BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16242_g1_i3 len=893 path=[121:0-636 758:637-892]

Length=893
                                                                      Score     E

ref|XP_010264420.1|  PREDICTED: uncharacterized protein LOC104602432  68.2    1e-09   
ref|XP_007225607.1|  hypothetical protein PRUPE_ppb013332mg           64.3    5e-09   
gb|KDO38891.1|  hypothetical protein CISIN_1g039492mg                 59.7    1e-07   
ref|XP_008780104.1|  PREDICTED: uncharacterized protein LOC103699888  60.1    2e-07   
ref|XP_008219704.1|  PREDICTED: uncharacterized protein LOC103319889  60.8    2e-07   
gb|KHN25850.1|  hypothetical protein glysoja_041653                   59.3    2e-07   
gb|ACY01936.1|  hypothetical protein                                  60.1    3e-07   
ref|XP_010039125.1|  PREDICTED: uncharacterized protein LOC104427787  60.8    3e-07   
ref|XP_006299079.1|  hypothetical protein CARUB_v10015220mg           57.4    4e-07   
ref|XP_010650282.1|  PREDICTED: ankyrin repeat-containing protein...  61.2    4e-07   
ref|XP_010650281.1|  PREDICTED: ankyrin repeat-containing protein...  61.2    4e-07   
ref|XP_010650279.1|  PREDICTED: ankyrin repeat-containing protein...  61.2    4e-07   
ref|XP_008463459.1|  PREDICTED: uncharacterized protein LOC103501626  59.7    5e-07   
ref|XP_010652555.1|  PREDICTED: uncharacterized protein LOC104879854  58.5    5e-07   
emb|CBI17200.3|  unnamed protein product                              59.7    1e-06   
ref|XP_008457272.1|  PREDICTED: uncharacterized protein LOC103497001  55.8    1e-06   
emb|CAN60366.1|  hypothetical protein VITISV_031870                   59.7    1e-06   Vitis vinifera
ref|XP_010650276.1|  PREDICTED: ankyrin repeat-containing protein...  59.7    1e-06   
ref|NP_001064026.2|  Os10g0106900                                     59.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72676.1|  hypothetical protein VITISV_020406                   59.3    2e-06   Vitis vinifera
ref|XP_010681196.1|  PREDICTED: uncharacterized protein LOC104896176  58.2    2e-06   
gb|AAL75752.1|AC037197_10  Putative copia-type polyprotein            59.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010436687.1|  PREDICTED: uncharacterized protein LOC104720492  58.5    2e-06   
ref|XP_008372614.1|  PREDICTED: uncharacterized protein LOC103435964  58.5    2e-06   
emb|CAN71522.1|  hypothetical protein VITISV_037360                   56.6    3e-06   Vitis vinifera
gb|AAL58228.1|AC084762_2  putative gag-pol polyprotein                58.9    3e-06   Oryza sativa [red rice]
ref|XP_010040154.1|  PREDICTED: uncharacterized protein LOC104428933  55.1    3e-06   
ref|XP_006592464.1|  PREDICTED: uncharacterized protein LOC102665448  55.1    4e-06   
gb|AAP46257.1|  putative polyprotein                                  58.5    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99612.1|  retrotransposon protein, putative, unclassified       58.5    4e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71759.1|  hypothetical protein VITISV_020777                   58.5    4e-06   Vitis vinifera
gb|KHN46621.1|  hypothetical protein glysoja_048547                   55.5    4e-06   
gb|KHM98936.1|  hypothetical protein glysoja_047983                   55.5    4e-06   
ref|XP_007099705.1|  Gag-pol polyprotein-like protein                 57.8    5e-06   
ref|XP_006583762.1|  PREDICTED: uncharacterized protein LOC102665045  55.5    5e-06   
emb|CAN60238.1|  hypothetical protein VITISV_032906                   58.2    5e-06   Vitis vinifera
gb|KHN12331.1|  hypothetical protein glysoja_034423                   55.1    5e-06   
ref|XP_004149950.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.2    5e-06   
ref|XP_009362729.1|  PREDICTED: uncharacterized protein LOC103952776  55.5    7e-06   
ref|XP_004516502.1|  PREDICTED: uncharacterized protein LOC101489943  55.8    8e-06   
ref|XP_006368540.1|  hypothetical protein POPTR_0001s04290g           57.0    9e-06   
emb|CAH66391.1|  OSIGBa0134J07.9                                      57.0    1e-05   Oryza sativa [red rice]
ref|XP_009344643.1|  PREDICTED: F-box/FBD/LRR-repeat protein At4g...  57.0    1e-05   
ref|XP_010928133.1|  PREDICTED: uncharacterized protein LOC105049990  56.2    1e-05   
gb|ABA95820.1|  retrotransposon protein, putative, unclassified       57.0    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KHN23990.1|  hypothetical protein glysoja_047761                   55.1    1e-05   
ref|XP_008450227.1|  PREDICTED: uncharacterized protein LOC103491890  56.2    1e-05   
gb|AGW47867.1|  polyprotein                                           56.6    1e-05   
ref|XP_008338144.1|  PREDICTED: uncharacterized protein LOC103401202  55.1    1e-05   
ref|XP_010243357.1|  PREDICTED: uncharacterized protein LOC104587441  53.1    2e-05   
gb|ABR67407.1|  integrase                                             56.6    2e-05   Cucumis melo [Oriental melon]
ref|XP_008775766.1|  PREDICTED: RNA-binding protein 26-like           55.5    2e-05   
ref|XP_006590081.1|  PREDICTED: uncharacterized protein LOC102666085  55.5    2e-05   
ref|XP_006593143.1|  PREDICTED: uncharacterized protein LOC102660881  53.1    2e-05   
ref|XP_008454868.1|  PREDICTED: uncharacterized protein LOC103495177  54.7    2e-05   
ref|XP_008383455.1|  PREDICTED: uncharacterized protein LOC103446160  54.7    2e-05   
ref|XP_006605237.1|  PREDICTED: uncharacterized protein LOC102669235  54.7    2e-05   
ref|XP_009339703.1|  PREDICTED: uncharacterized protein LOC103931892  55.5    2e-05   
ref|XP_006596850.1|  PREDICTED: uncharacterized protein LOC102669510  55.1    2e-05   
ref|XP_006588127.1|  PREDICTED: uncharacterized protein LOC102669122  55.1    2e-05   
ref|XP_010534731.1|  PREDICTED: uncharacterized protein LOC104810237  54.7    3e-05   
ref|XP_008459718.1|  PREDICTED: uncharacterized protein LOC103498760  54.3    3e-05   
ref|XP_007014181.1|  Uncharacterized protein TCM_038934               55.1    3e-05   
ref|XP_007200035.1|  hypothetical protein PRUPE_ppa024199mg           54.3    3e-05   
ref|XP_007217436.1|  hypothetical protein PRUPE_ppb014563mg           53.1    4e-05   
ref|XP_004493039.1|  PREDICTED: double-strand break repair protei...  54.7    4e-05   
ref|XP_009343509.1|  PREDICTED: uncharacterized protein LOC103935466  54.7    4e-05   
ref|XP_006590044.1|  PREDICTED: uncharacterized protein LOC102665857  55.1    4e-05   
ref|XP_004499905.1|  PREDICTED: uncharacterized protein LOC101491044  54.7    4e-05   
ref|XP_009346568.1|  PREDICTED: uncharacterized protein LOC103938288  54.7    4e-05   
ref|XP_011024400.1|  PREDICTED: uncharacterized protein LOC105125582  52.8    5e-05   
ref|XP_010064610.1|  PREDICTED: uncharacterized protein LOC104451708  52.8    5e-05   
ref|XP_006405962.1|  hypothetical protein EUTSA_v10028209mg           52.4    5e-05   
emb|CAA69271.1|  lectin receptor kinase                               54.7    6e-05   
ref|XP_009349037.1|  PREDICTED: uncharacterized protein LOC103940613  53.1    6e-05   
ref|XP_006588222.1|  PREDICTED: uncharacterized protein LOC102665335  52.8    6e-05   
gb|KHN45255.1|  hypothetical protein glysoja_041941                   52.0    7e-05   
ref|XP_010542108.1|  PREDICTED: uncharacterized protein LOC104815425  52.4    7e-05   
ref|XP_006603119.1|  PREDICTED: uncharacterized protein LOC102665355  53.1    7e-05   
emb|CAN79061.1|  hypothetical protein VITISV_024577                   54.7    7e-05   Vitis vinifera
ref|XP_006590177.1|  PREDICTED: uncharacterized protein LOC102669657  53.9    9e-05   
ref|XP_007034338.1|  CCHC-type integrase-like protein                 53.9    9e-05   
ref|XP_004515561.1|  PREDICTED: uncharacterized protein LOC101496635  52.0    1e-04   
ref|XP_006580664.1|  PREDICTED: uncharacterized protein LOC102668288  53.5    1e-04   
gb|KHN44822.1|  Retrovirus-related Pol polyprotein from transposo...  53.1    1e-04   
ref|XP_006584344.1|  PREDICTED: uncharacterized protein LOC102662068  52.4    1e-04   
ref|XP_009592715.1|  PREDICTED: uncharacterized protein LOC104089503  51.6    1e-04   
ref|XP_008346728.1|  PREDICTED: uncharacterized protein LOC103409699  52.8    1e-04   
ref|XP_006579168.1|  PREDICTED: uncharacterized protein LOC102668417  52.0    1e-04   
ref|XP_009146135.1|  PREDICTED: uncharacterized protein LOC103869817  53.1    1e-04   
gb|AAF16534.1|AC013482_8  T26F17.17                                   53.5    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008355685.1|  PREDICTED: uncharacterized protein LOC103419343  52.8    2e-04   
ref|XP_008789836.1|  PREDICTED: uncharacterized protein LOC103707210  52.0    2e-04   
ref|XP_006577542.1|  PREDICTED: uncharacterized protein LOC102660609  52.4    2e-04   
ref|XP_010669429.1|  PREDICTED: uncharacterized protein LOC104886660  52.8    2e-04   
ref|XP_006579101.1|  PREDICTED: uncharacterized protein LOC102660986  51.2    2e-04   
ref|XP_004145871.1|  PREDICTED: uncharacterized protein LOC101208246  52.8    2e-04   
ref|XP_009124302.1|  PREDICTED: uncharacterized protein LOC103849247  51.2    2e-04   
gb|AAT47077.1|  putative polyprotein                                  52.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009602835.1|  PREDICTED: uncharacterized protein LOC104097920  52.0    3e-04   
gb|KHN01715.1|  Retrovirus-related Pol polyprotein from transposo...  51.6    3e-04   
ref|XP_002317178.2|  hypothetical protein POPTR_0011s011602g          50.1    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009132175.1|  PREDICTED: uncharacterized protein LOC103856...  51.2    3e-04   
ref|XP_006495033.1|  PREDICTED: uncharacterized protein LOC102619790  50.8    3e-04   
ref|XP_009132179.1|  PREDICTED: uncharacterized protein LOC103856...  50.8    3e-04   
emb|CAB75469.1|  copia-type reverse transcriptase-like protein        52.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50001.1|AC007259_14  Hypothetical protein                       52.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAT38758.1|  Putative gag-pol polyprotein, identical               52.4    3e-04   Solanum demissum
emb|CAB71063.1|  copia-type polyprotein                               52.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358324.1|  PREDICTED: uncharacterized protein LOC103422074  52.0    3e-04   
gb|AAG50698.1|AC079604_5  copia-type polyprotein, putative            52.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAG60117.1|AC073555_1  copia-type polyprotein, putative            52.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAN68758.1|  hypothetical protein VITISV_004671                   52.4    4e-04   Vitis vinifera
ref|XP_006605158.1|  PREDICTED: uncharacterized protein LOC102668003  50.4    4e-04   
ref|XP_004237313.1|  PREDICTED: uncharacterized protein LOC101245451  51.2    4e-04   
ref|XP_006599885.1|  PREDICTED: uncharacterized protein LOC102665028  51.2    4e-04   
ref|XP_004156123.1|  PREDICTED: uncharacterized protein LOC101231875  51.6    4e-04   
emb|CDY06400.1|  BnaC05g31300D                                        49.7    4e-04   
ref|XP_008375852.1|  PREDICTED: uncharacterized protein LOC103439077  51.2    4e-04   
emb|CAN70479.1|  hypothetical protein VITISV_023585                   52.0    4e-04   Vitis vinifera
ref|XP_006607070.1|  PREDICTED: uncharacterized protein LOC102666119  51.2    4e-04   
ref|XP_008450471.1|  PREDICTED: uncharacterized protein LOC103492064  51.6    4e-04   
ref|XP_008390391.1|  PREDICTED: uncharacterized protein LOC103452643  51.2    5e-04   
ref|XP_008345390.1|  PREDICTED: uncharacterized protein LOC103408311  51.6    5e-04   
ref|XP_011004775.1|  PREDICTED: uncharacterized protein LOC105111183  50.4    5e-04   
ref|XP_008345992.1|  PREDICTED: uncharacterized protein LOC103408955  50.1    5e-04   
ref|XP_006574018.1|  PREDICTED: uncharacterized protein LOC102660454  50.1    5e-04   
ref|XP_007021628.1|  Uncharacterized protein TCM_031677               51.6    5e-04   
ref|XP_006577639.1|  PREDICTED: uncharacterized protein LOC102659578  50.8    5e-04   
ref|XP_009142131.1|  PREDICTED: uncharacterized protein LOC103866015  48.9    5e-04   
ref|XP_006579114.1|  PREDICTED: uncharacterized protein LOC102664804  50.8    5e-04   
ref|XP_009119950.1|  PREDICTED: uncharacterized protein LOC103844874  49.7    6e-04   
ref|XP_008464912.1|  PREDICTED: uncharacterized protein LOC103502670  50.8    6e-04   
ref|XP_010669264.1|  PREDICTED: uncharacterized protein LOC104886517  50.8    6e-04   
ref|XP_008391488.1|  PREDICTED: uncharacterized protein LOC103453704  49.7    6e-04   
gb|AAR13313.1|  gag-pol polyprotein                                   51.2    7e-04   Phaseolus vulgaris [French bean]
ref|XP_008808025.1|  PREDICTED: BTB/POZ and TAZ domain-containing...  50.8    7e-04   
ref|XP_007050318.1|  Uncharacterized protein TCM_004065               51.2    7e-04   
emb|CDY11902.1|  BnaC03g13280D                                        50.4    9e-04   
ref|XP_010911854.1|  PREDICTED: uncharacterized protein LOC105037921  50.1    9e-04   
ref|XP_009355531.1|  PREDICTED: uncharacterized protein LOC103946540  50.4    0.001   
ref|XP_009338084.1|  PREDICTED: uncharacterized protein LOC103930463  49.3    0.001   
ref|XP_007030287.1|  Uncharacterized protein TCM_026102               48.1    0.001   
ref|XP_010649298.1|  PREDICTED: uncharacterized protein LOC104879162  49.3    0.001   
ref|XP_006388389.1|  hypothetical protein POPTR_0200s00210g           50.8    0.001   



>ref|XP_010264420.1| PREDICTED: uncharacterized protein LOC104602432 [Nelumbo nucifera]
Length=344

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
              G NY +WST+M+ L    +LWDLVE+GY + G+   A +  R+KD +    +  AVD+
Sbjct  18   FQGSNYDVWSTKMKTLFLSQELWDLVEKGYTKDGVAADALRDLRKKDAIALFFIQQAVDD  77

Query  330  SVSHCVLDANNSKEAWDAIKTQYKGKS  250
             +   +  A  SKEAWD + T Y+G +
Sbjct  78   VIFRRISAATRSKEAWDRLYTAYQGTA  104



>ref|XP_007225607.1| hypothetical protein PRUPE_ppb013332mg [Prunus persica]
 gb|EMJ26806.1| hypothetical protein PRUPE_ppb013332mg [Prunus persica]
Length=198

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 9/94 (10%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYK--EKGLKDKAS-------KKDREKDFLIT  358
            LDG+NY  WS +M+ L    DLWDLVE+GY+  EK L  KA+       K++R+ D    
Sbjct  20   LDGKNYEYWSLQMKTLFISQDLWDLVEDGYEEPEKTLTGKATLESQQAVKENRKSDAKAL  79

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             ++   V ++    +L A  SKEAW+ +K +++G
Sbjct  80   FLIQQGVSKNFFPRLLSATTSKEAWEILKIEFQG  113



>gb|KDO38891.1| hypothetical protein CISIN_1g039492mg [Citrus sinensis]
Length=169

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 56/104 (54%), Gaps = 6/104 (6%)
 Frame = -3

Query  540  SSKMGTSFQKL----DGRNYRIWSTEMEKLLKCYDLWDLVEEGY--KEKGLKDKASKKDR  379
            ++ + +SFQ L     G NY  WS +M  L KC +LWDL+E G+   E     +  ++ R
Sbjct  3    ANGVNSSFQPLFPVFKGVNYHFWSLKMNTLFKCQELWDLLETGFIDSEPDEPSQQLREAR  62

Query  378  EKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKSL  247
            ++D     ++  A+D+ V   +  A  S+EAW+ +K +Y G  +
Sbjct  63   KRDSKALFMIQQALDDEVFPTISAATTSREAWEFLKREYLGDEM  106



>ref|XP_008780104.1| PREDICTED: uncharacterized protein LOC103699888 [Phoenix dactylifera]
Length=200

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = -3

Query  513  KLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDR-EKDFLITVILLIAV  337
            +L   NY  WS +M+ LL   D+WD+VE+GY+E G  D+A +++  +KD      +   +
Sbjct  10   RLTNTNYENWSIQMKALLGSQDIWDIVEKGYEEDG--DRAQQRETLKKDKKALYFIYQGL  67

Query  336  DESVSHCVLDANNSKEAWDAIKTQYKG  256
            DE+    ++ A NSK+AW+ ++  +KG
Sbjct  68   DEAAFEKIVGATNSKQAWEILEKAHKG  94



>ref|XP_008219704.1| PREDICTED: uncharacterized protein LOC103319889 [Prunus mume]
Length=258

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGY---------KEKGLKDKASKKDREKDFLIT  358
             DG NY  WS +M+ L    DLWD+VE+GY         KE   K +  K++++KD    
Sbjct  20   FDGENYEYWSVQMKTLFISQDLWDIVEDGYEEQETSKAGKETQEKQQTYKENKKKDANAL  79

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             ++   V +++   +L A  SK+AW+ +K ++KG
Sbjct  80   FLIQQGVSKNLFPRLLPATTSKQAWEILKIEFKG  113



>gb|KHN25850.1| hypothetical protein glysoja_041653, partial [Glycine soja]
Length=186

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 49/88 (56%), Gaps = 3/88 (3%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL---KDKASKKDREKDFLITVILLIA  340
             +G NY  W  +ME      DLWD+VEEG+    L   ++K  KK+++K+      L  A
Sbjct  2    FNGENYDFWRVKMETYFSSQDLWDIVEEGFDTSALNASQEKELKKNKQKNSKALFTLQQA  61

Query  339  VDESVSHCVLDANNSKEAWDAIKTQYKG  256
            V + +   ++ A  SKEAW+ ++ +++G
Sbjct  62   VTDPIFPKIMGAKTSKEAWNTLQEEFQG  89



>gb|ACY01936.1| hypothetical protein [Beta vulgaris]
Length=252

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE----KGLKDKASKK  385
            + +I+     S     G  Y +WS +M+ L K  +LWD+VE GY+E        ++  ++
Sbjct  3    INSITRNSQPSIPIFKGEKYHLWSVKMQTLFKSQELWDIVECGYEEPNESPAEPNQKLRE  62

Query  384  DREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            +R+KD      +  AVD+ +   +  A  SK+AW+ IK +Y+G
Sbjct  63   NRKKDAKALCFIQSAVDDDIFPRISTAKTSKDAWEIIKHEYRG  105



>ref|XP_010039125.1| PREDICTED: uncharacterized protein LOC104427787 [Eucalyptus grandis]
Length=347

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 18/100 (18%)
 Frame = -3

Query  513  KLDGRNYRIWSTEMEKLLKCYDLWDLVEEGY--------------KEKGLKDKASKKDRE  376
            KL+G+NY  WS +M+ L K  DLW+LVE GY               EK L  +  KKD++
Sbjct  13   KLNGKNYNNWSVQMKVLFKFQDLWNLVENGYIEVVDAEAFDALRKTEKDLLVETRKKDQK  72

Query  375  KDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              F I      A++E++   V  A  +KEAWD ++  YKG
Sbjct  73   ALFTI----FQAMEETIFEKVSSAETAKEAWDILQKSYKG  108



>ref|XP_006299079.1| hypothetical protein CARUB_v10015220mg, partial [Capsella rubella]
 gb|EOA31977.1| hypothetical protein CARUB_v10015220mg, partial [Capsella rubella]
Length=104

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = -3

Query  522  SFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS--KKDREKDFLITVIL  349
            S  +  G  Y +WS +M+ + +  ++WDLVE G+++    +     +++R+KD      +
Sbjct  11   SVPQFKGEKYHLWSLKMKTMFRSQEIWDLVENGFEDANPAEPEQQLRENRKKDAKALFFI  70

Query  348  LIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              A+DE +   ++  N S EAW+ +K +Y+G
Sbjct  71   QSALDEDIMSRIVAVNTSHEAWEILKREYQG  101



>ref|XP_010650282.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Vitis vinifera]
Length=646

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
             +G+ Y  WS +M  L    DLW+LV++GY E+ +   A +  R+ D      +  A+ E
Sbjct  12   FEGKGYDTWSIKMRTLFISEDLWELVDKGYVEEEIPRDAMRDVRKNDAKALFFIQQAITE  71

Query  330  SVSHCVLDANNSKEAWDAIKTQYKGKSL  247
            S+   +  A  SKEAWD ++T+Y+  SL
Sbjct  72   SIFPQISKATKSKEAWDTLQTKYQSTSL  99



>ref|XP_010650281.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Vitis vinifera]
Length=674

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
             +G+ Y  WS +M  L    DLW+LV++GY E+ +   A +  R+ D      +  A+ E
Sbjct  12   FEGKGYDTWSIKMRTLFISEDLWELVDKGYVEEEIPRDAMRDVRKNDAKALFFIQQAITE  71

Query  330  SVSHCVLDANNSKEAWDAIKTQYKGKSL  247
            S+   +  A  SKEAWD ++T+Y+  SL
Sbjct  72   SIFPQISKATKSKEAWDTLQTKYQSTSL  99



>ref|XP_010650279.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Vitis vinifera]
 ref|XP_010650280.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Vitis vinifera]
Length=679

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
             +G+ Y  WS +M  L    DLW+LV++GY E+ +   A +  R+ D      +  A+ E
Sbjct  12   FEGKGYDTWSIKMRTLFISEDLWELVDKGYVEEEIPRDAMRDVRKNDAKALFFIQQAITE  71

Query  330  SVSHCVLDANNSKEAWDAIKTQYKGKSL  247
            S+   +  A  SKEAWD ++T+Y+  SL
Sbjct  72   SIFPQISKATKSKEAWDTLQTKYQSTSL  99



>ref|XP_008463459.1| PREDICTED: uncharacterized protein LOC103501626 [Cucumis melo]
Length=257

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDESV  325
            G  Y  WS  M+ LL+  DLWDLVE+GY +   +DK   ++++KD    VI+   V +SV
Sbjct  20   GEGYEFWSIHMKTLLRSQDLWDLVEQGYADPDDEDKLW-ENKKKDSKALVIIQQVVHDSV  78

Query  324  SHCVLDANNSKEAWDAIKTQYKGKS  250
               ++ A +SK+AW  ++  ++G S
Sbjct  79   FSRIVAATSSKQAWLILQKAFQGDS  103



>ref|XP_010652555.1| PREDICTED: uncharacterized protein LOC104879854 [Vitis vinifera]
Length=199

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 7/94 (7%)
 Frame = -3

Query  516  QKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLIT  358
            Q   G NY+IWS +M+  LK +DLW++V E      L       + KA   ++ K F   
Sbjct  12   QIFAGENYQIWSVKMQTYLKAFDLWEVVAEDKPIAPLPMNPTLAQIKAHTDEKTKKFKAK  71

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             ++  +V + V H +++   +KEAWD +K +Y+G
Sbjct  72   TLIQNSVADLVFHRIMNCRATKEAWDKLKLEYQG  105



>emb|CBI17200.3| unnamed protein product [Vitis vinifera]
Length=645

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
              G  Y IWS++M  L    DLW+LV+ GY E+ +   A +  R+KD     ++  A+ E
Sbjct  12   FQGSGYDIWSSKMRTLFISEDLWELVDMGYIEEEISKNAIRDVRKKDAKALFLIQQAIAE  71

Query  330  SVSHCVLDANNSKEAWDAIKTQYK  259
            ++   +  A  SKEAWDA++ +Y+
Sbjct  72   NIFPQISKATKSKEAWDALQIEYQ  95



>ref|XP_008457272.1| PREDICTED: uncharacterized protein LOC103497001 [Cucumis melo]
Length=84

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDESV  325
            G  Y  WS  M+ LL+  +LWDLVE+GY     KDK  +++R+KD    VI+  AV +SV
Sbjct  13   GEGYEFWSISMKTLLRSQNLWDLVEQGYANPDDKDKL-RENRKKDSKALVIIQQAVHDSV  71

Query  324  SHCVLDANNSKEA  286
               +  A  SK+A
Sbjct  72   FSRIAAATTSKQA  84



>emb|CAN60366.1| hypothetical protein VITISV_031870 [Vitis vinifera]
Length=1274

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 49/89 (55%), Gaps = 9/89 (10%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDKASKKDREKDFLITVILLIAV  337
            G  Y  WS +M+ L K  DLWDLVE GY    +E  LK+  +KKD +  F I      AV
Sbjct  21   GECYEFWSIKMKTLFKSQDLWDLVENGYPYPDEEARLKEN-TKKDSKALFFIQQ----AV  75

Query  336  DESVSHCVLDANNSKEAWDAIKTQYKGKS  250
             ES+   +  A  +KEAW  +KT ++G S
Sbjct  76   HESIFSKIAAATTAKEAWTTLKTAFQGSS  104



>ref|XP_010650276.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis 
vinifera]
Length=689

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
              G  Y IWS++M  L    DLW+LV+ GY E+ +   A +  R+KD     ++  A+ E
Sbjct  12   FQGSGYDIWSSKMRTLFISEDLWELVDMGYIEEEISKNAIRDVRKKDAKALFLIQQAIAE  71

Query  330  SVSHCVLDANNSKEAWDAIKTQYK  259
            ++   +  A  SKEAWDA++ +Y+
Sbjct  72   NIFPQISKATKSKEAWDALQIEYQ  95



>ref|NP_001064026.2| Os10g0106900 [Oryza sativa Japonica Group]
 dbj|BAF25940.2| Os10g0106900 [Oryza sativa Japonica Group]
Length=646

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKD-------KASKKDREKDFLITVILL  346
            G NY IWS +M  LL    LWD+VE GY+E    +       K+  +DR  D     ++ 
Sbjct  11   GENYDIWSIKMRTLLLSQGLWDIVENGYQEYSAGETLTAEQKKSLAEDRMSDAKALFLIQ  70

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              V ES+   ++ A  SKEAWD +K +++G
Sbjct  71   QGVAESLFPRIIGAKKSKEAWDKLKEEFQG  100



>emb|CAN72676.1| hypothetical protein VITISV_020406 [Vitis vinifera]
Length=1183

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 49/89 (55%), Gaps = 9/89 (10%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDKASKKDREKDFLITVILLIAV  337
            G  Y  WS +M+ L K  DLWDLVE GY    +E  LK+  +KKD +  F I      AV
Sbjct  21   GECYEFWSIKMKTLFKSQDLWDLVENGYPYPDEEARLKEN-TKKDSKALFFIQQ----AV  75

Query  336  DESVSHCVLDANNSKEAWDAIKTQYKGKS  250
             ES+   +  A  +KEAW  +KT ++G S
Sbjct  76   HESIFSKIAVATTTKEAWTTLKTAFQGSS  104



>ref|XP_010681196.1| PREDICTED: uncharacterized protein LOC104896176 [Beta vulgaris 
subsp. vulgaris]
Length=268

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKE----KGLKDKASKKDREKDFLITVILLIAV  337
            G NY +WS +M  + K  +LWD+VE+GY E        D+  +++R++D      +  A+
Sbjct  19   GENYYLWSLKMTTMFKSQELWDMVEKGYVEPEEASAEPDQKLRENRKRDAKALFFIQPAL  78

Query  336  DESVSHCVLDANNSKEAWDAIKTQYKG  256
            D+ +   V  A+ SK+AW+ IK +Y G
Sbjct  79   DDEIFPRVSVASTSKQAWEIIKQEYFG  105



>gb|AAL75752.1|AC037197_10 Putative copia-type polyprotein [Oryza sativa Japonica Group]
 gb|AAP51797.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1350

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKD-------KASKKDREKDFLITVILL  346
            G NY IWS +M  LL    LWD+VE GY+E    +       K+  +DR  D     ++ 
Sbjct  11   GENYDIWSIKMRTLLLSQGLWDIVENGYQEYSAGETLTAEQKKSLAEDRMSDAKALFLIQ  70

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              V ES+   ++ A  SKEAWD +K +++G
Sbjct  71   QGVAESLFPRIIGAKKSKEAWDKLKEEFQG  100



>ref|XP_010436687.1| PREDICTED: uncharacterized protein LOC104720492 [Camelina sativa]
Length=365

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 59/110 (54%), Gaps = 13/110 (12%)
 Frame = -3

Query  528  GTSFQKL---DGRNYRIWSTEMEKLLKCYDLWDLVEEGYK----EKG-----LKDKASKK  385
            G+S Q +   +G+ Y  WS +M  + +  +LW +VEEG      +KG      + K  K+
Sbjct  3    GSSHQVIPIFNGKKYDFWSIKMATIFRTRNLWSVVEEGVPAGPVQKGETPETARAKTLKE  62

Query  384  DRE-KDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKSLKSY  238
            D E  D +   IL  AV + +   +  A++SKEAWDA+K +Y+G    SY
Sbjct  63   DVEANDTMALQILQTAVTDQIFSRIAAASSSKEAWDALKDEYQGSPQLSY  112



>ref|XP_008372614.1| PREDICTED: uncharacterized protein LOC103435964 [Malus domestica]
Length=377

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 68/121 (56%), Gaps = 12/121 (10%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKDKAS  391
            ++S    +FQ   LD +N+  WS +M+ LL  +D+W++VE GY E         L+ ++ 
Sbjct  1    MASNAMATFQVPVLDNKNFDNWSIKMKALLGAHDVWEVVENGYTEPEDEATLSQLQKESL  60

Query  390  KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG-KSLK--SYFCLRCK  220
            K  R+KD     ++  A+D +    V  A ++K+AW+ ++T YKG + +K   ++  +C+
Sbjct  61   KDSRKKDKKALYLIYQALDNNGFEKVSSATSAKQAWEKLQTSYKGAEQVKKFGHYAWKCR  120

Query  219  S  217
            +
Sbjct  121  A  121



>emb|CAN71522.1| hypothetical protein VITISV_037360 [Vitis vinifera]
Length=196

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 52/95 (55%), Gaps = 10/95 (11%)
 Frame = -3

Query  516  QKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKG--------LKDKASKKDREKDFLI  361
            Q   G NYRIWS +M+  L+ +DLW++V   +K            + KA   ++ K F  
Sbjct  12   QIFAGENYRIWSVKMQMYLEAFDLWEVV--VHKPIAPLPTNLTLAQIKAYTDEKTKKFEA  69

Query  360  TVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              ++  +V +SV H +++   +KEAWD +K +Y+G
Sbjct  70   KTLIQNSVADSVFHRIMNYKTTKEAWDKLKLEYQG  104



>gb|AAL58228.1|AC084762_2 putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF96256.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1167

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLITVILL  346
            G NY IWS +M  LL    LWD+VE GY+E          + K+  +DR  D     ++ 
Sbjct  11   GENYDIWSIKMRTLLLSQGLWDIVENGYQEYSAGETLTAEQKKSLAEDRMSDAKALFLIQ  70

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              V ES+   ++ A  SKEAWD +K +++G
Sbjct  71   QGVAESLFPRIIGAKKSKEAWDKLKEEFQG  100



>ref|XP_010040154.1| PREDICTED: uncharacterized protein LOC104428933 [Eucalyptus grandis]
Length=129

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (49%), Gaps = 0/92 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
             D  NY  WS +M   L   DLWD+VE+G +        SK   +KD      +  A+ E
Sbjct  14   FDVNNYDFWSIKMTTFLMAQDLWDIVEKGCEAPPEGASVSKDQLQKDARALYFIQQALSE  73

Query  330  SVSHCVLDANNSKEAWDAIKTQYKGKSLKSYF  235
            ++   ++ A  +K AWD ++ +++G   +  F
Sbjct  74   TIFQRIIGARTAKGAWDILREEFQGSEKRQSF  105



>ref|XP_006592464.1| PREDICTED: uncharacterized protein LOC102665448 [Glycine max]
Length=119

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 10/100 (10%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKDKASKKDRE  376
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E       +G+K+   K+ R+
Sbjct  5    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEEQDEVSLSQGVKE-TLKESRK  63

Query  375  KDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            +D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  64   RDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTCNKG  103



>gb|AAP46257.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF99717.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1335

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLITVILL  346
            G NY IWS +M  LL    LWD+VE GY+E          + K+  +DR  D     ++ 
Sbjct  11   GENYDIWSIKMRTLLLSQGLWDIVENGYQEYSAGETLTAEQKKSLAEDRMSDAKALFLIQ  70

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              V ES+   ++ A  SKEAWD +K +++G
Sbjct  71   QGVAESLFPRIIGAKKSKEAWDKLKEEFQG  100



>gb|ABA99612.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1198

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLITVILL  346
            G NY IWS +M  LL    LWD+VE GY+E          + K+  +DR  D     ++ 
Sbjct  11   GENYDIWSIKMRTLLLSQGLWDIVENGYQEYSAGETLTAEQKKSLAEDRMSDAKALFLIQ  70

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              V ES+   ++ A  SKEAWD +K +++G
Sbjct  71   QGVAESLFPRIIGAKKSKEAWDKLKEEFQG  100



>emb|CAN71759.1| hypothetical protein VITISV_020777 [Vitis vinifera]
Length=1472

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (54%), Gaps = 9/89 (10%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDKASKKDREKDFLITVILLIAV  337
            G  Y  WS +M+ L K  DLWDLVE GY    +E  LK+  +KKD +  F I      AV
Sbjct  21   GECYEFWSIKMKTLFKSQDLWDLVENGYPYPDEEARLKEN-TKKDSKALFFIQQ----AV  75

Query  336  DESVSHCVLDANNSKEAWDAIKTQYKGKS  250
             ES+   +     +KEAW  +KT ++G S
Sbjct  76   HESIFSKIAAXTTAKEAWTTLKTAFQGSS  104



>gb|KHN46621.1| hypothetical protein glysoja_048547, partial [Glycine soja]
Length=158

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKD  382
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E   +D+AS         K+ 
Sbjct  3    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE---QDEASLSQGVKETLKES  59

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            R++D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  60   RKRDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTCNKG  101



>gb|KHM98936.1| hypothetical protein glysoja_047983, partial [Glycine soja]
 gb|KHN01086.1| hypothetical protein glysoja_000754, partial [Glycine soja]
 gb|KHN08085.1| hypothetical protein glysoja_023695, partial [Glycine soja]
 gb|KHN10366.1| hypothetical protein glysoja_048706, partial [Glycine soja]
 gb|KHN19197.1| hypothetical protein glysoja_047113, partial [Glycine soja]
 gb|KHN21855.1| hypothetical protein glysoja_032739, partial [Glycine soja]
 gb|KHN34471.1| hypothetical protein glysoja_037949, partial [Glycine soja]
 gb|KHN35619.1| hypothetical protein glysoja_030971, partial [Glycine soja]
Length=158

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKD  382
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E   +D+AS         K+ 
Sbjct  3    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE---QDEASLSQGVKETLKES  59

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            R++D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  60   RKRDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTCNKG  101



>ref|XP_007099705.1| Gag-pol polyprotein-like protein [Theobroma cacao]
 gb|EOY20320.1| Gag-pol polyprotein-like protein [Theobroma cacao]
Length=492

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 10/104 (10%)
 Frame = -3

Query  537  SKMGTSFQK---LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------K  388
            S    SFQ     +G NY IWS +ME  L+  DLWD+VE G +   LKD A+        
Sbjct  7    SNTAFSFQSPPVFNGENYPIWSEKMESYLRGLDLWDVVESGAEVPALKDNATPAQVKQHH  66

Query  387  KDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            K+  K F     +  A+ +++   ++    +K+AW+ +K Q++G
Sbjct  67   KEVAKRFRALSYIQGALTDAMFVRIMGCKTAKDAWERLKVQFEG  110



>ref|XP_006583762.1| PREDICTED: uncharacterized protein LOC102665045, partial [Glycine 
max]
Length=163

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKD  382
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E   +D+AS         K+ 
Sbjct  5    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE---QDEASLSQGVKETLKES  61

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            R++D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  62   RKRDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTCNKG  103



>emb|CAN60238.1| hypothetical protein VITISV_032906 [Vitis vinifera]
Length=1430

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 9/91 (10%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDKASKKDREKDFLITVILLI  343
            ++G  Y  WS +M+ L K  DLWDLVE GY    +E  LK+  +KKD +  F I      
Sbjct  133  VEGECYEFWSIKMKTLFKSQDLWDLVENGYPYPDEEARLKEN-TKKDSKALFFIQQ----  187

Query  342  AVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
            A+ ES+   +  A  +KEAW  ++T ++G S
Sbjct  188  AIHESIFSKIAVATTAKEAWTTLETAFQGSS  218



>gb|KHN12331.1| hypothetical protein glysoja_034423, partial [Glycine soja]
Length=158

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 16/103 (16%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKD---KASKK  385
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E       +G+K+   ++ K+
Sbjct  3    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEEQDEASLSQGVKETLKESRKR  62

Query  384  DREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            D++  FLI  +    VDE     + +A  +KEAWD ++T  KG
Sbjct  63   DKKALFLIYQL----VDEDTFEKISNATTAKEAWDKLQTCNKG  101



>ref|XP_004149950.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101216349 
[Cucumis sativus]
Length=1830

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = -3

Query  540  SSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDK-------A  394
            S+ +     + +G+NYR WS +M+ L    DLWD+V+ GY     E GL  +       A
Sbjct  3    SNMLQPQLPRFEGKNYRRWSQQMKVLYGSQDLWDIVDIGYSEPESENGLSAQQLNELRDA  62

Query  393  SKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGK  253
             KKD++  F I      +VDE++   +   + +K AWDA++  Y+G+
Sbjct  63   RKKDKKALFFI----YQSVDENIFERISGVSTAKAAWDALQNLYEGE  105



>ref|XP_009362729.1| PREDICTED: uncharacterized protein LOC103952776 [Pyrus x bretschneideri]
Length=210

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 61/107 (57%), Gaps = 13/107 (12%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS +M+ LL  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNAMAAFQVPVLDSNNFDNWSIKMKALLGAHDVWEIVEKGYTEP--EDEATLSQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              K  R++D     ++  A+D++    V  A ++K+AW+ ++T YKG
Sbjct  59   SLKDSRKRDKKALYLIYQALDDNGFEKVSSATSTKQAWEKLQTSYKG  105



>ref|XP_004516502.1| PREDICTED: uncharacterized protein LOC101489943 [Cicer arietinum]
Length=232

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKDKA  394
            + N+ S+M     +L   NY  WS +M+ LL   + W++  +G++E          ++KA
Sbjct  1    MANVMSQM--PLPRLTKSNYDNWSVQMKALLGALEAWEVTRDGFEEPTNTTGYTAAQNKA  58

Query  393  SKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             K+ R KD     +L  AVD+S    +  +  SKEAWD +K  ++G
Sbjct  59   LKETRSKDKTALYMLFRAVDDSGFEKIAGSATSKEAWDTLKKAFEG  104



>ref|XP_006368540.1| hypothetical protein POPTR_0001s04290g [Populus trichocarpa]
 gb|ERP65109.1| hypothetical protein POPTR_0001s04290g [Populus trichocarpa]
Length=665

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 56/111 (50%), Gaps = 15/111 (14%)
 Frame = -3

Query  570  AESRKVLTNISSKMGTSFQKL-----DGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-KG  409
            AES   LT +  +  +SF  +     DG NY++W+ +ME  L   DLW+ VE+ Y+E K 
Sbjct  459  AESNYFLTGLVMEAESSFSHISSLIFDGENYQLWAVKMETYLDALDLWEAVEDDYEERKT  518

Query  408  LKDKASKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             K KA  K           L  A+  ++   ++   ++K+ WD +K +Y G
Sbjct  519  RKSKAKAK---------ACLFAAISTTIFTRIMSLKSAKDVWDYLKKEYAG  560



>emb|CAH66391.1| OSIGBa0134J07.9 [Oryza sativa Indica Group]
Length=1314

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLITVILL  346
            G NY IWS +M  LL    LWD+V+ GY+E          + K+  +DR  D     ++ 
Sbjct  11   GENYDIWSIKMRTLLLSQGLWDIVDNGYQEYSAGETLTAEQKKSLAEDRMSDAKALFLIQ  70

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              V ES+   ++ A  SKEAWD +K +++G
Sbjct  71   QGVAESLFPRIIGAKKSKEAWDKLKEEFQG  100



>ref|XP_009344643.1| PREDICTED: F-box/FBD/LRR-repeat protein At4g00160-like [Pyrus 
x bretschneideri]
Length=614

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 62/107 (58%), Gaps = 13/107 (12%)
 Frame = -3

Query  543  ISSKMGTSFQKL--DGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ L  D  N+  WS +M+ LL  +D+W++VE+GY E  L+D+A+       
Sbjct  1    MASNAMAAFQVLVLDNNNFDNWSIKMKALLGAHDVWEVVEKGYTE--LEDEATLSQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              K  R++D     ++  A+D++    V  A ++K+AW+ ++T YKG
Sbjct  59   SLKDSRKRDKKALYLIYQALDDNGFEKVSSATSAKQAWEKLQTSYKG  105



>ref|XP_010928133.1| PREDICTED: uncharacterized protein LOC105049990 [Elaeis guineensis]
Length=338

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDKAS----KKDREKDFLITV  355
             +G+ Y  W+ +M +     DLWD+VE GY    +E+G    A     K +R+KD    V
Sbjct  14   FNGQAYEFWNIKMGRFFISLDLWDMVENGYAEPTEEEGRLTPAQRNELKDNRKKDAKAFV  73

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             L  AV   +   +  A+++KEAW+ +K +Y+G
Sbjct  74   ALQQAVTGPIFPGIAGASSTKEAWNILKKEYQG  106



>gb|ABA95820.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1142

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLITVILL  346
            G NY IWS +M  LL    LWD+VE GY+E          + K+  +DR  D     ++ 
Sbjct  11   GENYDIWSIKMRTLLLSQGLWDIVENGYQEYSAGETLTAEQKKSLAEDRMSDAKALFLIQ  70

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              V ES+   ++ A  SK+AWD +K +++G
Sbjct  71   QGVAESLFPRIIGAKKSKKAWDKLKEEFQG  100



>gb|KHN23990.1| hypothetical protein glysoja_047761, partial [Glycine soja]
Length=205

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 51/104 (49%), Gaps = 7/104 (7%)
 Frame = -3

Query  546  NISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGY-------KEKGLKDKASK  388
            N +     S    +G NY  W  +ME      DLWD+VEEG+            ++K  K
Sbjct  1    NTTQSSTISVPIFNGENYDFWRVKMETYFSSQDLWDIVEEGFTIPADTSALNASQEKELK  60

Query  387  KDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            K+++K+      L  AV + +   ++ A  +KEAW+ ++ +++G
Sbjct  61   KNKQKNSKALFTLQQAVTDPIFPRIMGAKTAKEAWNTLQEEFQG  104



>ref|XP_008450227.1| PREDICTED: uncharacterized protein LOC103491890 [Cucumis melo]
Length=344

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASK--KDREKDFLITVILLIAVDESV  325
             Y  WS  M+ LL+  DLWDLVE+GY +    D  SK  ++R+KD    VI+  AV +SV
Sbjct  22   GYEFWSIRMKTLLRSQDLWDLVEQGYVD---PDDESKLWENRKKDSKALVIIQQAVHDSV  78

Query  324  SHCVLDANNSKEAWDAIKTQYKGKS  250
               +  + +SK+AW  ++  ++G S
Sbjct  79   FSQIAASTSSKQAWLILQKAFQGDS  103



>gb|AGW47867.1| polyprotein [Phaseolus vulgaris]
Length=1471

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 49/87 (56%), Gaps = 7/87 (8%)
 Frame = -3

Query  495  YRIWSTEMEKLLKCYDLWDLVEEGYKEK-------GLKDKASKKDREKDFLITVILLIAV  337
            Y  WS +M+ LL   D W++VEEG++E          + KA K+ R KD     +L  AV
Sbjct  19   YDNWSIQMKALLGSQDSWEVVEEGFEEPTNTTGYTAAQTKALKEMRSKDKAALYMLYRAV  78

Query  336  DESVSHCVLDANNSKEAWDAIKTQYKG  256
            DE++   +  A+ SKEAWD ++  +KG
Sbjct  79   DEAIFEKIAGASTSKEAWDILEKVFKG  105



>ref|XP_008338144.1| PREDICTED: uncharacterized protein LOC103401202 [Malus domestica]
Length=232

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS +M  LL  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNAMAAFQVPVLDNNNFDNWSIKMRALLGAHDVWEVVEKGYTEP--EDEATLSQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              K  R++D     ++  A+D++    V  A ++K+AW+ ++T YKG
Sbjct  59   SLKDSRKRDKKALYLIYQALDDNGFEKVSSATSAKQAWEKLQTSYKG  105



>ref|XP_010243357.1| PREDICTED: uncharacterized protein LOC104587441 [Nelumbo nucifera]
Length=111

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL--KDKASKKDREKDFLITVILLIAVDE  331
            G N   WS +M+ + K  +LWDLVE+G+++      D+  ++ R+KD     ++  A+DE
Sbjct  19   GENSHFWSLKMKTMFKSQELWDLVEKGFEDTSPIEPDQRLRETRKKDAKALFLIQQALDE  78

Query  330  SVSHCVLDANNSKEAWDAIKTQYKG  256
             +   +  A+ S +AW+ +K ++ G
Sbjct  79   EIFPRIAAASTSTQAWEILKQEFLG  103



>gb|ABR67407.1| integrase [Cucumis melo subsp. melo]
Length=1281

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 61/115 (53%), Gaps = 17/115 (15%)
 Frame = -3

Query  513  KLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------KKDREKDFLITV  355
            +  G+N+  WS +M+ L    +LWD+VE GY E   + + +       +++R KD     
Sbjct  14   RFSGKNFNQWSIQMKVLYGSQELWDIVERGYTEVENQSELTNQQLVELRENRNKDKKALF  73

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG---------KSLKSYF-CLRCK  220
             +  AVDE +S  +  A ++K AWD +++ Y+G         ++L+S F C++ K
Sbjct  74   FIYQAVDEFISERISTATSAKAAWDILRSTYQGEDKVKMIRLQALRSEFDCIKMK  128



>ref|XP_008775766.1| PREDICTED: RNA-binding protein 26-like [Phoenix dactylifera]
Length=261

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDRE---KDFLITVILLIAVDES  328
            NY  WS +M+ LL   D+WD+VE GY E   KD    + RE   KD      +   +D +
Sbjct  15   NYENWSIQMKALLGSQDIWDIVERGYVEAEDKDILMAQQRETLKKDKKALYFIYQGLDHA  74

Query  327  VSHCVLDANNSKEAWDAIKTQYKG  256
                V  A NSK+ W  ++  YKG
Sbjct  75   AFEKVASATNSKQVWKILQNAYKG  98



>ref|XP_006590081.1| PREDICTED: uncharacterized protein LOC102666085 [Glycine max]
Length=296

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKD  382
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E   +D+AS         K+ 
Sbjct  5    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE---QDEASLSQGVKETLKES  61

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            R++D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  62   RKRDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTCNKG  103



>ref|XP_006593143.1| PREDICTED: uncharacterized protein LOC102660881 [Glycine max]
Length=114

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 53/101 (52%), Gaps = 7/101 (7%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDRE-------KDFLITVI  352
            L G  Y  WS +++  L  +D+W++VE+GYKE   +   SK  +E       +D     +
Sbjct  14   LKGITYDNWSIKIKAFLGAHDVWEMVEKGYKEPQDETSLSKAQKETLKDSRKRDKNALFL  73

Query  351  LLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKSLKSYFCL  229
            +  A+D+     + +A ++KEAWD ++T  KG+      CL
Sbjct  74   IYQALDDDAFEKISNATSAKEAWDKLQTSRKGEDKVKKVCL  114



>ref|XP_008454868.1| PREDICTED: uncharacterized protein LOC103495177 [Cucumis melo]
Length=218

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 60/115 (52%), Gaps = 17/115 (15%)
 Frame = -3

Query  513  KLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------KKDREKDFLITV  355
            +  G+N+  WS +M+ L    +LWD++E GY E   + + +       +++R+KD     
Sbjct  14   RFSGKNFNQWSIQMKVLYGSQELWDIIERGYTEVENQSELTNQQLVELRENRKKDKKALF  73

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG---------KSLKSYF-CLRCK  220
             +  AVDE +      A ++K AWD +++ Y+G         ++L+S F C++ K
Sbjct  74   FIYQAVDEFIFERTSTATSAKAAWDILRSTYQGEDKAKMIRLQALRSEFDCIKMK  128



>ref|XP_008383455.1| PREDICTED: uncharacterized protein LOC103446160 [Malus domestica]
Length=231

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 63/118 (53%), Gaps = 13/118 (11%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS +M+ LL  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNAMAAFQVPVLDNNNFDNWSIKMKALLGAHDVWEVVEKGYTEP--EDEATMSQPQNE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKSLKSYFCLRC  223
              K  R++D     ++  A+D++    V  A ++K+AW+ ++T YK        CL+ 
Sbjct  59   SLKXSRKRDKKALYLIYQALDDNGFEKVSXATSAKQAWEKLQTSYKXAKQVKKVCLQV  116



>ref|XP_006605237.1| PREDICTED: uncharacterized protein LOC102669235 [Glycine max]
Length=225

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 9/97 (9%)
 Frame = -3

Query  522  SFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE----KGLKDKASKKDRE----KDF  367
            S  K +G +Y  WS  ME  L+  +LW +VEEG        G   +A KK  E    KD 
Sbjct  11   SIPKFNG-HYDFWSMNMENFLRSKELWSVVEEGIPAPVIGSGPGSEAQKKAMEEAKLKDL  69

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             +   L  A+D  +   +LD   SK  W ++K +Y+G
Sbjct  70   KVKNFLFQAIDRGILETILDKGTSKAIWTSMKQKYQG  106



>ref|XP_009339703.1| PREDICTED: uncharacterized protein LOC103931892 [Pyrus x bretschneideri]
Length=369

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 61/107 (57%), Gaps = 13/107 (12%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS +M+ LL  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNAMAAFQVPVLDNNNFDNWSIKMKALLGAHDVWEVVEKGYTEP--EDEATLSQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              K  R++D     ++  A+D++    V  A ++K+AW+ ++T YKG
Sbjct  59   SLKYSRKRDKKTLCLIYQALDDNGFENVSSATSAKQAWEKLQTSYKG  105



>ref|XP_006596850.1| PREDICTED: uncharacterized protein LOC102669510 [Glycine max]
Length=296

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKD  382
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E   +D+AS         K+ 
Sbjct  5    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE---QDEASLSQGVKETLKES  61

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            R++D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  62   RKRDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTCNKG  103



>ref|XP_006588127.1| PREDICTED: uncharacterized protein LOC102669122 [Glycine max]
Length=277

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKD  382
            G  FQ   L   NY  WS +M+ LL   D+WD++E G++E   +D+AS         K+ 
Sbjct  5    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIIENGFEE---QDEASLSQGVEETLKES  61

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            R++D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  62   RKRDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTCNKG  103



>ref|XP_010534731.1| PREDICTED: uncharacterized protein LOC104810237 [Tarenaya hassleriana]
Length=277

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 7/102 (7%)
 Frame = -3

Query  540  SSKMG-TSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKG------LKDKASKKD  382
            S+ +G T   +L+  NY  WS +M  LL   D W++VE GY E+        + K  K+ 
Sbjct  6    STSLGFTPLPRLNKTNYNNWSIQMRALLGAQDAWEVVENGYIEESSGTSTPAQLKTLKEM  65

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            R KD     ++  AVDE+    +  A  SKEAW+ ++  +KG
Sbjct  66   RMKDKTALYLMFQAVDEASFEKIAGATTSKEAWETLQKVFKG  107



>ref|XP_008459718.1| PREDICTED: uncharacterized protein LOC103498760 [Cucumis melo]
Length=233

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 66/128 (52%), Gaps = 17/128 (13%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDKA---  394
            +T+  + + +   K  G+N+  WS +M+ L    +LWD+VE GY     +  L ++    
Sbjct  1    MTSNGNMLQSQLPKFSGKNFNQWSIQMKVLYGSQELWDIVERGYIKVENQSELTNQQLVE  60

Query  393  SKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG---------KSLKS  241
             +++R+KD      +   VDE +   +  A ++K AWD +++ Y+G         ++L+S
Sbjct  61   LRENRKKDEKALFFIYQVVDEFIFERISTATSAKAAWDILRSTYQGEDKIKMIRLQALRS  120

Query  240  YF-CLRCK  220
             F C++ K
Sbjct  121  EFDCIKMK  128



>ref|XP_007014181.1| Uncharacterized protein TCM_038934 [Theobroma cacao]
 gb|EOY31800.1| Uncharacterized protein TCM_038934 [Theobroma cacao]
Length=352

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 48/92 (52%), Gaps = 7/92 (8%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------KKDREKDFLITVI  352
             +G NY  WS +M+  LK YDLWD++E G K   L+D AS        ++  K +     
Sbjct  15   FNGDNYPSWSVKMKAYLKGYDLWDVIESGTKVPPLRDNASAAQIKQYHEETAKRYKALSF  74

Query  351  LLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            +   V E +   ++   ++KEAW+ +K  ++G
Sbjct  75   IHGVVTEPIFSRIMACKSAKEAWEKLKVAFQG  106



>ref|XP_007200035.1| hypothetical protein PRUPE_ppa024199mg [Prunus persica]
 gb|EMJ01234.1| hypothetical protein PRUPE_ppa024199mg [Prunus persica]
Length=255

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (51%), Gaps = 8/99 (8%)
 Frame = -3

Query  546  NISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDF  367
            +I+S+    F    G NY  WS +M+      DLWD+V+ G+         + ++  KD 
Sbjct  2    SITSQTSIPFPIFTGENYDFWSIKMKSYFMSQDLWDIVDSGFN--------NPENPTKDA  53

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
                 L  A+D+++   ++ A  SKEAWD +K + +G +
Sbjct  54   KALFALQQALDDTIFPRIMGATTSKEAWDTLKEESQGNA  92



>ref|XP_007217436.1| hypothetical protein PRUPE_ppb014563mg [Prunus persica]
 gb|EMJ18635.1| hypothetical protein PRUPE_ppb014563mg [Prunus persica]
Length=189

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 21/111 (19%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGR----NYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGL  406
            ++N  S  G +F  L  R    NY  WS  M+ L K  +LW++VE+GY+E          
Sbjct  1    MSNAKSSNGHNFVSLIPRFNDDNYDYWSNNMKVLPKAVELWNMVEDGYEEPEDEQALTQA  60

Query  405  KDKASKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGK  253
            +  A K++R+KD  + V   I+           A N+KE W+ ++T Y+GK
Sbjct  61   QRNALKENRKKDIEMLVYERIS----------KAANAKEVWEKVQTTYQGK  101



>ref|XP_004493039.1| PREDICTED: double-strand break repair protein MRE11A-like [Cicer 
arietinum]
Length=310

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKDKA  394
            + N+ S+M     +L   NY  WS +M+ LL   + W+++ +G++E          ++KA
Sbjct  1    MANVMSQM--PLPRLTKSNYDNWSVQMKALLGALEAWEVIRDGFEEPTNTAGYTAAQNKA  58

Query  393  SKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             K+ R KD     +L  AVD+S    +     SKEAWD +K  ++G
Sbjct  59   LKETRSKDKTALYMLFRAVDDSGFEKIAGLATSKEAWDTLKKAFEG  104



>ref|XP_009343509.1| PREDICTED: uncharacterized protein LOC103935466 [Pyrus x bretschneideri]
Length=384

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 61/107 (57%), Gaps = 13/107 (12%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS +M+ LL  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNTMAAFQVPVLDNNNFDNWSIKMKALLGAHDVWEVVEKGYTEP--EDEATLSQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              K  R++D     ++  A+D++    V  A ++K+AW+ ++T YKG
Sbjct  59   SLKDSRKRDKKALYLIYQALDDNGFEKVSSATSAKQAWEKLQTSYKG  105



>ref|XP_006590044.1| PREDICTED: uncharacterized protein LOC102665857 [Glycine max]
Length=678

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 14/102 (14%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKD--KASKKD  382
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E       +G+K+  K S+K 
Sbjct  5    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEEQDEASLSQGVKETLKESRKR  64

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             +KD     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  65   DKKDLF---LIYQSVDEDTFEKISNATTTKEAWDKLQTCNKG  103



>ref|XP_004499905.1| PREDICTED: uncharacterized protein LOC101491044 [Cicer arietinum]
Length=368

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKG-------LKDKA  394
            + N+ S+M  S  +L   NY  WS +M+ LL   + W++   G++E          ++KA
Sbjct  1    MANVMSQM--SLPRLTKSNYDNWSVQMKALLGALEAWEVTRNGFEEPTNTAGYTEAQNKA  58

Query  393  SKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             K+ R KD     +L  AVD+S    +  +  SKEAWD +K  ++G
Sbjct  59   LKETRSKDKTTLYMLFQAVDDSGFEKISGSTTSKEAWDTLKKAFEG  104



>ref|XP_009346568.1| PREDICTED: uncharacterized protein LOC103938288 [Pyrus x bretschneideri]
Length=564

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 61/107 (57%), Gaps = 13/107 (12%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS +M+ LL  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNAMAAFQVPVLDNNNFDNWSIKMKALLGAHDVWEVVEKGYTEP--EDEATLSQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              K  R++D     ++  A+D++    V  A ++K+AW+ ++T YKG
Sbjct  59   SLKDSRKRDKKALYLIYQALDDNGFEKVSSATSAKQAWEKLQTSYKG  105



>ref|XP_011024400.1| PREDICTED: uncharacterized protein LOC105125582 [Populus euphratica]
Length=194

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 7/92 (8%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKD-------KASKKDREKDFLITVI  352
             DG NY++W+  ME      DLW+ VE+ Y+   L D       K  K+ +++       
Sbjct  11   FDGINYQVWAVRMEAYFDANDLWETVEQVYEVPTLSDNPTVVQIKNHKEKKQRTSKAKAT  70

Query  351  LLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            L  AV  ++ + ++    +KE WD +K +Y+G
Sbjct  71   LFAAVSPTIFYRIMTLKIAKEIWDFLKGEYEG  102



>ref|XP_010064610.1| PREDICTED: uncharacterized protein LOC104451708 [Eucalyptus grandis]
Length=192

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 10/96 (10%)
 Frame = -3

Query  513  KLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASK-KDREKDFLIT-------  358
            KL+G+N+  W  +M+ L K  DLW+LVE GY E    +     +  EKDFL+        
Sbjct  13   KLNGKNFNNWYVQMKVLFKSQDLWNLVENGYTEVVDAEAFDALRKEEKDFLVEFRKKDQK  72

Query  357  --VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
               ++  +V+E +   +     +K  WD ++  YKG
Sbjct  73   ALFMIFQSVEEVIFEKISRVETTKAVWDILQQSYKG  108



>ref|XP_006405962.1| hypothetical protein EUTSA_v10028209mg [Eutrema salsugineum]
 gb|ESQ47415.1| hypothetical protein EUTSA_v10028209mg [Eutrema salsugineum]
Length=171

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = -3

Query  543  ISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE----KGLKDKASKKD--  382
            + ++M       +G ++ +WS +M  LL   DLWD+VE G  E    + L++ A ++   
Sbjct  1    MDAQMQMRLPLFNGESHELWSIKMRTLLMARDLWDIVENGVSEENTNQSLEESAKRQKYL  60

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQY  262
            R KD     +L ++V +SV   +  A +SK+AW+ +K  +
Sbjct  61   RIKDMTALHMLQMSVTDSVFLRIARATSSKQAWEILKADF  100



>emb|CAA69271.1| lectin receptor kinase [Arabidopsis thaliana]
Length=544

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (51%), Gaps = 17/116 (15%)
 Frame = -3

Query  567  ESRKVLTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEK--------  412
            +S K+L   S+ +      L   NY  WS  M+ +L  +D+W++VE+G+ E         
Sbjct  10   QSLKILKMASNNVPFQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQ  69

Query  411  ----GLKDKASKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
                GL+D      R++D     ++   +DE     V++A ++KEAW+ ++T YKG
Sbjct  70   TQKDGLRD-----SRKRDKKALCLIYQGLDEDTFEKVVEATSAKEAWEKLRTSYKG  120



>ref|XP_009349037.1| PREDICTED: uncharacterized protein LOC103940613, partial [Pyrus 
x bretschneideri]
Length=223

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (54%), Gaps = 9/99 (9%)
 Frame = -3

Query  522  SFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE--KGLKDKASKKDRE------KDF  367
            S  + DG +Y  WS  ME  L+  + W L+E GY+E   G +  +  + +E      KD 
Sbjct  11   SIPRFDG-HYDHWSMLMENFLRSKEYWSLIEIGYEELANGAQPISEARQKELDAMKLKDL  69

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
                 L  A+D S+   +L+ + SK+ WD++KT+Y+G +
Sbjct  70   KAKNYLFQAIDRSILETMLEKDTSKKIWDSMKTKYEGNA  108



>ref|XP_006588222.1| PREDICTED: uncharacterized protein LOC102665335 [Glycine max]
Length=205

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 48/95 (51%), Gaps = 7/95 (7%)
 Frame = -3

Query  519  FQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDRE-------KDFLI  361
            F +L   NY  WS  M+ LL C D W++VE+ Y +   +   S  ++E       KD   
Sbjct  11   FPRLTKENYDNWSRHMKALLGCQDAWEIVEKSYTQPQNEAILSPNEKETLLKSKKKDQQA  70

Query  360  TVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
               +   +DE++   V +A  SKEAW+ +KT  +G
Sbjct  71   LTFIHQGLDEAMFELVSNATTSKEAWEILKTSLEG  105



>gb|KHN45255.1| hypothetical protein glysoja_041941, partial [Glycine soja]
Length=150

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYK--EKGLKD--KASKKD-REKDFLITVILL  346
            L G+N+  WS +M+ LL   DL D++E G +  ++G  D  K   KD ++KD    VIL 
Sbjct  14   LTGKNFNRWSVQMKALLGFQDLTDVIENGIEIPKEGASDSQKTEFKDLKKKDCKALVILH  73

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              VD+S    + +A ++KEAWD +   Y G
Sbjct  74   QCVDDSHFEKIANAKSAKEAWDILNKAYAG  103



>ref|XP_010542108.1| PREDICTED: uncharacterized protein LOC104815425 [Tarenaya hassleriana]
Length=197

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 50/97 (52%), Gaps = 17/97 (18%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGY------------KEKGLKDKASKKDREKDF  367
             DG NY++W+ +M+  +K  DLW+ VEE Y            + K  +DK ++K +    
Sbjct  9    FDGENYQMWAVKMKAYMKGADLWETVEEDYGVTPLGANPTLNQMKIYRDKVTRKGKAMS-  67

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
                 L  +V   +   +++  N+KE WD++K +Y+G
Sbjct  68   ----CLFASVPSFIFTKIMNMTNAKEMWDSLKEEYEG  100



>ref|XP_006603119.1| PREDICTED: uncharacterized protein LOC102665355 [Glycine max]
Length=248

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (51%), Gaps = 5/93 (5%)
 Frame = -3

Query  519  FQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGY-----KEKGLKDKASKKDREKDFLITV  355
            F  LDGRNY  WS +M+ +L   D+WDLV+ G           +    ++ +++D+    
Sbjct  11   FPILDGRNYDQWSRKMKAILGYQDVWDLVQNGLIPLPENANAAQQTVYRESKKEDWKGLC  70

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            IL   V+ ++   +  +  SKEAWD +   Y G
Sbjct  71   ILHQCVNPAIFEKIARSETSKEAWDILANSYAG  103



>emb|CAN79061.1| hypothetical protein VITISV_024577 [Vitis vinifera]
Length=1424

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
             +G NY  W  +M+ L    D+WDLVE G+ E  ++    K+ ++ D    + +   V  
Sbjct  214  FNGENYDFWCVKMKTLFMSQDVWDLVENGFDEPPVEKXQLKELKKMDAKALLFIQQGVGN  273

Query  330  SVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   ++ A+ +KEAWD ++ +++G
Sbjct  274  NIFPRIMRASKAKEAWDILQQEFQG  298



>ref|XP_006590177.1| PREDICTED: uncharacterized protein LOC102669657 [Glycine max]
Length=711

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKD  382
            G  FQ   L   NY  WS +++ LL   D+WD+VE G++E   +D+AS         K+ 
Sbjct  5    GFPFQMSMLTKNNYDNWSIKIKALLGAQDVWDIVENGFEE---QDEASLSQGVNETLKES  61

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            R++D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  62   RKRDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTCNKG  103



>ref|XP_007034338.1| CCHC-type integrase-like protein [Theobroma cacao]
 gb|EOY05264.1| CCHC-type integrase-like protein [Theobroma cacao]
Length=640

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 49/94 (52%), Gaps = 7/94 (7%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------KKDREKDFLITVI  352
             DG NY +W+ +M+  L+ ++LWD+VE   +   L+D AS       +KD  K +     
Sbjct  16   FDGINYSVWAVQMKAYLRGFNLWDVVENDTEVSPLRDNASAAQVKQYEKDVAKRYRALSF  75

Query  351  LLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
               AV E++   ++    +KE WD ++ ++ G +
Sbjct  76   FHSAVFETIFSRIIGCETAKEVWDTLQEEFLGNT  109



>ref|XP_004515561.1| PREDICTED: uncharacterized protein LOC101496635 [Cicer arietinum]
Length=198

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 51/95 (54%), Gaps = 7/95 (7%)
 Frame = -3

Query  519  FQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDKASK---KDREKDFLI  361
            F  L   NY  W   M+ LL   D+W++VE+GY     E+GL   A +   K R+KD   
Sbjct  11   FPLLKKENYEKWCLRMKALLGSQDVWEIVEKGYDEPQDEEGLSQVAKEALAKTRKKDQQA  70

Query  360  TVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              ++   +D+S+   V+DA NS EAW+ ++   +G
Sbjct  71   LTLIHQCLDDSMFEKVVDATNSMEAWNILEKSLQG  105



>ref|XP_006580664.1| PREDICTED: uncharacterized protein LOC102668288 [Glycine max]
Length=345

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 10/100 (10%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKDKASKKDRE  376
            G  FQ   L   NY  WS +M+ LL   D+WD+VE G++E       +G+K+   K+ R+
Sbjct  5    GFPFQMPMLTKNNYDSWSIKMKVLLGAQDVWDIVENGFEEQDEVSLSQGVKE-TLKESRK  63

Query  375  KDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            +D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  64   RDKKALFLIYQSVDEDTFEKISNATPAKEAWDKLQTCNKG  103



>gb|KHN44822.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=344

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 5/90 (6%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGY-----KEKGLKDKASKKDREKDFLITVILL  346
            LDGRNY  WS +M+ +L   D+WDLV+ G           +    ++ ++KD+    IL 
Sbjct  3    LDGRNYDQWSRKMKAILGYQDVWDLVQNGLIPLPENANAAQQTVYRESKKKDWKGLCILH  62

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              V+ ++   +  +  SKEAWD +   Y G
Sbjct  63   QCVNPAIFEKIARSETSKEAWDILANSYAG  92



>ref|XP_006584344.1| PREDICTED: uncharacterized protein LOC102662068 [Glycine max]
Length=236

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 10/100 (10%)
 Frame = -3

Query  528  GTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKDKASKKDRE  376
            G  FQ   L   NY  WS +M+ LL   D+WD+VE  ++E       +G+K+   K+ R+
Sbjct  5    GFPFQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENDFEEQDEALLSQGVKE-TLKESRK  63

Query  375  KDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            +D     ++  +VDE     + +A  +KEAWD ++T  KG
Sbjct  64   RDKKALFLIYQSVDEDTFEKISNATTAKEAWDKLQTFNKG  103



>ref|XP_009592715.1| PREDICTED: uncharacterized protein LOC104089503 [Nicotiana tomentosiformis]
Length=197

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 49/94 (52%), Gaps = 7/94 (7%)
 Frame = -3

Query  516  QKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLIT  358
            Q   G NY+IWS +M+  L+ YDLW +V +    + L       + KA   ++ K +   
Sbjct  12   QTFTGENYQIWSVKMKSYLETYDLWAVVMKDKLIQSLPANPTLAQIKAHSDEKTKKYKAK  71

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             I+  +V +S+   ++    SKEAW  +K +Y+G
Sbjct  72   TIIQNSVADSIFSKIIACETSKEAWKTLKQEYQG  105



>ref|XP_008346728.1| PREDICTED: uncharacterized protein LOC103409699 [Malus domestica]
Length=316

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 59/106 (56%), Gaps = 13/106 (12%)
 Frame = -3

Query  543  ISSKMGTSFQ--KLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS +M+  L  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNAMAAFQVPMLDNNNFDNWSIKMKAFLGAHDVWEVVEKGYTEP--EDEATMSQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYK  259
              K  R++D     ++  A+D++    VL A  +K+AW+ ++T YK
Sbjct  59   SLKDSRKRDKKALYLICQALDDNGFENVLSATFAKQAWEKLQTSYK  104



>ref|XP_006579168.1| PREDICTED: uncharacterized protein LOC102668417 [Glycine max]
Length=210

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 60/114 (53%), Gaps = 19/114 (17%)
 Frame = -3

Query  525  TSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE------------KGLKDKASK  388
             SFQ   L G  Y  WS +M+  L  +D+W++V +GYKE            + LKD + K
Sbjct  7    ASFQVPLLKGSTYDNWSIKMKAFLGEHDVWEMVGKGYKEPQDETSLSQAQKETLKD-SRK  65

Query  387  KDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKSLKSYFCLR  226
            +D++  FLI   L     E++S    +A ++KEAW  ++T +KG+      CL+
Sbjct  66   RDKKALFLIYQALHDNAFENIS----NATSAKEAWHKLQTSHKGEDKVKNVCLQ  115



>ref|XP_009146135.1| PREDICTED: uncharacterized protein LOC103869817, partial [Brassica 
rapa]
Length=530

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 17/93 (18%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEK------------GLKDKASKKDREKDFLITV  355
            NY  WS  M  +L  +D+W++VE+G+ E             GL+D      R++D     
Sbjct  70   NYDNWSLRMMAILGAHDVWEIVEKGFNEPENDGGLSQTQKDGLRD-----SRKRDKKALC  124

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   +DE     V  A  SKEAWD ++T YKG
Sbjct  125  LIYQGLDEDTFEKVAGAKTSKEAWDKLRTSYKG  157



>gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana]
Length=1291

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (55%), Gaps = 17/93 (18%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEK------------GLKDKASKKDREKDFLITV  355
            NY  WS +M+ +L  +D+W++VE+G+ E             GL+D      R++D     
Sbjct  17   NYDNWSLQMKAILGAHDVWEIVEKGFIEPENEGSLSQTQKDGLRD-----SRKRDKKALC  71

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   +DE     V++A ++KEAW+ ++T YKG
Sbjct  72   LIYQGLDEDTFEKVVEATSAKEAWEKLRTSYKG  104



>ref|XP_008355685.1| PREDICTED: uncharacterized protein LOC103419343 [Malus domestica]
Length=377

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 55/94 (59%), Gaps = 11/94 (12%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKDREKDFLIT  358
            L+  N+  WS +M+ LL  +D+W++VE+GY E   +D+A+         K  R++D    
Sbjct  14   LNNNNFDNWSIKMKALLGAHDVWEVVEKGYXEP--EDEATLXQPQKESLKDSRKRDKKAL  71

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             ++  A+D++    V  A ++K+AW+ ++T YKG
Sbjct  72   YLIYQALDDNGFEKVSSATSAKQAWEKLQTSYKG  105



>ref|XP_008789836.1| PREDICTED: uncharacterized protein LOC103707210 [Phoenix dactylifera]
Length=226

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 53/101 (52%), Gaps = 11/101 (11%)
 Frame = -3

Query  531  MGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKDR  379
            M  S  +L   NY+ W T+M+ LL   D W++VE+GY E   +D+A+         ++ R
Sbjct  1    MAFSVPQLTKDNYKNWCTKMKALLGSQDAWEMVEKGYVEP--EDEATLMENQRQSLRESR  58

Query  378  EKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            +KD     +    +DE+    V  A  S++AW+ ++  YKG
Sbjct  59   KKDKKALFLTYQGLDEATFEIVGAATTSRQAWEFLQKAYKG  99



>ref|XP_006577542.1| PREDICTED: uncharacterized protein LOC102660609 [Glycine max]
Length=292

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (51%), Gaps = 5/106 (5%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLK----DKASKK  385
            +  +S  +  +   L G+NY  W  ++  +++   +W+ VEEGY   G K     KA+ +
Sbjct  1    MAAVSGSIPANLPVLTGKNYENWKIQIRVVMRFQGVWEFVEEGYIPVGEKATEEQKAADR  60

Query  384  DRE-KDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
            ++E KD     IL  +VD +    +  A  SKEAWD ++  Y G +
Sbjct  61   EKEKKDCKELFILHQSVDAANFEKIAMAQTSKEAWDILQKSYDGAT  106



>ref|XP_010669429.1| PREDICTED: uncharacterized protein LOC104886660 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKG---LKDKASKKD-REKDFLITVILLIAV  337
            G NY +W ++M+ + K  +LWD+VE GY E     ++   + +D R+KD      +  A+
Sbjct  19   GENYHLWRSKMKTMFKSQELWDMVEHGYTEPAEPPVEPSQTLRDSRKKDANALFCIQSAL  78

Query  336  DESVSHCVLDANNSKEAWDAIKTQYKG  256
             + V   +  A+ +K+AWD IK ++ G
Sbjct  79   SDEVFPRISAASTAKQAWDIIKQEFFG  105



>ref|XP_006579101.1| PREDICTED: uncharacterized protein LOC102660986 [Glycine max]
Length=200

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 51/97 (53%), Gaps = 17/97 (18%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGY------------KEKGLKDKASKKDREKDF  367
             DG  Y +W+  M   L+  DLW+ VEE Y            + K  K++ +KK + K+F
Sbjct  15   FDGEEYELWAARMTAHLEALDLWEAVEENYDVPELPLDPTVAQMKNHKERKTKKAKAKNF  74

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            L +     AV + +   +++  ++K+ WD ++++Y+G
Sbjct  75   LFS-----AVSKIIFTRIMNFKSAKQIWDYLRSEYQG  106



>ref|XP_004145871.1| PREDICTED: uncharacterized protein LOC101208246 [Cucumis sativus]
Length=423

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 52/103 (50%), Gaps = 6/103 (6%)
 Frame = -3

Query  552  LTNISSKMGTSFQKL----DGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKK  385
            + N  + MGT+ Q L     G  Y  WS  M+ LL+  DLWDLVE  Y +   + K  +K
Sbjct  1    MDNNGNAMGTT-QPLILIFKGEGYEFWSMRMKTLLRSQDLWDLVEHNYADPDDEGKLREK  59

Query  384  DREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             R KD    VI+  AV +S    +     SKEAW  ++  ++G
Sbjct  60   -RRKDSKALVIIQQAVHDSGFSRIGTTTTSKEAWLILQKAFRG  101



>ref|XP_009124302.1| PREDICTED: uncharacterized protein LOC103849247 [Brassica rapa]
 ref|XP_009124303.1| PREDICTED: uncharacterized protein LOC103849247 [Brassica rapa]
Length=197

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 9/84 (11%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYK-EKGLKDKASKKDREKDFLITVILLIAVD  334
             DG NY IWS +M  LL   DLWD+VE G   EK LK         KD     +L ++V 
Sbjct  9    FDGDNYEIWSIKMRTLLMARDLWDVVESGASVEKTLKI--------KDMTALHMLQMSVT  60

Query  333  ESVSHCVLDANNSKEAWDAIKTQY  262
            +S+   +  A +SK+AW+ +K ++
Sbjct  61   DSLFIRIARATSSKQAWEILKEEF  84



>gb|AAT47077.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1136

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 7/88 (8%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLITVILLIA  340
            NY IWS +M  LL    LWD+VE GY+E          + K+  +DR  D     ++   
Sbjct  13   NYDIWSIKMRTLLLSQGLWDIVENGYQEYSAGETLTAEQKKSLVEDRMSDAKALFLIQQG  72

Query  339  VDESVSHCVLDANNSKEAWDAIKTQYKG  256
            V ES+   ++ A  SKEAWD +K +++ 
Sbjct  73   VAESLFPRIIGAKKSKEAWDKLKEEFQA  100



>ref|XP_009602835.1| PREDICTED: uncharacterized protein LOC104097920 [Nicotiana tomentosiformis]
Length=391

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (51%), Gaps = 20/110 (18%)
 Frame = -3

Query  549  TNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGY------------KEKGL  406
            T+ SS    +F   DG +Y+IW+  M+  L+  DLW+ VE+ Y            + K  
Sbjct  5    TSFSSIAPPTF---DGESYQIWAVRMQTYLEALDLWEAVEDDYEIAPLPNNPTMAQIKNY  61

Query  405  KDKASKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            K++ ++K + K       L  AV  ++   ++   ++KE WD +KT+Y+G
Sbjct  62   KERKTRKSKAK-----ACLFAAVSSTIFTRIMSLKSAKEVWDYLKTEYEG  106



>gb|KHN01715.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=302

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 44/85 (52%), Gaps = 8/85 (9%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
             DG +Y  WS  ME  L+   LW+LV+ G +E+         D   D+ +   L  A+D 
Sbjct  4    FDGLHYDHWSELMENFLRAKGLWNLVDSGVREEN--------DTTTDYKVKHYLFRAIDR  55

Query  330  SVSHCVLDANNSKEAWDAIKTQYKG  256
            S+   +LD + SK  WD++K ++ G
Sbjct  56   SIFKQILDRSTSKIVWDSLKRKFGG  80



>ref|XP_002317178.2| hypothetical protein POPTR_0011s011602g, partial [Populus trichocarpa]
 gb|EEE97790.2| hypothetical protein POPTR_0011s011602g, partial [Populus trichocarpa]
Length=160

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/94 (27%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEK---GLKDKASKKD----REKDFLITVI  352
             +G NY +W  +M+ L +  +LWD+VE G++E       ++A +K+    ++KD     +
Sbjct  17   FNGCNYDLWGKKMKTLFRSQNLWDIVENGFEEPENISTLEEAQRKELEVKKQKDASALYL  76

Query  351  LLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
            +  ++  ++   + +A+ +K+AWD ++ Q+ G S
Sbjct  77   IQQSLANTIFPRITEASTAKQAWDILQKQFPGDS  110



>ref|XP_009132175.1| PREDICTED: uncharacterized protein LOC103856795 isoform X1 [Brassica 
rapa]
 ref|XP_009132176.1| PREDICTED: uncharacterized protein LOC103856795 isoform X1 [Brassica 
rapa]
 ref|XP_009132177.1| PREDICTED: uncharacterized protein LOC103856795 isoform X1 [Brassica 
rapa]
 ref|XP_009132178.1| PREDICTED: uncharacterized protein LOC103856795 isoform X1 [Brassica 
rapa]
Length=224

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = -3

Query  525  TSFQKL----DGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLIT  358
            T  Q+L    +G  Y +WS +M  LL   DLWD+++    ++ ++++  K  R KD    
Sbjct  5    TQMQQLVPVFNGNEYELWSIKMRTLLMSRDLWDVIDSETSDQPMEEELVKSQRIKDMSAL  64

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQY  262
             +L ++V +++   +  A +SK+AW+ +K ++
Sbjct  65   YMLQMSVTDTIFLRITRATSSKQAWELLKAEF  96



>ref|XP_006495033.1| PREDICTED: uncharacterized protein LOC102619790 [Citrus sinensis]
Length=215

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 1/84 (1%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKD-REKDFLITVILLIAVDES  328
            G NY+IW+ +ME  L+  DLWDLVE   ++  L    + +D R++ +     +   V E+
Sbjct  15   GENYQIWAVKMESHLEACDLWDLVEADPEDPPLAHMRNNRDERKRRYKAKTCIHSTVSET  74

Query  327  VSHCVLDANNSKEAWDAIKTQYKG  256
                ++    +K AWD  K +Y+G
Sbjct  75   NFTKIMTCETAKHAWDLWKQEYQG  98



>ref|XP_009132179.1| PREDICTED: uncharacterized protein LOC103856795 isoform X2 [Brassica 
rapa]
Length=218

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/83 (28%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
             +G  Y +WS +M  LL   DLWD+++    ++ ++++  K  R KD     +L ++V +
Sbjct  8    FNGNEYELWSIKMRTLLMSRDLWDVIDSETSDQPMEEELVKSQRIKDMSALYMLQMSVTD  67

Query  330  SVSHCVLDANNSKEAWDAIKTQY  262
            ++   +  A +SK+AW+ +K ++
Sbjct  68   TIFLRITRATSSKQAWELLKAEF  90



>emb|CAB75469.1| copia-type reverse transcriptase-like protein [Arabidopsis thaliana]
Length=1272

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 17/93 (18%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEK------------GLKDKASKKDREKDFLITV  355
            NY  WS  M+ +L  +D+W++VE+G+ E             GL+D      R++D     
Sbjct  17   NYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQTQKDGLRD-----SRKRDKKALC  71

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   +DE     V++A ++KEAW+ ++T YKG
Sbjct  72   LIYQGLDEDTFEKVVEATSAKEAWEKLRTSYKG  104



>gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thaliana]
Length=1352

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 17/93 (18%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEK------------GLKDKASKKDREKDFLITV  355
            NY  WS  M+ +L  +D+W++VE+G+ E             GL+D      R++D     
Sbjct  17   NYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQTQKDGLRD-----SRKRDKKALC  71

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   +DE     V++A ++KEAW+ ++T YKG
Sbjct  72   LIYQGLDEDTFEKVVEATSAKEAWEKLRTSYKG  104



>gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum]
Length=1333

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 43/83 (52%), Gaps = 2/83 (2%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDESV  325
            G NY+ WS +M+ L K  +LWD+VE G  E         + R+   L T+    A+D+ +
Sbjct  19   GENYQFWSLKMKTLFKSQELWDIVETGIPEGNANQMREHRKRDSKALFTI--QQALDDEI  76

Query  324  SHCVLDANNSKEAWDAIKTQYKG  256
               +     SK+AW+ +K +Y G
Sbjct  77   FPRISAVETSKQAWEILKQEYFG  99



>emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana]
Length=1352

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 17/93 (18%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEK------------GLKDKASKKDREKDFLITV  355
            NY  WS  M+ +L  +D+W++VE+G+ E             GL+D      R++D     
Sbjct  17   NYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQTQKDGLRD-----SRKRDKKALC  71

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   +DE     V++A ++KEAW+ ++T YKG
Sbjct  72   LIYQGLDEDTFEKVVEATSAKEAWEKLRTSYKG  104



>ref|XP_008358324.1| PREDICTED: uncharacterized protein LOC103422074, partial [Malus 
domestica]
Length=427

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = -3

Query  522  SFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE--KGLKDKASKKDRE------KDF  367
            S  + DG +Y  WS  ME  L+  + W L+E GY+E  KG +  +  + +E      KD 
Sbjct  11   SIPRFDG-HYDHWSMLMENFLRSKEYWSLIETGYEELAKGAQTLSEARQKELDAVKLKDL  69

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYK  259
                 L  A+D S+   +L+ + SK+ WD++KT+Y+
Sbjct  70   KAKNYLFQAIDRSILETMLENDTSKKIWDSMKTKYE  105



>gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabidopsis thaliana]
 gb|AAG50765.1|AC079131_10 copia-type polyprotein, putative [Arabidopsis thaliana]
Length=1320

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 17/93 (18%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEK------------GLKDKASKKDREKDFLITV  355
            NY  WS  M+ +L  +D+W++VE+G+ E             GL+D      R++D     
Sbjct  17   NYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQTQKDGLRD-----SRKRDKKALC  71

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   +DE     V++A ++KEAW+ ++T YKG
Sbjct  72   LIYQGLDEDTFEKVVEATSAKEAWEKLRTSYKG  104



>gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabidopsis thaliana]
Length=1352

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 17/93 (18%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEK------------GLKDKASKKDREKDFLITV  355
            NY  WS  M+ +L  +D+W++VE+G+ E             GL+D      R++D     
Sbjct  17   NYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQTQKDGLRD-----SRKRDKKALC  71

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   +DE     V++A ++KEAW+ ++T YKG
Sbjct  72   LIYQGLDEDTFEKVVEATSAKEAWEKLRTSYKG  104



>emb|CAN68758.1| hypothetical protein VITISV_004671 [Vitis vinifera]
Length=972

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 50/98 (51%), Gaps = 8/98 (8%)
 Frame = -3

Query  522  SFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE----KGLKDKASKKDRE---KDFL  364
            +  + DG +Y  WS  ME  L+  + W LVE GY E      + +   K+  E   KD  
Sbjct  13   AIPRFDG-HYDHWSMLMENFLRSKEYWSLVETGYDEPQANAAMTEAQQKRLDEMKLKDLK  71

Query  363  ITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
            +   L  A+D ++   +L  N SK+ WD++K +Y+G +
Sbjct  72   VKNYLFQAIDRTILETILQKNTSKQIWDSMKKKYEGNA  109



>ref|XP_006605158.1| PREDICTED: uncharacterized protein LOC102668003 [Glycine max]
Length=198

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/97 (26%), Positives = 51/97 (53%), Gaps = 17/97 (18%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGY------------KEKGLKDKASKKDREKDF  367
             DG  Y +W+  M   L+  DLW+ VEE Y            + K  +++ +KK + K+F
Sbjct  15   FDGEEYELWAARMTAHLEALDLWEAVEENYDVPELPLDPTVAQMKNHRERKTKKAKAKNF  74

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            L +++  I     +   +++  ++K+ WD ++++Y+G
Sbjct  75   LFSIVSKI-----IFTRIMNFKSAKQIWDYLRSEYQG  106



>ref|XP_004237313.1| PREDICTED: uncharacterized protein LOC101245451 [Solanum lycopersicum]
Length=267

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 7/94 (7%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLK-----DKASKKDREKDFLITVILL  346
             +G NY+IWS +M+  L+ Y+LW++V E      L      D+     +EK      +LL
Sbjct  14   FNGENYQIWSVKMQAFLETYELWEIVTEDKPLDALPANPTLDQIKFNIQEKANKSKAMLL  73

Query  345  I--AVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
            +   V ++V + +L    +KEAWD +K +Y+G +
Sbjct  74   MQNVVADTVLYKILACKTAKEAWDRLKEEYQGNN  107



>ref|XP_006599885.1| PREDICTED: uncharacterized protein LOC102665028 [Glycine max]
Length=304

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 52/104 (50%), Gaps = 5/104 (5%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLK--DKASKKDR  379
            +T +S  +  +   L G+NY  W  ++  +++   +W+ VEEGY   G +  D+    DR
Sbjct  1    MTAVSGSIPANLPVLKGKNYENWKIQIRVVMRFQGVWEFVEEGYIPVGKRATDEQKVADR  60

Query  378  E---KDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            E   KD     IL  +VD +    +  A  SKEAWD ++  + G
Sbjct  61   EKEKKDCKALFILHQSVDAANFEKIAMAQTSKEAWDILQKSHDG  104



>ref|XP_004156123.1| PREDICTED: uncharacterized protein LOC101231875 [Cucumis sativus]
Length=423

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 51/103 (50%), Gaps = 6/103 (6%)
 Frame = -3

Query  552  LTNISSKMGTSFQKL----DGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKK  385
            + N  + MGT+ Q L     G  Y  WS  M+ L +  DLWDLVE  Y +   + K  +K
Sbjct  1    MDNHGNAMGTT-QPLILIFKGEGYEFWSMRMKTLFRSQDLWDLVEHNYADPDDEGKLREK  59

Query  384  DREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             R KD    VI+  AV +S    +     SKEAW  ++  ++G
Sbjct  60   -RRKDSKALVIIQQAVHDSGFSRIGTTTTSKEAWLILQKAFRG  101



>emb|CDY06400.1| BnaC05g31300D [Brassica napus]
Length=154

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKE--KGLKDKASKKDREKDFLITVILLIAVDE  331
            G  Y +WS +M+ + +  +LW LVE G+++      D+  ++ R+KD      +  A+D+
Sbjct  17   GEKYHLWSLKMKTMFRSQELWVLVETGFEDGNPAEPDQHIRERRKKDAKALFFIQTALDD  76

Query  330  SVSHCVLDANNSKEAWDAIKTQY  262
             +   +  AN + EAW+ +K +Y
Sbjct  77   DILSRISAANTAHEAWEILKQEY  99



>ref|XP_008375852.1| PREDICTED: uncharacterized protein LOC103439077 [Malus domestica]
Length=295

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 7/88 (8%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKD------KASKKD-REKDFLITVILLIA  340
            N+  WS +M+ LL  +D+W++VE+GY E   +D      K S KD R++D     ++  A
Sbjct  17   NFDNWSIKMKTLLGAHDVWEVVEKGYIEPEDEDTLIQAQKESLKDSRKRDKKALYLIYQA  76

Query  339  VDESVSHCVLDANNSKEAWDAIKTQYKG  256
            +D++    V  A ++K+AW+ ++T YKG
Sbjct  77   LDDNGFEKVSSATSAKQAWEKLQTSYKG  104



>emb|CAN70479.1| hypothetical protein VITISV_023585 [Vitis vinifera]
Length=958

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 47/88 (53%), Gaps = 7/88 (8%)
 Frame = -3

Query  498  NYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL-------KDKASKKDREKDFLITVILLIA  340
            NY+IW  +M+  LK +D W++V E      L       + KA   ++ K F    ++  +
Sbjct  18   NYQIWYVKMQTYLKAFDFWEVVAEDKPIAPLPANPTLAQIKAHIDEKTKKFKAKTLIQNS  77

Query  339  VDESVSHCVLDANNSKEAWDAIKTQYKG  256
            V + V H +++   +KEAWD +K +Y+G
Sbjct  78   VADLVFHRIMNCRTTKEAWDKLKLEYQG  105



>ref|XP_006607070.1| PREDICTED: uncharacterized protein LOC102666119, partial [Glycine 
max]
Length=371

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYK--EKGLKD--KASKKD-REKDFLITVILL  346
            L G+N+  WS +M+ LL   DL D++E G +  ++G  D  K   KD ++KD    VIL 
Sbjct  14   LTGKNFNRWSVQMKALLGFQDLTDVIENGIEIPKEGASDSQKTEFKDLKKKDCKALVILH  73

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              VD+S    + +A ++KEAWD +   Y G
Sbjct  74   QCVDDSHFEKIANAKSAKEAWDILNKAYAG  103



>ref|XP_008450471.1| PREDICTED: uncharacterized protein LOC103492064 [Cucumis melo]
Length=543

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 60/119 (50%), Gaps = 25/119 (21%)
 Frame = -3

Query  513  KLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-----------KKDREKDF  367
            +  G+N+  WS +M+ L    +LWD+VE GY E   + + +           KKD++  F
Sbjct  14   RFSGKNFNQWSIQMKVLYDSQELWDIVERGYTEVENQSELTNQQLVELRENCKKDKKALF  73

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG---------KSLKSYF-CLRCK  220
             I  +    VDE +   +  A ++K AWD +++ Y+G         ++L+S F C++ K
Sbjct  74   FIYQV----VDEFIFERISTATSAKAAWDILRSTYQGEDKVKMIRLQALRSEFDCIKMK  128



>ref|XP_008390391.1| PREDICTED: uncharacterized protein LOC103452643 [Malus domestica]
Length=312

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 48/97 (49%), Gaps = 12/97 (12%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYK---------EKGLKDK---ASKKDREKDF  367
             DG NY  W   M  + K YDLW++V+ GY+         E+ L +K     K++R  D 
Sbjct  14   FDGENYDYWRIRMTTIFKSYDLWEMVQHGYELPEMEIDALEEDLTEKQIATLKENRMNDA  73

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
                I+  AV + +   + +   +K AWD ++ +Y+G
Sbjct  74   RALGIIQGAVSDFIFPRIANEETAKAAWDTLQQEYRG  110



>ref|XP_008345390.1| PREDICTED: uncharacterized protein LOC103408311 [Malus domestica]
Length=476

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 49/97 (51%), Gaps = 12/97 (12%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYK---------EKGLKD---KASKKDREKDF  367
             DG NY  W   M  + K YDLWD+V+ GY+         E+ L +   K  K++R +D 
Sbjct  15   FDGENYDFWRIRMTTIFKSYDLWDMVQHGYELPEMEIDALEEDLTETQLKTLKQNRMEDA  74

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
                I+   V +++   + +   +K AW+ ++ +Y+G
Sbjct  75   RALGIIQGVVSDTIFPRIANEETAKGAWEVLQQEYRG  111



>ref|XP_011004775.1| PREDICTED: uncharacterized protein LOC105111183 [Populus euphratica]
Length=207

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 48/99 (48%), Gaps = 7/99 (7%)
 Frame = -3

Query  525  TSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGL------KDKASKKD-REKDF  367
            T     DG++Y  WS  ME LL+   LW LVE G +E  +        +A   D + KD 
Sbjct  8    TKIPHFDGQHYDHWSELMENLLRAKGLWSLVEIGIQEPIIGSALSTTQQAQHDDTKMKDH  67

Query  366  LITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
             +   L  A+D      +LD   SK  WD++K+++ G +
Sbjct  68   QVKHYLYQAIDRVTFEQILDRRTSKIVWDSLKSKFGGNA  106



>ref|XP_008345992.1| PREDICTED: uncharacterized protein LOC103408955 [Malus domestica]
Length=190

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 54/94 (57%), Gaps = 11/94 (12%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKDREKDFLIT  358
            LD  N+  WS +M+ LL  +D+W++VE+GY +   +D+A+         K  R++D    
Sbjct  9    LDNNNFDNWSIKMKALLGAHDVWEVVEKGYTKP--EDEATLSKPQKEILKDSRKRDKKAL  66

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             ++  A+D++    V  A ++K+AW+ ++  YKG
Sbjct  67   YLIYQALDDNGFEKVSSATSAKQAWEKLQISYKG  100



>ref|XP_006574018.1| PREDICTED: uncharacterized protein LOC102660454 [Glycine max]
Length=206

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 5/106 (5%)
 Frame = -3

Query  552  LTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLK--DKASKKDR  379
            +  +S  +  +   L G+NY  W  ++  +++   +W+ VEEGY   G +  ++ +  DR
Sbjct  1    MVAVSCSIPANLPVLTGKNYENWKIQIRVVMRFQGVWEFVEEGYIPVGERATEEQNAADR  60

Query  378  E---KDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKS  250
            E   KD     IL  +VD +    +  A  SKEAWD ++  + G +
Sbjct  61   EKEKKDCKALFILHQSVDAANFEKIAMAQTSKEAWDILQKSHDGAT  106



>ref|XP_007021628.1| Uncharacterized protein TCM_031677 [Theobroma cacao]
 gb|EOY13153.1| Uncharacterized protein TCM_031677 [Theobroma cacao]
Length=1061

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 50/94 (53%), Gaps = 11/94 (12%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS---------KKDREKDFLIT  358
            L G NY  WS +M+  L+ + LW++VE G  E  ++  A+         ++D+ K + + 
Sbjct  14   LTGENYVFWSVKMQSYLRAFPLWEVVEIG--EDPVQRHANPTLAQIRQFEEDKAKRYKVL  71

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              L  AV + +   ++  N+SKE WD +K ++ G
Sbjct  72   SCLHFAVSDDIFSRIMHLNSSKEVWDQLKEEFHG  105



>ref|XP_006577639.1| PREDICTED: uncharacterized protein LOC102659578 [Glycine max]
Length=274

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (48%), Gaps = 7/105 (7%)
 Frame = -3

Query  519  FQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDRE-------KDFLI  361
            F +L   NY  W   M+ LL   D W++VE+GY +   +   S  ++E       KD   
Sbjct  11   FPRLTKENYDNWCRRMKTLLGSQDAWEIVEKGYTQPQNEAILSPNEKETLLKSKKKDQQA  70

Query  360  TVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKGKSLKSYFCLR  226
               +   +DE++   V +A  SKEAW+ +KT  +G       CL+
Sbjct  71   LTFIHQGLDEAMFELVSNATTSKEAWEILKTSLEGVDKVKKVCLQ  115



>ref|XP_009142131.1| PREDICTED: uncharacterized protein LOC103866015 [Brassica rapa]
Length=133

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 49/93 (53%), Gaps = 13/93 (14%)
 Frame = -3

Query  528  GTSFQ--KLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITV  355
             TS Q   L   NY +WS  M+ LL+ +++WD +E G             D++K+ +   
Sbjct  15   STSIQCPMLSSTNYTVWSMRMKVLLRVHEVWDTIEPG-----------SDDQKKNDVAIA  63

Query  354  ILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            +L  +V E++   V +   SKE W+AIK+++ G
Sbjct  64   LLFQSVPETLILQVGEQTASKEIWNAIKSRHLG  96



>ref|XP_006579114.1| PREDICTED: uncharacterized protein LOC102664804 [Glycine max]
Length=336

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYK--EKGLKD--KASKKD-REKDFLITVILL  346
            L G+N+  WS +M+ LL   DL D++E G +  ++G  D  K   KD ++KD    VIL 
Sbjct  14   LTGKNFNRWSVQMKALLGFQDLIDVIENGIEIPKEGASDSQKIEFKDLKKKDCKALVILH  73

Query  345  IAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              VD+S    + +A ++KEAWD +   Y G
Sbjct  74   QCVDDSHFEKIANAKSAKEAWDILNKAYAG  103



>ref|XP_009119950.1| PREDICTED: uncharacterized protein LOC103844874 [Brassica rapa]
Length=200

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 48/85 (56%), Gaps = 11/85 (13%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDE  331
            L+  NY +W+ +M+ LLK + +WD++E               D EK+ +   +L+ ++ E
Sbjct  24   LNATNYTVWAIKMKILLKLHKVWDIIE-----------GEDADDEKNNMAMALLVQSIPE  72

Query  330  SVSHCVLDANNSKEAWDAIKTQYKG  256
            ++   V + + +K+ WDA+KT++ G
Sbjct  73   TLVLQVGELDTAKKVWDAVKTRHMG  97



>ref|XP_008464912.1| PREDICTED: uncharacterized protein LOC103502670 [Cucumis melo]
Length=330

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDESV  325
            G  Y  WS   + LL+   LWDLVE+GY +   + K  +++R+KD  + VI+  AV ++V
Sbjct  20   GEGYEFWSIRTKTLLRSQYLWDLVEQGYADPNDEGKL-QENRKKDSKMLVIIQQAVHDNV  78

Query  324  SHCVLDANNSKEAWDAIKTQYKGKS  250
               ++ A  SK+ W  ++   +G S
Sbjct  79   FSRIVAATTSKQVWLILQKALQGDS  103



>ref|XP_010669264.1| PREDICTED: uncharacterized protein LOC104886517 [Beta vulgaris 
subsp. vulgaris]
Length=289

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 4/89 (4%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGY----KEKGLKDKASKKDREKDFLITVILLIAV  337
            G  Y +WS +M+ + +  +LWDLVE GY    +   + DK     R+ +     I+  AV
Sbjct  18   GEKYHLWSIKMQTMFQSQELWDLVENGYEEPEQPPEVPDKKLCDSRKLNAKALFIIQSAV  77

Query  336  DESVSHCVLDANNSKEAWDAIKTQYKGKS  250
            D+ +   +  A   KEAW+ +K +Y+G S
Sbjct  78   DDDIFPRISTAKMPKEAWEILKMEYRGDS  106



>ref|XP_008391488.1| PREDICTED: uncharacterized protein LOC103453704 [Malus domestica]
Length=197

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 59/107 (55%), Gaps = 13/107 (12%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS + + LL  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNAMAAFQVPVLDNNNFDNWSIKKKALLGAHDVWEVVEKGYTEP--EDEATLCQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
              K  R++D     ++  A+D++    V  A ++K+AW+ ++  YKG
Sbjct  59   SLKDSRKRDKNALYLIYQALDDNGFEKVSSATSAKQAWEKLQISYKG  105



>gb|AAR13313.1| gag-pol polyprotein [Phaseolus vulgaris]
Length=529

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 47/92 (51%), Gaps = 7/92 (8%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKD-------KASKKDREKDFLITVI  352
             DG +Y++W+  ME  L+  DLW+ VEE Y+ + L +       K+ K  + K       
Sbjct  6    FDGDSYQMWAVRMETYLEALDLWEAVEEDYEIQSLPENPTVAQIKSQKDKKMKRSKAKAC  65

Query  351  LLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            L  AV   V   ++   ++KE WD +K +Y+G
Sbjct  66   LFAAVSPMVFTRIMSLKSAKEIWDYLKAEYEG  97



>ref|XP_008808025.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Phoenix 
dactylifera]
Length=441

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  474  MEKLLKCYDLWDLVEEGYKEKGLKDKASKKDREKDFLITVILLIAVDESVSHCVLDANNS  295
            M+ L    DLW+LVE+GY ++G   +  K+ + KD +    +  A+D++V   +  A  S
Sbjct  1    MKTLFISMDLWELVEKGYGDEGASRENIKEIKMKDAIALFFIQQAIDDTVFPRISAATKS  60

Query  294  KEAWDAIKTQYKGKS  250
            KEAWD ++++Y G +
Sbjct  61   KEAWDLLQSEYLGNA  75



>ref|XP_007050318.1| Uncharacterized protein TCM_004065 [Theobroma cacao]
 gb|EOX94475.1| Uncharacterized protein TCM_004065 [Theobroma cacao]
Length=1117

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 52/104 (50%), Gaps = 10/104 (10%)
 Frame = -3

Query  537  SKMGTSFQK---LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------K  388
            S    SFQ     +G NY IW  +ME  L+  DLWD VE G +   LKD A+        
Sbjct  7    SNTAFSFQSPSVFNGENYPIWFEKMESYLRGLDLWDAVESGAEVPTLKDNATPAQVKWNH  66

Query  387  KDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            ++  K F     +  A+ +++   ++    +K+AW+ +K Q++G
Sbjct  67   EEVAKRFRALSYIQGALIDAMFVRIMGCKTTKDAWERLKVQFEG  110



>emb|CDY11902.1| BnaC03g13280D [Brassica napus]
Length=317

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/109 (25%), Positives = 55/109 (50%), Gaps = 0/109 (0%)
 Frame = -3

Query  588  NGWKPNAESRKVLTNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKG  409
            +G     E R +     ++M       +G  Y +WS +M  LL   DLWD++E    ++ 
Sbjct  77   SGLHLQQEERIIAMEAQTQMQQLVPVFNGNEYELWSIKMRTLLMSRDLWDVIESETSDQP  136

Query  408  LKDKASKKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQY  262
            ++++  K  R KD     +L ++V +++   +  A +SK+A + +K ++
Sbjct  137  MEEELVKSQRIKDMSALYMLQMSVSDTIFLRIARATSSKQACELLKAEF  185



>ref|XP_010911854.1| PREDICTED: uncharacterized protein LOC105037921 [Elaeis guineensis]
Length=245

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 7/103 (7%)
 Frame = -3

Query  543  ISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKE-------KGLKDKASKK  385
            +S+ M     +L   NY  WS +M+ LL   D+W++VE+GY+E          +  A   
Sbjct  1    MSNSMQFPIPRLTTINYENWSIQMKALLGSQDIWEVVEKGYEEPQDDRVQTAAQRTALVD  60

Query  384  DREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             R+KD      +   +DE     V  A NSK+AW+ ++  +KG
Sbjct  61   QRKKDKKALYFIYQGLDEVKFEKVACATNSKQAWEILENAHKG  103



>ref|XP_009355531.1| PREDICTED: uncharacterized protein LOC103946540 [Pyrus x bretschneideri]
Length=384

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 60/106 (57%), Gaps = 13/106 (12%)
 Frame = -3

Query  543  ISSKMGTSFQK--LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS-------  391
            ++S    +FQ   LD  N+  WS +M+ LL  +D+W++VE+GY E   +D+A+       
Sbjct  1    MASNAMAAFQVPVLDSNNFDNWSIKMKALLCAHDVWEVVEKGYTEP--EDEATLSQPQKE  58

Query  390  --KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYK  259
              K  R++D     ++  A+D++    V  A ++K+AW+ ++T YK
Sbjct  59   SLKYSRKRDKKALYLIYQALDDNGFEKVSSATSAKQAWEKLQTSYK  104



>ref|XP_009338084.1| PREDICTED: uncharacterized protein LOC103930463 [Pyrus x bretschneideri]
Length=192

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 45/94 (48%), Gaps = 11/94 (12%)
 Frame = -3

Query  504  GRNYRIWSTEMEKLLKCYDLWDLVEEGY-----------KEKGLKDKASKKDREKDFLIT  358
            G NY  WS +M+ + K + LW+LVEEGY           K    K+   K++  KD    
Sbjct  16   GENYEFWSIKMKTIFKSHGLWELVEEGYEISTEKVADAEKPPLGKEIVLKENMTKDTKAL  75

Query  357  VILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
             I+  +V   V   +     SK AWD +K +Y+G
Sbjct  76   GIIQNSVTNRVFPRIAHEETSKGAWDKLKEEYRG  109



>ref|XP_007030287.1| Uncharacterized protein TCM_026102 [Theobroma cacao]
 gb|EOY10789.1| Uncharacterized protein TCM_026102 [Theobroma cacao]
Length=135

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 45/90 (50%), Gaps = 7/90 (8%)
 Frame = -3

Query  510  LDGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKDKAS----KKDRE---KDFLITVI  352
             DG+NY++W+ +ME  L+ YDLW  +E   +   L+D A+    K+  E   K +     
Sbjct  14   FDGKNYQVWAVKMETFLRAYDLWTAIETEEEPAALRDNATINQIKQHSEKVAKRYRALSF  73

Query  351  LLIAVDESVSHCVLDANNSKEAWDAIKTQY  262
            +  AV E +   ++    +K+ W  ++  Y
Sbjct  74   IQAAVSEKIFSRIMSCKTAKKTWTKLEEDY  103



>ref|XP_010649298.1| PREDICTED: uncharacterized protein LOC104879162 [Vitis vinifera]
Length=200

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 50/105 (48%), Gaps = 8/105 (8%)
 Frame = -3

Query  549  TNISSKMGTSFQKLDGRNYRIWSTEMEKLLKCYDLWDLVE-------EGYKEKGLKDKAS  391
            T  S+ +  +  K DG +Y  WS  ME  L+  + W LVE       EG +    + KA 
Sbjct  3    TESSNFVQPAIPKFDG-HYDHWSMLMENFLRSKEYWSLVENGIPAAAEGIEPTEAQQKAI  61

Query  390  KKDREKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
               + KD  +   L  A+D ++   +L+    K  WD++K +Y+G
Sbjct  62   ADHKLKDLKVKNYLFQAIDRNIMETILNKETGKHIWDSMKQKYQG  106



>ref|XP_006388389.1| hypothetical protein POPTR_0200s00210g [Populus trichocarpa]
 gb|ERP47303.1| hypothetical protein POPTR_0200s00210g [Populus trichocarpa]
Length=834

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 12/102 (12%)
 Frame = -3

Query  525  TSFQKL-----DGRNYRIWSTEMEKLLKCYDLWDLVEEGYKEKGLKD-------KASKKD  382
            TSF  +     DG NY++W+ +ME  L   DLW+ VEE Y+   L +       K  K+ 
Sbjct  657  TSFSHMSSPIFDGENYQLWAVKMETYLDAMDLWEAVEEDYEVHPLPNNPTVAQIKNHKER  716

Query  381  REKDFLITVILLIAVDESVSHCVLDANNSKEAWDAIKTQYKG  256
            + +       L  AV  ++   ++   + K+ WD +K +Y G
Sbjct  717  KTRKSKAKACLFAAVSTTIFTRIMSLQSVKDVWDYLKKEYAG  758



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1814529760516