BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16248_g2_i1 len=366 path=[39:0-208 38:209-365]

Length=366
                                                                      Score     E

gb|AFX67017.1|  60S ribosomal protein L27                             80.5    5e-17   
ref|XP_009592072.1|  PREDICTED: 60S ribosomal protein L27-3-like      81.3    9e-17   
ref|XP_009787670.1|  PREDICTED: 60S ribosomal protein L27-3-like      81.3    1e-16   
ref|XP_004243641.1|  PREDICTED: 60S ribosomal protein L27-3           80.5    2e-16   
gb|AFW90619.1|  ribosomal protein L27                                 80.5    2e-16   
dbj|BAA96367.1|  ribosomal protein L27                                79.7    3e-16   Panax ginseng [Chinese ginseng]
gb|EYU32722.1|  hypothetical protein MIMGU_mgv1a016082mg              79.3    5e-16   
emb|CDP16031.1|  unnamed protein product                              79.0    8e-16   
emb|CBI21769.3|  unnamed protein product                              77.0    1e-15   
ref|XP_010925925.1|  PREDICTED: 60S ribosomal protein L27-3-like      76.6    5e-15   
ref|XP_002267478.1|  PREDICTED: 60S ribosomal protein L27             76.6    5e-15   Vitis vinifera
ref|XP_009410911.1|  PREDICTED: 60S ribosomal protein L27             76.6    5e-15   
ref|XP_010052670.1|  PREDICTED: 60S ribosomal protein L27-like        76.6    6e-15   
ref|XP_006853437.1|  hypothetical protein AMTR_s00032p00176990        76.3    7e-15   
gb|KHN47720.1|  60S ribosomal protein L27                             75.9    8e-15   
ref|XP_010245429.1|  PREDICTED: 60S ribosomal protein L27-2-like      75.1    8e-15   
ref|XP_009395723.1|  PREDICTED: 60S ribosomal protein L27-like        76.3    8e-15   
ref|XP_010667820.1|  PREDICTED: 60S ribosomal protein L27-3-like      76.3    8e-15   
ref|XP_003546393.1|  PREDICTED: 60S ribosomal protein L27-like        75.9    9e-15   
ref|XP_011005551.1|  PREDICTED: 60S ribosomal protein L27-3           75.5    1e-14   
ref|XP_009609639.1|  PREDICTED: 60S ribosomal protein L27             75.5    1e-14   
gb|AAA86951.1|  ribosomal protein L27 homolog                         75.5    1e-14   Pisum sativum [garden pea]
ref|XP_010112899.1|  60S ribosomal protein L27                        75.5    2e-14   
ref|XP_010245426.1|  PREDICTED: 60S ribosomal protein L27-3           75.5    2e-14   
ref|XP_008805968.1|  PREDICTED: 60S ribosomal protein L27-3-like      75.5    2e-14   
gb|AAA86950.1|  ribosomal protein L27 homolog                         75.5    2e-14   Pisum sativum [garden pea]
ref|XP_010666201.1|  PREDICTED: 60S ribosomal protein L27-1-like      75.5    2e-14   
sp|Q05462.1|RL27_PEA  RecName: Full=60S ribosomal protein L27         75.1    2e-14   Pisum sativum [garden pea]
ref|XP_010056834.1|  PREDICTED: 60S ribosomal protein L27             75.1    2e-14   
emb|CAN79575.1|  hypothetical protein VITISV_032808                   75.1    2e-14   Vitis vinifera
ref|XP_010056839.1|  PREDICTED: 60S ribosomal protein L27-like        75.1    2e-14   
ref|XP_010648729.1|  PREDICTED: 60S ribosomal protein L27-3           75.1    2e-14   
gb|AAA86952.1|  ribosomal protein L27 homolog                         75.1    2e-14   Pisum sativum [garden pea]
ref|XP_009396530.1|  PREDICTED: 60S ribosomal protein L27-like        75.1    2e-14   
ref|XP_004485468.1|  PREDICTED: 60S ribosomal protein L27-like        75.1    2e-14   
ref|XP_010532514.1|  PREDICTED: 60S ribosomal protein L27-3           74.7    2e-14   
ref|XP_009619209.1|  PREDICTED: 60S ribosomal protein L27-like        74.7    2e-14   
ref|XP_009781608.1|  PREDICTED: 60S ribosomal protein L27-like        74.7    2e-14   
ref|XP_010915919.1|  PREDICTED: 60S ribosomal protein L27-3-like      74.7    2e-14   
ref|XP_004147740.1|  PREDICTED: 60S ribosomal protein L27-like        74.7    3e-14   
ref|XP_008451854.1|  PREDICTED: 60S ribosomal protein L27             74.3    3e-14   
ref|XP_008451849.1|  PREDICTED: 60S ribosomal protein L27-like        74.3    3e-14   
ref|XP_004241408.1|  PREDICTED: 60S ribosomal protein L27             74.3    3e-14   
ref|XP_004147739.1|  PREDICTED: 60S ribosomal protein L27-like        74.3    4e-14   
ref|XP_008801508.1|  PREDICTED: 60S ribosomal protein L27-3-like      73.9    4e-14   
ref|XP_010525173.1|  PREDICTED: 60S ribosomal protein L27-3-like      74.3    4e-14   
ref|XP_009395990.1|  PREDICTED: 60S ribosomal protein L27-3           73.9    5e-14   
ref|XP_002300063.1|  60S ribosomal protein L27                        73.9    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008783218.1|  PREDICTED: 60S ribosomal protein L27-3-like      73.9    5e-14   
ref|XP_004486790.1|  PREDICTED: 60S ribosomal protein L27-like        73.9    5e-14   
ref|XP_003592964.1|  60S ribosomal protein L27                        73.9    5e-14   
gb|AFK47915.1|  unknown                                               73.6    6e-14   
gb|ACJ86190.1|  unknown                                               73.6    7e-14   Medicago truncatula
ref|XP_010256388.1|  PREDICTED: 60S ribosomal protein L27-3-like      73.6    7e-14   
ref|XP_006840323.1|  hypothetical protein AMTR_s00045p00086530        73.6    7e-14   
ref|NP_001236951.1|  uncharacterized protein LOC100527246             73.6    8e-14   
ref|XP_008357506.1|  PREDICTED: 60S ribosomal protein L27-like        73.6    8e-14   
ref|XP_006481358.1|  PREDICTED: 60S ribosomal protein L27-like        73.6    8e-14   
gb|ADR71246.1|  60S ribosomal protein L27C                            73.6    8e-14   
gb|KDP22049.1|  hypothetical protein JCGZ_02471                       73.2    9e-14   
ref|XP_011004462.1|  PREDICTED: 60S ribosomal protein L27             73.2    1e-13   
ref|XP_004487922.1|  PREDICTED: 60S ribosomal protein L27-like        73.2    1e-13   
ref|XP_002308823.1|  ribosomal protein L27                            72.8    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008384054.1|  PREDICTED: 60S ribosomal protein L27-like        72.8    1e-13   
ref|XP_006441055.1|  hypothetical protein CICLE_v10024407mg           72.8    1e-13   
ref|XP_006478048.1|  PREDICTED: 60S ribosomal protein L27-like        72.8    1e-13   
ref|XP_007049015.1|  Ribosomal L27e protein family                    72.8    1e-13   
ref|XP_010466495.1|  PREDICTED: 60S ribosomal protein L27-2-like      73.2    1e-13   
ref|XP_011095690.1|  PREDICTED: 60S ribosomal protein L27-3-like      72.8    1e-13   
gb|ABK93641.1|  unknown                                               72.8    2e-13   Populus trichocarpa [western balsam poplar]
gb|KFK22901.1|  hypothetical protein AALP_AAs72951U000100             72.4    2e-13   
ref|XP_010551737.1|  PREDICTED: 60S ribosomal protein L27-3-like      72.4    2e-13   
ref|XP_002870267.1|  60S ribosomal protein L27                        72.4    2e-13   
ref|XP_010435004.1|  PREDICTED: 60S ribosomal protein L27-3           72.4    2e-13   
ref|XP_006406196.1|  hypothetical protein EUTSA_v10021742mg           72.4    2e-13   
ref|XP_004171636.1|  PREDICTED: 60S ribosomal protein L27-like        72.4    2e-13   
gb|KGN44160.1|  hypothetical protein Csa_7G209560                     72.4    2e-13   
ref|XP_010511086.1|  PREDICTED: 60S ribosomal protein L27-2-like      72.4    2e-13   
gb|EYU27541.1|  hypothetical protein MIMGU_mgv1a014965mg              73.2    2e-13   
ref|XP_010488240.1|  PREDICTED: 60S ribosomal protein L27-2           72.4    2e-13   
gb|KHN26621.1|  60S ribosomal protein L27                             72.0    2e-13   
ref|XP_010440362.1|  PREDICTED: 60S ribosomal protein L27-3-like      72.4    2e-13   
ref|NP_193236.1|  60S ribosomal protein L27-3                         72.4    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004139786.1|  PREDICTED: 60S ribosomal protein L27-3-like      72.4    2e-13   
ref|XP_007158885.1|  hypothetical protein PHAVU_002G190100g           72.4    2e-13   
gb|KFK39514.1|  hypothetical protein AALP_AA3G254000                  72.0    2e-13   
ref|NP_001241619.1|  uncharacterized protein LOC100799485             72.0    3e-13   
ref|XP_003594893.1|  60S ribosomal protein L27                        73.2    3e-13   
ref|XP_006298793.1|  hypothetical protein CARUB_v10014896mg           72.0    3e-13   
ref|XP_009375332.1|  PREDICTED: 60S ribosomal protein L27             71.6    3e-13   
ref|XP_007138839.1|  hypothetical protein PHAVU_009G241700g           71.6    3e-13   
gb|KGN54977.1|  60S ribosomal protein L27                             71.6    4e-13   
ref|XP_008464678.1|  PREDICTED: 60S ribosomal protein L27-3-like      71.6    4e-13   
ref|XP_004145994.1|  PREDICTED: 60S ribosomal protein L27-3-like      71.6    4e-13   
ref|XP_003531105.1|  PREDICTED: 60S ribosomal protein L27-like        71.6    4e-13   
gb|EYU33768.1|  hypothetical protein MIMGU_mgv1a016080mg              71.2    4e-13   
ref|XP_006284734.1|  hypothetical protein CARUB_v10005997mg           71.2    5e-13   
ref|XP_002323180.1|  ribosomal protein L27                            71.2    5e-13   Populus trichocarpa [western balsam poplar]
gb|KHN25920.1|  60S ribosomal protein L27                             68.9    7e-13   
ref|XP_011097648.1|  PREDICTED: 60S ribosomal protein L27-like        70.9    8e-13   
ref|NP_188862.1|  60S ribosomal protein L27-2                         70.9    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004303940.1|  PREDICTED: 60S ribosomal protein L27-like        70.5    9e-13   
gb|AAM63601.1|  ribosomal protein L27, putative                       70.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AFK44178.1|  unknown                                               70.5    1e-12   
gb|KDP25114.1|  hypothetical protein JCGZ_22649                       70.1    1e-12   
ref|XP_002513410.1|  60S ribosomal protein L27e, putative             70.1    1e-12   Ricinus communis
ref|XP_008342300.1|  PREDICTED: 60S ribosomal protein L27             70.1    2e-12   
emb|CDY58747.1|  BnaCnng33680D                                        68.9    2e-12   
emb|CDY37397.1|  BnaC05g30330D                                        68.9    2e-12   
gb|ABK93484.1|  unknown                                               69.3    2e-12   Populus trichocarpa [western balsam poplar]
emb|CDY50270.1|  BnaAnng10340D                                        68.9    2e-12   
ref|XP_011000630.1|  PREDICTED: 60S ribosomal protein L27-3-like      69.3    2e-12   
emb|CDY09044.1|  BnaC08g09980D                                        68.9    3e-12   
ref|XP_004300496.1|  PREDICTED: 60S ribosomal protein L27-like        69.3    3e-12   
ref|XP_009109081.1|  PREDICTED: 60S ribosomal protein L27-3           69.3    3e-12   
ref|XP_009145415.1|  PREDICTED: 60S ribosomal protein L27-3           68.9    3e-12   
ref|XP_009147953.1|  PREDICTED: 60S ribosomal protein L27-3-like      68.9    3e-12   
ref|XP_007213975.1|  hypothetical protein PRUPE_ppa013198mg           68.9    4e-12   
emb|CDY22727.1|  BnaA08g05570D                                        68.6    4e-12   
ref|NP_180781.1|  60S ribosomal protein L27-1                         68.9    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225811.1|  PREDICTED: 60S ribosomal protein L27-3 isofo...  68.2    7e-12   
ref|XP_002879375.1|  60S ribosomal protein L27                        68.2    7e-12   
gb|EPS69465.1|  hypothetical protein M569_05303                       68.2    8e-12   
gb|ADE76927.1|  unknown                                               67.8    1e-11   
ref|XP_009107813.1|  PREDICTED: 60S ribosomal protein L27-3-like      67.8    1e-11   
ref|XP_001777437.1|  predicted protein                                67.4    1e-11   
ref|XP_008371879.1|  PREDICTED: 60S ribosomal protein L27-3-like      67.4    1e-11   
gb|KDO47076.1|  hypothetical protein CISIN_1g041379mg                 66.2    2e-11   
gb|EPS70266.1|  hypothetical protein M569_04494                       67.8    2e-11   
ref|XP_001768302.1|  predicted protein                                67.0    2e-11   
gb|ABK22795.1|  unknown                                               66.6    3e-11   Picea sitchensis
ref|NP_001278543.1|  60S ribosomal protein L27                        66.2    3e-11   
ref|XP_007215138.1|  hypothetical protein PRUPE_ppa013188mg           66.2    4e-11   
ref|XP_001766314.1|  predicted protein                                65.5    7e-11   
gb|AFW68968.1|  60S ribosomal protein L27                             66.6    8e-11   
ref|XP_002949746.1|  component of cytosolic 80S ribosome and 60S ...  65.5    8e-11   
ref|XP_005850467.1|  hypothetical protein CHLNCDRAFT_57155            65.1    9e-11   
ref|XP_001782583.1|  predicted protein                                65.1    9e-11   
gb|AAT84169.1|  60S ribosomal protein L27                             64.7    1e-10   Chara globularis
gb|ABR25709.1|  60S ribosomal protein l27                             63.2    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_008225812.1|  PREDICTED: 60S ribosomal protein L27-3 isofo...  64.3    2e-10   
gb|KDO45446.1|  hypothetical protein CISIN_1g039578mg                 63.2    2e-10   
ref|XP_006293395.1|  hypothetical protein CARUB_v10024296mg           63.9    2e-10   
ref|XP_001691762.1|  ribosomal protein L27, component of cytosoli...  63.9    3e-10   Chlamydomonas reinhardtii
ref|NP_001065410.1|  Os10g0564300                                     63.5    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437450.1|  hypothetical protein SORBIDRAFT_10g027330        63.5    3e-10   Sorghum bicolor [broomcorn]
ref|XP_002532350.1|  60S ribosomal protein L27e, putative             63.5    3e-10   Ricinus communis
gb|KDD76779.1|  hypothetical protein H632_c107p1                      63.2    4e-10   
ref|NP_001288625.1|  60S ribosomal protein L27                        62.4    8e-10   
ref|XP_002447124.1|  hypothetical protein SORBIDRAFT_06g029070        62.4    9e-10   Sorghum bicolor [broomcorn]
ref|XP_008668869.1|  PREDICTED: 60S ribosomal protein L27-3-like      62.8    1e-09   
ref|XP_008225810.1|  PREDICTED: 60S ribosomal protein L27-3 isofo...  63.2    1e-09   
ref|XP_002504446.1|  predicted protein                                62.0    1e-09   Micromonas commoda
ref|XP_001417642.1|  Ribosomal protein L27, component of cytosoli...  62.0    1e-09   Ostreococcus lucimarinus CCE9901
gb|EPS58045.1|  hypothetical protein M569_16772                       61.6    1e-09   
sp|P41101.1|RL27_SOLTU  RecName: Full=60S ribosomal protein L27       61.6    2e-09   Solanum tuberosum [potatoes]
ref|XP_005650056.1|  ribosomal protein L27 component of cytosolic...  61.2    2e-09   
gb|KFM27058.1|  60S ribosomal protein L27                             61.2    2e-09   
ref|XP_003059933.1|  predicted protein                                60.1    5e-09   
ref|XP_002964492.1|  hypothetical protein SELMODRAFT_166700           60.1    5e-09   
emb|CEF97804.1|  Ribosomal protein L27e                               60.1    6e-09   
ref|XP_003079117.1|  RL27_PEA 60S ribosomal protein L27 pir||T064...  59.7    1e-08   
ref|XP_007514349.1|  60S ribosomal protein L27                        59.7    1e-08   
gb|AAA86949.1|  ribosomal protein L27 homolog                         57.0    2e-08   Pisum sativum [garden pea]
ref|XP_003563284.1|  PREDICTED: 60S ribosomal protein L27-3-like      57.8    3e-08   
gb|ACG47567.1|  hypothetical protein                                  56.2    4e-08   Zea mays [maize]
emb|CBI27167.3|  unnamed protein product                              57.0    7e-08   
ref|NP_001146947.1|  60S ribosomal protein L27                        56.6    1e-07   Zea mays [maize]
gb|KFK31141.1|  hypothetical protein AALP_AA6G074200                  56.6    1e-07   
ref|XP_006661913.1|  PREDICTED: 60S ribosomal protein L27-3-like      56.6    1e-07   
ref|NP_001046570.1|  Os02g0284600                                     56.6    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963680.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...  57.4    1e-07   
sp|Q02984.1|RL27_PYRST  RecName: Full=60S ribosomal protein L27       56.2    1e-07   Pyrobotrys stellata
ref|XP_007048317.1|  Ribosomal L27e protein family                    55.8    2e-07   
ref|XP_006656055.1|  PREDICTED: 60S ribosomal protein L27-3-like      55.5    3e-07   
ref|XP_006361947.1|  PREDICTED: 60S ribosomal protein L27-like        54.3    5e-07   
gb|KHN39496.1|  UTP--glucose-1-phosphate uridylyltransferase          57.0    7e-07   
ref|XP_006681056.1|  hypothetical protein BATDEDRAFT_26801            53.9    7e-07   
gb|EMT11141.1|  60S ribosomal protein L27-3                           53.9    9e-07   
ref|XP_005789333.1|  hypothetical protein EMIHUDRAFT_433742           53.1    2e-06   
gb|KCW76743.1|  hypothetical protein EUGRSUZ_D01098                   53.1    2e-06   
ref|XP_011111379.1|  hypothetical protein H072_5500                   52.0    2e-06   
ref|XP_003673734.1|  hypothetical protein NCAS_0A07950                52.4    3e-06   
ref|XP_005705277.1|  60S ribosomal protein L27e                       51.6    4e-06   
ref|XP_003177187.1|  60S ribosomal protein L27                        51.6    5e-06   
ref|XP_002850593.1|  60S ribosomal protein L27                        51.6    5e-06   Arthroderma otae CBS 113480
gb|EZF11226.1|  hypothetical protein H100_07669                       51.6    5e-06   
gb|EZF11225.1|  hypothetical protein H100_07669                       51.6    5e-06   
gb|EGE00457.1|  60S ribosomal protein L27-A                           51.6    5e-06   
ref|XP_002796051.1|  60S ribosomal protein L27                        51.2    8e-06   Paracoccidioides lutzii Pb01
gb|EEH04844.1|  60S ribosomal protein L27A                            50.8    8e-06   Histoplasma capsulatum G186AR
ref|XP_002623468.1|  60S ribosomal protein L27                        50.8    8e-06   Blastomyces gilchristii SLH14081
gb|EEQ42005.1|  60S ribosomal protein L27                             50.1    1e-05   Candida albicans
gb|KGG50862.1|  60S ribosomal protein L27                             50.8    1e-05   
ref|XP_007375790.1|  60S ribosomal protein L27                        50.8    1e-05   
gb|EEH39750.2|  60S ribosomal protein L27-A                           50.8    1e-05   Paracoccidioides lutzii Pb01
ref|XP_004208596.1|  PREDICTED: 60S ribosomal protein L27-like        50.4    1e-05   
emb|CCF49643.1|  probable 60S large subunit ribosomal protein L27     50.4    1e-05   
ref|XP_004202042.1|  Piso0_001515                                     50.4    1e-05   
gb|KEQ61101.1|  hypothetical protein M437DRAFT_67485                  50.4    1e-05   
gb|KGQ97393.1|  60S ribosomal protein L27                             50.1    2e-05   
gb|EST08473.1|  putative 60S large subunit ribosomal protein L27      50.1    2e-05   
sp|Q9P843.1|RL27_CANAX  RecName: Full=60S ribosomal protein L27       50.1    2e-05   Candida albicans
gb|AAX48860.1|  L27                                                   50.1    2e-05   Suberites domuncula
ref|XP_005836830.1|  large subunit ribosomal protein L27e, cytopl...  50.1    2e-05   
gb|ADW95787.1|  60S ribosomal L27-like protein                        49.7    2e-05   
ref|XP_002417801.1|  60S ribosomal protein L27                        49.7    2e-05   Candida dubliniensis CD36
ref|XP_003143636.1|  ribosomal protein L27                            49.7    2e-05   
gb|EKG17758.1|  Ribosomal protein L27e                                49.7    2e-05   
gb|KHN76565.1|  60S ribosomal protein L27                             49.7    3e-05   
gb|KFH66695.1|  ribosomal protein L27e                                48.9    3e-05   
ref|XP_001244078.1|  conserved hypothetical protein                   48.9    3e-05   Coccidioides immitis RS
gb|ELR02028.1|  large subunit ribosomal protein L27e                  49.3    3e-05   
ref|XP_004335925.1|  ribosomal L27e protein family                    49.3    3e-05   
emb|CDI52972.1|  probable 60S large subunit ribosomal protein L27     49.7    3e-05   
ref|XP_761336.1|  hypothetical protein UM05189.1                      50.1    3e-05   Ustilago maydis 521
ref|XP_003666882.1|  hypothetical protein MYCTH_2316558               49.3    3e-05   
ref|XP_002840000.1|  60S ribosomal protein L27                        49.3    3e-05   Tuber melanosporum Mel28
dbj|GAD94676.1|  60S ribosomal protein L27                            49.3    4e-05   
emb|CDS12808.1|  Putative 60S ribosomal protein L27                   49.3    4e-05   
emb|CDH60503.1|  60s ribosomal protein l27                            49.3    4e-05   
dbj|GAC92959.1|  hypothetical protein PHSY_000519                     50.1    4e-05   
ref|XP_003870903.1|  Rpl27a ribosomal protein L27                     48.9    4e-05   
gb|EIF48001.1|  60s ribosomal protein l27-a                           48.9    4e-05   
ref|XP_003068700.1|  60S ribosomal protein L27                        48.9    4e-05   
ref|XP_009154245.1|  60S ribosomal protein L27-A                      48.9    4e-05   
emb|CDQ01733.1|  Protein BM-RPL-27, isoform a                         48.9    4e-05   
ref|XP_004992561.1|  60S ribosomal protein RL27                       48.9    4e-05   
ref|XP_001897240.1|  60S ribosomal protein L27                        48.9    4e-05   Brugia malayi [agent of lymphatic filariasis]
ref|XP_002732673.1|  PREDICTED: 60S ribosomal protein L27-like is...  48.9    5e-05   Saccoglossus kowalevskii
gb|EJW88292.1|  60S ribosomal protein L27                             48.9    5e-05   
ref|XP_002381915.1|  60S ribosomal protein L27                        48.9    5e-05   Aspergillus flavus NRRL3357
ref|XP_006813962.1|  PREDICTED: 60S ribosomal protein L27-like is...  48.9    5e-05   
dbj|BAE56933.1|  unnamed protein product                              48.9    5e-05   Aspergillus oryzae
gb|EGE06122.1|  60S ribosomal protein L27-A                           48.9    5e-05   
ref|XP_008076838.1|  60S ribosomal protein L27                        49.7    5e-05   
ref|XP_661826.1|  hypothetical protein AN4222.2                       48.5    5e-05   Aspergillus nidulans FGSC A4
emb|CEJ79979.1|  Putative 60S ribosomal protein L27                   48.5    5e-05   
gb|ABW23226.1|  ribosomal protein rpl27                               47.8    6e-05   Eurythoe complanata
gb|EKV09886.1|  60S ribosomal protein L27                             48.5    6e-05   
ref|NP_001078392.1|  60S ribosomal protein L27-3                      48.5    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009228409.1|  60S ribosomal protein L27-A                      48.5    6e-05   
ref|XP_002549225.1|  60S ribosomal protein L27                        47.8    6e-05   Candida tropicalis MYA-3404
ref|XP_003657733.1|  60S ribosomal protein L27                        48.5    6e-05   
gb|ABW90358.1|  putative ribosomal protein L27                        48.5    6e-05   Sipunculus nudus
gb|ESZ92505.1|  60S ribosomal protein L27                             48.5    6e-05   
ref|XP_001386921.1|  60S ribosomal protein L27                        48.5    6e-05   Scheffersomyces stipitis CBS 6054
ref|XP_004343406.1|  60S ribosomal protein RL27                       48.5    6e-05   
ref|XP_003671515.1|  ribosomal protein L27                            48.5    6e-05   
gb|EKV08347.1|  60S ribosomal protein L27                             48.5    6e-05   
ref|XP_001556037.1|  60S ribosomal protein L27                        48.5    6e-05   Botrytis cinerea B05.10
emb|CAJ17394.1|  ribosomal protein L27e                               47.8    7e-05   Micromalthus debilis
ref|XP_007723939.1|  60S ribosomal protein L27-B                      48.1    7e-05   
ref|XP_007759980.1|  60S ribosomal protein L27-B                      48.1    7e-05   
ref|XP_008724849.1|  hypothetical protein G647_02277                  48.1    7e-05   
gb|ABW23181.1|  ribosomal protein rpl27                               48.1    7e-05   Arenicola marina [rock worm]
ref|XP_007734900.1|  60S ribosomal protein L27-A                      48.1    7e-05   
ref|XP_007780844.1|  hypothetical protein W97_04765                   48.5    7e-05   
ref|XP_009010096.1|  hypothetical protein HELRODRAFT_71308            48.1    7e-05   
gb|KEF60699.1|  large subunit ribosomal protein L27e                  48.9    7e-05   
ref|XP_007915246.1|  putative 60s ribosomal protein l27 protein       48.1    8e-05   
gb|KGO44919.1|  Ribosomal protein L27e                                48.1    8e-05   
ref|XP_006685520.1|  60S ribosomal protein L27                        48.1    8e-05   
ref|XP_003745113.1|  PREDICTED: 60S ribosomal protein L27-like        48.1    9e-05   
gb|KFH41474.1|  60S ribosomal protein L27-A-like protein              48.1    9e-05   
gb|KDO37913.1|  hypothetical protein CISIN_1g035907mg                 47.8    9e-05   
ref|XP_007295649.1|  60S ribosomal protein l27e                       48.5    9e-05   
ref|XP_011124954.1|  hypothetical protein AOL_s00109g171              47.8    1e-04   
emb|CCE33002.1|  probable 60S large subunit ribosomal protein         47.8    1e-04   
ref|XP_003956701.1|  hypothetical protein KAFR_0C05750                47.8    1e-04   
ref|XP_003670669.1|  ribosomal protein L27                            47.8    1e-04   
ref|XP_002582543.1|  60S ribosomal protein L27-A                      48.5    1e-04   Uncinocarpus reesii 1704
ref|NP_010759.1|  ribosomal 60S subunit protein L27B                  47.8    1e-04   Saccharomyces cerevisiae S288c
ref|NP_011874.1|  ribosomal 60S subunit protein L27A                  47.8    1e-04   Saccharomyces cerevisiae S288c
emb|CBQ72390.1|  probable 60S large subunit ribosomal protein L27     47.8    1e-04   
pdb|4BYN|Z  Chain Z, Cryo-em Reconstruction Of The 80s-eif5b-met-...  47.8    1e-04   
gb|KFX49293.1|  60S ribosomal protein L27-B                           47.8    1e-04   
gb|EWZ02401.1|  60S ribosomal protein L27-A                           47.8    1e-04   
gb|EEU07909.1|  Rpl27ap                                               47.8    1e-04   Saccharomyces cerevisiae JAY291
emb|CCK68773.1|  hypothetical protein KNAG_0B03310                    47.8    1e-04   
ref|XP_007928011.1|  hypothetical protein MYCFIDRAFT_55940            47.8    1e-04   
ref|XP_003677333.1|  hypothetical protein NCAS_0G00930                47.8    1e-04   
gb|ESU12042.1|  hypothetical protein FGSG_05999                       47.8    1e-04   
ref|XP_001525684.1|  60S ribosomal protein L27                        47.0    1e-04   
ref|XP_002143603.1|  60S ribosomal protein L27                        47.8    1e-04   
gb|KFH64804.1|  large subunit ribosomal protein L27e                  47.8    1e-04   
ref|XP_006595557.1|  PREDICTED: uncharacterized protein LOC100790...  48.9    1e-04   
ref|XP_001543009.1|  60S ribosomal protein L27                        47.8    1e-04   
emb|CDP27376.1|  Putative cytosolic 60S ribosomal protein Rpl27       47.8    1e-04   
emb|CDM35079.1|  60S ribosomal protein L27-A                          47.8    1e-04   
ref|XP_007797649.1|  putative 60s ribosomal protein l27 protein       47.8    1e-04   
ref|XP_007747901.1|  large subunit ribosomal protein L27e             47.8    1e-04   
gb|EFX78542.1|  hypothetical protein DAPPUDRAFT_231081                47.8    1e-04   
ref|NP_490905.1|  Protein RPL-27                                      47.8    1e-04   
ref|XP_006595558.1|  PREDICTED: uncharacterized protein LOC100790...  48.9    1e-04   
ref|XP_003709402.1|  60S ribosomal protein L27-A                      47.4    1e-04   
emb|CAO98832.1|  ribosomal protein L27                                47.4    1e-04   
gb|KEY81272.1|  60S ribosomal protein L27e                            48.1    1e-04   
ref|XP_448509.1|  60S ribosomal protein L27                           47.4    1e-04   
gb|ABZ04238.1|  ribosomal protein rpl27                               47.4    1e-04   
ref|XP_002638971.1|  C. briggsae CBR-RPL-27 protein                   47.4    1e-04   
gb|EGT38815.1|  hypothetical protein CAEBREN_30614                    47.4    1e-04   
gb|ACI12872.1|  ribosomal protein L27                                 47.4    2e-04   
gb|ELQ38677.1|  60S ribosomal protein L27-B                           47.4    2e-04   
gb|EMF13026.1|  Ribosomal_L27e-domain-containing protein              47.4    2e-04   
ref|XP_003111305.1|  CRE-RPL-27 protein                               47.4    2e-04   
tpe|CAL69070.1|  TPA: putative 60S ribosomal protein L27 isoform 1    47.4    2e-04   
ref|XP_750383.2|  60S ribosomal protein L27e                          48.1    2e-04   
gb|EDV09062.1|  ribosomal protein L27A                                47.8    2e-04   
gb|EGA78501.1|  Rpl27ap                                               47.8    2e-04   
ref|XP_003386102.1|  PREDICTED: 60S ribosomal protein L27-like is...  47.4    2e-04   
gb|EPS27655.1|  hypothetical protein PDE_02599                        47.8    2e-04   
ref|XP_002479924.1|  60S ribosomal protein L27                        47.4    2e-04   
ref|XP_007588989.1|  putative 60s ribosomal protein l27 protein       47.4    2e-04   
gb|KHJ32604.1|  putative 60s ribosomal protein l27                    47.4    2e-04   
gb|EZF11224.1|  hypothetical protein H100_07669                       47.4    2e-04   
ref|XP_003238254.1|  60S ribosomal protein L27                        47.4    2e-04   
gb|EZF11223.1|  hypothetical protein H100_07669                       47.4    2e-04   
emb|CCX05686.1|  Similar to 60S ribosomal protein L27-A; acc. no....  47.0    2e-04   
ref|XP_007838163.1|  60S ribosomal protein L27-A                      47.0    2e-04   
gb|EYE99376.1|  ribosomal protein L27e                                46.6    2e-04   
ref|XP_005978861.1|  PREDICTED: 60S ribosomal protein L27-like        47.0    2e-04   
gb|AIY67969.1|  60S ribosomal protein L27e                            46.2    2e-04   
ref|XP_003851852.1|  60S ribosomal protein L27                        47.0    2e-04   
emb|CDK28902.1|  unnamed protein product                              47.0    2e-04   
gb|EFQ32173.1|  ribosomal L27e family protein                         47.0    2e-04   
gb|ENH84401.1|  60s ribosomal protein l27-a                           47.0    2e-04   
ref|XP_461962.1|  60S ribosomal protein L27                           47.0    2e-04   
emb|CEG62737.1|  Putative 60S ribosomal protein L27                   46.6    2e-04   
gb|EFW98526.1|  60S ribosomal protein l27e                            46.6    2e-04   
tpe|CAL69071.1|  TPA: putative 60S ribosomal protein L27 isoform 2    46.6    2e-04   
ref|XP_009049506.1|  hypothetical protein LOTGIDRAFT_141455           46.6    3e-04   
emb|CDH53876.1|  60s ribosomal protein l27                            46.6    3e-04   
emb|CDH50475.1|  60s ribosomal protein l27                            46.6    3e-04   
ref|XP_005361211.1|  PREDICTED: 60S ribosomal protein L27-like        46.6    3e-04   
gb|KFP97721.1|  60S ribosomal protein L27                             46.2    3e-04   
emb|CDS13388.1|  Putative 60S ribosomal protein L27                   46.6    3e-04   
ref|XP_009865996.1|  PREDICTED: 60S ribosomal protein L27             45.8    3e-04   
gb|KFP48178.1|  60S ribosomal protein L27                             45.8    3e-04   
gb|KDN41433.1|  60s ribosomal protein l27                             46.6    3e-04   
gb|EPZ35389.1|  Ribosomal protein L27e domain-containing protein      46.6    3e-04   
ref|XP_005098580.1|  PREDICTED: 60S ribosomal protein L27-like is...  46.6    3e-04   
ref|XP_002592029.1|  hypothetical protein BRAFLDRAFT_122398           46.6    3e-04   
gb|EPB81811.1|  60S ribosomal protein L27-A                           46.6    3e-04   
gb|KFP87148.1|  60S ribosomal protein L27                             45.8    3e-04   
gb|KFP69542.1|  60S ribosomal protein L27                             45.8    3e-04   
gb|KFQ57695.1|  60S ribosomal protein L27                             45.8    3e-04   
dbj|BAB28240.1|  unnamed protein product                              45.8    3e-04   
ref|XP_005429631.1|  PREDICTED: 60S ribosomal protein L27             45.8    3e-04   
ref|XP_004180850.1|  hypothetical protein TBLA_0E02750                46.6    3e-04   
ref|XP_009281742.1|  PREDICTED: 60S ribosomal protein L27             45.8    3e-04   
gb|ELV12279.1|  60S ribosomal protein L27                             46.6    3e-04   
gb|KFV42694.1|  60S ribosomal protein L27                             45.8    3e-04   
ref|XP_008715959.1|  hypothetical protein HMPREF1541_03386            46.6    3e-04   
gb|ABR87257.1|  large subunit ribosomal protein 27                    46.2    3e-04   
ref|XP_007808357.1|  60S ribosomal protein L27                        46.6    3e-04   
gb|ABR87242.1|  large subunit ribosomal protein 27                    46.2    3e-04   
gb|ABR87254.1|  large subunit ribosomal protein 27                    46.2    3e-04   
ref|XP_003006868.1|  60S ribosomal protein L27                        46.6    3e-04   
dbj|GAA89981.1|  60S ribosomal protein L27e                           46.2    3e-04   
ref|XP_009928987.1|  PREDICTED: 60S ribosomal protein L27             45.8    3e-04   
ref|XP_007267341.1|  60s ribosomal protein l27                        46.2    3e-04   
gb|ABR87256.1|  large subunit ribosomal protein 27                    46.2    3e-04   
ref|XP_010182683.1|  PREDICTED: 60S ribosomal protein L27             45.8    3e-04   
ref|XP_001398956.1|  60S ribosomal protein L27                        46.2    4e-04   
sp|P61359.2|RL27_HIPCM  RecName: Full=60S ribosomal protein L27       46.2    4e-04   
gb|ACH48199.1|  60S ribosomal protein L27                             46.2    4e-04   
gb|KEZ43069.1|  hypothetical protein SAPIO_CDS5150                    46.2    4e-04   
dbj|GAA97442.1|  hypothetical protein E5Q_04121                       46.2    4e-04   
gb|AAQ54645.1|  60S ribosomal protein RL27                            46.2    4e-04   
ref|XP_003685349.1|  60S ribosomal protein L27                        46.2    4e-04   
ref|XP_006690819.1|  60S ribosomal protein l27-like protein           46.2    4e-04   
gb|ELT87377.1|  hypothetical protein CAPTEDRAFT_151982                46.2    4e-04   
gb|ABW90400.1|  putative ribosomal protein L27                        46.2    4e-04   
gb|ACI69263.1|  60S ribosomal protein L27                             45.8    4e-04   
gb|EDL41789.1|  mCG13926                                              45.8    4e-04   
emb|CDH12608.1|  probable 60S ribosomal protein L27-A                 45.4    4e-04   
ref|XP_001647386.1|  hypothetical protein Kpol_1018p60                46.2    4e-04   
gb|ABK55149.1|  ribosomal protein L27                                 46.2    4e-04   
ref|XP_001212185.1|  60S ribosomal protein L27                        46.2    4e-04   
ref|XP_002928660.1|  PREDICTED: 60S ribosomal protein L27-like        46.2    4e-04   
gb|KGL85813.1|  60S ribosomal protein L27                             45.8    4e-04   
ref|XP_002128439.1|  PREDICTED: 60S ribosomal protein L27-like        46.2    4e-04   
ref|XP_008922243.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
gb|KFW81033.1|  60S ribosomal protein L27                             45.8    5e-04   
gb|KFQ94576.1|  60S ribosomal protein L27                             45.4    5e-04   
ref|XP_003052048.1|  60S ribosomal protein L27                        45.8    5e-04   
ref|XP_005353600.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    5e-04   
ref|XP_010293915.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
sp|Q9XSU7.3|RL27_CANFA  RecName: Full=60S ribosomal protein L27       45.8    5e-04   
ref|XP_001485015.1|  60S ribosomal protein L27                        44.7    5e-04   
emb|CAB46818.1|  ribosomal protein L27                                45.8    5e-04   
emb|CAG02225.1|  unnamed protein product                              45.8    5e-04   
gb|EMC78414.1|  60S ribosomal protein L27                             45.4    5e-04   
ref|XP_005513673.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
ref|XP_009992477.1|  PREDICTED: 60S ribosomal protein L27             45.4    5e-04   
gb|KGL81143.1|  60S ribosomal protein L27                             45.4    5e-04   
gb|KFQ89762.1|  60S ribosomal protein L27                             45.4    5e-04   
ref|XP_006039920.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    5e-04   
ref|XP_004023278.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...  45.4    5e-04   
dbj|BAG34735.1|  unnamed protein product                              45.8    5e-04   
ref|NP_956018.1|  60S ribosomal protein L27                           45.8    5e-04   
ref|XP_003504660.1|  PREDICTED: 60S ribosomal protein L27 isoform X1  45.8    5e-04   
ref|XP_008504034.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
gb|KFV74490.1|  60S ribosomal protein L27                             45.4    5e-04   
gb|EFB24209.1|  hypothetical protein PANDA_020454                     45.4    5e-04   
ref|XP_003442655.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    5e-04   
gb|ADM64582.1|  ribosomal protein L27                                 45.8    5e-04   
gb|ACH44592.1|  putative ribosomal protein L27 variant 1              45.8    5e-04   
ref|NP_000979.1|  60S ribosomal protein L27                           45.8    5e-04   
ref|XP_005369123.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
ref|XP_005078201.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    5e-04   
gb|ACH44597.1|  putative ribosomal protein L27 variant 1              45.8    5e-04   
gb|ACH44596.1|  putative ribosomal protein L27 variant 1              45.8    5e-04   
ref|XP_001265033.1|  60S ribosomal protein L27                        45.8    5e-04   
ref|XP_004484633.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
gb|ABN80452.1|  ribosomal protein L27                                 45.8    5e-04   
ref|XP_005070189.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
ref|XP_004597397.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
ref|XP_010872388.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
gb|ACI69670.1|  60S ribosomal protein L27                             45.8    5e-04   
ref|XP_003272471.1|  PREDICTED: 60S ribosomal protein L27-like is...  45.8    5e-04   
ref|XP_004071214.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    5e-04   
ref|XP_001909650.1|  hypothetical protein                             47.4    5e-04   
gb|AAX29364.1|  ribosomal protein L27                                 45.8    5e-04   
ref|XP_008327421.1|  PREDICTED: 60S ribosomal protein L27             45.4    5e-04   
gb|AIC62021.1|  RPL27                                                 45.8    5e-04   
gb|ACI67287.1|  60S ribosomal protein L27                             45.8    5e-04   
ref|XP_006021002.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
ref|XP_004684183.1|  PREDICTED: 60S ribosomal protein L27             45.8    5e-04   
gb|KFP08965.1|  60S ribosomal protein L27                             45.4    6e-04   
ref|XP_010411175.1|  PREDICTED: 60S ribosomal protein L27             45.4    6e-04   
gb|EDL39102.1|  mCG123031                                             45.8    6e-04   
ref|NP_001016180.1|  60S ribosomal protein L27                        45.8    6e-04   
gb|ACI67629.1|  60S ribosomal protein L27                             45.8    6e-04   
gb|KFO52656.1|  60S ribosomal protein L27                             45.4    6e-04   
ref|XP_005350256.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    6e-04   
ref|NP_001279776.1|  ribosomal protein L27                            45.8    6e-04   
ref|XP_008414659.1|  PREDICTED: 60S ribosomal protein L27             45.8    6e-04   
ref|XP_010218505.1|  PREDICTED: 60S ribosomal protein L27             45.4    6e-04   
ref|XP_007562167.1|  PREDICTED: 60S ribosomal protein L27             45.8    6e-04   
gb|ACD65128.1|  putative 60S ribosomal protein RPL27                  45.8    6e-04   
ref|XP_006006020.1|  PREDICTED: 60S ribosomal protein L27             45.8    6e-04   
ref|XP_005353032.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    6e-04   
ref|XP_009878009.1|  PREDICTED: 60S ribosomal protein L27             45.4    6e-04   
emb|CCH42768.1|  60S ribosomal protein L27-B                          45.8    6e-04   
gb|EHH25013.1|  60S ribosomal protein L27                             45.8    6e-04   
ref|XP_004020538.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    6e-04   
ref|XP_005810361.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    6e-04   
ref|XP_009646866.1|  PREDICTED: 60S ribosomal protein L27             45.8    6e-04   
gb|EIE77729.1|  hypothetical protein RO3G_02433                       45.8    6e-04   
ref|XP_001635032.1|  predicted protein                                45.8    6e-04   
ref|XP_010641299.1|  PREDICTED: 60S ribosomal protein L27             45.4    6e-04   
ref|XP_004648933.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...  45.4    6e-04   
ref|XP_006092186.1|  PREDICTED: 60S ribosomal protein L27-like        45.4    6e-04   
ref|XP_004633519.1|  PREDICTED: 60S ribosomal protein L27-like        45.4    6e-04   
ref|XP_004552563.1|  PREDICTED: 60S ribosomal protein L27-like        45.8    6e-04   
ref|XP_009460260.1|  PREDICTED: 60S ribosomal protein L27             45.4    6e-04   
gb|EIE84555.1|  hypothetical protein RO3G_09265                       45.4    6e-04   
gb|EIE79532.1|  hypothetical protein RO3G_04237                       45.4    6e-04   
ref|XP_008642016.1|  PREDICTED: 60S ribosomal protein L27             45.4    6e-04   
emb|CAJ17388.1|  ribosomal protein L27e                               45.4    7e-04   
ref|XP_008303113.1|  PREDICTED: 60S ribosomal protein L27             45.4    7e-04   
gb|ACI68271.1|  60S ribosomal protein L27                             45.4    7e-04   
ref|XP_006901755.1|  PREDICTED: 60S ribosomal protein L27             45.4    7e-04   
gb|EIE87087.1|  hypothetical protein RO3G_11798                       45.4    7e-04   
ref|NP_001187051.1|  60S ribosomal protein L27                        45.4    7e-04   
ref|XP_006747326.1|  PREDICTED: 60S ribosomal protein L27-like        45.4    7e-04   
ref|XP_010744567.1|  PREDICTED: 60S ribosomal protein L27             45.4    8e-04   
ref|XP_006638191.1|  PREDICTED: 60S ribosomal protein L27-like        45.4    8e-04   
ref|XP_003222499.1|  PREDICTED: 60S ribosomal protein L27             45.4    8e-04   
gb|ABW04123.1|  60S ribosomal protein L27                             45.4    8e-04   
emb|CCH43973.1|  60S ribosomal protein L27-B                          45.4    8e-04   
gb|EPY88179.1|  60S ribosomal protein L27-like protein                45.4    8e-04   
ref|XP_006993004.1|  PREDICTED: 60S ribosomal protein L27             45.8    8e-04   
prf||1909362A  ribosomal protein L27                                  45.4    9e-04
gb|EQL01058.1|  Ribosomal protein L27e                                47.0    9e-04   
ref|XP_003965058.1|  PREDICTED: 60S ribosomal protein L27-like is...  45.1    9e-04   
ref|XP_009706289.1|  PREDICTED: 60S ribosomal protein L27             45.1    0.001   
gb|EYC35902.1|  hypothetical protein Y032_0961g3226                   45.1    0.001   
ref|XP_007482208.1|  PREDICTED: 60S ribosomal protein L27             45.1    0.001   
gb|AIW62543.1|  60S ribosomal protein L27                             45.1    0.001   
gb|AFM87362.1|  60S ribosomal protein L27-like protein                45.1    0.001   



>gb|AFX67017.1| 60S ribosomal protein L27, partial [Solanum tuberosum]
Length=74

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLK+AVT DCLQS DKKV AAKEAKA+FEERFKTGKNRWFF+KLRF
Sbjct  18   HIMPTRYTLDVDLKEAVTVDCLQSRDKKVTAAKEAKAKFEERFKTGKNRWFFTKLRF  74



>ref|XP_009592072.1| PREDICTED: 60S ribosomal protein L27-3-like [Nicotiana tomentosiformis]
 ref|XP_009592073.1| PREDICTED: 60S ribosomal protein L27-3-like [Nicotiana tomentosiformis]
Length=135

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLK+AVT DCLQS DKKV AAKEAKA+FEERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKEAVTVDCLQSRDKKVSAAKEAKAKFEERFKTGKNRWFFSKLRF  135



>ref|XP_009787670.1| PREDICTED: 60S ribosomal protein L27-3-like [Nicotiana sylvestris]
Length=135

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLK+AVT DCLQS DKKV AAKEAKA+FEERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKEAVTVDCLQSRDKKVTAAKEAKAKFEERFKTGKNRWFFSKLRF  135



>ref|XP_004243641.1| PREDICTED: 60S ribosomal protein L27-3 [Solanum lycopersicum]
 ref|XP_006357877.1| PREDICTED: 60S ribosomal protein L27-3-like [Solanum tuberosum]
Length=135

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLK+AVT DCLQS DKKV AAKEAKA+FEERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKEAVTVDCLQSRDKKVTAAKEAKAKFEERFKTGKNRWFFTKLRF  135



>gb|AFW90619.1| ribosomal protein L27 [Solanum tuberosum]
Length=135

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLK+AVT DCLQS DKKV AAKEAKA+FEERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKEAVTVDCLQSRDKKVTAAKEAKAKFEERFKTGKNRWFFTKLRF  135



>dbj|BAA96367.1| ribosomal protein L27 [Panax ginseng]
Length=135

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT DCLQS DKKV AAKE KAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVTVDCLQSRDKKVTAAKETKARLEERFKTGKNRWFFTKLRF  135



>gb|EYU32722.1| hypothetical protein MIMGU_mgv1a016082mg [Erythranthe guttata]
Length=135

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT DCLQS DKKV AAKE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVTPDCLQSKDKKVTAAKETKARFEERFKTGKNRWFFTKLRF  135



>emb|CDP16031.1| unnamed protein product [Coffea canephora]
Length=135

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT DCLQS DKKV AAK+AK RFEERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDIVTADCLQSRDKKVSAAKDAKTRFEERFKTGKNRWFFTKLRF  135



>emb|CBI21769.3| unnamed protein product [Vitis vinifera]
Length=83

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ D LQS DKKV AAKE K + EERFKTGKNRWFFSKLRF
Sbjct  27   HIMPTRYTLDVDLKDVVSPDVLQSRDKKVTAAKETKKKLEERFKTGKNRWFFSKLRF  83



>ref|XP_010925925.1| PREDICTED: 60S ribosomal protein L27-3-like [Elaeis guineensis]
Length=135

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKDAVT D LQS DKKV A KE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDAVTLDALQSRDKKVVACKETKARFEERFKTGKNRWFFTKLRF  135



>ref|XP_002267478.1| PREDICTED: 60S ribosomal protein L27 [Vitis vinifera]
Length=135

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ D LQS DKKV AAKE K + EERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKDVVSPDVLQSRDKKVTAAKETKKKLEERFKTGKNRWFFSKLRF  135



>ref|XP_009410911.1| PREDICTED: 60S ribosomal protein L27 [Musa acuminata subsp. malaccensis]
Length=135

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT D LQS DKKV A+KE KAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVTLDALQSRDKKVTASKETKARLEERFKTGKNRWFFTKLRF  135



>ref|XP_010052670.1| PREDICTED: 60S ribosomal protein L27-like [Eucalyptus grandis]
Length=135

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V  DCLQS DKKV AAKE K R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVNPDCLQSKDKKVTAAKETKKRLEERFKTGKNRWFFTKLRF  135



>ref|XP_006853437.1| hypothetical protein AMTR_s00032p00176990 [Amborella trichopoda]
 gb|ERN14904.1| hypothetical protein AMTR_s00032p00176990 [Amborella trichopoda]
Length=135

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD +T + LQSHDKKV  AK+AKARFEERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDIITLEALQSHDKKVTVAKDAKARFEERFKTGKNRWFFTKLRF  135



>gb|KHN47720.1| 60S ribosomal protein L27 [Glycine soja]
Length=131

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAVT D LQ+ DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  75   HLMPTRYTLDVDLKDAVTPDVLQAKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  131



>ref|XP_010245429.1| PREDICTED: 60S ribosomal protein L27-2-like [Nelumbo nucifera]
Length=91

 Score = 75.1 bits (183),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT D LQS DKKV AAKE KARFE+RFKTGKNRWFF+KLRF
Sbjct  35   HIMPTRYTLDVDLKDVVTLDTLQSRDKKVTAAKEVKARFEDRFKTGKNRWFFTKLRF  91



>ref|XP_009395723.1| PREDICTED: 60S ribosomal protein L27-like [Musa acuminata subsp. 
malaccensis]
Length=135

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT D LQS DKKV A KE KAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVTADSLQSRDKKVTACKETKARLEERFKTGKNRWFFTKLRF  135



>ref|XP_010667820.1| PREDICTED: 60S ribosomal protein L27-3-like [Beta vulgaris subsp. 
vulgaris]
Length=135

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ D LQS DKKV AAKE KARFEERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKDIVSADALQSKDKKVTAAKETKARFEERFKTGKNRWFFSKLRF  135



>ref|XP_003546393.1| PREDICTED: 60S ribosomal protein L27-like [Glycine max]
Length=135

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAVT D LQ+ DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVTPDVLQAKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  135



>ref|XP_011005551.1| PREDICTED: 60S ribosomal protein L27-3 [Populus euphratica]
Length=135

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT DCL S DKKV A KE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTADCLSSKDKKVTACKETKARFEERFKTGKNRWFFTKLRF  135



>ref|XP_009609639.1| PREDICTED: 60S ribosomal protein L27 [Nicotiana tomentosiformis]
Length=135

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  D LQS DKKV AAKEAKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNADVLQSRDKKVTAAKEAKARLEERFKTGKNRWFFTKLRF  135



>gb|AAA86951.1| ribosomal protein L27 homolog [Pisum sativum]
Length=135

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D LQS DKKV A KE K   EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVVPDVLQSKDKKVTALKETKKSVEERFKTGKNRWFFTKLRF  135



>ref|XP_010112899.1| 60S ribosomal protein L27 [Morus notabilis]
 gb|EXC35034.1| 60S ribosomal protein L27 [Morus notabilis]
Length=135

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTTDALQSKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  135



>ref|XP_010245426.1| PREDICTED: 60S ribosomal protein L27-3 [Nelumbo nucifera]
Length=135

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT D LQS DKKV AAKE KAR E+RFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVTLDTLQSRDKKVTAAKEVKARLEDRFKTGKNRWFFTKLRF  135



>ref|XP_008805968.1| PREDICTED: 60S ribosomal protein L27-3-like [Phoenix dactylifera]
Length=135

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKDAVT D LQS DKKV + KE KARFEERFK GKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDAVTLDALQSRDKKVASCKETKARFEERFKAGKNRWFFTKLRF  135



>gb|AAA86950.1| ribosomal protein L27 homolog [Pisum sativum]
Length=135

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D LQS DKKV A KE K   EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVVPDVLQSKDKKVTALKETKKSLEERFKTGKNRWFFTKLRF  135



>ref|XP_010666201.1| PREDICTED: 60S ribosomal protein L27-1-like [Beta vulgaris subsp. 
vulgaris]
Length=135

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ D LQS DKKV AAKE K RFE+RFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKDVVSSDVLQSKDKKVTAAKETKTRFEDRFKTGKNRWFFSKLRF  135



>sp|Q05462.1|RL27_PEA RecName: Full=60S ribosomal protein L27 [Pisum sativum]
 emb|CAA50035.1| ribosomal protein L27 [Pisum sativum]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D LQS DKKV A KE K   EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVVPDVLQSKDKKVTALKETKKSLEERFKTGKNRWFFTKLRF  135



>ref|XP_010056834.1| PREDICTED: 60S ribosomal protein L27 [Eucalyptus grandis]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D LQS DKKV AAKEAK R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVAVDSLQSKDKKVTAAKEAKKRLEERFKTGKNRWFFTKLRF  135



>emb|CAN79575.1| hypothetical protein VITISV_032808 [Vitis vinifera]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDV+LKD V+ D LQS DKKV AAKE K + EERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVNLKDVVSPDVLQSRDKKVTAAKETKKKLEERFKTGKNRWFFSKLRF  135



>ref|XP_010056839.1| PREDICTED: 60S ribosomal protein L27-like [Eucalyptus grandis]
 ref|XP_010057041.1| PREDICTED: 60S ribosomal protein L27-like [Eucalyptus grandis]
 ref|XP_010042780.1| PREDICTED: 60S ribosomal protein L27-like [Eucalyptus grandis]
 gb|KCW73719.1| hypothetical protein EUGRSUZ_E02329 [Eucalyptus grandis]
 gb|KCW73997.1| hypothetical protein EUGRSUZ_E02614 [Eucalyptus grandis]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D LQS DKKV AAKEAK R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVAVDSLQSKDKKVTAAKEAKKRLEERFKTGKNRWFFTKLRF  135



>ref|XP_010648729.1| PREDICTED: 60S ribosomal protein L27-3 [Vitis vinifera]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS DKKV AAKE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTVDALQSRDKKVTAAKETKARFEERFKTGKNRWFFTKLRF  135



>gb|AAA86952.1| ribosomal protein L27 homolog [Pisum sativum]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D LQS DKKV A KE K   EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVVPDVLQSKDKKVTALKETKKSLEERFKTGKNRWFFTKLRF  135



>ref|XP_009396530.1| PREDICTED: 60S ribosomal protein L27-like [Musa acuminata subsp. 
malaccensis]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT D LQS DKKV A KE K+R EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVTIDSLQSRDKKVSACKETKSRLEERFKTGKNRWFFTKLRF  135



>ref|XP_004485468.1| PREDICTED: 60S ribosomal protein L27-like [Cicer arietinum]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV+ D LQS DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVSVDVLQSKDKKVTALKETKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_010532514.1| PREDICTED: 60S ribosomal protein L27-3 [Tarenaya hassleriana]
Length=135

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS DKKV A KEAKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTIDALQSKDKKVTALKEAKARMEERFKTGKNRWFFTKLRF  135



>ref|XP_009619209.1| PREDICTED: 60S ribosomal protein L27-like [Nicotiana tomentosiformis]
 ref|XP_009781546.1| PREDICTED: 60S ribosomal protein L27 [Nicotiana sylvestris]
Length=135

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  D LQS DKKV AAKEAKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNVDVLQSRDKKVTAAKEAKARLEERFKTGKNRWFFTKLRF  135



>ref|XP_009781608.1| PREDICTED: 60S ribosomal protein L27-like [Nicotiana sylvestris]
Length=135

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  D LQS DKKV AAKEAKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNVDVLQSRDKKVTAAKEAKARLEERFKTGKNRWFFTKLRF  135



>ref|XP_010915919.1| PREDICTED: 60S ribosomal protein L27-3-like [Elaeis guineensis]
 gb|AGE46031.1| 60S ribosomal protein l27 [Elaeis guineensis]
Length=135

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD VT D LQS DKKV A KE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVTLDVLQSRDKKVAACKETKARFEERFKTGKNRWFFTKLRF  135



>ref|XP_004147740.1| PREDICTED: 60S ribosomal protein L27-like [Cucumis sativus]
 ref|XP_004166795.1| PREDICTED: 60S ribosomal protein L27-like [Cucumis sativus]
 gb|KGN53500.1| hypothetical protein Csa_4G062360 [Cucumis sativus]
Length=135

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS DKKV AAKE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTVDSLQSKDKKVTAAKETKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_008451854.1| PREDICTED: 60S ribosomal protein L27 [Cucumis melo]
 ref|XP_008451855.1| PREDICTED: 60S ribosomal protein L27 [Cucumis melo]
Length=135

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS DKKV AAKE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTIDSLQSKDKKVSAAKETKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_008451849.1| PREDICTED: 60S ribosomal protein L27-like [Cucumis melo]
Length=135

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS DKKV AAKE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTIDSLQSKDKKVSAAKETKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_004241408.1| PREDICTED: 60S ribosomal protein L27 [Solanum lycopersicum]
 ref|XP_006347291.1| PREDICTED: 60S ribosomal protein L27-like [Solanum tuberosum]
Length=135

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  D LQ+ DKKV AAKE KAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNADVLQARDKKVTAAKETKARLEERFKTGKNRWFFTKLRF  135



>ref|XP_004147739.1| PREDICTED: 60S ribosomal protein L27-like [Cucumis sativus]
 ref|XP_004166796.1| PREDICTED: 60S ribosomal protein L27-like [Cucumis sativus]
 gb|KGN53499.1| hypothetical protein Csa_4G061860 [Cucumis sativus]
Length=135

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS DKKV AAKE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTIDSLQSKDKKVTAAKETKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_008801508.1| PREDICTED: 60S ribosomal protein L27-3-like [Phoenix dactylifera]
Length=114

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQ+ D+KV A KE KARFEERFKTGKNRWFFSKLRF
Sbjct  58   HLMPTRYTLDVDLKDVVTLDALQTRDRKVAACKETKARFEERFKTGKNRWFFSKLRF  114



>ref|XP_010525173.1| PREDICTED: 60S ribosomal protein L27-3-like [Tarenaya hassleriana]
Length=135

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS DKKV A KE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTLDALQSKDKKVTALKETKARFEERFKTGKNRWFFTKLRF  135



>ref|XP_009395990.1| PREDICTED: 60S ribosomal protein L27-3 [Musa acuminata subsp. 
malaccensis]
Length=135

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD  T D LQS DKKV A KE KAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVATLDALQSRDKKVTACKETKARLEERFKTGKNRWFFTKLRF  135



>ref|XP_002300063.1| 60S ribosomal protein L27 [Populus trichocarpa]
 gb|ABK92640.1| unknown [Populus trichocarpa]
 gb|ABK93497.1| unknown [Populus trichocarpa]
 gb|ABK94291.1| unknown [Populus trichocarpa]
 gb|EEE84868.1| 60S ribosomal protein L27 [Populus trichocarpa]
Length=135

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT DCL + DKK+ A KE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTADCLSTKDKKITACKETKARFEERFKTGKNRWFFTKLRF  135



>ref|XP_008783218.1| PREDICTED: 60S ribosomal protein L27-3-like [Phoenix dactylifera]
Length=135

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ D LQS DKKV A KE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVSLDALQSRDKKVAACKETKARFEERFKTGKNRWFFTKLRF  135



>ref|XP_004486790.1| PREDICTED: 60S ribosomal protein L27-like [Cicer arietinum]
Length=135

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV+ D LQ+ DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVSVDVLQAKDKKVTALKETKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_003592964.1| 60S ribosomal protein L27 [Medicago truncatula]
 ref|XP_003593003.1| 60S ribosomal protein L27 [Medicago truncatula]
 gb|ACJ84080.1| unknown [Medicago truncatula]
 gb|AES63215.1| 60S ribosomal protein L27-1 [Medicago truncatula]
 gb|AFK33466.1| unknown [Medicago truncatula]
Length=135

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ VT D LQS DKKV A KEAK RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVVTTDVLQSKDKKVTALKEAKKRFEERFKTGKNRWFFTKLRF  135



>gb|AFK47915.1| unknown [Medicago truncatula]
 gb|AES65144.2| 60S ribosomal protein L27-1 [Medicago truncatula]
Length=135

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ VT D LQS DKKV A KEAK RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVVTTDVLQSKDKKVTALKEAKKRFEERFKTGKNRWFFTKLRF  135



>gb|ACJ86190.1| unknown [Medicago truncatula]
Length=135

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ VT D LQS DKKV A KEAK RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVVTTDVLQSKDKKVTALKEAKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_010256388.1| PREDICTED: 60S ribosomal protein L27-3-like [Nelumbo nucifera]
Length=135

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  + LQS DKKV AAKE KAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNLEALQSRDKKVTAAKEVKARLEERFKTGKNRWFFTKLRF  135



>ref|XP_006840323.1| hypothetical protein AMTR_s00045p00086530 [Amborella trichopoda]
 gb|ERN01998.1| hypothetical protein AMTR_s00045p00086530 [Amborella trichopoda]
Length=135

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYT+DVDLKD +T + LQSHDKKV  AKEAKA FEERFK GKNRWFF+KLRF
Sbjct  79   HIMPTRYTVDVDLKDIITLEILQSHDKKVTTAKEAKAGFEERFKNGKNRWFFTKLRF  135



>ref|NP_001236951.1| uncharacterized protein LOC100527246 [Glycine max]
 gb|ACU16302.1| unknown [Glycine max]
Length=135

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAVT D L + DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVTPDVLATKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  135



>ref|XP_008357506.1| PREDICTED: 60S ribosomal protein L27-like [Malus domestica]
Length=135

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V  +CLQ+ DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVNVECLQTKDKKVTALKEVKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_006481358.1| PREDICTED: 60S ribosomal protein L27-like [Citrus sinensis]
Length=135

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V+ D LQS DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVSADSLQSKDKKVTACKETKKRLEERFKTGKNRWFFTKLRF  135



>gb|ADR71246.1| 60S ribosomal protein L27C [Hevea brasiliensis]
Length=135

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS +KKV AAKE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTVDALQSKEKKVGAAKETKARFEERFKTGKNRWFFTKLRF  135



>gb|KDP22049.1| hypothetical protein JCGZ_02471 [Jatropha curcas]
Length=135

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQS +KKV AAKE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTVDSLQSKEKKVAAAKETKARFEERFKTGKNRWFFTKLRF  135



>ref|XP_011004462.1| PREDICTED: 60S ribosomal protein L27 [Populus euphratica]
Length=135

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT DCL + DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDLVTPDCLATKDKKVAACKETKTRFEERFKTGKNRWFFTKLRF  135



>ref|XP_004487922.1| PREDICTED: 60S ribosomal protein L27-like [Cicer arietinum]
Length=135

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ VT D LQS DKKV A KEAK RFE+RFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVVTPDSLQSKDKKVTALKEAKKRFEDRFKTGKNRWFFTKLRF  135



>ref|XP_002308823.1| ribosomal protein L27 [Populus trichocarpa]
 gb|EEE92346.1| ribosomal protein L27 [Populus trichocarpa]
Length=135

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT DCL + DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDLVTPDCLATKDKKVVACKETKTRFEERFKTGKNRWFFTKLRF  135



>ref|XP_008384054.1| PREDICTED: 60S ribosomal protein L27-like [Malus domestica]
 ref|XP_008349299.1| PREDICTED: 60S ribosomal protein L27 [Malus domestica]
 ref|XP_008356095.1| PREDICTED: 60S ribosomal protein L27-like [Malus domestica]
Length=135

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V  +CLQ+ DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVNVECLQTXDKKVTALKEVKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_006441055.1| hypothetical protein CICLE_v10024407mg [Citrus clementina]
 gb|ESR54295.1| hypothetical protein CICLE_v10024407mg [Citrus clementina]
Length=135

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD +  D LQ+ DKKV AAKE K R EERFKTGKNRWFFSKLRF
Sbjct  79   HLMPTRYTLDVDLKDVINPDVLQTKDKKVTAAKETKRRLEERFKTGKNRWFFSKLRF  135



>ref|XP_006478048.1| PREDICTED: 60S ribosomal protein L27-like [Citrus sinensis]
 gb|KDO47279.1| hypothetical protein CISIN_1g032739mg [Citrus sinensis]
Length=135

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD +  D LQ+ DKKV AAKE K R EERFKTGKNRWFFSKLRF
Sbjct  79   HLMPTRYTLDVDLKDVINPDVLQTKDKKVTAAKETKRRLEERFKTGKNRWFFSKLRF  135



>ref|XP_007049015.1| Ribosomal L27e protein family [Theobroma cacao]
 gb|EOX93172.1| Ribosomal L27e protein family [Theobroma cacao]
Length=135

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D LQ+ DKKV A K  K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTVDALQTKDKKVAACKATKERFEERFKTGKNRWFFTKLRF  135



>ref|XP_010466495.1| PREDICTED: 60S ribosomal protein L27-2-like [Camelina sativa]
Length=153

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  97   HLMPTRYTLDVDLKDVATVDALQSKDKKVTALKEAKAKLEERFKTGKNRWFFTKLRF  153



>ref|XP_011095690.1| PREDICTED: 60S ribosomal protein L27-3-like [Sesamum indicum]
 ref|XP_011095696.1| PREDICTED: 60S ribosomal protein L27-3-like [Sesamum indicum]
Length=135

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ D L S DKKV A KE KA+FEERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKDVVSADALVSRDKKVTACKEVKAKFEERFKTGKNRWFFSKLRF  135



>gb|ABK93641.1| unknown [Populus trichocarpa]
Length=135

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT DCL + DKKV A KE K RF ERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDLVTPDCLATKDKKVVACKETKTRFGERFKTGKNRWFFTKLRF  135



>gb|KFK22901.1| hypothetical protein AALP_AAs72951U000100 [Arabis alpina]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALQSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_010551737.1| PREDICTED: 60S ribosomal protein L27-3-like [Tarenaya hassleriana]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V+ + LQS DKKV A KEAKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVSLEALQSKDKKVTALKEAKARLEERFKTGKNRWFFTKLRF  135



>ref|XP_002870267.1| 60S ribosomal protein L27 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46526.1| 60S ribosomal protein L27 [Arabidopsis lyrata subsp. lyrata]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALQSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_010435004.1| PREDICTED: 60S ribosomal protein L27-3 [Camelina sativa]
 ref|XP_010496131.1| PREDICTED: 60S ribosomal protein L27-3 [Camelina sativa]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALQSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_006406196.1| hypothetical protein EUTSA_v10021742mg [Eutrema salsugineum]
 ref|XP_006414608.1| hypothetical protein EUTSA_v10026543mg [Eutrema salsugineum]
 ref|XP_006414610.1| hypothetical protein EUTSA_v10026541mg [Eutrema salsugineum]
 gb|ESQ47649.1| hypothetical protein EUTSA_v10021742mg [Eutrema salsugineum]
 gb|ESQ56061.1| hypothetical protein EUTSA_v10026543mg [Eutrema salsugineum]
 gb|ESQ56063.1| hypothetical protein EUTSA_v10026541mg [Eutrema salsugineum]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALQSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_004171636.1| PREDICTED: 60S ribosomal protein L27-like [Cucumis sativus]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  DCLQS   KV A+KE K R E RFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNVDCLQSRVSKVSASKEIKKRLENRFKTGKNRWFFTKLRF  135



>gb|KGN44160.1| hypothetical protein Csa_7G209560 [Cucumis sativus]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  DCLQS   KV A+KE K R E RFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNVDCLQSRVSKVSASKEIKKRLENRFKTGKNRWFFTKLRF  135



>ref|XP_010511086.1| PREDICTED: 60S ribosomal protein L27-2-like [Camelina sativa]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATVDALQSKDKKVTALKEAKAKLEERFKTGKNRWFFTKLRF  135



>gb|EYU27541.1| hypothetical protein MIMGU_mgv1a014965mg [Erythranthe guttata]
Length=172

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ D L S DKKV A KE K +FEERFKTGKNRWFFSKLRF
Sbjct  116  HIMPTRYTLDVDLKDVVSADALVSRDKKVTACKEVKGKFEERFKTGKNRWFFSKLRF  172



>ref|XP_010488240.1| PREDICTED: 60S ribosomal protein L27-2 [Camelina sativa]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATVDALQSKDKKVTALKEAKAKLEERFKTGKNRWFFTKLRF  135



>gb|KHN26621.1| 60S ribosomal protein L27 [Glycine soja]
Length=113

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D L + DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  57   HLMPTRYTLDVDLKDAVNPDVLNAKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  113



>ref|XP_010440362.1| PREDICTED: 60S ribosomal protein L27-3-like [Camelina sativa]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALQSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|NP_193236.1| 60S ribosomal protein L27-3 [Arabidopsis thaliana]
 sp|P51419.2|RL273_ARATH RecName: Full=60S ribosomal protein L27-3 [Arabidopsis thaliana]
 emb|CAB10279.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78542.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAL36343.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAM20365.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAM62713.1| ribosomal protein [Arabidopsis thaliana]
 dbj|BAF00331.1| ribosomal protein [Arabidopsis thaliana]
 gb|AEE83535.1| 60S ribosomal protein L27-3 [Arabidopsis thaliana]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALQSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_004139786.1| PREDICTED: 60S ribosomal protein L27-3-like [Cucumis sativus]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  DCLQS   KV A+KE K R E RFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNVDCLQSRVSKVSASKEIKKRLENRFKTGKNRWFFTKLRF  135



>ref|XP_007158885.1| hypothetical protein PHAVU_002G190100g [Phaseolus vulgaris]
 gb|ESW30879.1| hypothetical protein PHAVU_002G190100g [Phaseolus vulgaris]
Length=135

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D L S DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVNLDVLSSKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  135



>gb|KFK39514.1| hypothetical protein AALP_AA3G254000 [Arabis alpina]
Length=135

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALQSKDKKVVALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|NP_001241619.1| uncharacterized protein LOC100799485 [Glycine max]
 gb|ACU24239.1| unknown [Glycine max]
Length=135

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV  D L + DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVNPDVLNAKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  135



>ref|XP_003594893.1| 60S ribosomal protein L27 [Medicago truncatula]
Length=209

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF*V-  190
            H+MPTRYTLDVDLK+ VT D LQS DKKV A KEAK RFEERFKTGKNRWFF+KLR  V 
Sbjct  79   HLMPTRYTLDVDLKEVVTTDVLQSKDKKVTALKEAKKRFEERFKTGKNRWFFTKLRVGVK  138

Query  189  RFGVYCVLQILSIIYF  142
            RF     +Q+  +  F
Sbjct  139  RFWSMIYIQVFDMSKF  154



>ref|XP_006298793.1| hypothetical protein CARUB_v10014896mg [Capsella rubella]
 gb|EOA31691.1| hypothetical protein CARUB_v10014896mg [Capsella rubella]
Length=135

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATIDALQSKDKKVTALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_009375332.1| PREDICTED: 60S ribosomal protein L27 [Pyrus x bretschneideri]
Length=135

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V  +CLQ+ D+KV A KE K RFEER KTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVNVECLQTKDQKVTALKEVKKRFEERCKTGKNRWFFTKLRF  135



>ref|XP_007138839.1| hypothetical protein PHAVU_009G241700g [Phaseolus vulgaris]
 gb|ESW10833.1| hypothetical protein PHAVU_009G241700g [Phaseolus vulgaris]
Length=135

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAV+ D L + DKKV A KE K R E+RFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVSPDVLHAKDKKVTALKETKKRLEDRFKTGKNRWFFTKLRF  135



>gb|KGN54977.1| 60S ribosomal protein L27 [Cucumis sativus]
Length=135

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  DCLQS   KV A+KE K R E+RFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNVDCLQSKVSKVAASKEIKKRLEDRFKTGKNRWFFTKLRF  135



>ref|XP_008464678.1| PREDICTED: 60S ribosomal protein L27-3-like [Cucumis melo]
Length=135

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  DCLQS   KV A+KE K R E+RFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNVDCLQSKVSKVAASKEIKKRLEDRFKTGKNRWFFTKLRF  135



>ref|XP_004145994.1| PREDICTED: 60S ribosomal protein L27-3-like [Cucumis sativus]
 ref|XP_004170984.1| PREDICTED: 60S ribosomal protein L27-3-like [Cucumis sativus]
Length=135

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V  DCLQS   KV A+KE K R E+RFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDLKDVVNVDCLQSKVSKVAASKEIKKRLEDRFKTGKNRWFFTKLRF  135



>ref|XP_003531105.1| PREDICTED: 60S ribosomal protein L27-like [Glycine max]
 gb|KHN28940.1| 60S ribosomal protein L27 [Glycine soja]
Length=135

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYT DVDLKDAVT D L + DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTFDVDLKDAVTPDVLGTKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  135



>gb|EYU33768.1| hypothetical protein MIMGU_mgv1a016080mg [Erythranthe guttata]
Length=135

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ D L S DKKV A KE K +FEERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKDLVSGDALVSRDKKVTACKEIKGKFEERFKTGKNRWFFSKLRF  135



>ref|XP_006284734.1| hypothetical protein CARUB_v10005997mg [Capsella rubella]
 gb|EOA17632.1| hypothetical protein CARUB_v10005997mg [Capsella rubella]
Length=135

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D LQS DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDNLQSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_002323180.1| ribosomal protein L27 [Populus trichocarpa]
 gb|ABK93821.1| unknown [Populus trichocarpa]
 gb|EEF04941.1| ribosomal protein L27 [Populus trichocarpa]
Length=135

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKDAVT D L + DKKV A K+ KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDAVTADSLTTKDKKVTACKDTKARFEERFKTGKNRWFFTKLRF  135



>gb|KHN25920.1| 60S ribosomal protein L27 [Glycine soja]
Length=55

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  360  MPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            MPTRYTLDVDLKDAVT D L + DKKV A KE K R EERFKTGKNRWFF+KLRF
Sbjct  1    MPTRYTLDVDLKDAVTPDVLATKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF  55



>ref|XP_011097648.1| PREDICTED: 60S ribosomal protein L27-like [Sesamum indicum]
Length=135

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLKD V+ + L S DKKV A KE K RF+ERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKDIVSAEALVSRDKKVTACKEIKGRFQERFKTGKNRWFFSKLRF  135



>ref|NP_188862.1| 60S ribosomal protein L27-2 [Arabidopsis thaliana]
 ref|XP_002885488.1| 60S ribosomal protein L27 [Arabidopsis lyrata subsp. lyrata]
 sp|Q8LCL3.2|RL272_ARATH RecName: Full=60S ribosomal protein L27-2 [Arabidopsis thaliana]
 dbj|BAB03070.1| 60S ribosomal protein L27 [Arabidopsis thaliana]
 gb|AAL32695.1| 60S ribosomal protein L27 [Arabidopsis thaliana]
 gb|AAL36216.1| putative ribosomal protein L27 [Arabidopsis thaliana]
 gb|AAM14157.1| putative ribosomal protein L27 [Arabidopsis thaliana]
 gb|AAM13388.1| 60S ribosomal protein L27 [Arabidopsis thaliana]
 gb|AAM96987.1| putative ribosomal protein L27 [Arabidopsis thaliana]
 gb|AAN15737.1| putative ribosomal protein L27 [Arabidopsis thaliana]
 gb|EFH61747.1| 60S ribosomal protein L27 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE76607.1| 60S ribosomal protein L27-2 [Arabidopsis thaliana]
Length=135

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D L+S DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALKSKDKKVTALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_004303940.1| PREDICTED: 60S ribosomal protein L27-like [Fragaria vesca subsp. 
vesca]
Length=135

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ VT D L S DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVVTPDVLTSKDKKVTALKETKKRFEERFKTGKNRWFFTKLRF  135



>gb|AAM63601.1| ribosomal protein L27, putative [Arabidopsis thaliana]
Length=135

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T D L+S DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLDALKSKDKKVIALKEAKAKLEERFKTGKNRWFFTKLRF  135



>gb|AFK44178.1| unknown [Lotus japonicus]
 gb|AFK45743.1| unknown [Lotus japonicus]
Length=135

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V  D LQS DKKV A KE K R EERFKTGKNRWFF+KL F
Sbjct  79   HLMPTRYTLDVDLKDVVVPDSLQSKDKKVAALKETKKRLEERFKTGKNRWFFTKLGF  135



>gb|KDP25114.1| hypothetical protein JCGZ_22649 [Jatropha curcas]
Length=135

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD  T D L   DKKV AAKE K RFEERFKTGKNRWFFSKLRF
Sbjct  79   HLMPTRYTLDVDLKDVATPDALVGKDKKVTAAKEIKKRFEERFKTGKNRWFFSKLRF  135



>ref|XP_002513410.1| 60S ribosomal protein L27e, putative [Ricinus communis]
 gb|EEF48813.1| 60S ribosomal protein L27e, putative [Ricinus communis]
Length=135

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD  T D L + DKKV AAKE K R E+RFKTGKNRWFFSKLRF
Sbjct  79   HLMPTRYTLDVDLKDVATPDALVTKDKKVTAAKEIKKRLEDRFKTGKNRWFFSKLRF  135



>ref|XP_008342300.1| PREDICTED: 60S ribosomal protein L27 [Malus domestica]
 ref|XP_008362329.1| PREDICTED: 60S ribosomal protein L27 [Malus domestica]
Length=135

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V  + LQ+ DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVNVESLQTKDKKVTALKEVKKRFEERFKTGKNRWFFTKLRF  135



>emb|CDY58747.1| BnaCnng33680D [Brassica napus]
 emb|CDY54868.1| BnaC01g22620D [Brassica napus]
 emb|CDY39508.1| BnaA01g24800D [Brassica napus]
Length=109

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  53   HLMPTRYTLDVDLKEVATLEALSSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  109



>emb|CDY37397.1| BnaC05g30330D [Brassica napus]
Length=109

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  53   HLMPTRYTLDVDLKEVATVEALASKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  109



>gb|ABK93484.1| unknown [Populus trichocarpa]
Length=135

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D L + DKK+ A KE KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTADYLSTKDKKITACKETKARFEERFKTGKNRWFFTKLRF  135



>emb|CDY50270.1| BnaAnng10340D [Brassica napus]
 emb|CDY24288.1| BnaC03g42610D [Brassica napus]
 emb|CDY10627.1| BnaA05g17350D [Brassica napus]
 emb|CDX92934.1| BnaA03g36560D [Brassica napus]
Length=109

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  53   HLMPTRYTLDVDLKEVATLEALASKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  109



>ref|XP_011000630.1| PREDICTED: 60S ribosomal protein L27-3-like [Populus euphratica]
 ref|XP_011000631.1| PREDICTED: 60S ribosomal protein L27-3-like [Populus euphratica]
 ref|XP_011000632.1| PREDICTED: 60S ribosomal protein L27-3-like [Populus euphratica]
Length=135

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD VT D L + DKKV A K+ KARFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVTADSLTTKDKKVTACKDTKARFEERFKTGKNRWFFTKLRF  135



>emb|CDY09044.1| BnaC08g09980D [Brassica napus]
Length=109

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A KEAK + EERFKTGKNRWFF+KLRF
Sbjct  53   HLMPTRYTLDVDLKEVATLEALSSKDKKVAALKEAKGKLEERFKTGKNRWFFTKLRF  109



>ref|XP_004300496.1| PREDICTED: 60S ribosomal protein L27-like [Fragaria vesca subsp. 
vesca]
Length=131

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ VT D L S DKKV A KE K RFEERFKTGKNRWFF+KL+F
Sbjct  75   HLMPTRYTLDVDLKEVVTPDVLTSKDKKVTALKETKKRFEERFKTGKNRWFFTKLKF  131



>ref|XP_009109081.1| PREDICTED: 60S ribosomal protein L27-3 [Brassica rapa]
 ref|XP_009144714.1| PREDICTED: 60S ribosomal protein L27-3 [Brassica rapa]
Length=135

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLEALSSKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_009145415.1| PREDICTED: 60S ribosomal protein L27-3 [Brassica rapa]
Length=135

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLEALASKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_009147953.1| PREDICTED: 60S ribosomal protein L27-3-like [Brassica rapa]
 ref|XP_009135784.1| PREDICTED: 60S ribosomal protein L27-3-like [Brassica rapa]
Length=135

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A KEAKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLEALASKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF  135



>ref|XP_007213975.1| hypothetical protein PRUPE_ppa013198mg [Prunus persica]
 gb|EMJ15174.1| hypothetical protein PRUPE_ppa013198mg [Prunus persica]
Length=135

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY LDVDLK+ +T D LQ+ DKKV A KE KAR E+RFK+GKNRWFF+KLRF
Sbjct  79   HVMPTRYNLDVDLKEVLTVDALQTRDKKVAAKKEIKARLEDRFKSGKNRWFFTKLRF  135



>emb|CDY22727.1| BnaA08g05570D [Brassica napus]
Length=109

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A K+AKA+ EERFKTGKNRWFF+KLRF
Sbjct  53   HLMPTRYTLDVDLKEVATLEALSSKDKKVAALKDAKAKLEERFKTGKNRWFFTKLRF  109



>ref|NP_180781.1| 60S ribosomal protein L27-1 [Arabidopsis thaliana]
 sp|Q9SKX8.1|RL271_ARATH RecName: Full=60S ribosomal protein L27-1 [Arabidopsis thaliana]
 gb|AAD15383.1| 60S ribosomal protein L27 [Arabidopsis thaliana]
 gb|AAY17409.1| At2g32220 [Arabidopsis thaliana]
 gb|ABR46231.1| At2g32220 [Arabidopsis thaliana]
 gb|AEC08651.1| 60S ribosomal protein L27-1 [Arabidopsis thaliana]
Length=135

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLD+DLK+ V+ D + S DKKV A KEAKA+FEERFKTGKNRWFF+KLRF
Sbjct  79   HVMPTRYTLDLDLKNVVSADAISSKDKKVTALKEAKAKFEERFKTGKNRWFFTKLRF  135



>ref|XP_008225811.1| PREDICTED: 60S ribosomal protein L27-3 isoform X2 [Prunus mume]
Length=135

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY LDVDLK+ +T D LQ+ DKKV A KE KAR E+RFK+GKNRWFF+KLRF
Sbjct  79   HMMPTRYNLDVDLKEVLTVDALQTRDKKVAAKKEIKARLEDRFKSGKNRWFFTKLRF  135



>ref|XP_002879375.1| 60S ribosomal protein L27 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55634.1| 60S ribosomal protein L27 [Arabidopsis lyrata subsp. lyrata]
Length=135

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLD+DLK+ V+ D + S DKKV A KEAK++FEERFKTGKNRWFF+KLRF
Sbjct  79   HVMPTRYTLDLDLKNVVSGDAISSKDKKVTALKEAKSKFEERFKTGKNRWFFTKLRF  135



>gb|EPS69465.1| hypothetical protein M569_05303 [Genlisea aurea]
Length=135

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLK+ ++ D L + DKKV A KE K RFEERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKEVLSLDALVTRDKKVTACKEIKKRFEERFKTGKNRWFFSKLRF  135



>gb|ADE76927.1| unknown [Picea sitchensis]
Length=135

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRY+LDVDLK+ VT D L++ DKKV A K  KA FEERFK GKNRWFF+KLRF
Sbjct  79   HIMPTRYSLDVDLKNVVTFDKLETRDKKVAALKGVKASFEERFKAGKNRWFFTKLRF  135



>ref|XP_009107813.1| PREDICTED: 60S ribosomal protein L27-3-like [Brassica rapa]
Length=135

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  T + L S DKKV A KEAKA+ EERFK GKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVATLEALSSKDKKVAALKEAKAKLEERFKAGKNRWFFTKLRF  135



>ref|XP_001777437.1| predicted protein [Physcomitrella patens]
 gb|EDQ57724.1| predicted protein [Physcomitrella patens]
Length=135

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRY+LDVDLK+ VT D L+S   +V + K AKA  EERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYSLDVDLKNTVTADKLESTASRVESRKAAKAVLEERFKTGKNRWFFSKLRF  135



>ref|XP_008371879.1| PREDICTED: 60S ribosomal protein L27-3-like [Malus domestica]
Length=135

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY LDVDLK+  T D LQ+ DKKV AAKE KAR EERFK+GKNRWFF+K RF
Sbjct  79   HVMPTRYNLDVDLKEXATVDSLQTRDKKVAAAKEVKARLEERFKSGKNRWFFTKFRF  135



>gb|KDO47076.1| hypothetical protein CISIN_1g041379mg, partial [Citrus sinensis]
Length=85

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK  VT D LQS DKK+ A KE K R EERFKT KNRWFF+KLRF
Sbjct  29   HLMPTRYTLDVDLKVVVTADSLQSKDKKMIACKETKKRLEERFKTSKNRWFFTKLRF  85



>gb|EPS70266.1| hypothetical protein M569_04494 [Genlisea aurea]
Length=180

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDL++ ++ D L + DKKV A+KE K RFE+RFKTGKNRWFFSKLRF
Sbjct  124  HIMPTRYTLDVDLREVLSPDALVTRDKKVTASKEIKKRFEDRFKTGKNRWFFSKLRF  180



>ref|XP_001768302.1| predicted protein [Physcomitrella patens]
 gb|EDQ66916.1| predicted protein [Physcomitrella patens]
Length=135

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRY+LDVDLK+ VT D L+S   +V A K +K   EERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYSLDVDLKNIVTADKLESTASRVEARKASKTVLEERFKTGKNRWFFSKLRF  135



>gb|ABK22795.1| unknown [Picea sitchensis]
 gb|ABK25628.1| unknown [Picea sitchensis]
Length=135

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRY+LDVDLK+ V+ D L++ DKKV A K  KA FEERFK GKNRWFF+KLRF
Sbjct  79   HIMPTRYSLDVDLKNVVSFDKLETRDKKVAALKGVKASFEERFKAGKNRWFFTKLRF  135



>ref|NP_001278543.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG38303.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG38762.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACR34879.1| unknown [Zea mays]
Length=137

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVD KD  T   D L +HDKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDFKDVATGGPDALSTHDKKVAACKTAKARLEERFKTGKNRWFFTKLRF  137



>ref|XP_007215138.1| hypothetical protein PRUPE_ppa013188mg [Prunus persica]
 gb|EMJ16337.1| hypothetical protein PRUPE_ppa013188mg [Prunus persica]
Length=135

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD V  +   + DKKV A KE K RFEERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVVNVEAFATKDKKVTALKETKKRFEERFKTGKNRWFFTKLRF  135



>ref|XP_001766314.1| predicted protein [Physcomitrella patens]
 gb|EDQ68946.1| predicted protein [Physcomitrella patens]
Length=135

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRY+LDVDLK  VT D L+S   +V A K AKA  EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYSLDVDLKSTVTADKLESTASRVEARKGAKAVLEERFKTGKNRWFFTKLRF  135



>gb|AFW68968.1| 60S ribosomal protein L27 [Zea mays]
Length=260

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVD KD  T   D L +HDKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  202  HLMPTRYTLDVDFKDVATGGPDALSTHDKKVAACKTAKARLEERFKTGKNRWFFTKLRF  260



>ref|XP_002949746.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49298.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=135

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ ++ + L++  KK  A KEAK   EE+FK+GKNRWFFSKLRF
Sbjct  79   HMMPTRYTLDVDLKNVISAEALETATKKTEARKEAKKLLEEKFKSGKNRWFFSKLRF  135



>ref|XP_005850467.1| hypothetical protein CHLNCDRAFT_57155 [Chlorella variabilis]
 gb|EFN58365.1| hypothetical protein CHLNCDRAFT_57155 [Chlorella variabilis]
Length=134

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTL+V+LK  VT DC+ +  KKV A KEAKA  EE+FK+GKNRWFF+KL F
Sbjct  78   HIMPTRYTLEVELKGVVTADCIDNSTKKVEANKEAKALLEEKFKSGKNRWFFAKLAF  134



>ref|XP_001782583.1| predicted protein [Physcomitrella patens]
 gb|EDQ52572.1| predicted protein [Physcomitrella patens]
Length=135

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRY+LDVDLK  +T D L+S   +V A K AKA  EERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYSLDVDLKSTLTADKLESTAGRVEARKGAKAVLEERFKTGKNRWFFSKLRF  135



>gb|AAT84169.1| 60S ribosomal protein L27 [Chara globularis]
Length=135

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRY LDVDLK  V  + L++  KKV   KE K   EERFKTGKNRWFFSKLRF
Sbjct  79   HIMPTRYALDVDLKTTVIPEKLETQAKKVETRKEVKKILEERFKTGKNRWFFSKLRF  135



>gb|ABR25709.1| 60S ribosomal protein l27 [Oryza sativa Indica Group]
Length=82

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKD-AVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ A   D L + DKKV A K AKAR E+RFKTGKNRWFF+KLRF
Sbjct  25   HLMPTRYTLDVDLKEVAAGPDALATRDKKVAACKSAKARLEDRFKTGKNRWFFTKLRF  82



>ref|XP_008225812.1| PREDICTED: 60S ribosomal protein L27-3 isoform X3 [Prunus mume]
Length=135

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKL  202
            H+MPTRY LDVDLK+ +T D LQ+ DKKV A KE KAR E+RFK+GKNRWFF+KL
Sbjct  79   HMMPTRYNLDVDLKEVLTVDALQTRDKKVAAKKEIKARLEDRFKSGKNRWFFTKL  133



>gb|KDO45446.1| hypothetical protein CISIN_1g039578mg [Citrus sinensis]
Length=95

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL++DLK+ +T D LQS DKKV A KE K R EERFKTGKN WFF+KL F
Sbjct  39   HLMPTRYTLNIDLKEVLTADSLQSKDKKVTACKETKKRLEERFKTGKNCWFFTKLGF  95



>ref|XP_006293395.1| hypothetical protein CARUB_v10024296mg [Capsella rubella]
 gb|EOA26293.1| hypothetical protein CARUB_v10024296mg [Capsella rubella]
Length=135

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLD+DLKD V+ + + S DKKV A KEAK RFEERFKTGKNR FF+KLRF
Sbjct  79   HVMPTRYTLDLDLKDVVSGEAISSKDKKVTALKEAKTRFEERFKTGKNRCFFTKLRF  135



>ref|XP_001691762.1| ribosomal protein L27, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP04870.1| ribosomal protein L27 [Chlamydomonas reinhardtii]
Length=135

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLK  V  + ++S  KK  A KE K   EE+FK+GKNRWFFSKLRF
Sbjct  79   HIMPTRYTLDVDLKAVVAPEAIESAAKKTDARKECKKLLEEKFKSGKNRWFFSKLRF  135



>ref|NP_001065410.1| Os10g0564300 [Oryza sativa Japonica Group]
 pdb|3J61|Z Chain Z, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAG60203.1|AC084763_23 putative ribosomal protein L27 [Oryza sativa Japonica Group]
 gb|AAP55044.1| 60S ribosomal protein L27, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27247.1| Os10g0564300 [Oryza sativa Japonica Group]
 gb|EAY79547.1| hypothetical protein OsI_34676 [Oryza sativa Indica Group]
 gb|EAZ17001.1| hypothetical protein OsJ_32486 [Oryza sativa Japonica Group]
 gb|ABR25852.1| 60S ribosomal protein l27 [Oryza sativa Indica Group]
 dbj|BAG89924.1| unnamed protein product [Oryza sativa Japonica Group]
Length=136

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKD-AVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ A   D L + DKKV A K AKAR E+RFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVAAGPDALATRDKKVAACKSAKARLEDRFKTGKNRWFFTKLRF  136



>ref|XP_002437450.1| hypothetical protein SORBIDRAFT_10g027330 [Sorghum bicolor]
 gb|EER88817.1| hypothetical protein SORBIDRAFT_10g027330 [Sorghum bicolor]
Length=137

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVD KD  T   D L + DKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDFKDVATGGPDALSTRDKKVAACKTAKARLEERFKTGKNRWFFTKLRF  137



>ref|XP_002532350.1| 60S ribosomal protein L27e, putative [Ricinus communis]
 gb|EEF30023.1| 60S ribosomal protein L27e, putative [Ricinus communis]
Length=151

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H MPT YTLDVDLKD VT D L S D KV AAKE K RFEE FK+GKN+WFFSKLRF
Sbjct  95   HSMPTGYTLDVDLKDVVTPDALVSRDMKVTAAKEIKRRFEEIFKSGKNKWFFSKLRF  151



>gb|KDD76779.1| hypothetical protein H632_c107p1 [Helicosporidium sp. ATCC 50920]
Length=135

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ V  D +++  K+    + A+    E+FKTGKNRWFF+KLRF
Sbjct  79   HMMPTRYTLDVDLKNVVGADAVENSSKRKATNRAARKVLSEKFKTGKNRWFFTKLRF  135



>ref|NP_001288625.1| 60S ribosomal protein L27 [Zea mays]
 ref|XP_008663616.1| PREDICTED: 60S ribosomal protein L27-3-like [Zea mays]
 gb|ACF80486.1| unknown [Zea mays]
 gb|ACG24850.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG30548.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG33916.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG35995.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG36896.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG41834.1| 60S ribosomal protein L27 [Zea mays]
 gb|AFW59513.1| 60S ribosomal protein L27 [Zea mays]
Length=137

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVD KD  +   D L + DKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDFKDVASGGPDALSTRDKKVEACKAAKARLEERFKTGKNRWFFTKLRF  137



>ref|XP_002447124.1| hypothetical protein SORBIDRAFT_06g029070 [Sorghum bicolor]
 gb|EES11452.1| hypothetical protein SORBIDRAFT_06g029070 [Sorghum bicolor]
Length=137

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD  +   D L + DKKV A K AK R EERFK+GKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVASGGPDALSTRDKKVEACKTAKYRLEERFKSGKNRWFFTKLRF  137



>ref|XP_008668869.1| PREDICTED: 60S ribosomal protein L27-3-like [Zea mays]
 tpg|DAA35933.1| TPA: 60S ribosomal protein L27 [Zea mays]
Length=167

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVD KD  +   D L + DKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  109  HLMPTRYTLDVDFKDVASGGPDALSTRDKKVEACKAAKARLEERFKTGKNRWFFTKLRF  167



>ref|XP_008225810.1| PREDICTED: 60S ribosomal protein L27-3 isoform X1 [Prunus mume]
Length=239

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKL  202
            H+MPTRY LDVDLK+ +T D LQ+ DKKV A KE KAR E+RFK+GKNRWFF+KL
Sbjct  79   HMMPTRYNLDVDLKEVLTVDALQTRDKKVAAKKEIKARLEDRFKSGKNRWFFTKL  133



>ref|XP_002504446.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65704.1| predicted protein [Micromonas sp. RCC299]
Length=135

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK  VT D L++  KKV A KEAK   EERFKTGK+RWFF++L F
Sbjct  79   HLMPTRYTLDVDLKATVTPDALENATKKVAARKEAKKILEERFKTGKSRWFFTRLAF  135



>ref|XP_001417642.1| Ribosomal protein L27, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO95935.1| Ribosomal protein L27, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=135

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ VT D L +  KKV A KEAK   EERFKTGK+RWFF++L F
Sbjct  79   HLMPTRYTLDVDLKNVVTSDALDNATKKVAAQKEAKKLLEERFKTGKSRWFFTRLAF  135



>gb|EPS58045.1| hypothetical protein M569_16772 [Genlisea aurea]
Length=124

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYT+DVDLK+A+  D L + D KV A KE K RFEERFKTGKNRWFFSKLRF
Sbjct  69   HIMPTRYTVDVDLKEALPLDSLATRD-KVTACKEIKKRFEERFKTGKNRWFFSKLRF  124



>sp|P41101.1|RL27_SOLTU RecName: Full=60S ribosomal protein L27 [Solanum tuberosum]
 emb|CAB57298.1| 60S ribosomal protein L27 [Solanum tuberosum]
Length=138

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = -1

Query  366  HIMPTRYTLDVDL----KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLR  199
            HIMPTRYTLD DL    KD V  D LQ+ DKKV  A+  KAR  ERFKTGKNRWFF+KLR
Sbjct  79   HIMPTRYTLDEDLKDVVKDVVNADVLQARDKKV-TARRTKARLAERFKTGKNRWFFTKLR  137

Query  198  F  196
            F
Sbjct  138  F  138



>ref|XP_005650056.1| ribosomal protein L27 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE25512.1| ribosomal protein L27 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=135

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVDLK  VT D + +  K+     E     E++FKTGKNRWFF KLRF
Sbjct  79   HIMPTRYTLDVDLKSLVTADVVDNSTKRKETRVEVNKILEDKFKTGKNRWFFQKLRF  135



>gb|KFM27058.1| 60S ribosomal protein L27 [Auxenochlorella protothecoides]
Length=135

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLD++LK  V+ + L++  K+  A K AKA  EE+FKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDLELKGVVSNEALENSTKRKEANKAAKALLEEKFKTGKNRWFFTKLRF  135



>ref|XP_003059933.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55885.1| predicted protein [Micromonas pusilla CCMP1545]
Length=135

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK  VT D L +  KKV A KEAK   EERFKTGK+RWFF++L F
Sbjct  79   HLMPTRYTLDVDLKTTVTPDVLDNATKKVAARKEAKKVLEERFKTGKSRWFFTRLAF  135



>ref|XP_002964492.1| hypothetical protein SELMODRAFT_166700 [Selaginella moellendorffii]
 ref|XP_002992032.1| hypothetical protein SELMODRAFT_272249 [Selaginella moellendorffii]
 gb|EFJ06881.1| hypothetical protein SELMODRAFT_272249 [Selaginella moellendorffii]
 gb|EFJ34825.1| hypothetical protein SELMODRAFT_166700 [Selaginella moellendorffii]
Length=134

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+ VT + L +  KK    KE K  FEERFKTGKN+WFF+KLRF
Sbjct  78   HMMPTRYTLDVDLKNVVTSEKLDTDAKKKATRKEVKELFEERFKTGKNKWFFTKLRF  134



>emb|CEF97804.1| Ribosomal protein L27e [Ostreococcus tauri]
Length=135

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDV+ KD VT D L +  KKV A KEAK   EERFKTGK+RWFF++L F
Sbjct  79   HLMPTRYTLDVNFKDVVTSDVLDNATKKVAAQKEAKKLLEERFKTGKSRWFFTRLAF  135



>ref|XP_003079117.1| RL27_PEA 60S ribosomal protein L27 pir||T06451 ribosomal protein 
L27-garden pea (ISS) [Ostreococcus tauri]
Length=184

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDV+ KD VT D L +  KKV A KEAK   EERFKTGK+RWFF++L F
Sbjct  128  HLMPTRYTLDVNFKDVVTSDVLDNATKKVAAQKEAKKLLEERFKTGKSRWFFTRLAF  184



>ref|XP_007514349.1| 60S ribosomal protein L27 [Bathycoccus prasinos]
 emb|CCO15786.1| 60S ribosomal protein L27 [Bathycoccus prasinos]
Length=166

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDVDLK  VT D L    KKV A KE+K  FEE+FKTGKNRWFF++L F
Sbjct  110  HLMPTRYSLDVDLKGVVTPDVLDDATKKVAAQKESKKLFEEKFKTGKNRWFFTRLAF  166



>gb|AAA86949.1| ribosomal protein L27 homolog, partial [Pisum sativum]
Length=49

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  342  LDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            LDVDLKDAV  D LQS DKKV A KE K   EERFKTGKNRWFF+KLRF
Sbjct  1    LDVDLKDAVVPDVLQSKDKKVTALKETKKSVEERFKTGKNRWFFTKLRF  49



>ref|XP_003563284.1| PREDICTED: 60S ribosomal protein L27-3-like [Brachypodium distachyon]
Length=137

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLKD  +   D L S DKKV AAK AKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKDVASGGPDALASSDKKVAAAKSAKARLEERFKTGKNRWFFTKLRF  137



>gb|ACG47567.1| hypothetical protein [Zea mays]
Length=57

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = -1

Query  360  MPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            MPTRYTLDVD KD  +   D L + DKKV A K AKAR EERFKTGKNRWFF+ LRF
Sbjct  1    MPTRYTLDVDFKDVASGGPDALSTRDKKVEACKAAKARLEERFKTGKNRWFFTXLRF  57



>emb|CBI27167.3| unnamed protein product [Vitis vinifera]
Length=131

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKN  223
            H+MPTRYTLDVDLKD VT D LQS DKKV AAKE KARFEERFKTGKN
Sbjct  54   HLMPTRYTLDVDLKDVVTVDALQSRDKKVTAAKETKARFEERFKTGKN  101



>ref|NP_001146947.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACF85346.1| unknown [Zea mays]
 gb|ACG24674.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG29552.1| 60S ribosomal protein L27 [Zea mays]
 gb|ACG32212.1| 60S ribosomal protein L27 [Zea mays]
 gb|AFW75993.1| 60S ribosomal protein L27 [Zea mays]
Length=137

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVD KD  T   D L + DKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDFKDVATGGPDALSTRDKKVAACKAAKARLEERFKTGKNRWFFTKLRF  137



>gb|KFK31141.1| hypothetical protein AALP_AA6G074200 [Arabis alpina]
Length=132

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLD+DL   V  D + S DKKV A KEAK +FEERFK+GKN+WFF+KLRF
Sbjct  79   HLMPTRYTLDLDL---VNGDSISSKDKKVTALKEAKIKFEERFKSGKNKWFFTKLRF  132



>ref|XP_006661913.1| PREDICTED: 60S ribosomal protein L27-3-like [Oryza brachyantha]
Length=137

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVD KD  +   D L + DKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDFKDVASGGPDALATRDKKVAACKAAKARLEERFKTGKNRWFFTKLRF  137



>ref|NP_001046570.1| Os02g0284600 [Oryza sativa Japonica Group]
 dbj|BAD21487.1| putative 60S ribosomal protein L27 [Oryza sativa Japonica Group]
 dbj|BAD22201.1| putative 60S ribosomal protein L27 [Oryza sativa Japonica Group]
 dbj|BAF08484.1| Os02g0284600 [Oryza sativa Japonica Group]
 gb|EAY85390.1| hypothetical protein OsI_06769 [Oryza sativa Indica Group]
 gb|EAZ22606.1| hypothetical protein OsJ_06275 [Oryza sativa Japonica Group]
 dbj|BAH00566.1| unnamed protein product [Oryza sativa Japonica Group]
Length=137

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVD KD  +   D L + DKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDVDFKDVASGGPDALATRDKKVAACKAAKARLEERFKTGKNRWFFTKLRF  137



>ref|XP_004963680.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L27-3-like 
[Setaria italica]
Length=231

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVD KD  +   D L + DKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  173  HIMPTRYTLDVDFKDVASGGPDALSTRDKKVAACKAAKARLEERFKTGKNRWFFTKLRF  231



>sp|Q02984.1|RL27_PYRST RecName: Full=60S ribosomal protein L27 [Pyrobotrys stellata]
 emb|CAA48289.1| ribosomal protein L27 [Pyrobotrys stellata]
Length=134

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVD K  V  +  ++  KKV A KE K   EE+FKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDFK-GVAAEAQENPTKKVEARKECKKLLEEKFKTGKNRWFFTKLRF  134



>ref|XP_007048317.1| Ribosomal L27e protein family [Theobroma cacao]
 gb|EOX92474.1| Ribosomal L27e protein family [Theobroma cacao]
Length=135

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNR  220
            H+MPTRYTLD+DLKD VT D LQS DKKV A K  K +FEERFKTGKNR
Sbjct  79   HVMPTRYTLDLDLKDVVTVDSLQSKDKKVSACKATKEKFEERFKTGKNR  127



>ref|XP_006656055.1| PREDICTED: 60S ribosomal protein L27-3-like [Oryza brachyantha]
Length=134

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLDVD KD  +   + L + DKKV A K AKAR EERFKTGKNRWFF+KLRF
Sbjct  76   HIMPTRYTLDVDFKDVASGGPEALATRDKKVAACKAAKARLEERFKTGKNRWFFTKLRF  134



>ref|XP_006361947.1| PREDICTED: 60S ribosomal protein L27-like [Solanum tuberosum]
Length=122

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSK  205
            HIM T YTLDVDLKD V  D L + DKKV A K  KAR EERFKTGKNRWFF++
Sbjct  69   HIMATCYTLDVDLKDVVNADDLLALDKKVTAEKVTKARLEERFKTGKNRWFFTR  122



>gb|KHN39496.1| UTP--glucose-1-phosphate uridylyltransferase [Glycine soja]
Length=507

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWF  214
            H+MPTRYTLDVDLKDAV  D L + DKK       K   EERFKTGKNRWF
Sbjct  460  HLMPTRYTLDVDLKDAVNPDVLNAKDKKA---TAPKKLLEERFKTGKNRWF  507



>ref|XP_006681056.1| hypothetical protein BATDEDRAFT_26801 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78095.1| hypothetical protein BATDEDRAFT_26801 [Batrachochytrium dendrobatidis 
JAM81]
Length=135

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY LD+DLK  VT + ++   ++  A K  K  FEER+  GKN+WFF KLRF
Sbjct  79   HMMPTRYNLDIDLKTIVTGESVKEPSQRAGARKALKKVFEERYNAGKNKWFFQKLRF  135



>gb|EMT11141.1| 60S ribosomal protein L27-3 [Aegilops tauschii]
Length=137

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVT--QDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLDVDLK+  +   D L S DKKV AAK AKA+ EERFKTGKNRWFF+KLRF
Sbjct  79   HLMPTRYTLDVDLKEVASGAPDSLTSKDKKVGAAKAAKAKLEERFKTGKNRWFFTKLRF  137



>ref|XP_005789333.1| hypothetical protein EMIHUDRAFT_433742 [Emiliania huxleyi CCMP1516]
 gb|EOD36904.1| hypothetical protein EMIHUDRAFT_433742 [Emiliania huxleyi CCMP1516]
Length=147

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 6/63 (10%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDK------KVfaakeakarfeerfKTGKNRWFFSK  205
            H+MPTRYT+DVDLK  VT D + S +       +    K  + ++     +GKN+WFF K
Sbjct  85   HVMPTRYTMDVDLKSVVTADIVGSSNPTARQSCRKEVKKSLEEKYAASLASGKNKWFFQK  144

Query  204  LRF  196
            LRF
Sbjct  145  LRF  147



>gb|KCW76743.1| hypothetical protein EUGRSUZ_D01098 [Eucalyptus grandis]
Length=176

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKV  280
            H+MPTRYTLDVDLKD V  DCLQS DKKV
Sbjct  132  HLMPTRYTLDVDLKDVVNPDCLQSKDKKV  160



>ref|XP_011111379.1| hypothetical protein H072_5500 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40620.1| hypothetical protein H072_5500 [Dactylellina haptotyla CBS 200.50]
Length=80

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTLD+D LK A+T D  +   ++  A K  K  FEER++TGKN+WFF+ LRF
Sbjct  23   HLMPTRYTLDMDTLKGALTADTFKEPTQREEAKKSVKKAFEERYQTGKNKWFFTPLRF  80



>ref|XP_003673734.1| hypothetical protein NCAS_0A07950 [Naumovozyma castellii CBS 
4309]
 emb|CCC67353.1| hypothetical protein NCAS_0A07950 [Naumovozyma castellii CBS 
4309]
Length=136

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H++PTRYTLDV+  K+AV+++ ++   ++  A K  K   EER + GKN+WFFSKLRF
Sbjct  79   HLLPTRYTLDVESFKNAVSKETMEQPSQREEAKKVIKKALEERHQAGKNQWFFSKLRF  136



>ref|XP_005705277.1| 60S ribosomal protein L27e [Galdieria sulphuraria]
 gb|EME28757.1| 60S ribosomal protein L27e [Galdieria sulphuraria]
Length=137

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -1

Query  366  HIMPTRYTLDV--DLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTLD+   LK A+ +D   +   +    K  +   +ER+ TGKNRWFF+KLRF
Sbjct  79   HIMPTRYTLDIVDSLKKAIPEDARTNLTSRKKGKKAIQQLLKERYLTGKNRWFFTKLRF  137



>ref|XP_003177187.1| 60S ribosomal protein L27 [Microsporum gypseum CBS 118893]
 gb|EFQ98235.1| 60S ribosomal protein L27-A [Microsporum gypseum CBS 118893]
Length=135

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK AVT D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF  135



>ref|XP_002850593.1| 60S ribosomal protein L27 [Arthroderma otae CBS 113480]
 gb|EEQ27809.1| 60S ribosomal protein L27-A [Arthroderma otae CBS 113480]
Length=135

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK AVT D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF  135



>gb|EZF11226.1| hypothetical protein H100_07669 [Trichophyton rubrum MR850]
 gb|EZF38091.1| hypothetical protein H102_07634 [Trichophyton rubrum CBS 100081]
 gb|EZF48730.1| hypothetical protein H103_07657 [Trichophyton rubrum CBS 288.86]
 gb|EZF59428.1| hypothetical protein H104_07605 [Trichophyton rubrum CBS 289.86]
 gb|EZF69968.1| hypothetical protein H105_07660 [Trichophyton soudanense CBS 
452.61]
 gb|EZF80662.1| hypothetical protein H110_07654 [Trichophyton rubrum MR1448]
 gb|EZF91310.1| hypothetical protein H113_07715 [Trichophyton rubrum MR1459]
 gb|EZG02247.1| hypothetical protein H106_07492 [Trichophyton rubrum CBS 735.88]
 gb|EZG12891.1| hypothetical protein H107_07791 [Trichophyton rubrum CBS 202.88]
 gb|KDB29827.1| hypothetical protein H112_07644 [Trichophyton rubrum D6]
 gb|KFL60147.1| hypothetical protein TERG_00242 [Trichophyton rubrum CBS 118892]
Length=132

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK AVT D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  75   HLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF  132



>gb|EZF11225.1| hypothetical protein H100_07669 [Trichophyton rubrum MR850]
 gb|EZF38090.1| hypothetical protein H102_07634 [Trichophyton rubrum CBS 100081]
 gb|EZF48729.1| hypothetical protein H103_07657 [Trichophyton rubrum CBS 288.86]
 gb|EZF59427.1| hypothetical protein H104_07605 [Trichophyton rubrum CBS 289.86]
 gb|EZF69967.1| hypothetical protein H105_07660 [Trichophyton soudanense CBS 
452.61]
 gb|EZF80661.1| hypothetical protein H110_07654 [Trichophyton rubrum MR1448]
 gb|EZF91309.1| hypothetical protein H113_07715 [Trichophyton rubrum MR1459]
 gb|EZG02246.1| hypothetical protein H106_07492 [Trichophyton rubrum CBS 735.88]
 gb|EZG12890.1| hypothetical protein H107_07791 [Trichophyton rubrum CBS 202.88]
 gb|KDB29826.1| hypothetical protein H112_07644 [Trichophyton rubrum D6]
 gb|KFL60146.1| hypothetical protein TERG_00242 [Trichophyton rubrum CBS 118892]
Length=135

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK AVT D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF  135



>gb|EGE00457.1| 60S ribosomal protein L27-A [Trichophyton tonsurans CBS 112818]
 gb|EZF34255.1| hypothetical protein H101_02193 [Trichophyton interdigitale H6]
 gb|KDB22715.1| hypothetical protein H109_05381 [Trichophyton interdigitale MR816]
Length=135

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK AVT D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF  135



>ref|XP_002796051.1| 60S ribosomal protein L27 [Paracoccidioides sp. 'lutzii' Pb01]
Length=135

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK A+T D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGAITNDTFKEVSQREEAKKTVKKSLEERYNSGKNRWFFTPLRF  135



>gb|EEH04844.1| 60S ribosomal protein L27A [Histoplasma capsulatum G186AR]
 gb|EER37189.1| 60S ribosomal protein L27-A [Histoplasma capsulatum H143]
 gb|EGC40876.1| 60S ribosomal protein [Histoplasma capsulatum H88]
Length=135

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK A+T D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGAITNDTFKEVSQREEAKKVVKKSLEERYTSGKNRWFFTPLRF  135



>ref|XP_002623468.1| 60S ribosomal protein L27 [Blastomyces dermatitidis SLH14081]
 gb|EEQ71125.1| 60S ribosomal protein L27-A [Blastomyces dermatitidis SLH14081]
 gb|EEQ83942.1| 60S ribosomal protein L27-A [Blastomyces dermatitidis ER-3]
 gb|EGE83439.1| 60S ribosomal protein L27-B [Blastomyces dermatitidis ATCC 18188]
 gb|EQL36293.1| 60S ribosomal protein L27-B [Blastomyces dermatitidis ATCC 26199]
Length=135

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK A+T D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGAITNDTFKEVSQREEAKKVVKKSLEERYTSGKNRWFFTPLRF  135



>gb|EEQ42005.1| 60S ribosomal protein L27 [Candida albicans WO-1]
Length=80

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K AVT + L+   ++  A K  K  FEE+ + GKN+WFF KL F
Sbjct  23   HLMPTRYSLDVESFKSAVTSEALEEPSQREEAKKVVKKAFEEKHQAGKNKWFFQKLHF  80



>gb|KGG50862.1| 60S ribosomal protein L27 [Microsporidia sp. UGP3]
Length=166

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DVDLK+ V  D      K+  A      + EE++K G ++WFFSKLRF
Sbjct  110  HLMPTRYSIDVDLKNVVNLDVASDASKRKSACTVVSKKLEEKYKVGGSKWFFSKLRF  166



>ref|XP_007375790.1| 60S ribosomal protein L27 [Spathaspora passalidarum NRRL Y-27907]
 gb|EGW32514.1| 60S ribosomal protein L27 [Spathaspora passalidarum NRRL Y-27907]
Length=136

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K AVT + L+   ++  A K  K   EE+ + GKN+WFF KL F
Sbjct  79   HLMPTRYSLDVESFKSAVTSEALEEPSQREEAKKVVKKALEEKNQAGKNKWFFQKLHF  136



>gb|EEH39750.2| 60S ribosomal protein L27-A [Paracoccidioides sp. 'lutzii' Pb01]
Length=144

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK A+T D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  87   HLMPTRYTLELEGLKGAITNDTFKEVSQREEAKKTVKKSLEERYNSGKNRWFFTPLRF  144



>ref|XP_004208596.1| PREDICTED: 60S ribosomal protein L27-like [Hydra vulgaris]
Length=136

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DV L K+ V +D L+   K+  A  E KA+ EER+K+GKN+WFF KLRF
Sbjct  79   HLMPTRYSVDVALNKNKVNKDILKDGSKRRRAKTEIKAKLEERYKSGKNKWFFQKLRF  136



>emb|CCF49643.1| probable 60S large subunit ribosomal protein L27 [Ustilago hordei]
Length=136

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY L+++ LK AVTQD  +   ++  A K+ KA FEE++ +GKN+WFF+ LRF
Sbjct  79   HLMPTRYALELEGLKGAVTQDTFKEPSQREDAKKQIKAIFEEKYTSGKNKWFFTPLRF  136



>ref|XP_004202042.1| Piso0_001515 [Millerozyma farinosa CBS 7064]
 ref|XP_004202667.1| Piso0_001515 [Millerozyma farinosa CBS 7064]
 emb|CCE79451.1| Piso0_001515 [Millerozyma farinosa CBS 7064]
 emb|CCE88736.1| Piso0_001515 [Millerozyma farinosa CBS 7064]
Length=136

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K AVT + L+   ++    K  K   EE+ + GKN+WFF+KL F
Sbjct  79   HLMPTRYSLDVESFKSAVTSEALEEPSQREEVKKVVKKALEEKHQAGKNKWFFTKLHF  136



>gb|KEQ61101.1| hypothetical protein M437DRAFT_67485 [Aureobasidium melanogenum 
CBS 110374]
 gb|KEQ74757.1| hypothetical protein M436DRAFT_62204 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=135

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTL+++ LK AVT D  +   ++  A K  K   EER+++GKN+WFF+ LRF
Sbjct  78   HIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLRF  135



>gb|KGQ97393.1| 60S ribosomal protein L27 [Candida albicans P37005]
 gb|KGR16523.1| 60S ribosomal protein L27 [Candida albicans P78048]
 gb|KGT71683.1| 60S ribosomal protein L27 [Candida albicans 12C]
 gb|KGU16802.1| 60S ribosomal protein L27 [Candida albicans 19F]
Length=136

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K AVT + L+   ++  A K  K  FEE+ + GKN+WFF KL F
Sbjct  79   HLMPTRYSLDVESFKSAVTSEALEEPSQREEAKKVVKKAFEEKHQAGKNKWFFQKLHF  136



>gb|EST08473.1| putative 60S large subunit ribosomal protein L27 [Pseudozyma 
brasiliensis GHG001]
Length=136

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY L+++ LK AVTQD  +   ++  A K+ K  FEE++ +GKN+WFF+ LRF
Sbjct  79   HLMPTRYALELEGLKGAVTQDTFKEPSQREDAKKQIKQIFEEKYTSGKNKWFFTPLRF  136



>sp|Q9P843.1|RL27_CANAX RecName: Full=60S ribosomal protein L27 [Candida albicans]
 emb|CAB77636.1| ribosomal protein L27 [Candida albicans]
 gb|KGQ90886.1| 60S ribosomal protein L27 [Candida albicans P94015]
 gb|KGR02961.1| 60S ribosomal protein L27 [Candida albicans GC75]
 gb|KGR14457.1| 60S ribosomal protein L27 [Candida albicans P57072]
 gb|KGR22867.1| 60S ribosomal protein L27 [Candida albicans P37037]
 gb|KGU13472.1| 60S ribosomal protein L27 [Candida albicans P87]
 gb|KGU18082.1| 60S ribosomal protein L27 [Candida albicans L26]
 gb|KGU31635.1| 60S ribosomal protein L27 [Candida albicans P34048]
 gb|KGU34594.1| 60S ribosomal protein L27 [Candida albicans P75063]
 gb|KGU37019.1| 60S ribosomal protein L27 [Candida albicans P57055]
 gb|KHC41235.1| 60S ribosomal protein L27 [Candida albicans P76055]
 gb|KHC41904.1| 60S ribosomal protein L27 [Candida albicans P76067]
 gb|KHC48362.1| 60S ribosomal protein L27 [Candida albicans Ca6]
 gb|KHC56195.1| 60S ribosomal protein L27 [Candida albicans P60002]
 gb|KHC60534.1| 60S ribosomal protein L27 [Candida albicans P37039]
 gb|KHC67842.1| 60S ribosomal protein L27 [Candida albicans P75010]
 gb|KHC74527.1| 60S ribosomal protein L27 [Candida albicans P75016]
 gb|KHC83976.1| 60S ribosomal protein L27 [Candida albicans SC5314]
 gb|KHC84629.1| 60S ribosomal protein L27 [Candida albicans P78042]
 gb|KHC89414.1| 60S ribosomal protein L27 [Candida albicans SC5314]
Length=136

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K AVT + L+   ++  A K  K  FEE+ + GKN+WFF KL F
Sbjct  79   HLMPTRYSLDVESFKSAVTSEALEEPSQREEAKKVVKKAFEEKHQAGKNKWFFQKLHF  136



>gb|AAX48860.1| L27 [Suberites domuncula]
Length=136

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DV L K  V +D L+    +  A  E + +FEER KTGKNRWFF KLRF
Sbjct  79   HLMPTRYSVDVTLDKQVVNKDSLREPKNRKKARMEIRKKFEERHKTGKNRWFFQKLRF  136



>ref|XP_005836830.1| large subunit ribosomal protein L27e, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX49850.1| large subunit ribosomal protein L27e, cytoplasmic [Guillardia 
theta CCMP2712]
Length=136

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKD-AVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DVD K   ++ + + +  K+  A K  K  F+ER+  GKNRWFFSKLRF
Sbjct  79   HLMPTRYSVDVDFKPMGISPEVVTNPSKREEARKAIKQAFQERYTQGKNRWFFSKLRF  136



>gb|ADW95787.1| 60S ribosomal L27-like protein [Phragmatopoma lapidosa]
Length=136

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DV+L K+ V +D  +    +  A +E KARFEER+KTGKNRWFF KLRF
Sbjct  79   HLMPTRYSVDVNLEKNVVNKDAFRDPSLRRKAKREVKARFEERYKTGKNRWFFQKLRF  136



>ref|XP_002417801.1| 60S ribosomal protein L27 [Candida dubliniensis CD36]
 emb|CAX45516.1| 60s ribosomal protein l27, putative [Candida dubliniensis CD36]
Length=136

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K AVT + L+   ++  A K  K  FEE+ + GKN+WFF KL F
Sbjct  79   HLMPTRYSLDVESFKAAVTSEALEEPSQREEAKKVVKKAFEEKHQAGKNKWFFQKLHF  136



>ref|XP_003143636.1| ribosomal protein L27 [Loa loa]
 gb|EFO20435.1| 60S ribosomal protein L27 [Loa loa]
Length=136

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            +++PTRY++DV L K+ V +D L+   KK  A  E K +FEER+KTGKNRWFF+KLRF
Sbjct  79   NLLPTRYSVDVILDKNLVNKDVLKEPGKKRRARMEVKTKFEERYKTGKNRWFFTKLRF  136



>gb|EKG17758.1| Ribosomal protein L27e [Macrophomina phaseolina MS6]
Length=135

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  VT D  +   ++  A K  K   EER+++GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGVVTNDTFKEVSQREEAKKTVKKALEERYQSGKNRWFFTPLRF  135



>gb|KHN76565.1| 60S ribosomal protein L27 [Toxocara canis]
Length=145

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            +++PTRY++D+ L K++V +D L+   KK  A +E K++FEER+KTGKN+WFF+KLRF
Sbjct  88   NLLPTRYSVDITLDKNSVNKDVLKEPGKKRKARQEVKSKFEERYKTGKNKWFFTKLRF  145



>gb|KFH66695.1| ribosomal protein L27e [Mortierella verticillata NRRL 6337]
Length=80

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY L+++ LK  VT D  +   ++  A K  K  FEER+ +GKN+WFFSKLRF
Sbjct  23   HLMPTRYGLELETLKSVVTLDSFKEPSQREEAKKAIKKLFEERYNSGKNKWFFSKLRF  80



>ref|XP_001244078.1| conserved hypothetical protein [Coccidioides immitis RS]
Length=80

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  VT D  +   ++  A K  K   E+R+ +GKNRWFF+ LRF
Sbjct  23   HLMPTRYTLELEGLKGVVTNDTFKEVSQREEAKKTVKKALEDRYTSGKNRWFFTPLRF  80



>gb|ELR02028.1| large subunit ribosomal protein L27e [Pseudogymnoascus destructans 
20631-21]
 gb|KFX96200.1| hypothetical protein O988_05422 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY01332.1| hypothetical protein V490_00953 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFY10339.1| hypothetical protein V491_07699 [Pseudogymnoascus pannorum VKM 
F-3775]
 gb|KFY14532.1| hypothetical protein V492_02558 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY26923.1| hypothetical protein V493_03785 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
 gb|KFY42080.1| hypothetical protein V494_02622 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
 gb|KFY43633.1| hypothetical protein V495_03847 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY60509.1| hypothetical protein V497_03573 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
 gb|KFY64388.1| hypothetical protein V496_03279 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY75570.1| hypothetical protein V499_04454 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFY84098.1| hypothetical protein V500_09595 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFZ00494.1| hypothetical protein V498_00019 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
 gb|KFZ08364.1| hypothetical protein V502_09400 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
 gb|KFZ16016.1| hypothetical protein V501_02447 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=135

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  VT D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGVVTADTFKEVSQREEAKKTVKKALEERYTSGKNRWFFTPLRF  135



>ref|XP_004335925.1| ribosomal L27e protein family, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR13912.1| ribosomal L27e protein family, partial [Acanthamoeba castellanii 
str. Neff]
Length=132

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAV-TQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY LDV+L+  V  ++ L+    K    +  K  F+ R+ +GKN+WFF+KLRF
Sbjct  75   HLMPTRYGLDVELRSIVCKENALEKGQNKYKTKQALKKVFQTRYNSGKNKWFFTKLRF  132



>emb|CDI52972.1| probable 60S large subunit ribosomal protein L27 [Melanopsichium 
pennsylvanicum 4]
Length=161

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY L+++ LK AVTQD  +   ++  A K+ K  FEE++ +GKN+WFF+ LRF
Sbjct  104  HLMPTRYALELEGLKGAVTQDTFKEPSQREDAKKQIKQIFEEKYTSGKNKWFFTPLRF  161



>ref|XP_761336.1| hypothetical protein UM05189.1 [Ustilago maydis 521]
 gb|EAK83063.1| hypothetical protein UM05189.1 [Ustilago maydis 521]
Length=190

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY L+++ LK AVTQD  +   ++  A K+ K  FEE++ +GKN+WFF+ LRF
Sbjct  133  HLMPTRYALELEGLKGAVTQDTFKEPSQREDAKKQIKQIFEEKYTSGKNKWFFTPLRF  190



>ref|XP_003666882.1| hypothetical protein MYCTH_2316558 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO61637.1| hypothetical protein MYCTH_2316558 [Myceliophthora thermophila 
ATCC 42464]
Length=135

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  +T D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKSVITADTFKEPSQREEAKKTVKKVLEERYTSGKNRWFFTPLRF  135



>ref|XP_002840000.1| 60S ribosomal protein L27 [Tuber melanosporum Mel28]
 emb|CAZ84191.1| unnamed protein product [Tuber melanosporum]
Length=133

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYT+D++ LK  ++QD  +   ++  A K  K  FEER+++GKN+WFF+ LRF
Sbjct  76   HLMPTRYTIDLETLKGVISQDTFKEPSQREEAKKTIKKAFEERYQSGKNKWFFTPLRF  133



>dbj|GAD94676.1| 60S ribosomal protein L27 [Byssochlamys spectabilis No. 5]
Length=135

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  V+QD  +   ++  A K  K   E+R+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGVVSQDTFKEVSQREDAKKTIKKALEDRYTSGKNRWFFTPLRF  135



>emb|CDS12808.1| Putative 60S ribosomal protein L27 [Absidia idahoensis var. thermophila]
Length=136

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY LD++ +K  V+ +  +   ++V A K  K  FEER++TGKN+WFF+KLRF
Sbjct  79   HMMPTRYALDLEQIKGTVSAETFKDASQRVEAKKVIKKLFEERYQTGKNKWFFNKLRF  136



>emb|CDH60503.1| 60s ribosomal protein l27 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=136

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY LD++ +K  V+ +  +   ++V A K  K  FEER++TGKN+WFF+KLRF
Sbjct  79   HMMPTRYALDLEQIKGTVSAETFKDASQRVEAKKVIKKLFEERYQTGKNKWFFNKLRF  136



>dbj|GAC92959.1| hypothetical protein PHSY_000519 [Pseudozyma hubeiensis SY62]
Length=192

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY L+++ LK AVTQD  +   ++  A K+ K  FEE++ +GKN+WFF+ LRF
Sbjct  135  HLMPTRYALELEGLKGAVTQDTFKEPSQREDAKKQIKQIFEEKYTSGKNKWFFTPLRF  192



>ref|XP_003870903.1| Rpl27a ribosomal protein L27 [Candida orthopsilosis Co 90-125]
 emb|CCE45068.1| hypothetical protein CPAR2_700720 [Candida parapsilosis]
 emb|CCG24776.1| Rpl27a ribosomal protein L27 [Candida orthopsilosis]
Length=136

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K AV+ + L+   ++  A K  K  FEE+ + GKN+WFF KL F
Sbjct  79   HLMPTRYSLDVESFKSAVSSEALEEPSQREEAKKVVKKAFEEKHQAGKNKWFFQKLHF  136



>gb|EIF48001.1| 60s ribosomal protein l27-a [Brettanomyces bruxellensis AWRI1499]
Length=136

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYT D++ +K AVT + +    ++  A K  K  FEER + GKN+WFFSKL F
Sbjct  79   HLMPTRYTFDIEAIKGAVTPEVISEPSQREEAKKIVKKAFEERHRAGKNKWFFSKLSF  136



>ref|XP_003068700.1| 60S ribosomal protein L27 [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER26555.1| 60S ribosomal protein L27-B, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EFW20596.1| 60S ribosomal protein L27e [Coccidioides posadasii str. Silveira]
 gb|EAS32629.2| 60S ribosomal protein L27-B [Coccidioides immitis RS]
Length=135

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  VT D  +   ++  A K  K   E+R+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGVVTNDTFKEVSQREEAKKTVKKALEDRYTSGKNRWFFTPLRF  135



>ref|XP_009154245.1| 60S ribosomal protein L27-A [Exophiala dermatitidis NIH/UT8656]
 gb|EHY53784.1| 60S ribosomal protein L27-A [Exophiala dermatitidis NIH/UT8656]
Length=135

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRYTL+++ LK+ ++ D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HIMPTRYTLELEGLKNVISNDTFKEVSQREDAKKNVKKALEERYLSGKNRWFFTPLRF  135



>emb|CDQ01733.1| Protein BM-RPL-27, isoform a [Brugia malayi]
Length=144

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            +++PTRY++DV L K+ + +D L+   KK  A  E K +FEER+KTGKNRWFF+KLRF
Sbjct  87   NLLPTRYSVDVLLDKNLINKDVLKEPGKKRRARMEVKKKFEERYKTGKNRWFFTKLRF  144



>ref|XP_004992561.1| 60S ribosomal protein RL27 [Salpingoeca rosetta]
 gb|EGD74916.1| 60S ribosomal protein RL27 [Salpingoeca rosetta]
Length=139

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            HIMPTRY+L++   KD V+++ L++  KK  A KE K +    FK G+N WFFSKLRF
Sbjct  82   HIMPTRYSLNLKFNKDVVSKEALKNPVKKAAARKEVKKQLSRHFKKGENTWFFSKLRF  139



>ref|XP_001897240.1| 60S ribosomal protein L27 [Brugia malayi]
 emb|CDQ01734.1| Protein BM-RPL-27, isoform b [Brugia malayi]
Length=136

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            +++PTRY++DV L K+ + +D L+   KK  A  E K +FEER+KTGKNRWFF+KLRF
Sbjct  79   NLLPTRYSVDVLLDKNLINKDVLKEPGKKRRARMEVKKKFEERYKTGKNRWFFTKLRF  136



>ref|XP_002732673.1| PREDICTED: 60S ribosomal protein L27-like isoform X1 [Saccoglossus 
kowalevskii]
 ref|XP_006813963.1| PREDICTED: 60S ribosomal protein L27-like isoform X3 [Saccoglossus 
kowalevskii]
 ref|XP_006813964.1| PREDICTED: 60S ribosomal protein L27-like isoform X4 [Saccoglossus 
kowalevskii]
Length=136

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DV++ K  V +DC +   +K  A +EAKA+FEER+KTGKN+WFF KLRF
Sbjct  79   HLMPTRYSVDVNIDKSVVNKDCFRDPSRKRRARREAKAKFEERYKTGKNKWFFQKLRF  136



>gb|EJW88292.1| 60S ribosomal protein L27 [Wuchereria bancrofti]
Length=136

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            +++PTRY++DV L K+ + +D L+   KK  A  E K +FEER+KTGKNRWFF+KLRF
Sbjct  79   NLLPTRYSVDVLLDKNLINKDVLKEPGKKRRARVEVKKKFEERYKTGKNRWFFTKLRF  136



>ref|XP_002381915.1| 60S ribosomal protein L27 [Aspergillus flavus NRRL3357]
 ref|XP_001818935.2| 60S ribosomal protein L27 [Aspergillus oryzae RIB40]
 gb|EED48499.1| 60S ribosomal protein L27e [Aspergillus flavus NRRL3357]
Length=135

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK +VT D  +   ++  A K  K   E+R+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGSVTNDTFKEVSQREDAKKTVKKALEDRYTSGKNRWFFTPLRF  135



>ref|XP_006813962.1| PREDICTED: 60S ribosomal protein L27-like isoform X2 [Saccoglossus 
kowalevskii]
Length=147

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DV++ K  V +DC +   +K  A +EAKA+FEER+KTGKN+WFF KLRF
Sbjct  90   HLMPTRYSVDVNIDKSVVNKDCFRDPSRKRRARREAKAKFEERYKTGKNKWFFQKLRF  147



>dbj|BAE56933.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=132

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK +VT D  +   ++  A K  K   E+R+ +GKNRWFF+ LRF
Sbjct  75   HLMPTRYTLELEGLKGSVTNDTFKEVSQREDAKKTVKKALEDRYTSGKNRWFFTPLRF  132



>gb|EGE06122.1| 60S ribosomal protein L27-A [Trichophyton equinum CBS 127.97]
Length=140

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK AVT D  +   ++  A K  K   EER+ +GKNRWFF+ L F
Sbjct  78   HLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLTF  135



>ref|XP_008076838.1| 60S ribosomal protein L27 [Glarea lozoyensis ATCC 20868]
 gb|EPE36020.1| 60S ribosomal protein L27 [Glarea lozoyensis ATCC 20868]
Length=207

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK A+T D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  150  HLMPTRYTLELEGLKGAITADTFKEVSQREDAKKVVKKALEERYTSGKNRWFFTPLRF  207



>ref|XP_661826.1| hypothetical protein AN4222.2 [Aspergillus nidulans FGSC A4]
 gb|EAA59321.1| hypothetical protein AN4222.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF74452.1| TPA: 60S ribosomal protein L27e (AFU_orthologue; AFUA_1G06340) 
[Aspergillus nidulans FGSC A4]
Length=135

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  VT D  +   ++  A K  K   E+R+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGTVTADTFKEVSQREEAKKTIKKALEDRYTSGKNRWFFTPLRF  135



>emb|CEJ79979.1| Putative 60S ribosomal protein L27 [Torrubiella hemipterigena]
Length=135

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK A++ D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGAISADTFKEVSQREDAKKTVKKVLEERYTSGKNRWFFTPLRF  135



>gb|ABW23226.1| ribosomal protein rpl27 [Eurythoe complanata]
Length=78

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DV+L K  V +D  +    +  A +EAKA+FEER+ TGKNRWFF KLRF
Sbjct  21   HMMPTRYSVDVNLDKTLVNKDAFRDPALRXXARREAKAKFEERYXTGKNRWFFQKLRF  78



>gb|EKV09886.1| 60S ribosomal protein L27 [Penicillium digitatum PHI26]
Length=135

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  VT D  +   ++  A K  K   E+R+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGIVTNDTFKEVSQREEAKKTIKKALEDRYTSGKNRWFFTSLRF  135



>ref|NP_001078392.1| 60S ribosomal protein L27-3 [Arabidopsis thaliana]
 gb|AEE83536.1| 60S ribosomal protein L27-3 [Arabidopsis thaliana]
Length=131

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKV  280
            H+MPTRYTLDVDLK+  T D LQS DKKV
Sbjct  79   HLMPTRYTLDVDLKEVATLDALQSKDKKV  107



>ref|XP_009228409.1| 60S ribosomal protein L27-A [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT70075.1| 60S ribosomal protein L27-A [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=135

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  VT D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGTVTNDTFKEVSQREDAKKNVKKVLEERYTSGKNRWFFTPLRF  135



>ref|XP_002549225.1| 60S ribosomal protein L27 [Candida tropicalis MYA-3404]
 gb|EER33097.1| 60S ribosomal protein L27 [Candida tropicalis MYA-3404]
Length=80

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K +VT + L+   ++  A K  K  FEE+ + GKN+WFF KL F
Sbjct  23   HLMPTRYSLDVESFKSSVTSESLEEPTQREEAKKVVKKAFEEKHQAGKNKWFFQKLHF  80



>ref|XP_003657733.1| 60S ribosomal protein L27 [Thielavia terrestris NRRL 8126]
 gb|AEO71397.1| hypothetical protein THITE_2171584 [Thielavia terrestris NRRL 
8126]
Length=135

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  +T D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKSVITPDTFKEVSQREEAKKTVKKVLEERYMSGKNRWFFTPLRF  135



>gb|ABW90358.1| putative ribosomal protein L27 [Sipunculus nudus]
Length=127

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVDL-KDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY++DV+L K  V +D  +    +  A +E K +FEER+KTGKNRWFF KLRF
Sbjct  70   HLMPTRYSVDVNLDKQRVNKDAFRDPALRRKARREVKEKFEERYKTGKNRWFFQKLRF  127



>gb|ESZ92505.1| 60S ribosomal protein L27 [Sclerotinia borealis F-4157]
Length=135

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  V+ D  +   ++  A K  K   EER+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGVVSADTFKEVSQREEAKKTVKKALEERYTSGKNRWFFTALRF  135



>ref|XP_001386921.1| 60S ribosomal protein L27 [Scheffersomyces stipitis CBS 6054]
 gb|EAZ62898.1| 60S ribosomal protein L27 [Scheffersomyces stipitis CBS 6054]
Length=136

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY+LDV+  K  VT + L+   ++  A K  K   EE+ + GKN+WFF KL F
Sbjct  79   HLMPTRYSLDVESFKSVVTSEALEEPSQREEAKKVVKKALEEKHQAGKNKWFFQKLHF  136



>ref|XP_004343406.1| 60S ribosomal protein RL27 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW42147.1| 60S ribosomal protein RL27 [Capsaspora owczarzaki ATCC 30864]
Length=135

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  366  HIMPTRYTLDVDLKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRY LD+D K  + ++ L+    +  A    K  F+ER+  GKN+WFF KLRF
Sbjct  79   HLMPTRYGLDIDFKGVLNREHLKDPQSRRKARVAVKKTFQERYNAGKNKWFFQKLRF  135



>ref|XP_003671515.1| ribosomal protein L27 [Naumovozyma dairenensis CBS 421]
 emb|CCD26272.1| hypothetical protein NDAI_0H00980 [Naumovozyma dairenensis CBS 
421]
Length=136

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H++PTRYTLDV+  K+ V+ +  +   ++  A K  K  FEER + GKN+WFFSKLRF
Sbjct  79   HLLPTRYTLDVESFKNVVSTETFEEPSQREEAKKVIKKAFEERHQAGKNQWFFSKLRF  136



>gb|EKV08347.1| 60S ribosomal protein L27 [Penicillium digitatum Pd1]
Length=135

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  366  HIMPTRYTLDVD-LKDAVTQDCLQSHDKKVfaakeakarfeerfKTGKNRWFFSKLRF  196
            H+MPTRYTL+++ LK  VT D  +   ++  A K  K   E+R+ +GKNRWFF+ LRF
Sbjct  78   HLMPTRYTLELEGLKGIVTNDTFKEVSQREEAKKTIKKALEDRYTSGKNRWFFTALRF  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514511713122