XP_004978383.1|  PREDICTED: peroxidase 4-like                     81.6    4e-16   
gb|AFG61206.1|  hypothetical protein 0_13032_02                       79.7    4e-16   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                       82.0    4e-16   
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like            81.6    4e-16   
ref|XP_006856997.1|  hypothetical protein AMTR_s00711p00011340        80.5    4e-16   
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like            81.6    4e-16   
emb|CAL25300.1|  properoxidase                                        81.6    4e-16   Picea abies
ref|XP_008381199.1|  PREDICTED: peroxidase P7-like                    82.4    4e-16   
gb|KDP21683.1|  hypothetical protein JCGZ_03354                       81.6    4e-16   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                    81.6    4e-16   
dbj|BAM28607.1|  putative peroxidase                                  81.6    4e-16   
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                     82.0    4e-16   
ref|XP_009410539.1|  PREDICTED: cationic peroxidase 1-like            81.6    4e-16   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210        81.6    4e-16   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                          81.6    5e-16   Vitis vinifera
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                    81.6    5e-16   
ref|XP_003577842.1|  PREDICTED: peroxidase 4                          81.6    5e-16   
gb|AAA96137.1|  peroxidase                                            79.3    5e-16   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_011024237.1|  PREDICTED: lignin-forming anionic peroxidase...  81.6    5e-16   
gb|KEH29221.1|  peroxidase family protein                             81.6    5e-16   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg              81.3    5e-16   
ref|XP_002460939.1|  hypothetical protein SORBIDRAFT_02g037840        81.6    5e-16   Sorghum bicolor [broomcorn]
ref|XP_010270786.1|  PREDICTED: lignin-forming anionic peroxidase...  81.3    5e-16   
ref|XP_010270787.1|  PREDICTED: lignin-forming anionic peroxidase...  81.3    5e-16   
ref|XP_002489046.1|  hypothetical protein SORBIDRAFT_0246s002010      81.3    5e-16   Sorghum bicolor [broomcorn]
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                     81.6    5e-16   
gb|AAB48184.1|  peroxidase precursor                                  81.6    5e-16   Linum usitatissimum
ref|XP_004958685.1|  PREDICTED: peroxidase 66-like                    81.3    5e-16   
gb|ACO90366.1|  peroxidase precursor                                  80.1    5e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003579029.2|  PREDICTED: peroxidase 4-like                     81.3    6e-16   
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                  81.6    6e-16   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                     81.3    6e-16   
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                     81.3    6e-16   
ref|XP_002319968.2|  peroxidase family protein                        81.3    6e-16   
ref|NP_001151940.1|  peroxidase 52 precursor                          81.3    6e-16   
gb|AAL93151.1|AF485265_1  class III peroxidase                        81.3    6e-16   
ref|XP_003596720.1|  Peroxidase                                       81.3    6e-16   
gb|ABO77632.1|  peroxidase                                            81.3    6e-16   
ref|XP_009775408.1|  PREDICTED: cationic peroxidase 1-like            80.9    7e-16   
ref|XP_003602461.1|  Peroxidase                                       81.3    7e-16   
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like            81.3    7e-16   
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                 81.3    7e-16   
ref|XP_010261060.1|  PREDICTED: cationic peroxidase 1-like isofor...  80.9    7e-16   
ref|NP_001106020.1|  peroxidase 66 precursor                          80.9    8e-16   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                     80.9    8e-16   
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg           80.9    8e-16   
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                    80.9    8e-16   
ref|XP_010270789.1|  PREDICTED: lignin-forming anionic peroxidase...  80.9    8e-16   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g           80.9    8e-16   
ref|XP_011080818.1|  PREDICTED: uncharacterized protein LOC105163979  83.2    9e-16   
gb|AAQ55292.1|  class III peroxidase GvPx2b                           80.5    9e-16   
gb|EMT01627.1|  Peroxidase 52                                         80.9    9e-16   
ref|XP_002281731.1|  PREDICTED: peroxidase P7                         80.9    9e-16   
ref|XP_010261059.1|  PREDICTED: cationic peroxidase 1-like isofor...  80.9    9e-16   
gb|EMT13502.1|  Peroxidase 70                                         80.9    9e-16   
ref|XP_003596719.1|  Peroxidase                                       80.9    9e-16   
ref|XP_008385017.1|  PREDICTED: cationic peroxidase 1-like            80.9    9e-16   
ref|XP_008668608.1|  PREDICTED: uncharacterized protein LOC541674...  80.9    9e-16   
ref|XP_006470886.1|  PREDICTED: lignin-forming anionic peroxidase...  80.9    9e-16   
emb|CAN81400.1|  hypothetical protein VITISV_038539                   80.9    9e-16   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810        80.9    9e-16   
ref|XP_009595396.1|  PREDICTED: lignin-forming anionic peroxidase...  78.6    9e-16   
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...  80.9    1e-15   
gb|EMT02760.1|  Peroxidase 4                                          80.5    1e-15   
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...  80.9    1e-15   
ref|XP_007017041.1|  Translocon at the inner envelope membrane of...  83.6    1e-15   
gb|AFK43134.1|  unknown                                               80.5    1e-15   
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                    80.5    1e-15   
ref|XP_003577141.1|  PREDICTED: peroxidase 4-like                     80.5    1e-15   
ref|XP_003571907.1|  PREDICTED: peroxidase P7-like                    80.5    1e-15   
ref|XP_006365361.1|  PREDICTED: peroxidase 2-like                     79.7    1e-15   
gb|ADN96692.1|  peroxidase 5                                          80.5    1e-15   
gb|ABK23423.1|  unknown                                               80.5    1e-15   
ref|XP_003615995.1|  Peroxidase                                       80.5    1e-15   
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                    80.1    1e-15   
gb|ACZ51443.1|  peroxidase protein                                    80.5    1e-15   
ref|XP_002467656.1|  hypothetical protein SORBIDRAFT_01g031740        80.5    1e-15   
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000        80.5    1e-15   
gb|ACU23245.1|  unknown                                               80.5    1e-15   
ref|XP_010030093.1|  PREDICTED: lignin-forming anionic peroxidase...  80.1    1e-15   
ref|XP_007146855.1|  hypothetical protein PHAVU_006G075800g           80.1    1e-15   
ref|XP_006365362.1|  PREDICTED: peroxidase 70-like                    79.7    1e-15   
gb|AAR31106.1|  peroxidase precursor                                  80.1    1e-15   
ref|XP_009605441.1|  PREDICTED: lignin-forming anionic peroxidase...  79.3    2e-15   
ref|XP_007219390.1|  hypothetical protein PRUPE_ppa020254mg           80.1    2e-15   
ref|XP_009775853.1|  PREDICTED: cationic peroxidase 1-like            79.7    2e-15   
ref|XP_010689717.1|  PREDICTED: peroxidase P7-like                    80.1    2e-15   
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...  80.1    2e-15   
ref|XP_010067588.1|  PREDICTED: peroxidase 4-like                     80.1    2e-15   
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg              80.1    2e-15   
ref|XP_002441703.1|  hypothetical protein SORBIDRAFT_08g000990        80.1    2e-15   
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg              80.1    2e-15   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g           80.1    2e-15   
ref|XP_006351920.1|  PREDICTED: lignin-forming anionic peroxidase...  80.1    2e-15   
ref|XP_002319407.1|  peroxidase family protein                        79.7    2e-15   
ref|NP_001169614.1|  uncharacterized protein LOC100383495 precursor   80.1    2e-15   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                    79.7    2e-15   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                         79.7    2e-15   
emb|CAN63655.1|  hypothetical protein VITISV_018391                   79.3    2e-15   
gb|AFG61205.1|  hypothetical protein 0_13032_02                       77.8    2e-15   
gb|AAW52720.1|  peroxidase 6                                          79.7    2e-15   
ref|XP_008220986.1|  PREDICTED: lignin-forming anionic peroxidase...  79.7    2e-15   
ref|XP_004249044.1|  PREDICTED: peroxidase 2-like                     79.7    2e-15   
gb|AFG67569.1|  hypothetical protein 0_12973_01                       77.4    2e-15   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g           79.7    2e-15   
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g           79.7    2e-15   
gb|AHL39176.1|  class III peroxidase                                  79.7    2e-15   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g           79.7    2e-15   
dbj|BAJ92357.1|  predicted protein                                    79.7    2e-15   
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                    79.7    2e-15   
ref|XP_008790008.1|  PREDICTED: peroxidase P7-like                    79.7    2e-15   
dbj|BAM05634.1|  peroxidase 2                                         79.7    2e-15   
gb|EMT19349.1|  Peroxidase 70                                         79.7    2e-15   
dbj|BAK03433.1|  predicted protein                                    79.7    2e-15   
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                    79.7    2e-15   
ref|XP_010087174.1|  Cationic peroxidase 1                            79.3    2e-15   
dbj|BAM05635.1|  peroxidase 2                                         79.7    2e-15   
ref|XP_010915493.1|  PREDICTED: peroxidase P7-like                    79.7    2e-15   
ref|XP_007226601.1|  hypothetical protein PRUPE_ppa023604mg           79.3    3e-15   
emb|CBI18066.3|  unnamed protein product                              79.0    3e-15   
gb|ABC60340.1|  putative peroxidase                                   75.9    3e-15   
gb|EMS50651.1|  Peroxidase 70                                         79.7    3e-15   
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like            79.3    3e-15   
ref|XP_009775854.1|  PREDICTED: peroxidase 2-like                     79.3    3e-15   
gb|EYU30097.1|  hypothetical protein MIMGU_mgv1a010056mg              79.3    3e-15   
ref|XP_010087166.1|  Peroxidase 4                                     79.3    3e-15   
gb|KHN31328.1|  Peroxidase 4                                          77.0    3e-15   
gb|KDP22789.1|  hypothetical protein JCGZ_00376                       79.3    3e-15   
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...  79.3    3e-15   
ref|XP_002521867.1|  Lignin-forming anionic peroxidase precursor,...  79.3    3e-15   
ref|XP_004490701.1|  PREDICTED: peroxidase 4-like                     79.3    3e-15   
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like            79.0    4e-15   
ref|XP_004249054.1|  PREDICTED: peroxidase 70-like                    79.0    4e-15   
ref|XP_006842422.1|  hypothetical protein AMTR_s00077p00016660        77.8    4e-15   
ref|XP_010067589.1|  PREDICTED: peroxidase P7-like isoform X1         79.3    4e-15   
tpe|CAH69282.1|  TPA: class III peroxidase 40 precursor               79.0    4e-15   
ref|XP_010067590.1|  PREDICTED: peroxidase P7-like isoform X2         79.0    4e-15   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                79.0    4e-15   
gb|EEC75221.1|  hypothetical protein OsI_11488                        79.0    4e-15   
ref|XP_009620122.1|  PREDICTED: lignin-forming anionic peroxidase...  79.0    4e-15   
gb|ABF95843.1|  Peroxidase 52 precursor, putative, expressed          79.0    4e-15   
gb|ABR13314.1|  putative peroxidase class III                         75.9    4e-15   
emb|CDP08160.1|  unnamed protein product                              79.0    4e-15   
ref|XP_007131639.1|  hypothetical protein PHAVU_011G030100g           79.0    4e-15   
gb|EPS59568.1|  hypothetical protein M569_15235                       79.0    4e-15   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like            79.0    4e-15   
ref|XP_004492537.1|  PREDICTED: cationic peroxidase 1-like            79.0    5e-15   
ref|XP_008350978.1|  PREDICTED: LOW QUALITY PROTEIN: lignin-formi...  78.2    5e-15   
gb|EMS66985.1|  Peroxidase 4                                          79.0    5e-15   
emb|CAN61440.1|  hypothetical protein VITISV_022439                   78.2    5e-15   
ref|XP_010067586.1|  PREDICTED: peroxidase 4-like                     78.6    5e-15   
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                    78.6    5e-15   
emb|CBI15847.3|  unnamed protein product                              78.2    5e-15   
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                     78.6    6e-15   
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                     78.6    6e-15   
gb|EMT19218.1|  Peroxidase 70                                         78.2    6e-15   
emb|CAA71491.1|  peroxidase                                           78.6    6e-15   
emb|CAD67478.1|  peroxidase                                           78.2    6e-15   
gb|AHD24479.1|  class III peroxidase 191                              78.6    6e-15   
gb|ACN33662.1|  unknown                                               78.6    6e-15   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like            78.6    6e-15   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like            78.2    6e-15   
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor   78.6    6e-15   
ref|XP_004984445.1|  PREDICTED: peroxidase 52-like                    78.6    7e-15   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like            79.0    7e-15   
gb|KHN33941.1|  Peroxidase 52                                         77.8    7e-15   
ref|XP_007045348.1|  Lignin-forming anionic peroxidase                78.6    7e-15   
ref|XP_010067587.1|  PREDICTED: peroxidase 4-like                     78.2    7e-15   
dbj|BAM05637.1|  peroxidase 2                                         78.6    7e-15   
gb|ABK25962.1|  unknown                                               78.2    7e-15   
gb|KEH29223.1|  class III peroxidase                                  78.6    7e-15   
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                     78.2    7e-15   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like            78.2    7e-15   
ref|NP_001130666.1|  uncharacterized protein LOC100191769 precursor   78.2    7e-15   
ref|NP_001147443.1|  peroxidase 52 precursor                          78.6    8e-15   
gb|KEH38859.1|  lignin biosynthetic peroxidase                        78.2    8e-15   
ref|XP_006351919.1|  PREDICTED: lignin-forming anionic peroxidase...  78.2    8e-15   
ref|XP_004250402.1|  PREDICTED: lignin-forming anionic peroxidase     78.2    8e-15   
gb|AAR31108.1|  peroxidase precursor                                  78.2    8e-15   
ref|XP_003596715.1|  Peroxidase                                       78.2    8e-15   
gb|ABF48527.1|  cell wall peroxidase                                  78.2    8e-15   
sp|P16147.2|PERX_LUPPO  RecName: Full=Peroxidase                      76.6    8e-15   
ref|NP_001167809.1|  hypothetical protein precursor                   78.2    8e-15   
gb|EPS67864.1|  hypothetical protein M569_06908                       78.2    8e-15   
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030        78.2    8e-15   
ref|XP_010104414.1|  Peroxidase 52                                    78.2    8e-15   
ref|XP_006365356.1|  PREDICTED: cationic peroxidase 1-like            78.2    8e-15   
ref|XP_009801852.1|  PREDICTED: lignin-forming anionic peroxidase...  78.2    8e-15   
ref|XP_008350979.1|  PREDICTED: lignin-forming anionic peroxidase...  78.2    8e-15   
ref|XP_002531320.1|  Cationic peroxidase 1 precursor, putative        78.2    8e-15   
ref|XP_006365357.1|  PREDICTED: cationic peroxidase 1-like            78.2    9e-15   
ref|XP_006361366.1|  PREDICTED: lignin-forming anionic peroxidase...  78.2    9e-15   
ref|XP_004253400.1|  PREDICTED: peroxidase 70-like                    78.2    9e-15   
ref|XP_007045351.1|  Lignin-forming anionic peroxidase                78.2    9e-15   
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                    78.2    9e-15   
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                    78.2    9e-15   
gb|AAO13838.1|AF405326_1  peroxidase 2                                77.4    9e-15   
emb|CAN83972.1|  hypothetical protein VITISV_034708                   77.8    9e-15   
ref|NP_001050434.2|  Os03g0434500                                     76.6    9e-15   
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                     78.2    1e-14   
gb|ACN30737.1|  unknown                                               77.4    1e-14   
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like            77.8    1e-14   
ref|XP_006365360.1|  PREDICTED: peroxidase 70-like                    77.8    1e-14   
gb|ACF08094.1|  class III peroxidase                                  77.8    1e-14   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...  78.6    1e-14   
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg           77.8    1e-14   
gb|EMS57730.1|  Peroxidase 4                                          77.8    1e-14   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like            77.8    1e-14   
ref|XP_006367398.1|  PREDICTED: peroxidase 4-like                     77.8    1e-14   
gb|ACN42168.1|  peroxidase 1                                          77.8    1e-14   
ref|XP_003519284.1|  PREDICTED: peroxidase 4                          77.8    1e-14   
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                  77.8    1e-14   
gb|AFW76355.1|  hypothetical protein ZEAMMB73_514205                  77.4    1e-14   
gb|KDP25488.1|  hypothetical protein JCGZ_20644                       77.8    1e-14   
gb|KHN46100.1|  Cationic peroxidase 1                                 77.4    1e-14   
tpe|CAH69351.1|  TPA: class III peroxidase 109 precursor              77.8    1e-14   
dbj|BAC83101.1|  putative peroxidase precursor                        77.8    1e-14   
gb|EEC82680.1|  hypothetical protein OsI_27324                        77.8    1e-14   
ref|XP_007045349.1|  Lignin-forming anionic peroxidase                77.8    1e-14   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2      77.4    1e-14   
emb|CDP15947.1|  unnamed protein product                              77.0    1e-14   
gb|KEH29222.1|  peroxidase family protein                             77.8    1e-14   
ref|XP_009610471.1|  PREDICTED: cationic peroxidase 1-like            77.4    1e-14   
emb|CBI19219.3|  unnamed protein product                              79.0    1e-14   
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3      77.4    1e-14   
gb|EMT04570.1|  Peroxidase 52                                         77.4    1e-14   
emb|CBI27506.3|  unnamed protein product                              77.0    1e-14   
ref|XP_002461207.1|  hypothetical protein SORBIDRAFT_02g042840        77.4    1e-14   
ref|XP_009381205.1|  PREDICTED: peroxidase P7-like                    77.4    2e-14   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like            78.2    2e-14   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                77.0    2e-14   
ref|NP_001060626.1|  Os07g0676900                                     77.4    2e-14   
gb|AAX44001.2|  putative secretory peroxidase                         77.4    2e-14   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                     77.4    2e-14   
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                     77.8    2e-14   
ref|XP_004149367.1|  PREDICTED: peroxidase 4-like                     77.4    2e-14   
ref|XP_010064225.1|  PREDICTED: cationic peroxidase 1-like            77.4    2e-14   
gb|ACF08095.1|  class III peroxidase                                  77.4    2e-14   
ref|NP_001140437.1|  uncharacterized protein LOC100272496             76.6    2e-14   
dbj|BAK06463.1|  predicted protein                                    77.0    2e-14   
ref|XP_010227239.1|  PREDICTED: peroxidase P7-like                    77.4    2e-14   
ref|XP_006657042.1|  PREDICTED: peroxidase P7-like                    77.0    2e-14   
gb|KGN65858.1|  hypothetical protein Csa_1G533650                     77.0    2e-14   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                     77.0    2e-14   
ref|XP_004145303.1|  PREDICTED: cationic peroxidase 1-like            77.0    2e-14   
emb|CBI22007.3|  unnamed protein product                              78.2    2e-14   
ref|XP_007033588.1|  Peroxidase superfamily protein                   77.4    2e-14   
ref|XP_010527854.1|  PREDICTED: peroxidase 5-like                     77.0    2e-14   
ref|XP_008463816.1|  PREDICTED: peroxidase P7-like                    77.0    2e-14   
ref|NP_001057822.1|  Os06g0547400                                     77.0    2e-14   
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                    77.0    2e-14   
ref|XP_008234083.1|  PREDICTED: peroxidase P7-like                    76.6    2e-14   



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQQL S G TN+ V  Y+S+P  F+ DFA+AMVKM  LSPLTGTNG+IR 
Sbjct  252  LVSQKGLLHSDQQLFSGGSTNAQVNAYVSNPGTFSTDFAKAMVKMGNLSPLTGTNGQIRT  311

Query  187  DCRRMN  170
            DC+++N
Sbjct  312  DCKKVN  317



>ref|XP_009373126.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=324

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQQL S G T+S V  Y+S+P+ F  DFA AM+KM  LSPLTGTNG+IR 
Sbjct  259  LVSQKGLLHSDQQLFSGGSTDSQVNAYVSNPATFRTDFANAMIKMGNLSPLTGTNGQIRT  318

Query  187  DCRRMN  170
            +CR++N
Sbjct  319  NCRKVN  324



>gb|KHN48387.1| Peroxidase 52 [Glycine soja]
Length=265

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G T+SIV+ Y ++PS F++DFA AM+KM ++SPLTG+NGEIR+
Sbjct  200  LVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRK  259

Query  187  DCRRMN  170
            +CRR+N
Sbjct  260  NCRRIN  265



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G T+SIV+ Y ++PS F++DFA AM+KM ++SPLTG+NGEIR+
Sbjct  255  LVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRK  314

Query  187  DCRRMN  170
            +CRR+N
Sbjct  315  NCRRIN  320



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKG+LHSDQQL + G T+SIV  Y S+ + F  DFA AMVKM  LSPLTGTNG+IR+
Sbjct  249  LQSQKGILHSDQQLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRK  308

Query  187  DCRRMN  170
            +CR++N
Sbjct  309  NCRKIN  314



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQQL S G TNS+V+ Y S+PS+F  DF  AM+KM ++ PLTG+NGE+R+
Sbjct  257  LVSQKGLLHSDQQLFSGGSTNSLVQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGEVRK  316

Query  187  DCRRMN  170
            +CR+ N
Sbjct  317  NCRKTN  322



>ref|XP_008370240.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=324

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQ GLLHSDQQL S G T+S V  Y+S+P+ F  DFA AM+KM  LSPLTGTNG+IR 
Sbjct  259  LVSQXGLLHSDQQLFSGGSTDSQVNAYVSNPATFRTDFANAMIKMGNLSPLTGTNGQIRT  318

Query  187  DCRRMN  170
            +CR++N
Sbjct  319  NCRKVN  324



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G T+SIV+ Y ++P  F++DFA AM+KM ++SPLTG+NGEIR+
Sbjct  255  LVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGEIRK  314

Query  187  DCRRMN  170
            +CRR+N
Sbjct  315  NCRRIN  320



>ref|XP_004240264.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=133

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ QKGLLHSDQQL S G T+SIV  Y S+ + F  DFA AMVKM  LSPLTGTNG+IR+
Sbjct  68   LRIQKGLLHSDQQLSSGGSTDSIVNTYSSNSATFFTDFANAMVKMGNLSPLTGTNGQIRK  127

Query  187  DCRRMN  170
            +CR+ N
Sbjct  128  NCRKTN  133



>ref|XP_003602463.1| Peroxidase [Medicago truncatula]
 gb|AES72714.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL + G TNSIV  Y ++PS F++DFA AM+KM ++SPLTG+NGEIR+
Sbjct  257  LVQNKGLLHSDQQLFNGGSTNSIVSGYSTNPSSFSSDFATAMIKMGDISPLTGSNGEIRK  316

Query  187  DCRRMN  170
            +CR+ N
Sbjct  317  NCRKPN  322



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL + G T+S V+ Y ++PS F +DFA AM+KM ++SPLTG+NGEIR+
Sbjct  256  LINQKGLLHSDQQLFNGGSTDSQVRTYSNNPSTFNSDFAAAMIKMGDISPLTGSNGEIRK  315

Query  187  DCRRMN  170
            +CRR+N
Sbjct  316  NCRRVN  321



>ref|XP_007205557.1| hypothetical protein PRUPE_ppa008642mg [Prunus persica]
 gb|EMJ06756.1| hypothetical protein PRUPE_ppa008642mg [Prunus persica]
Length=324

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQQL S G TN+IV  YIS+   F  DFA AM KM  LSPLTGTNG+IR 
Sbjct  259  LVSQKGLLHSDQQLYSGGSTNTIVDAYISNTGTFRADFANAMKKMGNLSPLTGTNGQIRT  318

Query  187  DCRRMN  170
            +CR++N
Sbjct  319  NCRKIN  324



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKG+LHSDQQL + G T+SIV  Y S+ + F  DFA AMVKM  LSPLTGTNG+IR+
Sbjct  249  LQSQKGILHSDQQLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRK  308

Query  187  DCRRMN  170
            +CR+ N
Sbjct  309  NCRKNN  314



>ref|XP_009403860.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L + KGLLHSDQQL S+G T+S+VK Y + PSKFA+DFA AM+KM ++SPLTG+ GEIR 
Sbjct  251  LVNLKGLLHSDQQLFSNGSTDSLVKTYSASPSKFASDFAAAMIKMGDISPLTGSQGEIRN  310

Query  187  DCRRMN  170
            +CR +N
Sbjct  311  NCRMVN  316



>ref|XP_008245160.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=324

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQQL S G TN+IV  YIS+   F  DFA AM KM  LSPLTGTNG+IR 
Sbjct  259  LVSQKGLLHSDQQLYSGGSTNTIVDAYISNTGTFRADFANAMKKMGNLSPLTGTNGQIRT  318

Query  187  DCRRMN  170
            +CR++N
Sbjct  319  NCRKVN  324



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G T+SIV+ Y S+P+ F +DF  AM+KM ++SPLTG +GEIRR
Sbjct  259  LMAQRGLLHSDQELFNGGSTDSIVRTYSSNPATFNSDFVAAMIKMGDISPLTGNSGEIRR  318

Query  187  DCRRMN  170
            +CRR+N
Sbjct  319  NCRRLN  324



>ref|XP_008388322.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=323

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQQL S G T+S VK Y+S+P+ F  DFA A+ KM  LSPLTGT G+IR 
Sbjct  258  LVSQKGLLHSDQQLFSGGSTDSQVKAYVSNPATFRADFANAIKKMGNLSPLTGTKGQIRT  317

Query  187  DCRRMN  170
            DCR++N
Sbjct  318  DCRKVN  323



>gb|AEX20390.1| putative class III peroxidase [Coffea arabica x Coffea canephora]
Length=256

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ+QKGLLHSDQQL S G TN+ V  Y S+ + F  DFA AMVKM  LSPLTGTNG+IR 
Sbjct  191  LQTQKGLLHSDQQLFSGGSTNAQVNTYSSNSATFFTDFANAMVKMDNLSPLTGTNGQIRT  250

Query  187  DCRRMN  170
            +CR+ N
Sbjct  251  NCRKTN  256



>ref|XP_011095107.1| PREDICTED: cationic peroxidase 1-like [Sesamum indicum]
Length=321

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S +GLLHSDQQL S+G T++ V+ Y ++ + F NDFA AMVKMS LSPLTGTNG+IRR
Sbjct  256  LLSLRGLLHSDQQLFSNGSTDAQVRAYSTNSAAFFNDFASAMVKMSNLSPLTGTNGQIRR  315

Query  187  DCRRMN  170
            +CRR N
Sbjct  316  NCRRTN  321



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL + G T+S+V  Y ++PSKF++DF  AM+KM ++SPLTG+ GEIR+
Sbjct  255  LVNQKGLLHSDQQLFNKGSTDSLVSTYSTNPSKFSSDFVAAMIKMGDISPLTGSQGEIRK  314

Query  187  DCRRMN  170
            +CR++N
Sbjct  315  NCRKIN  320



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ QKGLLHSDQ L + G T+SIV  Y S+ + F+ DFA AMVKM  LSPLTGTNG+IR+
Sbjct  251  LQIQKGLLHSDQVLFNGGSTDSIVNTYSSNSATFSTDFANAMVKMGNLSPLTGTNGQIRK  310

Query  187  DCRRMN  170
            +CR+ N
Sbjct  311  NCRKTN  316



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G  +SIV+ YI++PS F +DF  AM+KM ++ PLTG+NGEIR+
Sbjct  257  LVNKKGLLHSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRK  316

Query  187  DCRRMN  170
            +CRR N
Sbjct  317  NCRRRN  322



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KG LHSDQQL + G T+SIV+ Y ++P  F +DFA AM+KM ++SPLTG+NGE+R+
Sbjct  255  LVQKKGFLHSDQQLFNGGSTDSIVRGYSTNPGTFPSDFAAAMIKMGDISPLTGSNGEVRK  314

Query  187  DCRRMN  170
            +CRR+N
Sbjct  315  NCRRIN  320



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G  +SIV+ YI++PS F +DF  AM+KM ++ PLTG+NGEIR+
Sbjct  257  LVNKKGLLHSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRK  316

Query  187  DCRRMN  170
            +CRR N
Sbjct  317  NCRRRN  322



>ref|XP_004240055.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=317

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ QKGLLHSDQQL S G T+SIV  Y S+ + F  DFA+AMVKM  LSPLTGTNG+IR+
Sbjct  252  LRIQKGLLHSDQQLSSGGSTDSIVNTYSSNSATFLADFAKAMVKMGNLSPLTGTNGQIRK  311

Query  187  DCRRMN  170
            +CR+ N
Sbjct  312  NCRKTN  317



>ref|XP_006345521.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ QKGLLHSDQQL S G T+SIV  Y S+ + F  DFA AMVKM  LSPLTGTNG+IR+
Sbjct  252  LRIQKGLLHSDQQLSSGGSTDSIVNTYSSNSATFFTDFANAMVKMGNLSPLTGTNGQIRK  311

Query  187  DCRRMN  170
            +CR+ N
Sbjct  312  NCRKTN  317



>ref|XP_006345522.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ QKGLLHSDQQL S G T+SIV  Y S+ + F  DFA+AMVKM  LSPLTGTNG+IR+
Sbjct  252  LRIQKGLLHSDQQLSSGGSTDSIVNTYSSNSATFFADFAKAMVKMGNLSPLTGTNGQIRK  311

Query  187  DCRRMN  170
            +CR+ N
Sbjct  312  NCRKTN  317



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L + KGLLHSDQQL + G T+S+V+ Y S PS F +DF+ AM+KM +++PLTG+NGEIR 
Sbjct  255  LINNKGLLHSDQQLFNGGSTDSLVRSYSSKPSTFISDFSAAMIKMGDITPLTGSNGEIRN  314

Query  187  DCRRMN  170
            +CRR+N
Sbjct  315  NCRRVN  320



>ref|XP_004240883.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=319

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G  +SIVK Y ++PS F +DF  AM+KM ++ PLTG+NGEIR+
Sbjct  254  LVNKKGLLHSDQQLFNGGSVDSIVKSYSNNPSSFISDFVTAMIKMGDIRPLTGSNGEIRK  313

Query  187  DCRRMN  170
            +CRR+N
Sbjct  314  NCRRIN  319



>ref|XP_007140134.1| hypothetical protein PHAVU_008G086800g [Phaseolus vulgaris]
 gb|ESW12128.1| hypothetical protein PHAVU_008G086800g [Phaseolus vulgaris]
Length=322

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKGLLHSDQ+L + G T+S V  Y+S+PS F  DFA AMVKMS L PLTG++GEIR 
Sbjct  257  LQSQKGLLHSDQELFNGGSTDSQVNGYVSNPSSFQTDFANAMVKMSNLGPLTGSSGEIRT  316

Query  187  DCRRMN  170
            +C + N
Sbjct  317  NCWKTN  322



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQQL + G T+S V+ Y ++P  FA+DFA AM+KM ++ PLTG+NGEIR+
Sbjct  256  LVNRRGLLHSDQQLFNGGSTDSAVRAYSNNPGSFASDFAAAMIKMGDIKPLTGSNGEIRK  315

Query  187  DCRRMN  170
            +CRR+N
Sbjct  316  NCRRIN  321



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQ+GLLHSDQQL + G T+SIV+ Y + PS F +DF  AM+KM ++SPLTG+ GEIR+
Sbjct  265  LISQRGLLHSDQQLFNGGSTDSIVRGYGNSPSSFNSDFVAAMIKMGDISPLTGSRGEIRK  324

Query  187  DCRRMN  170
            +CRR+N
Sbjct  325  NCRRVN  330



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL S G TN++V+ Y S+PS+F  DF  AM+ M ++ PLTG+NG+IR+
Sbjct  258  LVNQKGLLHSDQQLFSGGSTNALVQTYSSNPSRFNTDFVAAMINMGDVKPLTGSNGQIRK  317

Query  187  DCRRMN  170
            +CR+ N
Sbjct  318  NCRKTN  323



>ref|XP_002517727.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
 gb|EEF44659.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
Length=264

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L + KGLLHSDQQL S G TNS VK Y + P  F  DFA AM+KM +LSPLTGT+G+IR 
Sbjct  199  LVNNKGLLHSDQQLFSGGSTNSQVKTYSTDPFTFYADFANAMIKMGKLSPLTGTDGQIRT  258

Query  187  DCRRMN  170
            DCR++N
Sbjct  259  DCRKVN  264



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGLLHSDQQL + G  +SIVK Y  +PS FA DF  AM+KM ++ PLTG+ GEIR+
Sbjct  254  LVSKKGLLHSDQQLFNGGSADSIVKSYSDNPSIFATDFVTAMIKMGDIRPLTGSKGEIRK  313

Query  187  DCRRMN  170
            +CRR+N
Sbjct  314  NCRRIN  319



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL + G T+SIV EY  +PS F++DF  AM+KM ++SPLTG+NGEIR+
Sbjct  260  LVDSKGLLHSDQQLFNGGSTDSIVHEYSLYPSSFSSDFVTAMIKMGDISPLTGSNGEIRK  319

Query  187  DCRRMN  170
             CR +N
Sbjct  320  QCRSVN  325



>ref|XP_006350928.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=292

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L + KG+LHSDQQL S G T+S VK Y +HP  F  DFA+AMVK+  LSPLTGTNG+IR 
Sbjct  227  LVNNKGILHSDQQLYSGGSTDSQVKTYSTHPITFDADFAKAMVKLGNLSPLTGTNGQIRT  286

Query  187  DCRRMN  170
            +CR++N
Sbjct  287  NCRKIN  292



>ref|XP_010041552.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=322

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  KGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRRDCRR  176
            KGLLHSDQQL S G T+S+V+ Y S PS F++DFA AM+KM ++ PLTG++GE+R++CR+
Sbjct  261  KGLLHSDQQLFSGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGEVRKNCRK  320

Query  175  MN  170
            +N
Sbjct  321  IN  322



>gb|KDP22793.1| hypothetical protein JCGZ_00380 [Jatropha curcas]
Length=293

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL + G T+S V+ Y S+P+ F +DFA AMVKM  LSPLTGT+G+IR 
Sbjct  228  LLAQKGLLHSDQQLFNGGSTDSQVRAYSSNPTSFRSDFASAMVKMGNLSPLTGTSGQIRT  287

Query  187  DCRRMN  170
            +CR+ N
Sbjct  288  NCRKAN  293



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G T+SIV+ Y ++PS F++DF  AM+KM +++PLTG+ GE+R+
Sbjct  255  LVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDFVTAMIKMGDITPLTGSKGEVRK  314

Query  187  DCRRMN  170
            +CRR+N
Sbjct  315  NCRRIN  320



>gb|ADN96693.1| peroxidase 6 [Rubia cordifolia]
Length=321

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGLLHSDQQL + G T++IV+ Y S+P  FA DFA AM+KM ++ PLTG+ GE+R 
Sbjct  256  LVSRKGLLHSDQQLYNGGSTDTIVRGYSSNPGSFAADFAAAMIKMGDIKPLTGSKGEVRS  315

Query  187  DCRRMN  170
            +CRR+N
Sbjct  316  NCRRIN  321



>gb|KHN33229.1| Cationic peroxidase 1 [Glycine soja]
Length=263

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGL HSDQQL S  FT+S VK+Y ++PS F +DFA+AM+KMS LSPLTG  G+IR+
Sbjct  198  LLSKKGLFHSDQQLYSGSFTDSKVKDYATYPSLFKSDFAKAMLKMSNLSPLTGAQGQIRK  257

Query  187  DCRRMN  170
             C R+N
Sbjct  258  VCSRVN  263



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G  +SIV  Y ++PS F++DF  AM+KM ++ PLTG+NGEIR+
Sbjct  256  LVDKKGLLHSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDIRPLTGSNGEIRK  315

Query  187  DCRRMN  170
            +CRR+N
Sbjct  316  NCRRLN  321



>ref|XP_010552918.1| PREDICTED: peroxidase P7-like [Tarenaya hassleriana]
Length=319

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  QKGLLHSDQ+L + G T+SIV+ Y + P+ F++DF  AM++M ++SPLTG  GEIRR
Sbjct  254  LMVQKGLLHSDQELFNGGSTDSIVRTYGTKPATFSSDFTAAMIRMGDISPLTGKKGEIRR  313

Query  187  DCRRMN  170
            +CRR+N
Sbjct  314  NCRRVN  319



>ref|XP_010032327.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=322

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  KGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRRDCRR  176
            KGLLHSDQQL S G T+S+V+ Y S PS F++DFA AM+KM ++ PLTG++GE+R++CR+
Sbjct  261  KGLLHSDQQLFSGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGEVRKNCRK  320

Query  175  MN  170
            +N
Sbjct  321  IN  322



>ref|XP_009803848.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ QKGLLHSDQQL S G T+SIV  Y S+ + F  DF  AMVKM  LSPLTGT+G+IR+
Sbjct  249  LQIQKGLLHSDQQLFSGGSTHSIVNTYSSNSATFFTDFKNAMVKMGNLSPLTGTSGQIRK  308

Query  187  DCRRMN  170
            +CR+ N
Sbjct  309  NCRKTN  314



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S++GLLHSDQQL + G T+SIV+ Y + PS F +DF  AM+KM ++SPLTG+ GEIR+
Sbjct  257  LVSRRGLLHSDQQLFNGGSTDSIVRGYGNSPSSFNSDFVSAMIKMGDISPLTGSRGEIRK  316

Query  187  DCRRMN  170
            +CRR+N
Sbjct  317  NCRRVN  322



>ref|XP_009606349.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGLLHSDQQL + G  +SIVK Y  +P+ FA DF  AM+KM ++ PLTG+ GEIR+
Sbjct  254  LVSKKGLLHSDQQLFNGGSADSIVKSYSDNPNSFAADFVTAMIKMGDIRPLTGSKGEIRK  313

Query  187  DCRRMN  170
            +CRR+N
Sbjct  314  NCRRIN  319



>ref|XP_010041648.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ+QKGLLHSDQQL S G T++ V  Y S+ + F  DFA AMVKM  LSPLTG++G+IR+
Sbjct  254  LQTQKGLLHSDQQLFSGGSTDAQVNTYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRK  313

Query  187  DCRRMN  170
            +CR++N
Sbjct  314  NCRKLN  319



>ref|XP_011076613.1| PREDICTED: peroxidase P7 [Sesamum indicum]
Length=321

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S++GLLHSDQQL   G T+SIV+ Y + P+ F +DFA AM+KM ++ PLTG+NGE+R+
Sbjct  256  LVSRRGLLHSDQQLFIGGATDSIVRTYSNDPNTFKSDFAAAMLKMGDIRPLTGSNGEVRK  315

Query  187  DCRRMN  170
            +CRR+N
Sbjct  316  NCRRVN  321



>gb|KDP45730.1| hypothetical protein JCGZ_17337 [Jatropha curcas]
Length=232

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL S G T + VK Y ++P+ F  DFA AMVKM +LSPLTGTNG+IR 
Sbjct  167  LVHNKGLLHSDQQLFSGGSTEAQVKTYSTNPTAFYEDFANAMVKMGKLSPLTGTNGQIRT  226

Query  187  DCRRMN  170
            +CR++N
Sbjct  227  NCRKVN  232



>ref|XP_009371984.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=323

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQQL S G T+S V  Y+S+P+ F  DFA A+ KM  LSPLTG+ G+IR 
Sbjct  258  LVSQKGLLHSDQQLFSGGSTDSQVNAYVSNPATFRADFANAIKKMGNLSPLTGSRGQIRT  317

Query  187  DCRRMN  170
            DCR++N
Sbjct  318  DCRKVN  323



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKGLLHSDQQL S G T+S V  Y S+   F  DFA AM+KM  LSPLTGT+G+IR 
Sbjct  257  LQSQKGLLHSDQQLFSGGSTDSQVNAYSSNLGSFRTDFANAMIKMGNLSPLTGTSGQIRT  316

Query  187  DCRRMN  170
            +CR++N
Sbjct  317  NCRKVN  322



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G T+SIV+ Y + PS F++DFA AM+KM ++SPLTGT+GEIR+
Sbjct  259  LMAQRGLLHSDQELFNGGSTDSIVRGYSNTPSSFSSDFAAAMIKMGDISPLTGTSGEIRK  318

Query  187  DCRRMN  170
             C R N
Sbjct  319  LCGRTN  324



>ref|XP_008650762.1| PREDICTED: peroxidase 70 isoform X1 [Zea mays]
 tpg|DAA64105.1| TPA: peroxidase 70 Precursor [Zea mays]
Length=321

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQQL + G T+ +V+ Y S P +F+ DFA AM++M  +SPLTGT G+IRR
Sbjct  256  LLAQRGLLHSDQQLFNGGATDGLVRTYASTPRRFSGDFAAAMIRMGNISPLTGTQGQIRR  315

Query  187  DCRRMN  170
             C R+N
Sbjct  316  ACSRVN  321



>ref|XP_010921101.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQ+GLLHSDQ+L + G T+S+V  Y ++PSKF++DF  A++KM ++SPLTG+ GEIR+
Sbjct  255  LVSQEGLLHSDQELYNKGSTDSLVSTYSTNPSKFSSDFVAAIIKMGDISPLTGSQGEIRK  314

Query  187  DCRRMN  170
            +CR++N
Sbjct  315  NCRKIN  320



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G T+SIV+ Y ++PS F++DFA AM+KM ++SPLTG++GEIR+
Sbjct  259  LMTQRGLLHSDQELFNGGSTDSIVRGYSNNPSSFSSDFAAAMIKMGDISPLTGSSGEIRK  318

Query  187  DCRRMN  170
             C R N
Sbjct  319  VCGRTN  324



>ref|NP_001106040.1| peroxidase 70 precursor [Zea mays]
 sp|A5H452.1|PER70_MAIZE RecName: Full=Peroxidase 70; AltName: Full=Plasma membrane-bound 
peroxidase 2b; Short=pmPOX2b; Flags: Precursor [Zea mays]
 gb|ABN48843.1| plasma membrane-bound peroxidase 2b [Zea mays]
Length=321

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQQL + G T+ +V+ Y S P +F+ DFA AM++M  +SPLTGT G+IRR
Sbjct  256  LLAQRGLLHSDQQLFNGGATDGLVRTYASTPRRFSRDFAAAMIRMGNISPLTGTQGQIRR  315

Query  187  DCRRMN  170
             C R+N
Sbjct  316  ACSRVN  321



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+++KGLLHSDQ+L + G T+S V  Y++ P  F NDFA +MVKM  + PLTGTNGEIR+
Sbjct  251  LRAKKGLLHSDQELFNGGSTDSQVTSYVTSPITFRNDFATSMVKMGNIKPLTGTNGEIRK  310

Query  187  DCRRMN  170
            +CR+ N
Sbjct  311  NCRKPN  316



>gb|ACJ11762.1| class III peroxidase [Gossypium hirsutum]
Length=323

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ QKGLLHSDQQL S G T+S V  Y S+   F  DFA AMVKM  LSPLTGT+G+IR 
Sbjct  258  LQGQKGLLHSDQQLFSGGSTDSQVNAYSSNLGSFTTDFANAMVKMGNLSPLTGTSGQIRT  317

Query  187  DCRRMN  170
            +CR+ N
Sbjct  318  NCRKAN  323



>ref|XP_002285723.1| PREDICTED: cationic peroxidase 1 isoform X1 [Vitis vinifera]
Length=317

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+++KGLLHSDQQL + G T+SIV+ Y ++ + F  D A AM+KM  LSPLTGTNGEIR 
Sbjct  250  LKAKKGLLHSDQQLYNGGSTDSIVETYSTNSATFFTDVANAMIKMGNLSPLTGTNGEIRT  309

Query  187  DCRRMN  170
            DC+++N
Sbjct  310  DCKKIN  315



>ref|XP_010066439.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=322

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ+QKGLLHSDQQL S G T++ V  Y S+ + F  DFA AMVKM  LSPLTG++G+IR+
Sbjct  257  LQTQKGLLHSDQQLFSGGSTDAQVNMYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRK  316

Query  187  DCRRMN  170
            +CR++N
Sbjct  317  NCRKVN  322



>gb|AAP42508.1| anionic peroxidase swpb3 [Ipomoea batatas]
Length=320

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL +   T+S V+ Y ++PSKF +DFA AM+KM ++ PLTG NGEIR+
Sbjct  255  LVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPSKFKSDFAAAMIKMGDIKPLTGNNGEIRK  314

Query  187  DCRRMN  170
            +CRR N
Sbjct  315  NCRRRN  320



>gb|KHG25850.1| Peroxidase 4 [Gossypium arboreum]
Length=323

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  ++GLLHSDQ+L + G T+SIV+ Y  +PS F++DF  AM+KM ++SPLTG+ GEIR+
Sbjct  258  LIGKRGLLHSDQELFNGGSTDSIVRAYSKNPSSFSSDFVTAMIKMGDISPLTGSKGEIRK  317

Query  187  DCRRMN  170
            +CRR+N
Sbjct  318  NCRRVN  323



>ref|XP_007142069.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
 gb|ESW14063.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
Length=318

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL S G T+S V  Y + PS F  DFA AMVKM  LSPLTG +G+IR 
Sbjct  253  LINQKGLLHSDQQLFSGGSTDSQVTTYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRT  312

Query  187  DCRRMN  170
            DCR++N
Sbjct  313  DCRKVN  318



>gb|KEH34417.1| cationic peroxidase [Medicago truncatula]
Length=323

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL S G T+S V  Y + PS F  DFA AMVKM  LSPLTG NG+IR 
Sbjct  258  LVNKKGLLHSDQQLFSGGSTDSQVTAYSTSPSTFYTDFASAMVKMGNLSPLTGNNGQIRT  317

Query  187  DCRRMN  170
            +CR++N
Sbjct  318  NCRKVN  323



>ref|XP_010685964.1| PREDICTED: peroxidase 4-like [Beta vulgaris subsp. vulgaris]
Length=319

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S++GLLHSDQQL + G T+SIV+ + ++P  F +DFA AM+KM ++SPLTG+ GEIR+
Sbjct  254  LVSKRGLLHSDQQLFNGGSTDSIVQSFSNNPGYFRSDFATAMIKMGDISPLTGSQGEIRK  313

Query  187  DCRRMN  170
            +CRR N
Sbjct  314  NCRRAN  319



>gb|KDO63401.1| hypothetical protein CISIN_1g020966mg [Citrus sinensis]
Length=319

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  ++ V+ Y ++P+ FA DFA AMVKM  +SPLTGTNGEIRR
Sbjct  254  LVNRRGLLHSDQELFNGGSQDATVRGYSTNPASFARDFAAAMVKMGNISPLTGTNGEIRR  313

Query  187  DCRRMN  170
            +CR +N
Sbjct  314  NCRVVN  319



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQQL + G T+SIV+ Y ++PS F++DF   M+KM ++SPLTG+ GEIR+
Sbjct  256  LINRRGLLHSDQQLFNGGSTDSIVRGYSNNPSSFSSDFVTGMIKMGDISPLTGSRGEIRK  315

Query  187  DCRRMN  170
            +CRR+N
Sbjct  316  NCRRVN  321



>ref|XP_009371986.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Pyrus x bretschneideri]
Length=312

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQQL S G T++ V  Y+S+ + F  DFA AM KM  LSPLTGTNG+IR 
Sbjct  247  LVNQRGLLHSDQQLFSGGSTDAQVNAYVSNTAAFRADFANAMKKMGNLSPLTGTNGQIRT  306

Query  187  DCRRMN  170
            DCR++N
Sbjct  307  DCRKVN  312



>ref|XP_009371985.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Pyrus x bretschneideri]
Length=325

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQQL S G T++ V  Y+S+ + F  DFA AM KM  LSPLTGTNG+IR 
Sbjct  260  LVNQRGLLHSDQQLFSGGSTDAQVNAYVSNTAAFRADFANAMKKMGNLSPLTGTNGQIRT  319

Query  187  DCRRMN  170
            DCR++N
Sbjct  320  DCRKVN  325



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQS+KGLLHSDQ+L + G T+S V  Y S+P+ F  DFA AM+KM  LSPLTG++G+IR 
Sbjct  251  LQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRT  310

Query  187  DCRRMN  170
            +CR+ N
Sbjct  311  NCRKTN  316



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQS+KGLLHSDQ+L + G T+S V  Y S+P+ F  DFA AM+KM  LSPLTG++G+IR 
Sbjct  249  LQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRT  308

Query  187  DCRRMN  170
            +CR+ N
Sbjct  309  NCRKTN  314



>gb|ABR23054.1| basic peroxidase swpb4 [Ipomoea batatas]
Length=320

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL +   T+S V+ Y ++PSKF +DFA AM+KM ++ PLTG NGEIR+
Sbjct  255  LVNKKGLLHSDQQLFNGVSTDSTVRGYSTNPSKFRSDFAAAMIKMGDIKPLTGNNGEIRK  314

Query  187  DCRRMN  170
            +CRR N
Sbjct  315  NCRRRN  320



>ref|XP_009622973.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=320

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+  KG+LHSDQQL S G T+S V  Y + P  FA DFA+A+VKM  LSPLTGTNG+IR 
Sbjct  255  LKKNKGILHSDQQLFSGGSTDSQVTTYGTRPITFAADFAKAIVKMGNLSPLTGTNGQIRT  314

Query  187  DCRRMN  170
            +CR++N
Sbjct  315  NCRKIN  320



>ref|XP_006662662.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=324

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  QKGLLHSDQ+L + G T+S+V+ YIS  S F  DF   M+KM ++SPLTG+NGEIR 
Sbjct  259  LVVQKGLLHSDQELFNGGATDSLVQTYISSQSTFFADFVTGMIKMGDISPLTGSNGEIRT  318

Query  187  DCRRMN  170
            +CRR+N
Sbjct  319  NCRRVN  324



>ref|XP_006664870.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=323

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  QKGLLHSDQ+L + G T+S+V+ YIS  S F  DF   M+KM ++SPLTG+NGEIR 
Sbjct  258  LVVQKGLLHSDQELFNGGATDSLVQTYISSQSTFFADFVTGMIKMGDISPLTGSNGEIRT  317

Query  187  DCRRMN  170
            +CRR+N
Sbjct  318  NCRRVN  323



>gb|KHN40655.1| Cationic peroxidase 1 [Glycine soja]
Length=334

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQS+KGLLHSDQ+L + G T+S V  Y S+P+ F  DFA AM+KM  LSPLTG++G+IR 
Sbjct  269  LQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRT  328

Query  187  DCRRMN  170
            +CR+ N
Sbjct  329  NCRKTN  334



>emb|CDX80957.1| BnaC03g02110D [Brassica napus]
Length=324

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQ+GLLHSDQ L + G T+SIV+EY  +   F NDFA AMVKMS +SPLTGT GEIR 
Sbjct  259  LMSQRGLLHSDQVLFNGGSTDSIVREYSQNARVFRNDFAAAMVKMSHISPLTGTAGEIRS  318

Query  187  DCRRMN  170
            +C R N
Sbjct  319  NCGRTN  324



>dbj|BAJ91992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQQL + G  +++V++Y ++P+ FA DF  AM+KM  ++PLTGTNG+IRR
Sbjct  256  LVAQRGLLHSDQQLFNGGSQDALVRQYGTNPALFAADFVAAMIKMGNIAPLTGTNGQIRR  315

Query  187  DCRRMN  170
            +CR +N
Sbjct  316  NCRVVN  321



>ref|XP_011003587.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=317

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL S G T++ V+ Y S+ + F  DFA AM+KM  LSPLTGTNG+IR 
Sbjct  252  LLNQKGLLHSDQQLFSGGSTDAQVRAYSSNQAAFRTDFANAMIKMGNLSPLTGTNGQIRT  311

Query  187  DCRRMN  170
            +CR+ N
Sbjct  312  NCRKAN  317



>ref|XP_002323054.1| hypothetical protein POPTR_0016s14030g [Populus trichocarpa]
 gb|EEF04815.1| hypothetical protein POPTR_0016s14030g [Populus trichocarpa]
 gb|AHL39187.1| class III peroxidase [Populus trichocarpa]
Length=317

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL S G T++ V+ Y S+ + F  DFA AM+KM  LSPLTGTNG+IR 
Sbjct  252  LLNQKGLLHSDQQLFSGGSTDAQVRAYSSNQAAFRTDFANAMIKMGNLSPLTGTNGQIRT  311

Query  187  DCRRMN  170
            +CR+ N
Sbjct  312  NCRKAN  317



>ref|XP_004242492.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=314

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L + KG+LHSDQQL S G T+S VK Y ++P  F  DFA+AMVK+  LSPLTGTNG+IR 
Sbjct  249  LVNNKGILHSDQQLYSGGSTDSQVKSYSTNPIAFDADFAKAMVKLGNLSPLTGTNGQIRT  308

Query  187  DCRRMN  170
            +CR++N
Sbjct  309  NCRKIN  314



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQS+KGLLHSDQ+L + G T+S V  Y S+P+ F  DFA AM+KM  LSPLTG++G+IR 
Sbjct  277  LQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRT  336

Query  187  DCRRMN  170
            +CR+ N
Sbjct  337  NCRKTN  342



>ref|XP_009773428.1| PREDICTED: peroxidase 4-like, partial [Nicotiana sylvestris]
Length=186

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G  +SIV  Y ++PS F++DF  AM+KM ++ PLTG+NGEIR+
Sbjct  65   LVDKKGLLHSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDIRPLTGSNGEIRK  124

Query  187  DCRRM  173
            +CR M
Sbjct  125  NCRSM  129



>ref|NP_001065568.2| Os11g0112400 [Oryza sativa Japonica Group]
 dbj|BAF27413.2| Os11g0112400, partial [Oryza sativa Japonica Group]
Length=136

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQ+L + G T+++V+ YIS  S F  DF   M+KM +++PLTG+NGEIR+
Sbjct  71   LVVKKGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRK  130

Query  187  DCRRMN  170
            +CRR+N
Sbjct  131  NCRRIN  136



>ref|XP_008356153.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=125

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL S G T+S+V  Y +    F  DFA AMVKM  LSPLTGT G++R 
Sbjct  60   LVNRKGLLHSDQQLFSGGSTDSLVTTYSTTAGTFYTDFANAMVKMGSLSPLTGTTGQVRT  119

Query  187  DCRRMN  170
            +CR++N
Sbjct  120  NCRKIN  125



>ref|XP_010066394.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ+QKGLLHSDQQL S G T++ V  Y S+ + F  DFA AMV M  LSPLTG++G+IR+
Sbjct  254  LQTQKGLLHSDQQLFSGGSTDAQVNTYSSNSATFMTDFANAMVTMGNLSPLTGSSGQIRK  313

Query  187  DCRRMN  170
            +CR++N
Sbjct  314  NCRKVN  319



>ref|XP_010066382.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=133

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ QKGLLHSDQQL S G T++ V  Y S+ + F  DFA AMVKM  LSPLTG++G+IR+
Sbjct  68   LQIQKGLLHSDQQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRK  127

Query  187  DCRRMN  170
            +C ++N
Sbjct  128  NCGKVN  133



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL + G T+SIV+ Y +  S F +DF   M+KM ++SPLTG+ GEIR+
Sbjct  260  LLNQKGLLHSDQQLFNGGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRK  319

Query  187  DCRRMN  170
            +CRRMN
Sbjct  320  NCRRMN  325



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGLLHSDQQ+ S G TNS V  Y + PS +++DF  AM+KM ++SPLTG +GEIR+
Sbjct  255  LVSKKGLLHSDQQVFSGGSTNSQVSTYSTSPSTWSSDFVAAMIKMGDISPLTGKSGEIRK  314

Query  187  DCRRMN  170
            +CR+ N
Sbjct  315  NCRKTN  320



>ref|XP_006378807.1| hypothetical protein POPTR_0010s24330g [Populus trichocarpa]
 gb|ERP56604.1| hypothetical protein POPTR_0010s24330g [Populus trichocarpa]
Length=316

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLL SDQ+L S G T+SIV EY  +P+KF++DFA AM+KM ++SPLTGT G+IRR
Sbjct  251  LMQKKGLLQSDQELFSGGSTDSIVSEYSRNPAKFSSDFASAMIKMGDISPLTGTAGQIRR  310

Query  187  DCRRMN  170
             C  +N
Sbjct  311  ICSAVN  316



>ref|XP_009775239.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=320

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KG+LHSDQQL S G T+S V  Y + P  FA DFA+A+VKM  LSPLTGTNG+IR 
Sbjct  255  LVKNKGILHSDQQLFSGGSTDSQVTTYSTRPITFAADFAKAIVKMGNLSPLTGTNGQIRT  314

Query  187  DCRRMN  170
            +CR++N
Sbjct  315  NCRKIN  320



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G T+S V+ Y ++PS F++DF   M+KM ++SPLTG+ GEIR+
Sbjct  254  LVNRKGLLHSDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRK  313

Query  187  DCRRMN  170
            +CRR+N
Sbjct  314  NCRRIN  319



>ref|XP_004502855.1| PREDICTED: peroxidase 52-like [Cicer arietinum]
Length=322

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G  +SIV  Y ++P+ F++ F+ AM+KM ++SPLTG+NGEIR+
Sbjct  257  LIQKKGLLHSDQQLFNGGSADSIVTGYSTNPTSFSSAFSAAMIKMGDISPLTGSNGEIRK  316

Query  187  DCRRMN  170
            +CRR N
Sbjct  317  NCRRTN  322



>ref|XP_006470332.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=320

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G T+S V+ Y ++PS F++DF   M+KM ++SPLTG+ GEIR+
Sbjct  255  LVNRKGLLHSDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRK  314

Query  187  DCRRMN  170
            +CRR+N
Sbjct  315  NCRRVN  320



>ref|XP_004977588.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=321

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGLLHSDQ+L + G T++ V+ Y+S  S F  DF   M+KM +++PLTG+NGEIR+
Sbjct  256  LVSKKGLLHSDQELFNGGATDAQVQSYVSSQSAFFADFVTGMIKMGDITPLTGSNGEIRK  315

Query  187  DCRRMN  170
            +CRRMN
Sbjct  316  NCRRMN  321



>ref|XP_009776128.1| PREDICTED: peroxidase 4-like, partial [Nicotiana sylvestris]
Length=219

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGLLHSDQQL + G  +S VK Y  +PS FA D   AM+KM ++ PLTG+ GEIR+
Sbjct  154  LVSKKGLLHSDQQLFNGGSADSTVKSYSDNPSSFATDLVTAMIKMGDIRPLTGSKGEIRK  213

Query  187  DCRRMN  170
            +C+R+N
Sbjct  214  NCKRIN  219



>dbj|BAA77389.1| peroxidase 3 [Scutellaria baicalensis]
Length=318

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  KGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRRDCRR  176
            +GLLHSDQ+L ++G  ++ V+ Y ++ + F NDFA AMVKMS LSPLTGTNG+IRR+CRR
Sbjct  257  RGLLHSDQELFNNGTADAQVRAYSTNSAAFFNDFANAMVKMSNLSPLTGTNGQIRRNCRR  316

Query  175  MN  170
             N
Sbjct  317  TN  318



>ref|XP_006361306.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G  +SIVK Y ++PS F +DF  AM+KM +  PLTG+ GEIR+
Sbjct  254  LVNKKGLLHSDQQLFNGGSVDSIVKSYSNNPSSFTSDFVTAMIKMGDNRPLTGSKGEIRK  313

Query  187  DCRRMN  170
            +CRR+N
Sbjct  314  NCRRIN  319



>ref|XP_010093550.1| Cationic peroxidase 1 [Morus notabilis]
 gb|EXB54257.1| Cationic peroxidase 1 [Morus notabilis]
Length=322

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  361  SQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRRDC  182
            S KGLLHSDQQL ++G T+S V+ Y ++P+ F  DFA AM+KM  LSPLTGT+G+IR +C
Sbjct  259  SLKGLLHSDQQLFNNGSTDSQVRAYSTNPTSFRTDFANAMIKMGNLSPLTGTSGQIRTNC  318

Query  181  RRMN  170
            R++N
Sbjct  319  RKVN  322



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ L + G T+SIV+ Y ++PS F +DFA AM+KM ++SPLTG++GEIR+
Sbjct  259  LMTQRGLLHSDQVLFNGGSTDSIVRGYSNNPSSFNSDFAAAMIKMGDISPLTGSSGEIRK  318

Query  187  DCRRMN  170
             C R N
Sbjct  319  VCGRTN  324



>gb|ABR17414.1| unknown [Picea sitchensis]
Length=98

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ QKGLLHSDQ+L +    +  V  Y ++P+ F NDFA AMVKM  + PLTG NGEIR+
Sbjct  33   LKGQKGLLHSDQELFNGSSADIKVHFYATYPNAFFNDFAAAMVKMGNIKPLTGNNGEIRK  92

Query  187  DCRRMN  170
            +CR++N
Sbjct  93   NCRKIN  98



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLL SDQ L + G T+S+V+ Y + P++F +DFA AMVKM +++PLTG+NG+IR+
Sbjct  258  LVQNKGLLQSDQVLFNGGSTDSVVRNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRK  317

Query  187  DCRRMN  170
            +CRR+N
Sbjct  318  NCRRVN  323



>ref|XP_010925617.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G  +++V++Y ++P+ FA+DFA AMVKM  +SPLTG  GEIR 
Sbjct  252  LVNQQGLLHSDQELFNGGSQDALVRQYSNNPALFASDFAAAMVKMGNISPLTGNRGEIRL  311

Query  187  DCRRMN  170
            DCR++N
Sbjct  312  DCRKVN  317



>ref|XP_010264471.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=320

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L + KGLLHSDQQL S+G T+S+V  Y ++ + F  DFA AMVKM  LSPLTGT+GEIR 
Sbjct  255  LLNMKGLLHSDQQLFSNGSTDSLVTTYSTNAATFLTDFANAMVKMGNLSPLTGTSGEIRT  314

Query  187  DCRRMN  170
            +C R+N
Sbjct  315  NCSRVN  320



>ref|XP_004305595.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=326

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLL SDQ L S G T+SIV EY S P+KF  DFA AM+KM  ++PLTG+NG+IRR
Sbjct  260  LIQKKGLLASDQVLYSGGSTDSIVSEYSSKPAKFIADFATAMIKMGNINPLTGSNGQIRR  319

Query  187  DCRRMNY  167
             C  +NY
Sbjct  320  ICSALNY  326



>ref|XP_006468993.1| PREDICTED: peroxidase 52-like [Citrus sinensis]
Length=319

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  ++ V+ Y ++P+ FA DFA AMVKM  +SPLTGT+GEIRR
Sbjct  254  LVNRRGLLHSDQELFNGGSQDATVRGYSTNPASFARDFAAAMVKMGNISPLTGTDGEIRR  313

Query  187  DCRRMN  170
            +CR +N
Sbjct  314  NCRVVN  319



>gb|KHN29528.1| Cationic peroxidase 1 [Glycine soja]
Length=260

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKGLLH+DQ L + G T+S V  Y S PS F  DFA AMVKM  +SPLTG++GEIR 
Sbjct  195  LQSQKGLLHTDQVLFNGGSTDSQVNGYASDPSSFNTDFANAMVKMGNISPLTGSSGEIRT  254

Query  187  DCRRMN  170
            +C + N
Sbjct  255  NCWKTN  260



>gb|EYU41992.1| hypothetical protein MIMGU_mgv1a010234mg [Erythranthe guttata]
Length=318

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S++GLL SDQ L ++G T++ V+ Y ++ + F NDFA AMVKMS LSPLTGTNG+IRR
Sbjct  253  LVSRRGLLTSDQVLFNNGTTDAQVRAYSTNSASFFNDFAAAMVKMSNLSPLTGTNGQIRR  312

Query  187  DCRRMN  170
            +CRR N
Sbjct  313  NCRRRN  318



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G T+SIV+ Y +  S F++DFA+AM+KM ++ PLTG+NGEIR+
Sbjct  254  LIQKKGLLHSDQQLFNGGSTDSIVRAYRNSYSTFSSDFAKAMIKMGDIKPLTGSNGEIRK  313

Query  187  DCRRMN  170
            +CR+ N
Sbjct  314  NCRKPN  319



>ref|XP_010035985.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  QKGLLHSDQQL S G TN+ V  Y  +   F NDFA+AMVKM  LSPLTG+ G+IR 
Sbjct  255  LVCQKGLLHSDQQLFSGGSTNAQVTAYSKNFGSFQNDFAKAMVKMGGLSPLTGSTGQIRT  314

Query  187  DCRRMN  170
            +CRR+N
Sbjct  315  NCRRVN  320



>gb|ABV24960.2| putative secretory peroxidase [Catharanthus roseus]
Length=330

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQ+L + G TNS+V+ Y      F +DFA AM+KM ++SPLTG+NGE+R+
Sbjct  265  LINKKGLLHSDQELYNGGSTNSLVEAYSKDTKAFYSDFAAAMIKMGDISPLTGSNGEVRK  324

Query  187  DCRRMN  170
            +CRR+N
Sbjct  325  NCRRVN  330



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL + G T+S+V+ Y S+PS F +DF   M+KM ++ PLTG++GEIR+
Sbjct  266  LLQNKGLLHSDQQLFNGGSTDSLVRTYGSNPSTFTSDFVAGMIKMGDIKPLTGSSGEIRK  325

Query  187  DCRRMN  170
            +CR++N
Sbjct  326  NCRKIN  331



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQ L + G T+SIV+ Y ++PS F++DF  AM+KM ++SPLTG++GEIR+
Sbjct  259  LVAQKGLLHSDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRK  318

Query  187  DCRRMN  170
             C R N
Sbjct  319  MCGRTN  324



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQ L + G T+SIV+ Y ++PS F++DF  AM+KM ++SPLTG++GEIR+
Sbjct  259  LVAQKGLLHSDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRK  318

Query  187  DCRRMN  170
             C R N
Sbjct  319  MCGRTN  324



>ref|XP_007208188.1| hypothetical protein PRUPE_ppa020902mg [Prunus persica]
 gb|EMJ09387.1| hypothetical protein PRUPE_ppa020902mg [Prunus persica]
Length=326

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            + SQKGLLHSDQQL S GFT + V  Y ++ + F  DFAEAM KM  LSPLTG+ G+IR 
Sbjct  261  VMSQKGLLHSDQQLYSGGFTKTAVDAYANNAASFMEDFAEAMNKMGRLSPLTGSIGQIRT  320

Query  187  DCRRMN  170
            +CR++N
Sbjct  321  NCRKVN  326



>ref|XP_009122142.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Brassica rapa]
Length=325

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G T+SIV  Y ++PS F++DF  AM+KM ++SPLTG++GEIR+
Sbjct  260  LVAQRGLLHSDQELFNGGXTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRK  319

Query  187  DCRRMN  170
             C R N
Sbjct  320  VCGRTN  325



>ref|NP_001242089.1| uncharacterized protein LOC100815671 precursor [Glycine max]
 gb|ACU22965.1| unknown [Glycine max]
Length=322

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKGLLH+DQ L + G T+S V  Y S PS F  DFA AMVKM  +SPLTG++GEIR 
Sbjct  257  LQSQKGLLHTDQVLFNGGSTDSQVNGYASDPSSFNTDFANAMVKMGNISPLTGSSGEIRT  316

Query  187  DCRRMN  170
            +C + N
Sbjct  317  NCWKTN  322



>ref|XP_006842425.1| hypothetical protein AMTR_s00077p00020210, partial [Amborella 
trichopoda]
 gb|ERN04100.1| hypothetical protein AMTR_s00077p00020210, partial [Amborella 
trichopoda]
Length=183

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQ+GLLHSDQ+L + G T+S V  Y    S F  DFA AMVKM  +SPLTG++GEIR 
Sbjct  118  LVSQRGLLHSDQELFNGGATDSQVNGYTGSSSTFFTDFANAMVKMGNISPLTGSSGEIRT  177

Query  187  DCRRMN  170
            +CRR+N
Sbjct  178  NCRRVN  183



>ref|XP_009420366.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=317

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL S G T+S+V  Y ++ ++F +DFA AMVKM  +SPLTGT+GE+R 
Sbjct  252  LVKKKGLLHSDQQLFSGGSTDSLVTTYSTNTARFFSDFAAAMVKMGNISPLTGTDGEVRL  311

Query  187  DCRRMN  170
            +CR+ N
Sbjct  312  NCRKTN  317



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGL+HSDQQL + G T+SIV+ Y ++P+ F  DF+ AM++M ++SPLTG+ GEIR 
Sbjct  259  LIQKKGLIHSDQQLFNGGSTDSIVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRE  318

Query  187  DCRRMN  170
            +CRR+N
Sbjct  319  NCRRVN  324



>gb|ACT35473.1| peroxidase 52, partial [Brassica rapa]
Length=306

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G T+SIV  Y ++PS F++DF  AM+KM ++SPLTG++GEIR+
Sbjct  241  LVAQRGLLHSDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRK  300

Query  187  DCRRMN  170
             C R N
Sbjct  301  VCGRTN  306



>ref|XP_004983933.1| PREDICTED: peroxidase 70-like [Setaria italica]
Length=330

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQ+GLLHSDQ L   G T+ +V+ Y S   ++ +DFA AMV+M+ + PLTGT+GEIR 
Sbjct  265  LLSQRGLLHSDQALFGGGATDGLVRAYASDAGRWGSDFAAAMVRMASIGPLTGTDGEIRV  324

Query  187  DCRRMN  170
            +CRR+N
Sbjct  325  NCRRVN  330



>gb|AHL39166.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLL SDQ+L S G T+SIV EY  +P+KF++DFA AM+KM ++SPLTG+ G+IRR
Sbjct  251  LMQKKGLLQSDQELFSGGSTDSIVSEYSRNPAKFSSDFASAMIKMGDISPLTGSAGQIRR  310

Query  187  DCRRMN  170
             C  +N
Sbjct  311  ICSAVN  316



>ref|XP_003602462.1| Peroxidase [Medicago truncatula]
 gb|AES72713.1| class III peroxidase [Medicago truncatula]
Length=322

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL + G TNSIV  Y ++ + F +DFA AM+KM ++ PLTG+NGEIR+
Sbjct  257  LVQNKGLLHSDQQLFNGGSTNSIVSGYFNNQNSFFSDFATAMIKMGDIKPLTGSNGEIRK  316

Query  187  DCRRMN  170
            +CR+ N
Sbjct  317  NCRKPN  322



>ref|XP_008369411.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=325

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL S G T+SIV+EY  H   F NDF  AM+KM  ++PL G  GEIR 
Sbjct  257  LVQKKGLLHSDQQLFSGGKTDSIVREYSEHQESFFNDFVSAMIKMGTINPLIGPAGEIRL  316

Query  187  DCRRMN  170
            +CRR+N
Sbjct  317  NCRRIN  322



>emb|CDX70158.1| BnaA10g25070D [Brassica napus]
Length=325

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G T+SIV  Y ++PS F++DF  AM+KM ++SPLTG++GEIR+
Sbjct  260  LVAQRGLLHSDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRK  319

Query  187  DCRRMN  170
             C R N
Sbjct  320  VCGRTN  325



>gb|KHN40654.1| Cationic peroxidase 1 [Glycine soja]
Length=260

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKGLLH+DQ L + G T+S V  Y S PS F  DFA AM+KM  +SPLTG++GEIR 
Sbjct  195  LQSQKGLLHTDQVLFNGGSTDSQVNGYASDPSSFNTDFANAMIKMGNISPLTGSSGEIRT  254

Query  187  DCRRMN  170
            +C + N
Sbjct  255  NCWKTN  260



>gb|ABR18139.1| unknown [Picea sitchensis]
Length=327

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ Q GLLHSDQQL   G T++ V  Y  HP  F NDFA AMVKM  + PLT  NGEIR+
Sbjct  262  LQFQNGLLHSDQQLFKGGSTDNRVSFYAVHPDAFFNDFAAAMVKMGNIKPLTVNNGEIRK  321

Query  187  DCRRMN  170
            +CR++N
Sbjct  322  NCRKIN  327



>tpe|CAH69372.1| TPA: class III peroxidase 130 precursor [Oryza sativa Japonica 
Group]
 gb|ABA91159.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ00524.1| hypothetical protein OsI_22542 [Oryza sativa Indica Group]
 gb|EAZ17186.1| hypothetical protein OsJ_32693 [Oryza sativa Japonica Group]
 dbj|BAH01350.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQ+L + G T+++V+ YIS  S F  DF   M+KM +++PLTG+NGEIR+
Sbjct  259  LVVKKGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRK  318

Query  187  DCRRMN  170
            +CRR+N
Sbjct  319  NCRRIN  324



>gb|EPS67183.1| peroxidase, partial [Genlisea aurea]
Length=131

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL +  +T+S+V+ +++ P  F  DF   M++M  +SPLTG++GEIR+
Sbjct  66   LVENKGLLHSDQQLYNGAYTDSVVERFVNRPESFERDFVVGMIRMGNISPLTGSDGEIRK  125

Query  187  DCRRMN  170
             CRR+N
Sbjct  126  SCRRIN  131



>gb|AEX12221.1| hypothetical protein 0_7393_01 [Pinus taeda]
Length=118

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+S++GLLHSDQ+L + G T+S V +Y S+ + F +DFA AMVKM  + PLTGT+GEIR+
Sbjct  53   LKSKRGLLHSDQELFNGGSTDSHVTKYASNQNTFFSDFAAAMVKMGNIKPLTGTSGEIRK  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>gb|AEX12217.1| hypothetical protein 0_7393_01 [Pinus taeda]
 gb|AEX12218.1| hypothetical protein 0_7393_01 [Pinus taeda]
 gb|AEX12222.1| hypothetical protein 0_7393_01 [Pinus taeda]
 gb|AEX12223.1| hypothetical protein 0_7393_01 [Pinus radiata]
Length=118

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+S++GLLHSDQ+L + G T+S V +Y S+ + F +DFA AMVKM  + PLTGT+GEIR+
Sbjct  53   LKSKRGLLHSDQELFNGGSTDSHVTKYASNQNTFFSDFAAAMVKMGNIKPLTGTSGEIRK  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>ref|XP_010041557.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ Q+GLLHSDQQL S G T++ V  Y S+ + F  DFA AMVKM  LSPLTG++G+IR+
Sbjct  254  LQIQEGLLHSDQQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRK  313

Query  187  DCRRMN  170
            +CR +N
Sbjct  314  NCRNVN  319



>ref|XP_007048724.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX92881.1| Peroxidase superfamily protein [Theobroma cacao]
Length=320

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G  +++V+ Y ++P  F++DFA AMV+M  +SPLTGT GEIRR
Sbjct  255  LVAQRGLLHSDQELFNGGSQDALVRTYSTNPEVFSSDFAAAMVRMGNISPLTGTRGEIRR  314

Query  187  DCRRMN  170
            +CR +N
Sbjct  315  NCRVVN  320



>ref|NP_001065971.1| Os12g0112000 [Oryza sativa Japonica Group]
 tpe|CAH69377.1| TPA: class III peroxidase 135 precursor [Oryza sativa Japonica 
Group]
 gb|ABA96259.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28990.1| Os12g0112000 [Oryza sativa Japonica Group]
 gb|EAZ19424.1| hypothetical protein OsJ_34981 [Oryza sativa Japonica Group]
 dbj|BAG91443.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK99332.1| peroxidase [Oryza sativa Japonica Group]
Length=327

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQ+L + G T+++V+ YIS  S F  DF   M+KM +++PLTG+NGEIR+
Sbjct  262  LVVKKGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRK  321

Query  187  DCRRMN  170
            +CRR+N
Sbjct  322  NCRRIN  327



>gb|EAY79693.1| hypothetical protein OsI_34840 [Oryza sativa Indica Group]
Length=329

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQ+L + G T+++V+ YIS  S F  DF   M+KM +++PLTG+NGEIR+
Sbjct  264  LVVKKGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRK  323

Query  187  DCRRMN  170
            +CRR+N
Sbjct  324  NCRRIN  329



>gb|KHG17773.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=325

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSG-FTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIR  191
            L  ++GL HSDQQL + G FT+SIV+ Y ++P  F +DFA AM+KM ++SPLTG+ GEIR
Sbjct  259  LIDRRGLFHSDQQLFTGGGFTDSIVRGYSNNPRSFRSDFAAAMIKMGDISPLTGSMGEIR  318

Query  190  RDCRRMN  170
            ++CRR+N
Sbjct  319  KNCRRVN  325



>ref|XP_010035984.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQQL S G TN+ V  Y  +   F NDFA+AMVKM  LSPLTG+ G+IR 
Sbjct  255  LVSQKGLLHSDQQLFSGGSTNAQVTTYSKNLDLFKNDFAKAMVKMGGLSPLTGSAGQIRT  314

Query  187  DCRRMN  170
            +C+R+N
Sbjct  315  NCKRVN  320



>emb|CAA62597.1| korean-radish isoperoxidase [Raphanus sativus]
Length=315

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ L + G T+SIV+ Y + PS F +DFA AM+KM ++SPLTG++GEIR+
Sbjct  250  LMAQRGLLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRK  309

Query  187  DCRRMN  170
             C R N
Sbjct  310  VCGRTN  315



>ref|XP_004500339.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=318

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL S G T+S V  Y + PS F  DFA AMVKM  LSPLTG NG+IR 
Sbjct  253  LVNKKGLLHSDQQLFSGGSTDSQVTTYSTSPSTFNADFASAMVKMGNLSPLTGNNGQIRT  312

Query  187  DCRRMN  170
            +C ++N
Sbjct  313  NCHKVN  318



>gb|AAX53172.1| peroxidase [Populus alba x Populus glandulosa]
Length=316

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V+ Y ++ + FA DFA AMV+M  +SPLTGTNGEIRR
Sbjct  251  LVARRGLLHSDQELFNGGSQDALVRTYSTNGATFARDFAAAMVRMGNISPLTGTNGEIRR  310

Query  187  DCRRMN  170
            +CR +N
Sbjct  311  NCRVVN  316



>gb|AAD43561.1|AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum]
Length=316

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V+ Y ++P+ F+ DFA AMVKM  +SPLTGT GEIRR
Sbjct  251  LVARRGLLHSDQELFNGGSQDALVRTYSNNPATFSADFAAAMVKMGNISPLTGTQGEIRR  310

Query  187  DCRRMN  170
            +CR +N
Sbjct  311  NCRVVN  316



>ref|XP_003557955.1| PREDICTED: peroxidase P7-like [Brachypodium distachyon]
Length=326

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   K LLHSDQQLL++G T  +V+ Y ++P  F  DFAEAMV+MS L+PLTG++GEIR 
Sbjct  259  LLRSKALLHSDQQLLAAGATEGLVRFYGANPEAFRRDFAEAMVRMSSLAPLTGSSGEIRA  318

Query  187  DCRRMN  170
            +CR++N
Sbjct  319  NCRKVN  324



>gb|KHN08839.1| Cationic peroxidase 1 [Glycine soja]
Length=259

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL S G T+S V  Y + PS F  DFA AMVKM  LSPLTG +G+IR 
Sbjct  194  LINKKGLLHSDQQLFSGGSTDSQVTAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRT  253

Query  187  DCRRMN  170
            +CR++N
Sbjct  254  NCRKVN  259



>dbj|BAJ97638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGL+HSDQ+L + G T+ +V+ Y+S  S F  DF E M+KM ++SPLTG NGE+R+
Sbjct  255  LVAKKGLMHSDQELFNGGATDPLVQYYVSSQSAFFADFVEGMIKMGDISPLTGNNGEVRK  314

Query  187  DCRRMN  170
            +CR++N
Sbjct  315  NCRKIN  320



>gb|EPS73958.1| peroxidase 3, partial [Genlisea aurea]
Length=314

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  Q+GLLHSDQQLL+S  T + VK Y +    F NDFA  MVKMS LSPLTG+ GEIRR
Sbjct  249  LVGQRGLLHSDQQLLNSVATAAQVKSYTTDSQAFFNDFASGMVKMSNLSPLTGSQGEIRR  308

Query  187  DCRRMN  170
            +C R+N
Sbjct  309  NCARVN  314



>ref|XP_003552299.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=322

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKGLLH+DQ L + G T+S V  Y S PS F  DFA AM+KM  +SPLTG++GEIR 
Sbjct  257  LQSQKGLLHTDQVLFNGGSTDSQVNGYASDPSSFNTDFANAMIKMGNISPLTGSSGEIRT  316

Query  187  DCRRMN  170
            +C + N
Sbjct  317  NCWKTN  322



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G  +SIV  Y ++P  F++DF  AM+KM ++ PLTG+NGEIR+
Sbjct  256  LVNKKGLLHSDQQLFNGGSADSIVTSYSNNPRSFSSDFVTAMIKMGDIRPLTGSNGEIRK  315

Query  187  DCRRMN  170
            +C R+N
Sbjct  316  NCGRIN  321



>gb|AFG67580.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
Length=118

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+SQKGLLHSDQQL + G T+S+V  Y +  + F  DFA AMV M  ++PLTGT+GEIR 
Sbjct  53   LRSQKGLLHSDQQLYNGGSTDSMVTTYSTKQNTFFTDFAAAMVNMGNVNPLTGTSGEIRT  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>ref|XP_010925616.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G  +++V++Y ++P+ FA DFA AMVKM  +SPLTG +GEIR 
Sbjct  252  LVNQQGLLHSDQELFNGGSQDALVRQYSTNPALFARDFAAAMVKMGNISPLTGNSGEIRL  311

Query  187  DCRRMN  170
            +CR++N
Sbjct  312  NCRKIN  317



>ref|XP_006596457.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=301

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL S G T+S V  Y + PS F  DFA AMVKM  LSPLTG +G+IR 
Sbjct  236  LINKKGLLHSDQQLFSGGSTDSQVTAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRT  295

Query  187  DCRRMN  170
            +CR++N
Sbjct  296  NCRKVN  301



>emb|CAH10839.1| peroxidase [Picea abies]
Length=317

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL S G TNS V  Y ++ + F  DFA AMVKM  +SPLTGT+G+IR+
Sbjct  252  LGNRKGLLHSDQQLFSGGSTNSQVTTYSANQNTFFTDFAAAMVKMGNISPLTGTSGQIRK  311

Query  187  DCRRMN  170
            +CR+ N
Sbjct  312  NCRKAN  317



>ref|XP_010035986.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQ+GLLHSDQQL S G TN+ V  Y  +   F NDFA+AMVKM  LSPLTG++G+IR 
Sbjct  255  LVSQEGLLHSDQQLFSGGSTNAQVAAYSKNLGSFRNDFADAMVKMGGLSPLTGSSGQIRT  314

Query  187  DCRRMN  170
            +CR++N
Sbjct  315  NCRKVN  320



>emb|CAH10841.1| peroxidase [Picea abies]
Length=320

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ QKGLLHSDQQL + G T+S V  Y ++ + F  DFA AMVKMS +SPLTGT+G+IR+
Sbjct  255  LKIQKGLLHSDQQLFNGGSTDSQVTAYSTNQNSFFTDFAAAMVKMSNISPLTGTSGQIRK  314

Query  187  DCRRMN  170
            +CR+ N
Sbjct  315  NCRKAN  320



>ref|XP_002450133.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
 gb|EES09121.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
Length=328

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGLLHSDQ+L + G T+++V+ Y+   S F  DF   M+KM +++PLTG+NG+IR+
Sbjct  263  LLSKKGLLHSDQELFNGGATDTLVQSYVGSQSTFFTDFVTGMIKMGDITPLTGSNGQIRK  322

Query  187  DCRRMN  170
            +CRR+N
Sbjct  323  NCRRVN  328



>ref|XP_004958164.1| PREDICTED: peroxidase 70-like [Setaria italica]
Length=324

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G T+++V+ Y + P++F++DFA  MV+MS +  LTG++G+IRR
Sbjct  259  LVAQRGLLHSDQELFNGGSTDALVRSYAASPAQFSSDFAAGMVRMSGIGVLTGSSGQIRR  318

Query  187  DCRRMN  170
            +CRR+N
Sbjct  319  NCRRVN  324



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ ++GLLHSDQQL + G T+++V  Y ++P  F+ DFA AMVKM  + PLTG NGEIR+
Sbjct  261  LERRRGLLHSDQQLFNGGSTDNLVSFYTTYPIAFSIDFAVAMVKMGSIEPLTGNNGEIRK  320

Query  187  DCRRMN  170
            +CR++N
Sbjct  321  NCRKIN  326



>ref|XP_004978553.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=355

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S+KGLLHSDQ+L + G T++ V+ Y+S  S F  DF   M+KM +++PLTG+NGEIR+
Sbjct  290  LVSKKGLLHSDQELFNGGATDAQVQSYVSSQSAFFADFVTGMIKMGDITPLTGSNGEIRK  349

Query  187  DCRRMN  170
            +CRR+N
Sbjct  350  NCRRIN  355



>ref|XP_003623567.1| Peroxidase [Medicago truncatula]
 gb|AES79785.1| class III peroxidase [Medicago truncatula]
Length=312

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQKGL  SDQ L + G T+S V EY S  S FA DFA AMVKM  L+P+TG+NG+IR 
Sbjct  247  LQSQKGLFSSDQALFNGGSTDSDVDEYSSDSSSFATDFANAMVKMGNLNPITGSNGQIRT  306

Query  187  DCRRMN  170
            +CR +N
Sbjct  307  NCRVIN  312



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ L + G T+SIV+ Y ++PS F +DF  AM+KM ++SPLTG++GEIR+
Sbjct  259  LMTQRGLLHSDQVLFNGGSTDSIVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGEIRK  318

Query  187  DCRRMN  170
             C R N
Sbjct  319  VCGRTN  324



>ref|XP_004243276.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=319

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L++++GLL SDQ+L + G  +S+VK Y S    F  DFA AMVKM  LSPLTGTNGEIRR
Sbjct  254  LEARRGLLQSDQELFNGGSQDSLVKSYSSDGEAFRRDFASAMVKMGNLSPLTGTNGEIRR  313

Query  187  DCRRMN  170
            +CR +N
Sbjct  314  NCRAIN  319



>ref|XP_006470943.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=323

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLL SDQ L S G T+SIV EY  +PSKF +DFA AM+KM+++SPLTG+ GEIRR
Sbjct  258  LIQKKGLLASDQVLFSGGSTDSIVDEYSKNPSKFKSDFAAAMIKMADISPLTGSAGEIRR  317

Query  187  DCRRMN  170
             C  +N
Sbjct  318  VCNLVN  323



>emb|CDX98835.1| BnaC09g50000D [Brassica napus]
Length=325

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G T+SIV  Y ++P+ F++DF  AM+KM ++SPLTG++GEIR+
Sbjct  260  LVAQRGLLHSDQELFNGGSTDSIVTGYSNNPASFSSDFTAAMIKMGDISPLTGSSGEIRK  319

Query  187  DCRRMN  170
             C R N
Sbjct  320  VCGRTN  325



>gb|KHG09190.1| Peroxidase 4 [Gossypium arboreum]
Length=322

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQ L + G T+S+VK Y S+  KF +DF  AM+KM +++PLTG+NGEIR+
Sbjct  257  LLNKKGLLHSDQILFNGGSTDSLVKTYSSNTKKFYSDFVTAMIKMGDITPLTGSNGEIRK  316

Query  187  DCRRMN  170
            +CR+ N
Sbjct  317  NCRKPN  322



>ref|XP_009419858.1| PREDICTED: cationic peroxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=328

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S KGLLHSDQQL   G T+S V  Y ++ +KF  DFA AMVKM  +SPLTG++GEIR 
Sbjct  263  LLSNKGLLHSDQQLHGGGSTDSQVSSYAANSAKFFRDFASAMVKMGSISPLTGSSGEIRT  322

Query  187  DCRRMN  170
            DCR+ N
Sbjct  323  DCRKTN  328



>ref|XP_006470944.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=323

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLL SDQ L S G T+SIV EY  +PSKF +DFA AM+KM+++SPLTGT G+IRR
Sbjct  258  LIQKKGLLASDQVLFSGGSTDSIVDEYSKNPSKFKSDFAAAMIKMADISPLTGTAGQIRR  317

Query  187  DCRRMN  170
             C  +N
Sbjct  318  VCNIVN  323



>emb|CAH10842.1| peroxidase [Picea abies]
Length=320

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ QKGLLHSDQQL + G T+S V  Y ++ + F  DFA AMVKMS +SPLTGT+G+IR+
Sbjct  255  LKIQKGLLHSDQQLFNGGPTDSQVTAYSTNQNSFFTDFAAAMVKMSNISPLTGTSGQIRK  314

Query  187  DCRRMN  170
            +CR+ N
Sbjct  315  NCRKAN  320



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL + G T+SIV+ Y +  + F++DFA+AM+KM ++ PLTG+NGEIR+
Sbjct  254  LIQNKGLLHSDQQLFNGGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSNGEIRK  313

Query  187  DCRRMN  170
            +CR+ N
Sbjct  314  NCRKPN  319



>ref|XP_010041464.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ QKGLLHSDQQL S G T++ V  Y S+ + F  DFA AMVKM  LSPLTG++G+IR+
Sbjct  254  LQIQKGLLHSDQQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRK  313

Query  187  DCRRMN  170
             C ++N
Sbjct  314  SCGKVN  319



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ L + G T+SIV+ Y + PS F +DFA AM+KM ++SPLTG++GEIR+
Sbjct  231  LMAQRGLLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRK  290

Query  187  DCRRMN  170
             C + N
Sbjct  291  VCGKTN  296



>ref|XP_008228933.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=322

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L +SG  +++V+ Y ++ + F+ DFA AM KMS +SPLTGTNGEIR+
Sbjct  257  LVARRGLLHSDQELFNSGSQDALVRTYSNNAAAFSRDFAAAMAKMSAISPLTGTNGEIRK  316

Query  187  DCRRMN  170
            +CR +N
Sbjct  317  NCRLVN  322



>ref|XP_007215699.1| hypothetical protein PRUPE_ppa008808mg [Prunus persica]
 gb|EMJ16898.1| hypothetical protein PRUPE_ppa008808mg [Prunus persica]
Length=318

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L +SG  +++V+ Y ++ + F+ DFA AM KMS +SPLTGTNGEIR+
Sbjct  253  LVARRGLLHSDQELFNSGSQDALVRTYSNNAAAFSRDFAAAMAKMSAISPLTGTNGEIRK  312

Query  187  DCRRMN  170
            +CR +N
Sbjct  313  NCRLVN  318



>gb|EMT04397.1| Peroxidase 4 [Aegilops tauschii]
Length=176

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  ++GLLHSDQ+L + G  +++V+EY+   S F  DF E M+KM +++PLTG+NG+IR 
Sbjct  111  LVQKRGLLHSDQELFNGGAADTLVREYVGSQSAFFKDFVEGMIKMGDITPLTGSNGQIRM  170

Query  187  DCRRMN  170
            +CRR+N
Sbjct  171  NCRRVN  176



>ref|XP_010915492.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G  +++V++Y ++ + FA+DFA AMVKM  +SPLTGT+GEIR 
Sbjct  251  LVAQRGLLHSDQELFNGGSQDALVRQYSTNAALFASDFAGAMVKMGSISPLTGTSGEIRL  310

Query  187  DCRRMN  170
            +CR++N
Sbjct  311  NCRKVN  316



>ref|XP_009777403.1| PREDICTED: peroxidase-like [Nicotiana sylvestris]
Length=161

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++ GLLHSDQ+L + G  +++V+ Y ++ + F +DFA AMV+M  +SPLTGTNGEIRR
Sbjct  96   LVARHGLLHSDQELFNGGSQDALVRSYSTNGAAFTSDFAAAMVRMGNISPLTGTNGEIRR  155

Query  187  DCRRMN  170
            +CR +N
Sbjct  156  NCRAIN  161



>gb|EMT00634.1| Peroxidase 4 [Aegilops tauschii]
Length=176

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  ++GLLHSDQ+L + G  +++V+EY+   S F  DF E M+KM +++PLTG+NG+IR 
Sbjct  111  LVQKRGLLHSDQELFNGGAADTLVREYVGSQSAFFKDFVEGMIKMGDITPLTGSNGQIRM  170

Query  187  DCRRMN  170
            +CRR+N
Sbjct  171  NCRRVN  176



>ref|XP_009125598.1| PREDICTED: peroxidase P7 [Brassica rapa]
Length=324

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ L + G T+SIV+ Y + PS F +DFA AM+KM ++SPLTG++GEIR+
Sbjct  259  LMAQRGLLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRK  318

Query  187  DCRRMN  170
             C + N
Sbjct  319  VCGKTN  324



>emb|CDY04948.1| BnaAnng01300D [Brassica napus]
Length=324

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ L + G T+SIV+ Y + PS F +DFA AM+KM ++SPLTG++GEIR+
Sbjct  259  LMAQRGLLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRK  318

Query  187  DCRRMN  170
             C + N
Sbjct  319  VCGKTN  324



>emb|CDY14118.1| BnaC02g02350D [Brassica napus]
Length=324

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ L + G T+SIV+ Y + PS F +DFA AM+KM ++SPLTG++GEIR+
Sbjct  259  LMAQRGLLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFASAMIKMGDISPLTGSSGEIRK  318

Query  187  DCRRMN  170
             C + N
Sbjct  319  VCGKTN  324



>ref|XP_008457311.1| PREDICTED: cationic peroxidase 1-like [Cucumis melo]
Length=319

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQ L ++   +S V  YIS P  F +DFA AMVKMS LSPLTG++G+IR 
Sbjct  254  LVQNKGLLHSDQALFTNSSADSHVSSYISDPKAFFSDFAAAMVKMSNLSPLTGSDGQIRS  313

Query  187  DCRRMN  170
            DCR++N
Sbjct  314  DCRKIN  319



>gb|EMS48893.1| Peroxidase 52 [Triticum urartu]
Length=312

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGF--TNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEI  194
            L   +GLLHSDQQL + G   T+++V+ Y + P  F  DFAEAMV+M  LSPLTG++GEI
Sbjct  243  LLRSRGLLHSDQQLFAGGLGPTDALVRFYGADPEAFGRDFAEAMVRMGGLSPLTGSSGEI  302

Query  193  RRDCRRMNY  167
            R +CR++NY
Sbjct  303  RANCRKVNY  311



>ref|XP_011070600.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=304

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQ +KGLL SDQ L S G T+SIV EYI  P  FA DFA AM+KM E+ PLTG +G IRR
Sbjct  239  LQQRKGLLQSDQVLFSGGSTDSIVSEYIRSPQTFARDFANAMIKMGEIQPLTGQSGIIRR  298

Query  187  DCRRMN  170
             C  +N
Sbjct  299  VCNAIN  304



>gb|AFK46186.1| unknown [Lotus japonicus]
Length=316

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQS+KGL HSDQ   + G T+S V  Y+++P+ F  DFA AMVKM  LSPLTG++G+IR 
Sbjct  251  LQSKKGLFHSDQVPFNGGSTDSQVNSYVTNPASFKTDFANAMVKMGNLSPLTGSSGQIRT  310

Query  187  DCRRMN  170
            +CR+ N
Sbjct  311  NCRKTN  316



>gb|EYU46001.1| hypothetical protein MIMGU_mgv1a018175mg [Erythranthe guttata]
Length=309

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSG----FTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNG  200
            L S KGLLHSDQQL   G     T+S+V  Y ++P  F +DFA AM+KM  LSPLTGTNG
Sbjct  240  LVSNKGLLHSDQQLFGGGGATTSTDSLVSGYANNPPAFFSDFASAMIKMGNLSPLTGTNG  299

Query  199  EIRRDCRRMN  170
            +IR +CR++N
Sbjct  300  QIRSNCRKIN  309



>ref|XP_002451848.1| hypothetical protein SORBIDRAFT_04g008620 [Sorghum bicolor]
 gb|EES04824.1| hypothetical protein SORBIDRAFT_04g008620 [Sorghum bicolor]
Length=278

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V++Y S+P+ FA+DFA AM+KM  +SPLTGT G+IR 
Sbjct  211  LLAKRGLLHSDQELFNGGSQDALVRQYSSNPALFASDFAAAMIKMGNISPLTGTAGQIRA  270

Query  187  DCRRMN  170
            +CR +N
Sbjct  271  NCRVVN  276



>gb|KDP25490.1| hypothetical protein JCGZ_20646 [Jatropha curcas]
Length=327

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLL SDQ L S G T++IV EY+++P  FA+DFA AMVKM  ++PLTGT GEIRR
Sbjct  262  LVAKQGLLQSDQILFSGGSTDTIVNEYVANPLTFASDFAAAMVKMGNINPLTGTQGEIRR  321

Query  187  DCRRMN  170
             C  +N
Sbjct  322  VCNVVN  327



>ref|XP_009358287.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=319

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L + KGLLHSDQQL S G T+S+V  Y +    F  DFA AMVKM  LSPLTGT G++R 
Sbjct  254  LVNSKGLLHSDQQLFSGGSTDSLVTTYSTTAGTFYTDFASAMVKMGSLSPLTGTTGQVRT  313

Query  187  DCRRMN  170
            +CR++N
Sbjct  314  NCRKIN  319



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S++GLLHSDQQL + G  +SIV  Y ++PS F++DF  AM+KM +  PLTG+NGEIR+
Sbjct  259  LVSKRGLLHSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDNRPLTGSNGEIRK  318

Query  187  DCRRMN  170
            +CR  N
Sbjct  319  NCRTRN  324



>ref|XP_010915491.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G  +++V++Y ++   F  DFA+AMVKM  +SPLTGT+GEIR 
Sbjct  251  LVAQRGLLHSDQELFNGGSQDALVRQYSTYAELFERDFAQAMVKMGSISPLTGTSGEIRL  310

Query  187  DCRRMNY  167
            +CR++N+
Sbjct  311  NCRKVNW  317



>ref|XP_010689732.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=319

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L++++GLLHSDQ+L + G  + +V+ Y S+   FANDFA AMVKM  +SPLTG+NGEIR+
Sbjct  254  LRARRGLLHSDQELFNGGSQDGLVRLYSSNFRAFANDFANAMVKMGNISPLTGSNGEIRK  313

Query  187  DCRRMN  170
            +CR +N
Sbjct  314  NCRVIN  319



>gb|EYU46002.1| hypothetical protein MIMGU_mgv1a009759mg [Erythranthe guttata]
Length=332

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQ L + G T+S+++ Y   P  F +DF  AM+KM ++SPLTG+NGEIR+
Sbjct  267  LIKKKGLLHSDQILYNGGSTDSLIETYSKKPETFNDDFVTAMIKMGDISPLTGSNGEIRK  326

Query  187  DCRRMN  170
            +CRR N
Sbjct  327  NCRRAN  332



>dbj|BAM28608.1| putative peroxidase [Nepenthes alata]
Length=317

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  KGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRRDCRR  176
            KGLLHSDQQL ++G  +S V +Y S PS F+ DFA A+VKM  LSPLTGT G+IR +CR+
Sbjct  255  KGLLHSDQQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNLSPLTGTEGQIRTNCRK  314

Query  175  MN  170
            +N
Sbjct  315  VN  316



>gb|AEX12219.1| hypothetical protein 0_7393_01 [Pinus taeda]
Length=118

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+S++GLLHSDQ+L + G T+S V +Y S+ + F +DFA AM+KM  + PLTGT+GEIR+
Sbjct  53   LKSKRGLLHSDQELFNGGSTDSHVTKYASNQNTFFSDFAAAMLKMGNIKPLTGTSGEIRK  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>gb|AFG67570.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
 gb|AFG67579.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
Length=118

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L++QKGLLHSDQQL + G T+S+V  Y +  + F  DFA AMV M  ++PLTGT+GEIR 
Sbjct  53   LRNQKGLLHSDQQLYNGGSTDSMVTTYSTKQNTFFTDFAAAMVNMGNINPLTGTSGEIRT  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>emb|CAH10840.1| peroxidase [Picea abies]
Length=320

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+ QKGLLHSDQQL + G T+S V  Y ++ + F  DFA AMVKM  +SPLTGT+G+IR+
Sbjct  255  LKVQKGLLHSDQQLFNGGSTDSQVTTYSTNQNSFFTDFAAAMVKMGNISPLTGTSGQIRK  314

Query  187  DCRRMN  170
            +CR+ N
Sbjct  315  NCRKAN  320



>gb|AFG67576.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
Length=118

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L++QKGLLHSDQQL + G T+S+V  Y +  + F  DFA AMV M  ++PLTGT+GEIR 
Sbjct  53   LRNQKGLLHSDQQLYNGGSTDSMVTTYSTKQNTFFTDFATAMVNMGNINPLTGTSGEIRT  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>gb|AFG67567.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
 gb|AFG67568.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
 gb|AFG67573.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
 gb|AFG67574.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
 gb|AFG67577.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
 gb|AFG67578.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
Length=118

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L++QKGLLHSDQQL + G T+S+V  Y +  + F  DFA AMV M  ++PLTGT+GEIR 
Sbjct  53   LRNQKGLLHSDQQLYNGGSTDSMVTTYSTKQNTFFTDFAAAMVNMGNINPLTGTSGEIRT  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>ref|XP_010653358.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=325

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G T+++V  Y +  + F  DFA AMVKM  LSPLTGT+G+IR 
Sbjct  260  LVNKKGLLHSDQQLFNGGSTDAVVNTYSTRSTTFFTDFANAMVKMGNLSPLTGTSGQIRT  319

Query  187  DCRRMN  170
            +CR+ N
Sbjct  320  NCRKTN  325



>ref|XP_010246464.1| PREDICTED: peroxidase P7-like [Nelumbo nucifera]
Length=319

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +S+V+ Y +  + FA DF+ AMV+M  +SPLTGTNGEIR 
Sbjct  254  LVARRGLLHSDQELFNGGSQDSLVRSYSTDGTSFARDFSAAMVRMGNISPLTGTNGEIRL  313

Query  187  DCRRMN  170
            +CRR+N
Sbjct  314  NCRRVN  319



>ref|XP_009790966.1| PREDICTED: peroxidase P7-like [Nicotiana sylvestris]
Length=319

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V+ Y ++ + F +DFA AMV+M  +SPLTGTNGEIRR
Sbjct  254  LVARRGLLHSDQELFNGGSQDALVRSYSTNDAAFRSDFAAAMVRMGNISPLTGTNGEIRR  313

Query  187  DCRRMN  170
            +CR +N
Sbjct  314  NCRAIN  319



>gb|AEW07847.1| hypothetical protein 0_12973_01, partial [Pinus radiata]
Length=118

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L++QKGLLHSDQQL + G T+S+V  Y +  + F  DFA AMV M  ++PLTGT+GEIR 
Sbjct  53   LRNQKGLLHSDQQLYNGGSTDSMVTTYSTKQNTFFTDFAAAMVNMGNVNPLTGTSGEIRT  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>ref|XP_002320417.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE98732.1| peroxidase family protein [Populus trichocarpa]
 gb|AHL39181.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V+ Y ++ + FA DFA AMVKM  +SPLTG NGEIRR
Sbjct  251  LVARRGLLHSDQELFNGGSQDALVRTYSTNGATFARDFAAAMVKMGNISPLTGRNGEIRR  310

Query  187  DCRRMN  170
            +CR +N
Sbjct  311  NCRVVN  316



>ref|XP_004958680.1| PREDICTED: peroxidase 70-like [Setaria italica]
Length=317

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L++Q GLLHSDQQL + G T+ +V+ Y S P++F  DFA +MV+M  +SPLTG+ G+IR 
Sbjct  252  LRAQSGLLHSDQQLFNGGATDGLVRTYASTPTRFNRDFAASMVRMGNISPLTGSQGQIRL  311

Query  187  DCRRMN  170
             C R+N
Sbjct  312  ACSRVN  317



>ref|XP_011033755.1| PREDICTED: peroxidase P7-like [Populus euphratica]
Length=316

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V+ Y ++ + FA DFA AMVKM  +SPLTG NGEIRR
Sbjct  251  LVARRGLLHSDQELFNGGSQDALVRTYSTNGATFARDFAAAMVKMGNISPLTGRNGEIRR  310

Query  187  DCRRMN  170
            +CR +N
Sbjct  311  NCRVVN  316



>gb|AFG67571.1| hypothetical protein 0_12973_01, partial [Pinus taeda]
Length=118

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQQL + G T+S+V  Y +  + F  DFA AMV M  ++PLTGT+GEIR 
Sbjct  53   LSNQKGLLHSDQQLYNGGSTDSMVTTYSTKQNTFFTDFAAAMVNMGNINPLTGTSGEIRT  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>ref|XP_002281755.1| PREDICTED: peroxidase P7 [Vitis vinifera]
Length=317

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G  +++V+ Y ++ + F  DFA AMVKMS +SPLTGTNGEIR 
Sbjct  252  LMTQRGLLHSDQELFNGGSQDALVRTYSANNALFFGDFAAAMVKMSNISPLTGTNGEIRS  311

Query  187  DCRRMN  170
            +CR +N
Sbjct  312  NCRVVN  317



>ref|XP_009593782.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V+ Y ++ + F +DFA AMV+M  +SPLTGTNGEIRR
Sbjct  254  LVARRGLLHSDQELFNGGSQDALVRSYSTNGAAFRSDFAAAMVRMGNISPLTGTNGEIRR  313

Query  187  DCRRMN  170
            +CR +N
Sbjct  314  NCRAIN  319



>ref|XP_003522126.2| PREDICTED: cationic peroxidase 1 [Glycine max]
Length=264

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKF-ANDFAEAMVKMSELSPLTGTNGEIR  191
            L  +KGL HSDQQL S  FT+S VK Y ++PS F  +DFA AM+KMS LSPLTGT G+IR
Sbjct  198  LLYKKGLFHSDQQLYSGSFTDSKVKYYATYPSLFFKSDFANAMLKMSNLSPLTGTQGQIR  257

Query  190  RDCRRMN  170
            + C R+N
Sbjct  258  KVCSRVN  264



>gb|ABK59095.1| peroxidase 1 [Sesbania rostrata]
Length=321

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQ+L + G T+ +VK+Y  +P  F  DFA++M+KM  + PLTG  GE+R 
Sbjct  254  LLQTKGLLHSDQELFNGGSTDELVKQYSYYPEAFFQDFAKSMIKMGNIQPLTGDQGEVRV  313

Query  187  DCRRMNY  167
            DCR++NY
Sbjct  314  DCRKVNY  320



>ref|XP_006833057.1| hypothetical protein AMTR_s00170p00037010 [Amborella trichopoda]
 gb|ERM98335.1| hypothetical protein AMTR_s00170p00037010 [Amborella trichopoda]
Length=315

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V+ Y ++ + F++DFA AMV M  +SPLTGTNGEIR 
Sbjct  250  LVNRRGLLHSDQELFNGGSQDALVRTYSTNGATFSSDFASAMVNMGNISPLTGTNGEIRN  309

Query  187  DCRRMN  170
            +CRR+N
Sbjct  310  NCRRIN  315



>ref|XP_009388702.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=456

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQKGLLHSDQ+L ++G  +++V++Y ++ + F+ DFA AMVKM  +SPLTG+ GEIR 
Sbjct  391  LVSQKGLLHSDQELFNNGTQDALVRQYSTNAAAFSRDFAAAMVKMGNISPLTGSQGEIRL  450

Query  187  DCRRMN  170
            DC+++N
Sbjct  451  DCKKVN  456


 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  ++GLLHSDQ+L + G  +S+V++Y ++ + F+ DFA AMVKM  +SPLTGT GEIR 
Sbjct  254  LVVRRGLLHSDQELFNKGSQDSLVRQYSTNAAAFSCDFAAAMVKMGNISPLTGTKGEIRL  313

Query  187  DCRR  176
            +CR+
Sbjct  314  NCRK  317



>ref|XP_010256951.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=318

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLS-SGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIR  191
            L   KGLLH+DQ+L + S  T+S+VK+Y+ +PSKF  DFA+AMVKM  +SPLTG+ GEIR
Sbjct  252  LLKGKGLLHTDQELFNGSSSTDSLVKKYVGNPSKFFKDFAKAMVKMGNISPLTGSEGEIR  311

Query  190  RDCRRMN  170
             +CR +N
Sbjct  312  FNCRELN  318



>ref|XP_006595847.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=326

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGL+HSDQ+L + G T+S+V+ Y ++P+ F  DF+ AM++M ++SPLTG+ GEIR 
Sbjct  261  LIQKKGLIHSDQELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRE  320

Query  187  DCRRMN  170
            +CRR+N
Sbjct  321  NCRRVN  326



>gb|AEX12220.1| hypothetical protein 0_7393_01 [Pinus taeda]
Length=118

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+S++GLLHSDQ+L + G T+S V +Y S+ + F +DFA AMVKM  + PL GT+GEIR+
Sbjct  53   LKSKRGLLHSDQELFNGGSTDSHVTKYASNQNTFFSDFAAAMVKMGNIKPLNGTSGEIRK  112

Query  187  DCRRMN  170
            +CR+ N
Sbjct  113  NCRKPN  118



>gb|KGN45822.1| hypothetical protein Csa_6G013940 [Cucumis sativus]
Length=265

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLL SDQ L + G T+S+V+ Y + P++F +DFA AMVKM +++PLTG+NG+IR+
Sbjct  200  LVQNKGLLQSDQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRK  259

Query  187  DCRRMN  170
            +CR +N
Sbjct  260  NCRMVN  265



>ref|XP_010915489.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=316

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ L  +G  N +V+ Y ++ S F  DFA AMVKM  +SPLTG NGEIRR
Sbjct  251  LVARRGLLHSDQALFDNGPVNGLVQLYSTNNSVFYTDFAAAMVKMGNISPLTGFNGEIRR  310

Query  187  DCRRMN  170
            +CRR+N
Sbjct  311  NCRRVN  316



>gb|KHN44724.1| Peroxidase 4 [Glycine soja]
Length=318

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGL+HSDQ+L + G T+S+V+ Y ++P+ F  DF+ AM++M ++SPLTG+ GEIR 
Sbjct  253  LIQKKGLIHSDQELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRE  312

Query  187  DCRRMN  170
            +CRR+N
Sbjct  313  NCRRVN  318



>ref|XP_010915490.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +Q+GLLHSDQ+L + G  N++V+ Y +  + FA+DFA AMVKM  +SPLTGT+GEIR 
Sbjct  251  LVAQQGLLHSDQELFNGGSQNALVQRYSNDAALFASDFAGAMVKMGSISPLTGTSGEIRL  310

Query  187  DCRRMN  170
            +CR++N
Sbjct  311  NCRKVN  316



>ref|XP_004298191.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=325

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLL SDQ L S G T+S+V EY S P+KF  DFA AM+KM  ++PLTG+NG+IRR
Sbjct  260  LIQKKGLLASDQVLFSGGSTDSVVSEYSSKPAKFKADFATAMIKMGNINPLTGSNGQIRR  319

Query  187  DCRRMN  170
             C  +N
Sbjct  320  ICSALN  325



>ref|XP_009130879.1| PREDICTED: peroxidase 52-like [Brassica rapa]
 emb|CDY52147.1| BnaA03g55260D [Brassica napus]
Length=324

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L SQ+GLLH DQ L + G T+SIV+EY  +   F NDFA AM+KMS++SPLTG++GEIR 
Sbjct  259  LMSQRGLLHFDQVLFNGGSTDSIVREYSQNARVFRNDFAAAMLKMSQISPLTGSDGEIRM  318

Query  187  DCRRMN  170
             C R N
Sbjct  319  SCGRTN  324



>ref|XP_004510041.1| PREDICTED: peroxidase 52-like [Cicer arietinum]
Length=318

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L + KGL HSDQ L ++G  +++V+ Y ++ +KF++DFA AMVK+S++SPLTGTNGEIR+
Sbjct  253  LIASKGLFHSDQVLFNNGTQDNLVRTYSTNGAKFSSDFAVAMVKLSKISPLTGTNGEIRK  312

Query  187  DCRRMN  170
            +CR +N
Sbjct  313  NCRLVN  318



>ref|XP_002441702.1| hypothetical protein SORBIDRAFT_08g000980 [Sorghum bicolor]
 gb|EES15540.1| hypothetical protein SORBIDRAFT_08g000980 [Sorghum bicolor]
Length=131

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S  GLLHSDQ+L + G T+++V+ Y+S  S F  DF   M+KM +++PLTG+ GEIR+
Sbjct  66   LVSNMGLLHSDQELFNGGATDALVQSYVSSQSAFFADFVTGMIKMGDITPLTGSAGEIRK  125

Query  187  DCRRMN  170
            +CRR+N
Sbjct  126  NCRRIN  131



>gb|AII99880.1| peroxidase [Cicer arietinum]
Length=306

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQ GL HSDQ+L + G T+SIV  Y S PS F  DFA AM+KM  LSPLTG++G+IR 
Sbjct  241  LQSQMGLFHSDQELFNQGSTDSIVDGYSSDPSSFETDFANAMLKMGNLSPLTGSSGQIRT  300

Query  187  DCRRMN  170
             C  +N
Sbjct  301  TCGAIN  306



>ref|XP_008229747.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=319

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL S G T+S+V  Y +    F  DFA AMVKM  LSPLTGT+G+IR 
Sbjct  254  LVDSKGLLHSDQQLFSGGSTDSLVTTYSTSSGTFYTDFANAMVKMGNLSPLTGTSGQIRT  313

Query  187  DCRRMN  170
            +CR+ N
Sbjct  314  NCRKTN  319



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQQL + G T+SIV++Y +  S F   F   M+KM ++SPLTG+NGEIR+
Sbjct  256  LIKKKGLLHSDQQLFNGGSTDSIVRKYSNSRSNFNAHFVAGMIKMGDISPLTGSNGEIRK  315

Query  187  DCRRMN  170
            +CRR+N
Sbjct  316  NCRRVN  321



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLL SDQ L + G T+S+V+ Y + P++F +DFA AMVKM +++PLTG+NG+IR+
Sbjct  257  LVQNKGLLQSDQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRK  316

Query  187  DCRRMN  170
            +CR +N
Sbjct  317  NCRMVN  322



>ref|XP_008780505.1| PREDICTED: peroxidase P7-like, partial [Phoenix dactylifera]
Length=250

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V +Y ++ S FA+DFA AMVKM  +SPLTGT+GEIR 
Sbjct  184  LVARRGLLHSDQELFNGGSQDALVWQYSTNASLFASDFARAMVKMGNISPLTGTSGEIRL  243

Query  187  DCRRMN  170
            +CR++N
Sbjct  244  NCRKVN  249



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S KGLLHSDQ+L + G T+S+VK Y ++P  F +DFA AM+KM ++ PLTG+ GEIR+
Sbjct  258  LLSNKGLLHSDQELFNGGTTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRK  317

Query  187  DCRRMN  170
             C ++N
Sbjct  318  ICSKIN  323



>ref|XP_009365290.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=318

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQ+L + G  +++V+ Y +  + F  DFA AMVKMS +SPLTGTNGEIR+
Sbjct  253  LVARRGLLHSDQELFNGGSQDALVRTYSNDVAAFTRDFAAAMVKMSAISPLTGTNGEIRK  312

Query  187  DCRRMN  170
            +CR +N
Sbjct  313  NCRLVN  318



>ref|XP_004492538.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=317

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            LQSQ GL HSDQ+L + G T+SIV  Y S PS F  DFA AM+KM  LSPLTG++G+IR 
Sbjct  252  LQSQMGLFHSDQELFNQGSTDSIVDGYSSDPSSFETDFANAMLKMGNLSPLTGSSGQIRT  311

Query  187  DCRRMN  170
             C  +N
Sbjct  312  TCGAIN  317



>ref|XP_009410536.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=321

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S KGLLHSDQ+L + G T+S VK Y +    F +DFA AM+KM ++SPLTG++GEIR+
Sbjct  256  LISTKGLLHSDQELYNGGSTDSQVKAYSNSSGSFYSDFAAAMIKMGDISPLTGSSGEIRK  315

Query  187  DCRRMN  170
            +CR++N
Sbjct  316  NCRKIN  321



>ref|XP_004297785.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=327

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLL SDQ L S G T+SIV EY S P+ F  DFA AM+KM +++PLTG+NG+IRR
Sbjct  262  LIQKKGLLASDQVLFSGGSTDSIVSEYSSKPANFKADFAAAMIKMGDINPLTGSNGQIRR  321

Query  187  DCRRMN  170
             C  +N
Sbjct  322  ICSALN  327



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L   KGLLHSDQQL + G T+SIV+ Y +  + F++DFA AM+KM ++ PLTG++GEIR+
Sbjct  254  LIQNKGLLHSDQQLFNGGSTDSIVRAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGEIRK  313

Query  187  DCRRMN  170
            +CR+ N
Sbjct  314  NCRKTN  319



>ref|XP_010263840.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=318

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S KGLLHSDQQL + G T+S V+ Y ++ + F +DF  AM+KM  LSPLTGT+G++R 
Sbjct  253  LLSNKGLLHSDQQLFNGGSTDSQVRTYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQLRT  312

Query  187  DCRRMN  170
            +CRR+N
Sbjct  313  NCRRVN  318



>ref|XP_006348978.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=319

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L++++GLL SDQ+L + G  +S+VK Y S    F  D+A AMVKM  +SPLTGTNGEIRR
Sbjct  254  LEARRGLLQSDQELFNGGSQDSLVKSYSSDGEAFKRDYASAMVKMGNISPLTGTNGEIRR  313

Query  187  DCRRMN  170
            +CR +N
Sbjct  314  NCRAIN  319



>gb|KDO41520.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=298

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQ L + G T+S+V  Y S+   F +DFA AM+KM ++SPLTG+ GEIR+
Sbjct  233  LLNQKGLLHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEIRK  292

Query  187  DCRRMN  170
            +CRR N
Sbjct  293  NCRRPN  298



>ref|XP_002438530.1| hypothetical protein SORBIDRAFT_10g021630 [Sorghum bicolor]
 gb|EER89897.1| hypothetical protein SORBIDRAFT_10g021630 [Sorghum bicolor]
Length=329

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GL HSDQ+L + G  +++VK+Y  + + FA DFA+AMV+M  +SPLTGT GE+R 
Sbjct  264  LMARQGLFHSDQELFNGGSQDALVKKYSGNAAMFAADFAKAMVRMGAISPLTGTQGEVRL  323

Query  187  DCRRMN  170
            DCR++N
Sbjct  324  DCRKVN  329



>gb|KDO57833.1| hypothetical protein CISIN_1g024722mg [Citrus sinensis]
Length=263

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLL SDQ L S G T+ IV EY  +PSKF +DFA AM+KM+++SPLTGT G+IRR
Sbjct  198  LIQKKGLLASDQVLFSGGSTDYIVDEYSKNPSKFKSDFAAAMIKMADISPLTGTAGQIRR  257

Query  187  DCRRMN  170
             C  +N
Sbjct  258  VCNIVN  263



>gb|EPS63041.1| hypothetical protein M569_11749, partial [Genlisea aurea]
Length=316

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +++GLLHSDQQL S G  +S+V+ Y ++   F  +FA+AMVKM  +SPLTGT GEIRR
Sbjct  251  LLTRRGLLHSDQQLFSGGSQDSLVQFYSNNDFAFRREFADAMVKMGNISPLTGTQGEIRR  310

Query  187  DCRRMN  170
            +CRR+N
Sbjct  311  NCRRVN  316



>ref|XP_006468162.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
 gb|KDO41521.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=323

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L +QKGLLHSDQ L + G T+S+V  Y S+   F +DFA AM+KM ++SPLTG+ GEIR+
Sbjct  258  LLNQKGLLHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEIRK  317

Query  187  DCRRMN  170
            +CRR N
Sbjct  318  NCRRPN  323



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L S KGLLHSDQ+L + G T+S+VK Y ++P  F +DFA AM+KM ++ PLTG+ GEIR+
Sbjct  258  LLSNKGLLHSDQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRK  317

Query  187  DCRRMN  170
             C ++N
Sbjct  318  ICSKVN  323



>ref|XP_003522012.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=409

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  QKGLLHSDQQL ++G T++IV+ Y  +P  F  DFA+ M KM  LSPLTGTNG+IR+
Sbjct  344  LLKQKGLLHSDQQLYNNGSTDTIVEFYAKNPLGFRTDFAKVMTKMGNLSPLTGTNGQIRK  403

Query  187  DCRRMN  170
             C ++N
Sbjct  404  QCSKVN  409



>ref|XP_006843744.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
 gb|ERN05419.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
Length=318

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G ++S+V+ Y S+   F  DF  AM+KM ++ PLTG+NGEIR+
Sbjct  253  LINKKGLLHSDQQLFNGGSSDSLVRSYSSNSDLFDKDFVAAMIKMGDIKPLTGSNGEIRK  312

Query  187  DCRRMN  170
            +CR++N
Sbjct  313  NCRKIN  318



>dbj|BAM28609.1| putative peroxidase [Nepenthes alata]
Length=317

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  KGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRRDCRR  176
            KGLLHSDQQL ++G  +S V +Y S PS F+ DFA A+VKM   SPLTGT G+IR +CR+
Sbjct  255  KGLLHSDQQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNFSPLTGTEGQIRTNCRK  314

Query  175  MN  170
            +N
Sbjct  315  VN  316



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L ++KGLLHSDQQL + G T+S V  Y ++ +KF +DFA AMV M  +SPLTGT+GEIR 
Sbjct  251  LVNKKGLLHSDQQLYNGGSTDSQVTTYANNFAKFYSDFAAAMVNMGNISPLTGTSGEIRT  310

Query  187  DCRRMN  170
            +CR++N
Sbjct  311  NCRKIN  316



>gb|AFG61207.1| hypothetical protein 0_13032_02, partial [Pinus taeda]
Length=138

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+SQKGLLHSDQQL + G T+S+V  Y ++ + F +DF  +M+ M  ++PLTGT+GEIR+
Sbjct  73   LRSQKGLLHSDQQLYNGGSTDSMVTTYSNNKNTFFSDFPTSMINMGNINPLTGTSGEIRK  132

Query  187  DCRRMN  170
            +CR+ N
Sbjct  133  NCRKPN  138



>ref|XP_004978383.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=290

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L  +KGLLHSDQ+L + G T++ V+ Y+S  S F  DF   M+KM +++PLTG+NGEIR+
Sbjct  225  LVCKKGLLHSDQELSNGGSTDAQVRSYVSSQSAFFADFVTGMIKMGDITPLTGSNGEIRK  284

Query  187  DCRRMN  170
            +CRR+N
Sbjct  285  NCRRIN  290



>gb|AFG61206.1| hypothetical protein 0_13032_02, partial [Pinus taeda]
Length=138

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  367  LQSQKGLLHSDQQLLSSGFTNSIVKEYISHPSKFANDFAEAMVKMSELSPLTGTNGEIRR  188
            L+SQKGLLHSDQQL + G T+S+V  Y ++ + F +DF  +M+ M  ++PLTGT+GEIR+
Sbjct  73   LRSQKGLLHSDQQLYNGGSTDSMVTTYSNNKNTFFSDFPTSMISMGNINPLTGTSGEIRK  132

Query  187  DCRRMN  170
            +CR+ N
Sbjct  133  NCRKPN  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514511713122