BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16215_g1_i1 len=1421 path=[1569:0-61 1801:62-744 2484:745-1420]

Length=1421
                                                                      Score     E

ref|XP_006352249.1|  PREDICTED: mitochondrial inner membrane prot...    495   8e-169   
ref|XP_004244633.1|  PREDICTED: mitochondrial inner membrane prot...    482   2e-163   
ref|XP_009786373.1|  PREDICTED: mitochondrial inner membrane prot...    476   4e-161   
ref|XP_009780449.1|  PREDICTED: mitochondrial inner membrane prot...    471   4e-159   
ref|XP_006343861.1|  PREDICTED: mitochondrial inner membrane prot...    464   1e-156   
ref|XP_009618996.1|  PREDICTED: mitochondrial inner membrane prot...    461   3e-155   
ref|XP_009618995.1|  PREDICTED: mitochondrial inner membrane prot...    461   5e-155   
ref|XP_011074390.1|  PREDICTED: mitochondrial inner membrane prot...    458   3e-154   
ref|XP_011101043.1|  PREDICTED: mitochondrial inner membrane prot...    453   2e-152   
emb|CDP12154.1|  unnamed protein product                                426   8e-143   
ref|XP_010261576.1|  PREDICTED: mitochondrial inner membrane prot...    411   4e-136   
gb|EYU23348.1|  hypothetical protein MIMGU_mgv1a018646mg                408   1e-135   
gb|KDP45027.1|  hypothetical protein JCGZ_01527                         410   2e-135   
ref|XP_010274444.1|  PREDICTED: mitochondrial inner membrane prot...    409   4e-135   
gb|KDO76531.1|  hypothetical protein CISIN_1g0137752mg                  405   2e-133   
gb|EYU40017.1|  hypothetical protein MIMGU_mgv1a008726mg                400   6e-133   
ref|XP_006476388.1|  PREDICTED: mitochondrial inner membrane prot...    402   3e-132   
ref|XP_006439353.1|  hypothetical protein CICLE_v10020194mg             402   3e-132   
ref|XP_008239037.1|  PREDICTED: mitochondrial inner membrane prot...    399   2e-131   
ref|XP_004505010.1|  PREDICTED: mitochondrial inner membrane prot...    397   1e-130   
ref|XP_007209155.1|  hypothetical protein PRUPE_ppa005941mg             397   3e-130   
ref|XP_007040516.1|  Inner membrane protein isoform 1                   394   3e-129   
ref|XP_010055864.1|  PREDICTED: mitochondrial inner membrane prot...    391   3e-128   
ref|XP_010087269.1|  Mitochondrial inner membrane protein OXA1          391   4e-127   
ref|XP_010274445.1|  PREDICTED: mitochondrial inner membrane prot...    386   1e-126   
ref|XP_008451946.1|  PREDICTED: mitochondrial inner membrane prot...    386   4e-126   
ref|XP_003542770.1|  PREDICTED: mitochondrial inner membrane prot...    385   4e-126   
ref|XP_010325667.1|  PREDICTED: mitochondrial inner membrane prot...    385   6e-126   
ref|XP_004149745.1|  PREDICTED: mitochondrial inner membrane prot...    384   2e-125   
gb|KHN10035.1|  Mitochondrial inner membrane protein OXA1               385   4e-125   
gb|KDO76532.1|  hypothetical protein CISIN_1g0137752mg                  380   7e-125   
ref|XP_003529495.1|  PREDICTED: mitochondrial inner membrane prot...    381   3e-124   
ref|XP_010551130.1|  PREDICTED: mitochondrial inner membrane prot...    379   1e-123   
ref|XP_003529306.1|  PREDICTED: mitochondrial inner membrane prot...    379   2e-123   
ref|XP_009358591.1|  PREDICTED: mitochondrial inner membrane prot...    379   3e-123   
ref|XP_008346707.1|  PREDICTED: mitochondrial inner membrane prot...    378   3e-123   
gb|EPS73660.1|  hypothetical protein M569_01093                         376   2e-122   
gb|KHN07284.1|  Mitochondrial inner membrane protein OXA1               372   3e-122   
ref|XP_011026896.1|  PREDICTED: mitochondrial inner membrane prot...    375   8e-122   
ref|XP_002509958.1|  cytochrome oxidase biogenesis protein, putative    374   8e-122   Ricinus communis
ref|XP_007146149.1|  hypothetical protein PHAVU_006G016400g             374   9e-122   
ref|XP_006387873.1|  hypothetical protein POPTR_0513s00210g             372   4e-121   
ref|XP_010676296.1|  PREDICTED: mitochondrial inner membrane prot...    372   8e-121   
ref|XP_004306681.1|  PREDICTED: mitochondrial inner membrane prot...    372   9e-121   
ref|XP_003622394.1|  Mitochondrial inner membrane protein OXA1          371   3e-120   
ref|XP_011017708.1|  PREDICTED: mitochondrial inner membrane prot...    370   5e-120   
ref|XP_006394440.1|  hypothetical protein EUTSA_v10004275mg             369   1e-119   
ref|XP_002324680.2|  hypothetical protein POPTR_0018s13680g             368   2e-119   Populus trichocarpa [western balsam poplar]
ref|XP_007040517.1|  Inner membrane protein isoform 2                   363   3e-118   
ref|XP_008233188.1|  PREDICTED: mitochondrial inner membrane prot...    365   7e-118   
ref|XP_006583991.1|  PREDICTED: mitochondrial inner membrane prot...    362   8e-118   
ref|XP_008233186.1|  PREDICTED: mitochondrial inner membrane prot...    364   8e-118   
ref|XP_002297976.1|  Inner membrane protein OXA1                        365   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_007218039.1|  hypothetical protein PRUPE_ppa006036mg             363   2e-117   
ref|XP_008376101.1|  PREDICTED: mitochondrial inner membrane prot...    363   2e-117   
ref|XP_002530480.1|  cytochrome oxidase biogenesis protein, putative    363   3e-117   Ricinus communis
ref|XP_010458195.1|  PREDICTED: mitochondrial inner membrane prot...    361   2e-116   
ref|XP_011020075.1|  PREDICTED: mitochondrial inner membrane prot...    360   3e-116   
gb|KEH31120.1|  60 kDa inner membrane protein                           359   6e-116   
ref|XP_004298901.1|  PREDICTED: mitochondrial inner membrane prot...    359   8e-116   
ref|XP_002866467.1|  hypothetical protein ARALYDRAFT_496379             358   2e-115   
ref|XP_010483945.1|  PREDICTED: mitochondrial inner membrane prot...    355   5e-114   
ref|XP_009151326.1|  PREDICTED: mitochondrial inner membrane prot...    354   1e-113   
ref|XP_010659217.1|  PREDICTED: mitochondrial inner membrane prot...    353   2e-113   
ref|XP_010444079.1|  PREDICTED: mitochondrial inner membrane prot...    353   2e-113   
ref|NP_201011.1|  mitochondrial inner membrane protein OXA1             353   3e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CBI34480.3|  unnamed protein product                                353   3e-113   
ref|XP_008799548.1|  PREDICTED: mitochondrial inner membrane prot...    351   8e-113   
emb|CDY00249.1|  BnaA06g21500D                                          353   1e-112   
emb|CDX86930.1|  BnaC03g52000D                                          353   1e-112   
gb|KHF97323.1|  Mitochondrial inner membrane OXA1 -like protein         351   2e-112   
ref|XP_006280517.1|  hypothetical protein CARUB_v10026454mg             350   3e-112   
ref|XP_010919268.1|  PREDICTED: mitochondrial inner membrane prot...    343   1e-109   
ref|XP_009382302.1|  PREDICTED: mitochondrial inner membrane prot...    343   2e-109   
ref|XP_006381144.1|  hypothetical protein POPTR_0006s07260g             333   2e-106   
ref|XP_010551119.1|  PREDICTED: mitochondrial inner membrane prot...    332   1e-105   
ref|XP_009133781.1|  PREDICTED: mitochondrial inner membrane prot...    329   3e-104   
ref|XP_010559124.1|  PREDICTED: mitochondrial inner membrane prot...    328   6e-104   
ref|XP_009411464.1|  PREDICTED: mitochondrial inner membrane prot...    327   3e-103   
ref|XP_002880242.1|  hypothetical protein ARALYDRAFT_483801             327   5e-103   
gb|EPS65404.1|  hypothetical protein M569_09370                         321   6e-103   
emb|CDX95701.1|  BnaC03g25820D                                          325   1e-102   
emb|CDX83365.1|  BnaA03g21410D                                          323   7e-102   
ref|XP_010919269.1|  PREDICTED: mitochondrial inner membrane prot...    321   9e-102   
ref|XP_010506652.1|  PREDICTED: mitochondrial inner membrane prot...    319   6e-100   
ref|XP_010508013.1|  PREDICTED: mitochondrial inner membrane prot...    318   9e-100   
ref|XP_010544829.1|  PREDICTED: mitochondrial inner membrane prot...    318   1e-99    
gb|EYU40019.1|  hypothetical protein MIMGU_mgv1a025462mg                315   6e-99    
ref|XP_006397838.1|  hypothetical protein EUTSA_v10001727mg             314   3e-98    
ref|NP_182170.1|  inner membrane OXA1-like protein                      313   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411468.1|  PREDICTED: mitochondrial inner membrane prot...    310   8e-98    
gb|KHG27847.1|  Mitochondrial inner membrane OXA1 -like protein         306   3e-96    
ref|XP_010506653.1|  PREDICTED: mitochondrial inner membrane prot...    303   1e-94    
ref|XP_006294256.1|  hypothetical protein CARUB_v10023251mg             303   4e-94    
ref|XP_010055019.1|  PREDICTED: mitochondrial inner membrane prot...    301   5e-94    
ref|XP_002467635.1|  hypothetical protein SORBIDRAFT_01g031260          300   8e-93    Sorghum bicolor [broomcorn]
ref|XP_010055023.1|  PREDICTED: mitochondrial inner membrane prot...    298   1e-92    
ref|XP_008799549.1|  PREDICTED: mitochondrial inner membrane prot...    292   5e-91    
ref|XP_004983890.1|  PREDICTED: mitochondrial inner membrane prot...    295   7e-91    
gb|EMS59812.1|  Mitochondrial inner membrane protein OXA1               291   8e-91    
gb|EAZ16712.1|  hypothetical protein OsJ_32188                          294   1e-90    Oryza sativa Japonica Group [Japonica rice]
gb|AAM92288.1|  putative cytochrome oxidase assembly protein            294   1e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010413084.1|  PREDICTED: mitochondrial inner membrane prot...    290   6e-90    
gb|AAG13422.1|AC051634_3  putative Oxa1 protein                         294   8e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662522.1|  PREDICTED: mitochondrial inner membrane prot...    287   2e-89    
ref|XP_003574213.1|  PREDICTED: mitochondrial inner membrane prot...    288   2e-88    
ref|XP_010229306.1|  PREDICTED: mitochondrial inner membrane prot...    288   2e-88    
gb|EPS67807.1|  hypothetical protein M569_06967                         280   2e-87    
ref|NP_001168896.1|  hypothetical protein                               285   3e-87    Zea mays [maize]
dbj|BAK02696.1|  predicted protein                                      282   4e-86    
ref|XP_009607376.1|  PREDICTED: mitochondrial inner membrane prot...    273   1e-85    
ref|NP_001048756.1|  Os03g0116000                                       281   2e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EEE58210.1|  hypothetical protein OsJ_09169                          280   3e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74390.1|  hypothetical protein OsI_09733                          275   3e-83    Oryza sativa Indica Group [Indian rice]
gb|ABF93648.1|  60Kd inner membrane protein, expressed                  274   6e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468646.1|  hypothetical protein SORBIDRAFT_01g049540          273   3e-82    Sorghum bicolor [broomcorn]
ref|XP_004985991.1|  PREDICTED: mitochondrial inner membrane prot...    273   3e-82    
gb|KHG19923.1|  Mitochondrial inner membrane OXA1 -like protein         266   4e-82    
gb|AGT17416.1|  inner membrane protein                                  268   2e-80    
ref|XP_010553841.1|  PREDICTED: mitochondrial inner membrane prot...    267   2e-80    
ref|XP_010553840.1|  PREDICTED: mitochondrial inner membrane prot...    266   4e-80    
ref|XP_008650106.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    264   5e-78    
emb|CDY30690.1|  BnaA02g33120D                                          256   6e-78    
gb|EMT11597.1|  Mitochondrial inner membrane protein OXA1               263   1e-76    
ref|XP_006853548.1|  hypothetical protein AMTR_s00032p00233900          251   1e-76    
ref|XP_002960272.1|  hypothetical protein SELMODRAFT_73518              252   9e-76    
gb|KCW71509.1|  hypothetical protein EUGRSUZ_E00060                     244   8e-74    
gb|KCW71507.1|  hypothetical protein EUGRSUZ_E00058                     246   3e-73    
ref|XP_002967440.1|  hypothetical protein SELMODRAFT_408456             248   3e-73    
ref|XP_001782477.1|  predicted protein                                  248   6e-73    
ref|XP_010274446.1|  PREDICTED: mitochondrial inner membrane prot...    243   9e-72    
ref|XP_008644207.1|  PREDICTED: hypothetical protein isoform X1         239   2e-70    
ref|XP_007159291.1|  hypothetical protein PHAVU_002G225700g             228   1e-66    
ref|XP_010544832.1|  PREDICTED: mitochondrial inner membrane prot...    228   7e-66    
ref|XP_010553842.1|  PREDICTED: mitochondrial inner membrane prot...    220   1e-64    
gb|EMS63651.1|  Mitochondrial inner membrane protein OXA1               209   2e-58    
tpg|DAA42925.1|  TPA: hypothetical protein ZEAMMB73_313766              196   4e-55    
ref|XP_010550519.1|  PREDICTED: mitochondrial inner membrane prot...    195   3e-53    
ref|XP_010550521.1|  PREDICTED: mitochondrial inner membrane prot...    186   8e-51    
ref|XP_005850884.1|  hypothetical protein CHLNCDRAFT_140542             182   4e-48    
ref|XP_001418188.1|  Oxa1 family transporter: 60 KD inner membran...    178   7e-48    Ostreococcus lucimarinus CCE9901
ref|XP_010550520.1|  PREDICTED: mitochondrial inner membrane prot...    176   1e-46    
ref|XP_005651155.1|  hypothetical protein COCSUDRAFT_39658              171   4e-46    
ref|XP_007512866.1|  predicted protein                                  174   1e-45    
emb|CCJ28445.1|  unnamed protein product                                174   3e-45    
ref|XP_003079772.1|  putative cytochrome oxidase assembly protein...    171   5e-45    
ref|XP_003383807.1|  PREDICTED: mitochondrial inner membrane prot...    173   7e-45    
emb|CEF98290.1|  Membrane insertase OXA1/ALB3/YidC                      171   4e-44    
gb|EMT11598.1|  Mitochondrial inner membrane protein OXA1               167   1e-43    
ref|XP_003383873.1|  PREDICTED: mitochondrial inner membrane prot...    169   2e-43    
ref|XP_005823454.1|  hypothetical protein GUITHDRAFT_117364             163   2e-42    
ref|XP_010544810.1|  PREDICTED: mitochondrial inner membrane prot...    165   2e-42    
ref|XP_010544820.1|  PREDICTED: mitochondrial inner membrane prot...    164   6e-42    
ref|XP_010545161.1|  PREDICTED: mitochondrial inner membrane prot...    162   2e-41    
ref|XP_003059469.1|  cytochrome oxidase biogenesis family               158   3e-41    
ref|XP_007873481.1|  hypothetical protein PNEG_01536                    163   4e-41    
ref|XP_002111548.1|  hypothetical protein TRIADDRAFT_23561              159   6e-41    Trichoplax adhaerens
ref|XP_007219768.1|  hypothetical protein PRUPE_ppa025587mg             157   6e-41    
ref|XP_008868290.1|  hypothetical protein H310_05370                    160   1e-40    
gb|KFH72250.1|  hypothetical protein MVEG_02541                         161   2e-40    
ref|XP_007159295.1|  hypothetical protein PHAVU_002G225900g             155   2e-40    
ref|XP_010550518.1|  PREDICTED: mitochondrial inner membrane prot...    159   3e-40    
ref|XP_003724188.1|  PREDICTED: mitochondrial inner membrane prot...    160   4e-40    
ref|XP_010550517.1|  PREDICTED: mitochondrial inner membrane prot...    158   7e-40    
gb|EIE80290.1|  hypothetical protein RO3G_04995                         156   1e-39    
ref|XP_009842842.1|  hypothetical protein H257_16184                    157   1e-39    
ref|XP_002169136.2|  PREDICTED: mitochondrial inner membrane prot...    158   3e-39    
ref|XP_005314501.1|  PREDICTED: mitochondrial inner membrane prot...    155   5e-39    
ref|XP_010544818.1|  PREDICTED: mitochondrial inner membrane prot...    155   1e-38    
ref|XP_010544811.1|  PREDICTED: mitochondrial inner membrane prot...    154   2e-38    
ref|XP_002174771.1|  inner membrane translocase Oxa102                  153   3e-38    Schizosaccharomyces japonicus yFS275
ref|XP_010790930.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    155   4e-38    
emb|CDH51810.1|  mitochondrial inner membrane protein oxa1l-like        153   7e-38    
ref|XP_010793094.1|  PREDICTED: mitochondrial inner membrane prot...    153   2e-37    
emb|CDP21743.1|  unnamed protein product                                144   2e-37    
ref|XP_001639327.1|  predicted protein                                  149   2e-37    Nematostella vectensis
emb|CDS03152.1|  hypothetical protein LRAMOSA00554                      151   3e-37    
ref|XP_001742405.1|  hypothetical protein                               147   4e-37    Monosiga brevicollis MX1
ref|XP_002500884.1|  cytochrome oxidase biogenesis family               146   6e-37    Micromonas commoda
gb|EPB90412.1|  hypothetical protein HMPREF1544_02778                   150   9e-37    
ref|XP_007436445.1|  PREDICTED: mitochondrial inner membrane prot...    149   3e-36    
ref|XP_007662256.1|  PREDICTED: mitochondrial inner membrane prot...    149   3e-36    
ref|XP_003227547.1|  PREDICTED: mitochondrial inner membrane prot...    149   3e-36    
ref|XP_005807304.1|  PREDICTED: mitochondrial inner membrane prot...    149   4e-36    
gb|AAI34231.1|  Zgc:163091 protein                                      149   4e-36    Danio rerio [leopard danio]
ref|NP_001106402.1|  oxidase (cytochrome c) assembly 1-like             148   5e-36    Xenopus tropicalis [western clawed frog]
gb|AAI52010.1|  Oxa1l protein                                           149   5e-36    Danio rerio [leopard danio]
ref|NP_001098600.2|  oxidase (cytochrome c) assembly 1-like             149   5e-36    Danio rerio [leopard danio]
gb|EPX74122.1|  inner membrane translocase Oxa102                       147   6e-36    
ref|XP_008426239.1|  PREDICTED: mitochondrial inner membrane prot...    147   1e-35    
ref|XP_007248080.1|  PREDICTED: mitochondrial inner membrane prot...    147   2e-35    
ref|XP_007436446.1|  PREDICTED: mitochondrial inner membrane prot...    146   2e-35    
ref|XP_007436444.1|  PREDICTED: mitochondrial inner membrane prot...    146   2e-35    
ref|XP_007551475.1|  PREDICTED: mitochondrial inner membrane prot...    147   2e-35    
ref|XP_008618881.1|  hypothetical protein SDRG_14524                    145   3e-35    
emb|CEG66499.1|  hypothetical protein RMATCC62417_03066                 144   3e-35    
ref|XP_315429.4|  AGAP005421-PA                                         145   4e-35    Anopheles gambiae str. PEST
gb|KDO25568.1|  hypothetical protein SPRG_20688                         144   6e-35    
gb|KFB48215.1|  AGAP005421-PA-like protein                              145   7e-35    
ref|XP_010740031.1|  PREDICTED: mitochondrial inner membrane prot...    146   7e-35    
ref|XP_002875952.1|  predicted protein                                  142   8e-35    
ref|XP_002612458.1|  hypothetical protein BRAFLDRAFT_214259             144   9e-35    Branchiostoma floridae
emb|CEJ03963.1|  hypothetical protein RMCBS344292_17934                 144   1e-34    
ref|XP_009107740.1|  PREDICTED: mitochondrial inner membrane prot...    138   1e-34    
emb|CEG66498.1|  hypothetical protein RMATCC62417_03066                 144   1e-34    
ref|XP_003449430.2|  PREDICTED: mitochondrial inner membrane prot...    144   2e-34    
dbj|BAC36908.1|  unnamed protein product                                144   2e-34    Mus musculus [mouse]
dbj|BAE24033.1|  unnamed protein product                                144   2e-34    Mus musculus [mouse]
dbj|BAE32503.1|  unnamed protein product                                143   2e-34    Mus musculus [mouse]
ref|XP_006817147.1|  PREDICTED: mitochondrial inner membrane prot...    143   3e-34    
ref|XP_009019457.1|  hypothetical protein HELRODRAFT_121655             140   3e-34    
gb|EDL36360.1|  oxidase assembly 1-like, isoform CRA_d                  143   3e-34    
ref|NP_081212.1|  mitochondrial inner membrane protein OXA1L            143   3e-34    Mus musculus [mouse]
gb|ACO09357.1|  Inner membrane protein OXA1L, mitochondrial precu...    143   3e-34    Osmerus mordax
ref|XP_003924390.1|  PREDICTED: mitochondrial inner membrane prot...    143   3e-34    
gb|EPY53819.1|  inner membrane translocase Oxa102                       142   4e-34    
ref|XP_004562716.1|  PREDICTED: mitochondrial inner membrane prot...    143   5e-34    
ref|XP_004079879.1|  PREDICTED: mitochondrial inner membrane prot...    143   5e-34    
ref|XP_005925924.1|  PREDICTED: mitochondrial inner membrane prot...    142   5e-34    
ref|XP_006801756.1|  PREDICTED: mitochondrial inner membrane prot...    143   7e-34    
ref|XP_004992614.1|  hypothetical protein PTSG_07193                    141   7e-34    
gb|KDD75294.1|  inner membrane protein                                  139   8e-34    
ref|XP_010899007.1|  PREDICTED: mitochondrial inner membrane prot...    142   1e-33    
ref|XP_003741477.1|  PREDICTED: mitochondrial inner membrane prot...    141   1e-33    
dbj|BAB25113.1|  unnamed protein product                                141   1e-33    Mus musculus [mouse]
ref|NP_001162055.1|  oxidase assembly 1-like                            141   1e-33    Rattus norvegicus [brown rat]
ref|XP_005623266.1|  PREDICTED: mitochondrial inner membrane prot...    141   1e-33    
dbj|BAE42101.1|  unnamed protein product                                141   2e-33    Mus musculus [mouse]
ref|XP_004879917.1|  PREDICTED: mitochondrial inner membrane prot...    141   2e-33    
ref|XP_003967001.1|  PREDICTED: mitochondrial inner membrane prot...    143   2e-33    
ref|XP_004421315.1|  PREDICTED: mitochondrial inner membrane prot...    140   2e-33    
ref|XP_005711735.1|  unnamed protein product                            140   2e-33    
ref|XP_005603270.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    141   2e-33    
ref|XP_005706414.1|  preprotein translocase, Oxa1 family                140   3e-33    
ref|XP_008285617.1|  PREDICTED: mitochondrial inner membrane prot...    141   3e-33    
emb|CCA19898.1|  mitochondrial inner membrane protein OXA1 putative     139   3e-33    
gb|ETE62324.1|  Mitochondrial inner membrane protein OXA1L              141   3e-33    
ref|XP_004389992.1|  PREDICTED: mitochondrial inner membrane prot...    140   4e-33    
ref|XP_002926062.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    142   4e-33    
ref|XP_009025059.1|  hypothetical protein HELRODRAFT_114451             138   5e-33    
ref|XP_003755910.1|  PREDICTED: mitochondrial inner membrane prot...    139   5e-33    
ref|XP_003420979.1|  PREDICTED: mitochondrial inner membrane prot...    139   6e-33    
ref|XP_008838134.1|  PREDICTED: mitochondrial inner membrane prot...    139   6e-33    
ref|XP_008838135.1|  PREDICTED: mitochondrial inner membrane prot...    139   6e-33    
emb|CCG83137.1|  Inner membrane protein oxa1-2                          141   7e-33    
ref|XP_006835521.1|  PREDICTED: mitochondrial inner membrane prot...    139   8e-33    
ref|XP_008708786.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    139   8e-33    
gb|KFO27516.1|  Mitochondrial inner membrane protein OXA1L              138   1e-32    
ref|XP_006776876.1|  PREDICTED: mitochondrial inner membrane prot...    137   1e-32    
ref|XP_007479856.1|  PREDICTED: mitochondrial inner membrane prot...    138   1e-32    
ref|XP_003987500.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    139   1e-32    
gb|ENN72201.1|  hypothetical protein YQE_11161                          139   1e-32    
ref|XP_007479855.1|  PREDICTED: mitochondrial inner membrane prot...    138   1e-32    
gb|EPX70518.1|  inner membrane translocase Oxa101                       137   2e-32    
ref|XP_006883188.1|  PREDICTED: mitochondrial inner membrane prot...    138   2e-32    
ref|XP_004402170.1|  PREDICTED: mitochondrial inner membrane prot...    138   2e-32    
ref|XP_004801243.1|  PREDICTED: mitochondrial inner membrane prot...    137   2e-32    
gb|EJT47213.1|  hypothetical protein A1Q1_04071                         139   2e-32    
gb|ETN64298.1|  cytochrome oxidase biogenesis protein (oxa1 mitoc...    138   2e-32    
gb|EKD03549.1|  hypothetical protein A1Q2_02132                         139   2e-32    
ref|XP_008063470.1|  PREDICTED: mitochondrial inner membrane prot...    138   2e-32    
ref|XP_007098153.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    139   2e-32    
ref|XP_006144544.1|  PREDICTED: mitochondrial inner membrane prot...    138   2e-32    
ref|XP_004609542.1|  PREDICTED: mitochondrial inner membrane prot...    137   2e-32    
emb|CDX79742.1|  BnaC03g20780D                                          137   2e-32    
ref|XP_007949355.1|  PREDICTED: mitochondrial inner membrane prot...    137   2e-32    
ref|XP_010636111.1|  PREDICTED: mitochondrial inner membrane prot...    137   2e-32    
gb|KDR14241.1|  Mitochondrial inner membrane protein OXA1L              138   2e-32    
ref|XP_005370551.1|  PREDICTED: mitochondrial inner membrane prot...    137   3e-32    
ref|XP_002047220.1|  GJ13319                                            137   4e-32    Drosophila virilis
ref|XP_006100156.1|  PREDICTED: mitochondrial inner membrane prot...    137   4e-32    
ref|XP_004661807.1|  PREDICTED: mitochondrial inner membrane prot...    138   5e-32    
ref|XP_002008047.1|  GI12049                                            136   5e-32    Drosophila mojavensis
ref|XP_004091955.1|  PREDICTED: mitochondrial inner membrane prot...    136   5e-32    
gb|EJK49811.1|  hypothetical protein THAOC_31279                        140   6e-32    
ref|XP_003260624.1|  PREDICTED: mitochondrial inner membrane prot...    136   7e-32    
ref|XP_005882335.1|  PREDICTED: mitochondrial inner membrane prot...    135   8e-32    
ref|XP_004755530.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    138   8e-32    
ref|XP_004474631.1|  PREDICTED: mitochondrial inner membrane prot...    136   9e-32    
gb|ELK11260.1|  Mitochondrial inner membrane protein OXA1L              136   9e-32    
emb|CAD62333.1|  unnamed protein product                                135   1e-31    
ref|XP_008321940.1|  PREDICTED: mitochondrial inner membrane prot...    136   1e-31    
ref|XP_006913680.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    136   1e-31    
sp|Q15070.3|OXA1L_HUMAN  RecName: Full=Mitochondrial inner membra...    135   1e-31    
gb|AAH01669.2|  OXA1L protein                                           135   1e-31    
ref|NP_596177.1|  mitochondrial inner membrane translocase Oxa102       135   1e-31    
emb|CAA63844.1|  oxa1Sp2                                                135   1e-31    
ref|XP_004054962.1|  PREDICTED: mitochondrial inner membrane prot...    135   1e-31    
ref|XP_005666330.1|  PREDICTED: mitochondrial inner membrane prot...    135   1e-31    
ref|XP_005978041.1|  PREDICTED: mitochondrial inner membrane prot...    135   2e-31    
ref|XP_004010403.1|  PREDICTED: mitochondrial inner membrane prot...    135   2e-31    
ref|XP_004694587.1|  PREDICTED: mitochondrial inner membrane prot...    135   2e-31    
ref|XP_005685334.1|  PREDICTED: mitochondrial inner membrane prot...    135   2e-31    
ref|XP_003808176.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    135   2e-31    
ref|NP_001030412.1|  mitochondrial inner membrane protein OXA1L         135   2e-31    
ref|XP_509840.3|  PREDICTED: LOW QUALITY PROTEIN: mitochondrial i...    135   2e-31    
ref|XP_003802029.1|  PREDICTED: mitochondrial inner membrane prot...    135   2e-31    
ref|XP_010829542.1|  PREDICTED: mitochondrial inner membrane prot...    135   2e-31    
gb|AAI12332.1|  Oxidase (cytochrome c) assembly 1-like                  135   2e-31    
ref|XP_006066586.1|  PREDICTED: mitochondrial inner membrane prot...    134   2e-31    
ref|NP_005006.3|  mitochondrial inner membrane protein OXA1L            135   2e-31    
ref|XP_008559221.1|  PREDICTED: mitochondrial inner membrane prot...    134   3e-31    
ref|XP_008564762.1|  PREDICTED: mitochondrial inner membrane prot...    135   3e-31    
emb|CAA05127.1|  OXA1L                                                  135   3e-31    
ref|XP_003506155.2|  PREDICTED: mitochondrial inner membrane prot...    134   3e-31    
ref|XP_008156781.1|  PREDICTED: mitochondrial inner membrane prot...    135   3e-31    
ref|XP_001652200.1|  cytochrome oxidase biogenesis protein (oxa1 ...    134   3e-31    
gb|ERE89351.1|  inner membrane protein OXA1L                            134   3e-31    
ref|XP_009247183.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    135   4e-31    
ref|XP_001957846.1|  GF23816                                            134   4e-31    
ref|XP_005535330.1|  similar to mitochondrial inner membrane prot...    134   5e-31    
ref|XP_002094335.1|  GE20254                                            133   6e-31    
ref|NP_648417.1|  CG6404, isoform B                                     133   6e-31    
ref|XP_007988968.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    134   7e-31    
ref|XP_001972309.1|  GG13956                                            133   7e-31    
gb|EFN71509.1|  Mitochondrial inner membrane protein OXA1L              133   8e-31    
ref|XP_005377185.1|  PREDICTED: mitochondrial inner membrane prot...    133   8e-31    
ref|XP_002030027.1|  GM24796                                            133   1e-30    
ref|XP_005186987.1|  PREDICTED: mitochondrial inner membrane prot...    132   1e-30    
ref|XP_008208736.1|  PREDICTED: mitochondrial inner membrane prot...    132   1e-30    
gb|EPY51675.1|  inner membrane translocase Oxa101                       132   1e-30    
ref|XP_006675818.1|  hypothetical protein BATDEDRAFT_34302              133   1e-30    
ref|XP_001985412.1|  GH17044                                            133   1e-30    
ref|XP_010376651.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    133   1e-30    
ref|XP_001997036.1|  GH23226                                            132   1e-30    
ref|XP_003901610.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    133   1e-30    
ref|XP_007449583.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    133   1e-30    
ref|XP_968413.1|  PREDICTED: mitochondrial inner membrane protein...    132   2e-30    
ref|XP_004584962.1|  PREDICTED: mitochondrial inner membrane prot...    132   2e-30    
ref|XP_001862125.1|  inner membrane protein oxa1-1, mitochondrial       132   2e-30    
ref|XP_004698949.1|  PREDICTED: mitochondrial inner membrane prot...    132   2e-30    
ref|XP_008267566.1|  PREDICTED: mitochondrial inner membrane prot...    132   2e-30    
ref|XP_002177364.1|  predicted protein                                  127   2e-30    
ref|XP_009621900.1|  PREDICTED: mitochondrial inner membrane prot...    125   2e-30    
ref|XP_007100556.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    132   2e-30    
ref|XP_007180594.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    132   2e-30    
ref|XP_010952995.1|  PREDICTED: mitochondrial inner membrane prot...    131   3e-30    
gb|EZA54730.1|  Mitochondrial inner membrane protein OXA1L              131   3e-30    
ref|XP_010987716.1|  PREDICTED: mitochondrial inner membrane prot...    131   4e-30    
emb|CCU97310.1|  unnamed protein product                                130   4e-30    
ref|XP_006175944.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    131   5e-30    
ref|XP_005895525.1|  PREDICTED: mitochondrial inner membrane prot...    130   5e-30    
ref|XP_004646734.1|  PREDICTED: mitochondrial inner membrane prot...    131   6e-30    
ref|XP_002068901.1|  GK18022                                            130   6e-30    
ref|XP_006217278.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    131   6e-30    
ref|XP_005560858.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    131   6e-30    
ref|XP_011064424.1|  PREDICTED: mitochondrial inner membrane prot...    130   7e-30    
ref|XP_003474355.2|  PREDICTED: mitochondrial inner membrane prot...    130   7e-30    
emb|CCI50092.1|  unnamed protein product                                133   9e-30    
ref|XP_001353642.2|  GA19566                                            130   9e-30    
ref|XP_004283247.1|  PREDICTED: mitochondrial inner membrane prot...    129   1e-29    
gb|AAH27191.1|  Oxa1l protein                                           128   2e-29    
emb|CBN74460.1|  Oxa1 or Cox18/Oxa2 homolog, mitochondrial integr...    128   3e-29    
ref|XP_005103513.1|  PREDICTED: mitochondrial inner membrane prot...    129   3e-29    
ref|XP_003700990.1|  PREDICTED: mitochondrial inner membrane prot...    129   3e-29    
gb|EDL36359.1|  oxidase assembly 1-like, isoform CRA_c                  128   3e-29    
dbj|BAM18497.1|  cytochrome oxidase biogenesis protein                  128   3e-29    
ref|XP_001099660.1|  PREDICTED: mitochondrial inner membrane prot...    128   4e-29    
gb|EFX86068.1|  hypothetical protein DAPPUDRAFT_193442                  127   8e-29    
gb|EDM14153.1|  rCG23545, isoform CRA_d                                 126   9e-29    
gb|EFZ09389.1|  hypothetical protein SINV_15992                         124   1e-28    
ref|XP_001946799.2|  PREDICTED: mitochondrial inner membrane prot...    126   1e-28    
ref|XP_004531592.1|  PREDICTED: mitochondrial inner membrane prot...    125   2e-28    
ref|XP_002174532.1|  inner membrane translocase Oxa101                  124   3e-28    
gb|EFA75517.1|  putative oxidase assembly protein                       125   3e-28    
gb|EUC62475.1|  inner membrane OXA1L-like protein                       125   4e-28    
ref|XP_004929631.1|  PREDICTED: mitochondrial inner membrane prot...    124   4e-28    
ref|XP_002908364.1|  mitochondrial inner membrane protein OXA1          124   4e-28    
ref|XP_006037159.1|  PREDICTED: mitochondrial inner membrane prot...    124   5e-28    
gb|EDL36357.1|  oxidase assembly 1-like, isoform CRA_a                  123   6e-28    
ref|XP_006988540.1|  PREDICTED: mitochondrial inner membrane prot...    124   7e-28    
gb|KEP49535.1|  inner membrane protein Oxa1-1                           124   7e-28    
ref|XP_004344684.1|  membrane protein insertase, YidC/Oxa1 subfam...    122   8e-28    
ref|XP_002680549.1|  predicted protein                                  119   1e-27    
gb|ACK57254.1|  CG6404-like protein                                     121   2e-27    
ref|XP_004864258.1|  PREDICTED: mitochondrial inner membrane prot...    123   2e-27    
gb|ESA10651.1|  hypothetical protein GLOINDRAFT_80414                   118   1e-26    
dbj|GAA98725.1|  hypothetical protein E5Q_05413                         121   1e-26    
ref|XP_002434421.1|  cytochrome oxidase biogenesis protein, putative    120   2e-26    
ref|XP_009058999.1|  hypothetical protein LOTGIDRAFT_123644             119   2e-26    
ref|XP_003194299.1|  hypothetical protein CGB_E3570C                    120   2e-26    
emb|CAH89782.1|  hypothetical protein                                   120   2e-26    
gb|KGB77893.1|  preprotein translocase subunit YidC                     118   3e-26    
gb|EXX60844.1|  Oxa1p                                                   119   3e-26    
ref|XP_004354692.1|  putative oxidase assembly protein                  117   1e-25    
ref|XP_004474630.1|  PREDICTED: mitochondrial inner membrane prot...    118   1e-25    
ref|XP_001729204.1|  hypothetical protein MGL_3671                      117   2e-25    
gb|AFR95561.2|  preprotein translocase subunit YidC                     115   2e-25    
dbj|GAA52489.1|  preprotein translocase subunit YidC                    115   4e-25    
gb|ETM02632.1|  hypothetical protein L917_00954                         115   4e-25    
ref|XP_006661968.1|  PREDICTED: mitochondrial inner membrane prot...    111   5e-25    
gb|ETM55882.1|  hypothetical protein L914_00993                         115   5e-25    
emb|CDQ62342.1|  unnamed protein product                                115   5e-25    
gb|ETK96195.1|  hypothetical protein L915_00999                         115   6e-25    
ref|XP_010724999.1|  PREDICTED: mitochondrial inner membrane prot...    115   6e-25    
gb|AHY45780.1|  membrane protein insertase, YidC/Oxa1 family            113   7e-25    
ref|XP_005708885.1|  preprotein translocase, Oxa1 family                114   9e-25    
ref|WP_038683740.1|  hypothetical protein                               110   1e-24    
gb|EFN79417.1|  Mitochondrial inner membrane protein OXA1L              112   1e-24    
ref|XP_009176628.1|  hypothetical protein T265_11653                    114   2e-24    
ref|XP_006566384.1|  PREDICTED: mitochondrial inner membrane prot...    114   2e-24    
gb|EWM27696.1|  mitochondrial inner membrane protein oxa1l              113   3e-24    
ref|XP_005144205.1|  PREDICTED: mitochondrial inner membrane prot...    112   4e-24    
ref|XP_420604.2|  PREDICTED: mitochondrial inner membrane protein...    112   5e-24    
ref|WP_038685310.1|  hypothetical protein                               109   5e-24    
ref|XP_008477357.1|  PREDICTED: mitochondrial inner membrane prot...    114   5e-24    
gb|AHY48053.1|  Membrane protein insertase, YidC/Oxa1 family            110   6e-24    
ref|XP_008302048.1|  PREDICTED: mitochondrial inner membrane prot...    112   6e-24    
ref|XP_008302945.1|  PREDICTED: mitochondrial inner membrane prot...    112   7e-24    
ref|XP_571212.1|  hypothetical protein                                  113   7e-24    
ref|XP_775567.1|  hypothetical protein CNBE2810                         113   7e-24    
ref|WP_035433823.1|  OxaA-like protein precursor                        109   8e-24    
gb|EEM14311.1|  Membrane protein oxaA 1                                 109   8e-24    
gb|EMS58025.1|  Mitochondrial inner membrane protein OXA1               108   8e-24    
ref|XP_006746556.1|  PREDICTED: mitochondrial inner membrane prot...    110   8e-24    
ref|WP_020059662.1|  OxaA precursor                                     109   9e-24    
ref|WP_018782457.1|  MULTISPECIES: OxaA precursor                       109   1e-23    
ref|XP_007877448.1|  hypothetical protein PFL1_01747                    113   1e-23    
ref|XP_008302047.1|  PREDICTED: mitochondrial inner membrane prot...    111   1e-23    
emb|CEF66161.1|  Mitochondrial inner membrane protein OXA1L             111   1e-23    
ref|XP_008302944.1|  PREDICTED: mitochondrial inner membrane prot...    111   1e-23    
ref|WP_028400766.1|  OxaA-like protein precursor                        108   2e-23    
ref|WP_012096471.1|  OxaA precursor                                     108   2e-23    
ref|XP_005812332.1|  PREDICTED: mitochondrial inner membrane prot...    110   2e-23    
ref|XP_003741476.1|  PREDICTED: mitochondrial inner membrane prot...    110   2e-23    
ref|WP_016112829.1|  membrane protein oxaA 1                            108   2e-23    
ref|XP_009289575.1|  PREDICTED: mitochondrial inner membrane prot...    110   2e-23    
ref|WP_003194158.1|  OxaA precursor                                     108   2e-23    
ref|WP_018764822.1|  MULTISPECIES: OxaA precursor                       108   2e-23    
ref|NP_001107941.1|  mitochondrial inner membrane protein COX18         109   2e-23    
ref|XP_010707951.1|  PREDICTED: mitochondrial inner membrane prot...    109   3e-23    
ref|XP_009003983.1|  PREDICTED: mitochondrial inner membrane prot...    110   3e-23    
ref|XP_005085685.1|  PREDICTED: mitochondrial inner membrane prot...    112   4e-23    
ref|NP_593559.1|  mitochondrial inner membrane translocase Oxa101       109   4e-23    
gb|KFN01530.1|  membrane insertase, YidC/Oxa1 family domain protein     107   5e-23    
ref|XP_007002498.1|  hypothetical protein TREMEDRAFT_37898              110   6e-23    
emb|CDY40509.1|  BnaC01g20030D                                          104   6e-23    
ref|XP_003398921.1|  PREDICTED: mitochondrial inner membrane prot...    110   7e-23    
ref|XP_011113026.1|  hypothetical protein H072_7264                     110   7e-23    
ref|XP_007537799.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    109   7e-23    
ref|XP_006781984.1|  PREDICTED: mitochondrial inner membrane prot...    107   1e-22    
ref|NP_001279727.1|  mitochondrial inner membrane protein COX18-like    108   1e-22    
ref|XP_007906240.1|  PREDICTED: mitochondrial inner membrane prot...    108   1e-22    
ref|WP_000727736.1|  OxaA precursor                                     106   1e-22    
ref|XP_639906.1|  hypothetical protein DDB_G0284883                     108   1e-22    
ref|XP_002737317.1|  PREDICTED: mitochondrial inner membrane prot...    107   2e-22    
ref|WP_013401916.1|  MULTISPECIES: OxaA precursor                       105   2e-22    
dbj|GAC98568.1|  60Kd inner membrane protein                            110   2e-22    
ref|XP_007542869.1|  PREDICTED: mitochondrial inner membrane prot...    106   2e-22    
gb|EDM14151.1|  rCG23545, isoform CRA_b                                 105   2e-22    
gb|EPQ17651.1|  Mitochondrial inner membrane protein OXA1L              107   2e-22    
emb|CDI98651.1|  cytochrome oxidase biogenesis protein                  108   2e-22    
gb|EID42812.1|  membrane protein insertase, YidC/Oxa1 family            105   2e-22    
ref|XP_004474632.1|  PREDICTED: mitochondrial inner membrane prot...    108   2e-22    
ref|XP_008419207.1|  PREDICTED: mitochondrial inner membrane prot...    106   2e-22    
ref|XP_003697219.1|  PREDICTED: mitochondrial inner membrane prot...    108   3e-22    
ref|WP_000726761.1|  OxaA precursor                                     105   3e-22    
ref|XP_004086595.1|  PREDICTED: mitochondrial inner membrane prot...    105   3e-22    
gb|ELU42072.1|  60Kd inner membrane domain-containing protein           107   3e-22    
ref|XP_010573890.1|  PREDICTED: mitochondrial inner membrane prot...    105   3e-22    
gb|KHJ48879.1|  inner membrane protein                                  108   3e-22    
ref|XP_008419205.1|  PREDICTED: mitochondrial inner membrane prot...    106   3e-22    
gb|EHA99998.1|  Mitochondrial inner membrane protein OXA1L              107   4e-22    
ref|XP_002084413.1|  GD12846                                            107   4e-22    
ref|WP_000726758.1|  OxaA precursor                                     104   5e-22    
ref|XP_002107842.1|  hypothetical protein TRIADDRAFT_51760              105   5e-22    
gb|KFD53679.1|  hypothetical protein M513_05384                         108   5e-22    
ref|XP_010636112.1|  PREDICTED: mitochondrial inner membrane prot...    107   5e-22    
ref|XP_006037156.1|  PREDICTED: mitochondrial inner membrane prot...    105   5e-22    
gb|EZP74816.1|  OxaA-like protein precursor                             104   5e-22    
ref|XP_010544814.1|  PREDICTED: mitochondrial inner membrane prot...    103   5e-22    
ref|XP_003458711.1|  PREDICTED: mitochondrial inner membrane prot...    105   6e-22    
ref|WP_000727750.1|  OxaA precursor                                     104   6e-22    
ref|WP_034316178.1|  OxaA-like protein precursor                        104   7e-22    
ref|WP_000726766.1|  OxaA-like protein precursor                        104   7e-22    
ref|WP_003329765.1|  OxaA-like protein precursor                        104   7e-22    
ref|WP_017673752.1|  OxaA precursor                                     104   7e-22    
gb|EEK97560.1|  Membrane protein oxaA 1                                 103   8e-22    
gb|EEK64651.1|  Membrane protein oxaA 1                                 103   8e-22    
ref|WP_000727745.1|  MULTISPECIES: OxaA precursor                       104   8e-22    
ref|WP_000319204.1|  OxaA-like protein precursor                        103   8e-22    
ref|WP_016085339.1|  membrane protein oxaA 1                            104   8e-22    
ref|WP_000727734.1|  MULTISPECIES: OxaA precursor                       104   8e-22    
ref|WP_015865425.1|  OxaA precursor                                     104   8e-22    
ref|WP_000726760.1|  OxaA precursor                                     103   8e-22    
gb|ESA13286.1|  hypothetical protein GLOINDRAFT_48177                   104   8e-22    
ref|XP_001902368.1|  60Kd inner membrane protein                        105   9e-22    
ref|XP_007523608.1|  PREDICTED: mitochondrial inner membrane prot...    105   9e-22    
ref|XP_007523607.1|  PREDICTED: mitochondrial inner membrane prot...    105   1e-21    
emb|CAX69653.1|  preprotein translocase YidC subunit                    105   1e-21    
ref|WP_033673552.1|  OxaA-like protein precursor                        103   1e-21    
dbj|GAK65098.1|  oxidase cytochrome c assembly 1-like                   107   1e-21    
ref|WP_002130197.1|  MULTISPECIES: OxaA precursor                       103   1e-21    
ref|WP_000726759.1|  OxaA precursor                                     103   1e-21    
ref|WP_002113235.1|  OxaA precursor                                     103   1e-21    
ref|WP_002144555.1|  OxaA precursor                                     103   1e-21    
ref|WP_000727737.1|  MULTISPECIES: OxaA precursor                       103   1e-21    
ref|WP_017435766.1|  OxaA precursor                                     103   1e-21    
ref|XP_003139636.1|  hypothetical protein LOAG_04051                    105   2e-21    
ref|WP_026592169.1|  OxaA-like protein precursor                        103   2e-21    



>ref|XP_006352249.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Solanum 
tuberosum]
Length=443

 Score =   495 bits (1275),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 260/385 (68%), Positives = 304/385 (79%), Gaps = 13/385 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPE-SSSENPRVLTHLRHCYFGN  254
             MAYRRS   TTRAK LY Q+  AP+I + H  DDDRK  +  S ENPR+ +  +  Y  +
Sbjct  1     MAYRRS--LTTRAKFLYQQKGAAPAICYTH--DDDRKTHDLPSCENPRISSFFQPHYARS  56

Query  255   RISLGVGVARIPFQDRKFSPP----PWAMAPIWMRNMSTSVGEGMNKIEYISEV--LSDK  416
              I+   G ++ PFQ+R+F P     P    P++ R+MS+SVG G  KIEYISEV  L+DK
Sbjct  57    EINSFNG-SKNPFQNRRFFPSHLMIPMNSGPMFSRSMSSSVGGGAEKIEYISEVAELADK  115

Query  417   AVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
             AVEAVASQ P VNEVA+A ADSYLPV ALQYLIDYVH  TGF+WWASI+ TT++IR +TL
Sbjct  116   AVEAVASQVPAVNEVAIATADSYLPVKALQYLIDYVHIFTGFDWWASIIATTIVIRCITL  175

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PLMI QLKAT+K A+L+PKLD+I +EMQNRGMAPAAV EGQQRM+    EY V+PF+  +
Sbjct  176   PLMINQLKATTKFAILKPKLDEINEEMQNRGMAPAAVAEGQQRMQAAMKEYGVTPFTPLK  235

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             GI IQGPIFVSFF+AISNM EKVPSFK+GG  WFTDLT  DSMYIFPVLTALTFWITVEC
Sbjct  236   GILIQGPIFVSFFMAISNMVEKVPSFKQGGVLWFTDLTVTDSMYIFPVLTALTFWITVEC  295

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             NAQEG+EGNPS  TIKNVSRA AAL+IPFTA FPKAVFCYW+TSN+FSLSYGL++KRP V
Sbjct  296   NAQEGLEGNPSAKTIKNVSRAFAALTIPFTAGFPKAVFCYWMTSNLFSLSYGLLVKRPAV  355

Query  1137  KKLLGVPIIPPAPPRADQSSGLPFF  1211
             KK LGVPII P  P+++Q  GLPFF
Sbjct  356   KKFLGVPII-PVTPKSEQKPGLPFF  379



>ref|XP_004244633.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Solanum 
lycopersicum]
 ref|XP_010324643.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Solanum 
lycopersicum]
 ref|XP_010324644.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Solanum 
lycopersicum]
Length=447

 Score =   482 bits (1240),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 256/385 (66%), Positives = 300/385 (78%), Gaps = 13/385 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPE-SSSENPRVLTHLRHCYFGN  254
             MAYRRS   TTRAK LY Q+   P+IS+ H  DDDRK  +  S ENPRV +  +  Y  +
Sbjct  1     MAYRRS--LTTRAKFLYQQKGATPAISYTH--DDDRKTHDLPSCENPRVSSFFQPRYARS  56

Query  255   RISLGVGVARIPFQDRKFSPP----PWAMAPIWMRNMSTSVGEGMNKIEYISEV--LSDK  416
              I+   G   + FQ+R+F P     P     ++ R+MS+SVG G  KIEYISEV  L+DK
Sbjct  57    EINSFNGSKNL-FQNRRFFPSRLMIPMNSGSMFTRSMSSSVGGGAEKIEYISEVAELADK  115

Query  417   AVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
             AVEAVASQ P VNEVA AAADSYLPV ALQYLIDYVH  TGF+WWASI+ TT++IR +TL
Sbjct  116   AVEAVASQVPAVNEVANAAADSYLPVKALQYLIDYVHIFTGFDWWASIIATTIVIRCITL  175

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PLMI QLKAT+K A+L+PKLD+I +EMQ+RGMAPAAV EGQQRM+    E+ V+PF+  +
Sbjct  176   PLMINQLKATTKFAILKPKLDEINEEMQSRGMAPAAVAEGQQRMQAAMKEHGVTPFTPLK  235

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             GI IQGP+FVSFF+AISNM EKVPSFK+GG  WFTDLT  DSMYIFPVLTALTFWITVEC
Sbjct  236   GILIQGPVFVSFFMAISNMVEKVPSFKQGGVLWFTDLTVTDSMYIFPVLTALTFWITVEC  295

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             NAQEG+EGNPS  TIKNVSRA AAL+IPFTA FPKAVFCYW+TSN+FSLSYGL++KRP V
Sbjct  296   NAQEGLEGNPSAKTIKNVSRAFAALTIPFTAGFPKAVFCYWMTSNLFSLSYGLLVKRPAV  355

Query  1137  KKLLGVPIIPPAPPRADQSSGLPFF  1211
             KK LGVPII P  P+++Q   LPFF
Sbjct  356   KKFLGVPII-PVTPKSEQKPALPFF  379



>ref|XP_009786373.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Nicotiana 
sylvestris]
 ref|XP_009786374.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Nicotiana 
sylvestris]
 ref|XP_009786375.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Nicotiana 
sylvestris]
Length=445

 Score =   476 bits (1224),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 260/385 (68%), Positives = 295/385 (77%), Gaps = 12/385 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MAYRR+   TTRAK LY QQR      H +  DDD++  E   +NPR  T L+  Y    
Sbjct  1     MAYRRN--LTTRAKFLYQQQRVVTPAFH-YSHDDDKQSQEPMCKNPRFSTFLQPHYVRRG  57

Query  258   ISLGVGVARIPFQDRKFSPPPWA----MAPIWMRNMSTSV-GEGMNKIEYISEV--LSDK  416
             I+   G  + PFQ R+F P P      +  ++ RNMS+SV G G  KIEYISEV  L+DK
Sbjct  58    INSFNG-PKSPFQHRRFRPSPHMICMNLGSVFTRNMSSSVSGGGAEKIEYISEVAELADK  116

Query  417   AVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
             AVE V SQ P VNEVAVAAA+SYLPV ALQYLIDYVH  TGF+WWASI+ TT+LIR +TL
Sbjct  117   AVEVVTSQVPAVNEVAVAAAESYLPVQALQYLIDYVHFFTGFDWWASIIATTILIRCITL  176

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PLMI QLKATSKLAL++PKLD I QEMQ+RGMAPAAV EGQ++MK    EY VSPF+  +
Sbjct  177   PLMINQLKATSKLALVKPKLDAINQEMQDRGMAPAAVAEGQEKMKAAMKEYGVSPFTPLK  236

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             GI IQGPIFVSFF+AISNM EKVPSFK+GG  WFTDLTTPDSMYIFPVLTALTFWITVEC
Sbjct  237   GILIQGPIFVSFFMAISNMVEKVPSFKQGGVLWFTDLTTPDSMYIFPVLTALTFWITVEC  296

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             NAQEGMEGN    TIKNVSRA AAL+IPFTA FPKAVFCYW+TSN+FSLSYGLVIK P V
Sbjct  297   NAQEGMEGNAHAKTIKNVSRAFAALTIPFTAGFPKAVFCYWMTSNLFSLSYGLVIKNPAV  356

Query  1137  KKLLGVPIIPPAPPRADQSSGLPFF  1211
             KKLL VPI+P +PP ++Q  GL FF
Sbjct  357   KKLLRVPIVPVSPP-SEQKPGLSFF  380



>ref|XP_009780449.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Nicotiana 
sylvestris]
 ref|XP_009780450.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Nicotiana 
sylvestris]
Length=449

 Score =   471 bits (1211),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 245/386 (63%), Positives = 297/386 (77%), Gaps = 12/386 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MAYRR+   TTRAKLLY QQR  P+ S+ H DDD R  PE   ++ RV +  +  Y G+ 
Sbjct  1     MAYRRN--ITTRAKLLYQQQRVTPAFSYFHHDDD-RNNPEPGFDSSRVPSFSQSRYMGSA  57

Query  258   ISLG-VGVARIPFQDRKFSPP----PWAMAPIWMRNMSTSVGEGMNKIEY---ISEVLSD  413
               +     +R PFQDR+F       P +   +  RNMST++G   +KI+Y   ++EVL+D
Sbjct  58    SGINSFSGSRNPFQDRRFCASGLMIPMSYGSLLTRNMSTNIGGEADKIDYMTDVAEVLAD  117

Query  414   KAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
             KAVEAV SQAP VNE+A+AAAD YLPV AL YL+DY+H  TG  WWASIV T+++IR LT
Sbjct  118   KAVEAVVSQAPAVNEMAIAAADCYLPVKALMYLMDYIHMFTGLEWWASIVATSIIIRLLT  177

Query  594   LPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             LP+MI QLK+TS+L LLRPK+++I++EMQN+GMAPAAV EGQQRM +L  E+ VS F+  
Sbjct  178   LPVMINQLKSTSQLTLLRPKMEEIKEEMQNKGMAPAAVAEGQQRMNELMKEHGVSMFTPL  237

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             +G+ IQGPIFVSFF+AI NMA+ VPS K GGAFWFTDLTTPDSMYI PVLTALTFWITVE
Sbjct  238   KGLLIQGPIFVSFFVAIRNMADNVPSLKHGGAFWFTDLTTPDSMYILPVLTALTFWITVE  297

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
             CNAQEG+EGNP+  TIKNVSRA AAL+IPFTA FPKA+FCYWITSN+FSLSYGLVIK   
Sbjct  298   CNAQEGLEGNPAGRTIKNVSRAFAALTIPFTAGFPKAIFCYWITSNLFSLSYGLVIKNHA  357

Query  1134  VKKLLGVPIIPPAPPRADQSSGLPFF  1211
             VKK LGVPIIP +PP+ +Q  G+PFF
Sbjct  358   VKKKLGVPIIPFSPPK-EQKPGVPFF  382



>ref|XP_006343861.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Solanum 
tuberosum]
Length=453

 Score =   464 bits (1195),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 242/388 (62%), Positives = 291/388 (75%), Gaps = 12/388 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK-PESSSENPRVLTHLRHCYFGN  254
             MAYRRS   TTRAKLLY QQR  P+ S+ H+DDDDRK  PE +  N R+ +  +  Y G+
Sbjct  1     MAYRRS--ITTRAKLLYQQQRVTPAFSYFHKDDDDRKSCPEPTFVNSRITSFSQSRYMGS  58

Query  255   RISLGVGV-ARIPFQDRKFSPP----PWAMAPIWMRNMSTSVGEGMNKIEYIS---EVLS  410
                +   + +R P+QDR+F       P +      RNMST +G G +KI Y++   EVL+
Sbjct  59    VSGVNSFIGSRSPYQDRRFCASGLMVPMSYGSSLTRNMSTDIGGGADKINYVTDVAEVLA  118

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
             DKAVEAV SQAP +NEVA+AAAD YLPV AL YLIDYVH  TGF WW SIV T+++IR  
Sbjct  119   DKAVEAVVSQAPALNEVAIAAADCYLPVKALMYLIDYVHIFTGFEWWGSIVATSIMIRLC  178

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
             TLP MI QLKATSKL LLRPKL+ I++EMQN+GM PAAV +GQ+RM++L  EY V+PF+ 
Sbjct  179   TLPFMINQLKATSKLTLLRPKLEVIKEEMQNKGMEPAAVADGQRRMQELMREYGVTPFTP  238

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +G+ IQGPIF+SFF+AI NM + VPS K GG FWFTDLTTPD MYI PVLTALTFWITV
Sbjct  239   LKGLLIQGPIFISFFMAIRNMVDTVPSLKMGGPFWFTDLTTPDDMYILPVLTALTFWITV  298

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             E NAQEG+EGNP+  TIKNVSR  AAL++P TASFPKA+FCYWITSN+FSLSYGLVIK  
Sbjct  299   ELNAQEGLEGNPAGKTIKNVSRGFAALTVPLTASFPKAIFCYWITSNLFSLSYGLVIKSH  358

Query  1131  KVKKLLGVPIIPPAPPRA-DQSSGLPFF  1211
              VKK LG+PIIP +PP + +Q   LPFF
Sbjct  359   AVKKALGIPIIPYSPPTSTEQKPALPFF  386



>ref|XP_009618996.1| PREDICTED: mitochondrial inner membrane protein OXA1 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009618997.1| PREDICTED: mitochondrial inner membrane protein OXA1 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009618998.1| PREDICTED: mitochondrial inner membrane protein OXA1 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009618999.1| PREDICTED: mitochondrial inner membrane protein OXA1 isoform 
X2 [Nicotiana tomentosiformis]
Length=446

 Score =   461 bits (1185),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 261/386 (68%), Positives = 300/386 (78%), Gaps = 14/386 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQR-FAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MAYRR+   TTRAK LY QQR   P+  + H  DDD+K  E   +NPR  T L+  Y  +
Sbjct  1     MAYRRN--LTTRAKFLYQQQRVITPAFCYPH--DDDKKTQEPICKNPRFSTFLQPHYVKS  56

Query  255   RISLGVGVARIPFQDRKFSPPP----WAMAPIWMRNMSTSV-GEGMNKIEYISEV--LSD  413
              I+  +   + PFQDR+F P       ++  ++ RNMS+SV G G  KIEYISEV  L+D
Sbjct  57    GIN-SLNGPKSPFQDRRFRPSQHMICMSLGSMFTRNMSSSVSGGGTEKIEYISEVAELAD  115

Query  414   KAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
             KAVE V SQ P VNEVAVAAA+SYLPV ALQYLIDYVH  TGF+WWASI+ TT++IR +T
Sbjct  116   KAVEVVTSQVPAVNEVAVAAAESYLPVQALQYLIDYVHIFTGFDWWASIIATTIIIRCIT  175

Query  594   LPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             LPLMI QLKATSKLAL++PKLD I QEMQ+RGMAPAAV EGQQ+MK   NEY VSPF+  
Sbjct  176   LPLMINQLKATSKLALVKPKLDAINQEMQDRGMAPAAVAEGQQKMKAAMNEYGVSPFTPL  235

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             +GI IQGPIFVSFF+AISNM EKVPSFK+GG  WFTDLTTPDSMYIFPVLTALTFWITVE
Sbjct  236   KGILIQGPIFVSFFMAISNMVEKVPSFKQGGVLWFTDLTTPDSMYIFPVLTALTFWITVE  295

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
             CNAQEG+EGN    TIKNVSRA AAL+IPFTA FPKAVFCYW+TSN+FSLSYGLVIK P 
Sbjct  296   CNAQEGLEGNAHAKTIKNVSRAFAALTIPFTAGFPKAVFCYWMTSNLFSLSYGLVIKNPA  355

Query  1134  VKKLLGVPIIPPAPPRADQSSGLPFF  1211
             VKKLL +PIIP +PP ++Q  GL FF
Sbjct  356   VKKLLRIPIIPVSPP-SEQKPGLSFF  380



>ref|XP_009618995.1| PREDICTED: mitochondrial inner membrane protein OXA1 isoform 
X1 [Nicotiana tomentosiformis]
Length=458

 Score =   461 bits (1185),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 261/387 (67%), Positives = 301/387 (78%), Gaps = 14/387 (4%)
 Frame = +3

Query  75    RMAYRRSSITTTRAKLLYDQQR-FAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFG  251
             +MAYRR+   TTRAK LY QQR   P+  + H  DDD+K  E   +NPR  T L+  Y  
Sbjct  12    QMAYRRN--LTTRAKFLYQQQRVITPAFCYPH--DDDKKTQEPICKNPRFSTFLQPHYVK  67

Query  252   NRISLGVGVARIPFQDRKFSPPP----WAMAPIWMRNMSTSV-GEGMNKIEYISEV--LS  410
             + I+  +   + PFQDR+F P       ++  ++ RNMS+SV G G  KIEYISEV  L+
Sbjct  68    SGIN-SLNGPKSPFQDRRFRPSQHMICMSLGSMFTRNMSSSVSGGGTEKIEYISEVAELA  126

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
             DKAVE V SQ P VNEVAVAAA+SYLPV ALQYLIDYVH  TGF+WWASI+ TT++IR +
Sbjct  127   DKAVEVVTSQVPAVNEVAVAAAESYLPVQALQYLIDYVHIFTGFDWWASIIATTIIIRCI  186

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
             TLPLMI QLKATSKLAL++PKLD I QEMQ+RGMAPAAV EGQQ+MK   NEY VSPF+ 
Sbjct  187   TLPLMINQLKATSKLALVKPKLDAINQEMQDRGMAPAAVAEGQQKMKAAMNEYGVSPFTP  246

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +GI IQGPIFVSFF+AISNM EKVPSFK+GG  WFTDLTTPDSMYIFPVLTALTFWITV
Sbjct  247   LKGILIQGPIFVSFFMAISNMVEKVPSFKQGGVLWFTDLTTPDSMYIFPVLTALTFWITV  306

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             ECNAQEG+EGN    TIKNVSRA AAL+IPFTA FPKAVFCYW+TSN+FSLSYGLVIK P
Sbjct  307   ECNAQEGLEGNAHAKTIKNVSRAFAALTIPFTAGFPKAVFCYWMTSNLFSLSYGLVIKNP  366

Query  1131  KVKKLLGVPIIPPAPPRADQSSGLPFF  1211
              VKKLL +PIIP +PP ++Q  GL FF
Sbjct  367   AVKKLLRIPIIPVSPP-SEQKPGLSFF  392



>ref|XP_011074390.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Sesamum 
indicum]
Length=433

 Score =   458 bits (1178),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 238/372 (64%), Positives = 288/372 (77%), Gaps = 9/372 (2%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSS---ENPRVLTHLRHCYF  248
             MAYRRS   T RAKLL+ Q R APS SH+ RDDDDR  P   S   +NP + ++ +H  F
Sbjct  1     MAYRRS--ITARAKLLHQQHRVAPSFSHVPRDDDDRGTPLHHSPISKNPEIPSNFQHRLF  58

Query  249   GNRISLGV-GVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEG-MNKIEYISEVLSDKAV  422
             G   ++G    +R  FQDR+F  P  A +P+++RNMS S+GEG  +KIE +++VL DKAV
Sbjct  59    GMGNNVGTFHRSRNLFQDRRFGIPA-ACSPVFVRNMS-SLGEGPADKIEIMTDVLGDKAV  116

Query  423   EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
             E  +   PV NEVAVAAADS+ PVAALQYLIDY+H  TGFNWWASIV  TLLIR + LPL
Sbjct  117   EVGSQVGPVANEVAVAAADSFFPVAALQYLIDYIHSFTGFNWWASIVLATLLIRGIQLPL  176

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             MI QLK+TSK  LLRP+L++I++EMQ+R  +P AV EGQ RMK+LF EY V+PF+  +GI
Sbjct  177   MINQLKSTSKFTLLRPRLEEIKEEMQSRSTSPDAVAEGQARMKELFKEYGVTPFTPLKGI  236

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
              I GPIF SFF A+ NMA  VPSFKEGG  WFTDLTTPDSMYI P+LTALTFWITVECNA
Sbjct  237   LISGPIFCSFFFAVRNMAVNVPSFKEGGTLWFTDLTTPDSMYILPILTALTFWITVECNA  296

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKK  1142
             QEG+EGNP+ GTIKN SR +AAL++PFTA+FPKA+FCYWITSN+FSL+YGL +K+P VKK
Sbjct  297   QEGLEGNPTAGTIKNFSRVLAALTVPFTATFPKAIFCYWITSNLFSLTYGLALKKPGVKK  356

Query  1143  LLGVPIIPPAPP  1178
              LGVPI+P A P
Sbjct  357   FLGVPILPKAQP  368



>ref|XP_011101043.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Sesamum 
indicum]
Length=436

 Score =   453 bits (1166),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 241/385 (63%), Positives = 289/385 (75%), Gaps = 12/385 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQ-RFAPSISHIHRDDDDRKKPESS--SENPRVLTHLRHCYF  248
             MAYRR    T RAK  Y QQ R APS SH+ RDD DR+   S+  S N  +  + +H + 
Sbjct  1     MAYRRG--VTARAKFFYQQQQRVAPSFSHVRRDDSDREDLNSNPISRNTEIRNYFQHRFL  58

Query  249   G--NRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMST-SVGEG-MNKIEYISEVLSDK  416
             G  N  S   G +R  F+DR+F  P     P++ RN S+ +VGEG ++KIE +++V+ D 
Sbjct  59    GTGNNFSAFNG-SRNLFKDRRFGIPA-GCGPVFSRNFSSGTVGEGAVDKIEILNDVV-DV  115

Query  417   AVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
               +      PVV+EVA  AADS+ PVAALQYLIDYVH  TGFNWWASIV TTLLIR + L
Sbjct  116   LGDKAVEVVPVVSEVAAVAADSFFPVAALQYLIDYVHTYTGFNWWASIVVTTLLIRSIQL  175

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PL+I QLK+TSK  LLRPKL+ I++EMQNR M+P AV EGQ +M+ LF EY V+PF+  +
Sbjct  176   PLLINQLKSTSKFTLLRPKLEAIKEEMQNREMSPNAVAEGQAQMQKLFKEYGVTPFTPLK  235

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             G+ I GPIF SFF A++N+AEKVPSFKEGGA WFTDLTTPDSMYIFPVLTALTFWITVEC
Sbjct  236   GLLISGPIFCSFFFAVNNLAEKVPSFKEGGALWFTDLTTPDSMYIFPVLTALTFWITVEC  295

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             NAQEG+EGNP+  TIKNVSRA AAL+IPFTASF KA+FCYWITSN+FSLSYGLVIK+P+V
Sbjct  296   NAQEGLEGNPTAHTIKNVSRAFAALTIPFTASFAKAIFCYWITSNLFSLSYGLVIKKPEV  355

Query  1137  KKLLGVPIIPPAPPRADQSSGLPFF  1211
             KK LG+PIIP  PP  +Q  GL FF
Sbjct  356   KKFLGIPIIPVTPPSTNQKPGLSFF  380



>emb|CDP12154.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   426 bits (1096),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 240/295 (81%), Gaps = 6/295 (2%)
 Frame = +3

Query  345   RNMSTSVGEGM-NKIEYISEV---LSDKAVEAVASQapvvnevavaaa-DSYLPVAALQY  509
             RNMSTS+GE    KI+YI++V   L+D  VEAV +QA  V      AA DS+LPVAALQY
Sbjct  9     RNMSTSIGEAAAEKIDYITDVADVLTDHTVEAVVTQAAPVVNEVAVAAADSFLPVAALQY  68

Query  510   LIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRG  689
             LIDYVH  TGFNWWASIV TT+LIRW+T+PLMI QLKATSK  LLRP+L++I++EM++RG
Sbjct  69    LIDYVHTFTGFNWWASIVVTTILIRWVTVPLMINQLKATSKFTLLRPRLEEIKEEMESRG  128

Query  690   MAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGA  869
             M+P AV+EGQQRMK LFNEY V+PF+  RG+  QGPIF+SFFLAI+NM EKVPSFKEGGA
Sbjct  129   MSPTAVSEGQQRMKQLFNEYGVTPFTPMRGLLFQGPIFISFFLAITNMVEKVPSFKEGGA  188

Query  870   FWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTA  1049
             FWF DLTTPDSMYIFPVLTALTFWITVECN QEGMEGNP+ GTIKNVSR  AAL+IPFTA
Sbjct  189   FWFVDLTTPDSMYIFPVLTALTFWITVECNMQEGMEGNPAAGTIKNVSRGFAALTIPFTA  248

Query  1050  SFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR-ADQSSGLPFF  1211
              F K +FCYWITSNIFSL YGLVIK P VKK LG+PIIP  PP   +Q     FF
Sbjct  249   GFAKGIFCYWITSNIFSLMYGLVIKNPAVKKALGIPIIPVTPPSPGEQKPAFSFF  303



>ref|XP_010261576.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Nelumbo 
nucifera]
Length=432

 Score =   411 bits (1057),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 217/382 (57%), Positives = 282/382 (74%), Gaps = 16/382 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKP---ESSSENPRVLTHLRHCYF  248
             MA RRS   ++R  LL  +QR+ PS ++I  DDD +++P     +S  P +   L+    
Sbjct  1     MACRRS--ISSRLTLL--RQRYHPSFAYIIHDDDGKRQPPPVTDASTRPAISNILQKQTG  56

Query  249   GNRISLGVGVARIPFQDR---KFSPPPWAMAPIWMRNMSTSVGEGMNKIEYIS---EVLS  410
              N I+         FQ +    FS PP    P + R+MS+++GEG +KIEYIS   E+L+
Sbjct  57    VNNINKASAWFETRFQVKGLSSFSLPP-GFGPSFCRHMSSTIGEGSDKIEYISDVAEILT  115

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
             +K+V+   +Q P V+EVA+AAADS+ PVAALQYLID +H  TG NWWASI  TT+LIR  
Sbjct  116   EKSVDV--AQVPAVSEVAIAAADSFYPVAALQYLIDGIHSFTGLNWWASIALTTILIRGA  173

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
             T+PL+I QLKATSKL L+RP+L++IRQ+MQ+  M P AV EGQ+RMK +F EY V+PF+ 
Sbjct  174   TIPLLINQLKATSKLTLMRPRLEEIRQQMQDMEMDPKAVAEGQKRMKAIFREYGVTPFTP  233

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +G+FIQGP+F+SF+LAISNM EKVPSFK GGAFWFTDLTTPD++YIFPVLT+LTF ITV
Sbjct  234   LKGLFIQGPVFISFYLAISNMVEKVPSFKGGGAFWFTDLTTPDNLYIFPVLTSLTFLITV  293

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             ECN QEG+EGNP+ GT+KN SR +A  +IPFT +FPKA+FCYW+TSN+FSL+YGLV+K P
Sbjct  294   ECNMQEGLEGNPAAGTMKNFSRILAVFTIPFTMNFPKAIFCYWVTSNLFSLTYGLVLKSP  353

Query  1131  KVKKLLGVPIIPPAPPRADQSS  1196
              VK+ LG+P +P  PP   QSS
Sbjct  354   SVKEFLGLPKMPVPPPTTTQSS  375



>gb|EYU23348.1| hypothetical protein MIMGU_mgv1a018646mg, partial [Erythranthe 
guttata]
Length=383

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 222/381 (58%), Positives = 282/381 (74%), Gaps = 13/381 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRF-APSISHIHRDDDDRKKPESSS----ENPRVLTHLRHC  242
             MAYRRS   T+RAK  Y QQ+  AP +S+IHRDD DR++  S+      N     ++++ 
Sbjct  1     MAYRRS--ITSRAKQFYQQQQIIAPPLSNIHRDDADREESRSNPFPFPANHETRNYIQNR  58

Query  243   YFGNRI--SLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTS-VGEGM-NKIEYISEVLS  410
             +FG  I  S     +R  F+D +F+ P      +++R+ S++ +G G  + IE++++ ++
Sbjct  59    FFGGGINNSSSFNGSRNVFRDWRFAAPAGFGGSVFVRDFSSAGIGGGAADNIEFLND-MA  117

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
                VE  A  AP VNEVA+AAADS+ PVAALQYLI+Y+H  TGF+WWASIV TTLLIR L
Sbjct  118   GIFVEKAAEVAPAVNEVAIAAADSFYPVAALQYLIEYIHISTGFHWWASIVVTTLLIRTL  177

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
              LPL++ QLKATSK  LLRPKL+ I++EM N  M+P+ V +GQ RMK LF E+ V+PF+ 
Sbjct  178   QLPLILHQLKATSKFTLLRPKLEAIKEEMNNGDMSPSTVADGQARMKKLFKEHGVTPFTP  237

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +GI I  PIF SFF AI NMAEKVPSFK+GGAFWF DLT PD+MYIFPVLTALTFWITV
Sbjct  238   LKGILITAPIFCSFFFAIRNMAEKVPSFKDGGAFWFMDLTAPDTMYIFPVLTALTFWITV  297

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             ECNAQEG+EGNP+ GTIK VSR  AAL++PFTASFP+AVFCYWITSN+FSL+YGL++K  
Sbjct  298   ECNAQEGLEGNPTAGTIKIVSRVFAALTVPFTASFPQAVFCYWITSNLFSLTYGLIVKNH  357

Query  1131  KVKKLLGVPIIPPAP-PRADQ  1190
             KVK LLG+PII  AP P +D 
Sbjct  358   KVKNLLGIPIITVAPTPASDN  378



>gb|KDP45027.1| hypothetical protein JCGZ_01527 [Jatropha curcas]
Length=440

 Score =   410 bits (1053),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 226/377 (60%), Positives = 279/377 (74%), Gaps = 20/377 (5%)
 Frame = +3

Query  81    AYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCY-----  245
             AY RS   +TRA L+  Q +F  S S+I   DDDRK+  S  E P  L  +         
Sbjct  3     AYIRS--LSTRANLVRRQCQF--SFSYILHHDDDRKR-NSIDEGPLPLRGMSSSSLQQRG  57

Query  246   ----FGNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV---  404
                 F N  S   G ++   +  +FS  P ++   ++R MST++GEG  K+E +S+V   
Sbjct  58    FASGFINNSSKYSGFSQERRRCSEFSLSP-SIGASFLRYMSTTIGEGSEKLELMSDVADV  116

Query  405   LSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIR  584
             L+D  V+AVA+  P VNEVAVAAADS+ PVA LQ++ID VH  TGFNWWASI+ TTLLIR
Sbjct  117   LTDTTVQAVAN--PAVNEVAVAAADSFFPVAILQHVIDNVHSFTGFNWWASIILTTLLIR  174

Query  585   WLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPF  764
               T+PL+I QLKATSKL L+RP+L++I+Q+MQ++GM PA V EGQ++MK LFNEY VSPF
Sbjct  175   GATVPLLINQLKATSKLTLMRPRLEEIKQQMQDKGMDPATVAEGQKQMKLLFNEYGVSPF  234

Query  765   SAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWI  944
             +  +G+FIQGP+F+SFFLAISNM EKVPSFK GGAFWF DLTTPDS+YIFP+LTALTFWI
Sbjct  235   TPLKGLFIQGPVFISFFLAISNMVEKVPSFKTGGAFWFVDLTTPDSLYIFPILTALTFWI  294

Query  945   TVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIK  1124
             TVECN QEGMEGNP+ GT+KNVSR +AA+SIP T SFPKA+FCYWITSN+FSL YGLV+K
Sbjct  295   TVECNMQEGMEGNPAAGTMKNVSRVLAAVSIPLTMSFPKAIFCYWITSNLFSLFYGLVLK  354

Query  1125  RPKVKKLLGVPIIPPAP  1175
              P VKK LG+P IP  P
Sbjct  355   VPGVKKTLGIPKIPVPP  371



>ref|XP_010274444.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Nelumbo nucifera]
Length=423

 Score =   409 bits (1050),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 221/376 (59%), Positives = 276/376 (73%), Gaps = 17/376 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MA+RRS   + R  LL  +QRF PS S+I  DDD + +P ++      LT     YF   
Sbjct  1     MAFRRS--ISFRVTLL--RQRFHPSFSYILHDDDRKCQPPAADP----LTRPAASYFLEE  52

Query  258   ISLGVGVARIPFQDRKFSPPPW--AMAPIWMRNMSTSVGEGMNKIEYI---SEVLSDKAV  422
              +    +  + FQD++FS       + P   R+MS++VG G +K EYI   ++VL++K V
Sbjct  53    GTYNSNI-NLKFQDKRFSSLYLLPGIGPSLCRHMSSTVGGGSDKFEYINDVADVLTEKGV  111

Query  423   EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
             E   +Q P V+EVA+AAADS+ PVAALQYLID VH  TG +WWASI  TT+LIR  T+PL
Sbjct  112   EV--AQVPSVSEVAIAAADSFYPVAALQYLIDGVHSFTGLHWWASIALTTILIRGATVPL  169

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             +I QLKATSKL L+RP L++I+Q++ +  M P AV EGQ+RMK LF EY VSPF+ F+G+
Sbjct  170   LINQLKATSKLTLMRPHLEEIKQQI-DMAMDPKAVTEGQKRMKALFKEYGVSPFTPFKGL  228

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
             FIQGPIF+SFF AISNMAEKVPSFK GGAFWFTDLTTPDS+YIFP+LT+L F ITVECN 
Sbjct  229   FIQGPIFISFFTAISNMAEKVPSFKGGGAFWFTDLTTPDSLYIFPILTSLIFLITVECNM  288

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKK  1142
             QEGMEGN   GT+KNVSR +A L+IPFT SFPKA+FCYW+TSN+FSL YGLV+KRP VK+
Sbjct  289   QEGMEGNSVAGTMKNVSRVLAVLTIPFTMSFPKAIFCYWVTSNLFSLMYGLVLKRPSVKE  348

Query  1143  LLGVPIIPPAPPRADQ  1190
              LG+P +P APP A Q
Sbjct  349   FLGLPKLPAAPPSATQ  364



>gb|KDO76531.1| hypothetical protein CISIN_1g0137752mg [Citrus sinensis]
Length=436

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 214/384 (56%), Positives = 278/384 (72%), Gaps = 11/384 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK-PESSSENPRVLTHLRHCYFGN  254
             MAYRRS   TTRA L+   + + PS ++I  D D ++K P+ +     + + ++   FGN
Sbjct  1     MAYRRS--LTTRATLI--ARAYNPSFNYIIYDHDHKQKSPDETLSRTNIHSFIQSRSFGN  56

Query  255   RISLGVGVARIPFQDR--KFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV---LSDKA  419
              ++   G+       R  +FS  P ++   + R MST+VGEG +KIE IS+V    ++  
Sbjct  57    SLNNSYGLGNFFHGQRVSQFSLVP-SVGSAFCRYMSTTVGEGADKIELISDVADVFTETT  115

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             V+A+A+QAP VNEVA+AAADS+LPVAALQ+ ID +H  TGFNWWASI+ TTLLIR  T+P
Sbjct  116   VQAIANQAPAVNEVAIAAADSFLPVAALQHFIDAMHNFTGFNWWASIIVTTLLIRTATVP  175

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L+I QLK+TSKL L+RP+L++I+Q+MQ++ M P AV +GQ+RM++LF EY V P +  +G
Sbjct  176   LLINQLKSTSKLTLMRPRLEEIKQDMQDKAMDPMAVADGQKRMQNLFKEYGVHPLTPLKG  235

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             +FIQGP+F+SFFLAISNMAEKVPSFK GGAFWFTDL+TPDS YI P+LT L+F ITVECN
Sbjct  236   LFIQGPVFISFFLAISNMAEKVPSFKNGGAFWFTDLSTPDSFYILPILTGLSFLITVECN  295

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              QEG+EGNP+  T+KN+SR  A LSIP T +FPKA+FCYWITSN FSL YGLV+K P VK
Sbjct  296   MQEGLEGNPAAVTMKNISRGFAVLSIPLTMTFPKAIFCYWITSNFFSLVYGLVLKVPGVK  355

Query  1140  KLLGVPIIPPAPPRADQSSGLPFF  1211
             K+LGVP IP      D       F
Sbjct  356   KMLGVPEIPVVQQTTDPKPSFSLF  379



>gb|EYU40017.1| hypothetical protein MIMGU_mgv1a008726mg [Erythranthe guttata]
Length=364

 Score =   400 bits (1029),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 215/355 (61%), Positives = 265/355 (75%), Gaps = 12/355 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPR---VLTHLRHCYF  248
             MA+RRS   T RAKLLY   R A    HIH+DD+D++ P  ++       +   L+ C F
Sbjct  1     MAFRRS--ITARAKLLYQHPRAAAPFPHIHQDDNDQQNPNPNNPISNNPVISNQLQRCLF  58

Query  249   GNRISLGVGV-ARIPFQDRKFSPPPWAMAPIWMRNMSTSVGE----GMNKIEYISEVLSD  413
             G   +LG    +R  F DR+F+ P     P++ RNMS S+GE     +  +  ++EV  D
Sbjct  59    GTGNNLGGSYRSRNLFHDRRFAIPAGCGPPVFSRNMS-SIGERPSENIEIMTDMAEVFGD  117

Query  414   KAVEAVASQap-vvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
             K VE  +SQ   V NEVA+AAADS++PVAALQYLIDYVHC TGFNWWASIV TT+LIRW+
Sbjct  118   KVVEVASSQVGPVANEVALAAADSFMPVAALQYLIDYVHCYTGFNWWASIVVTTILIRWI  177

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
              LPLMI  LK+TSK  LLRP+L++I+++MQ+R M+PAAV EGQ+RMK LF EY V+P + 
Sbjct  178   QLPLMINTLKSTSKFTLLRPRLEEIKEDMQSRDMSPAAVAEGQERMKKLFKEYGVTPLTP  237

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +G+ I GPIF  FFLA+ NMAE VPSFKEGGAFWFTDLTTPD+MYIFP+LTALTFWITV
Sbjct  238   LKGLLITGPIFFCFFLAVRNMAENVPSFKEGGAFWFTDLTTPDTMYIFPILTALTFWITV  297

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGL  1115
             ECN Q+GMEGNP+ GTIKNVSR  A L++PFTA FPKA+FCYWITSN+FSL+YGL
Sbjct  298   ECNTQDGMEGNPTAGTIKNVSRVFAVLTVPFTAMFPKAIFCYWITSNLFSLAYGL  352



>ref|XP_006476388.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Citrus 
sinensis]
Length=436

 Score =   402 bits (1032),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 211/369 (57%), Positives = 274/369 (74%), Gaps = 11/369 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MAYRRS   TTRA L+   + + PS ++I +  D  +  P+ +     + + ++   FGN
Sbjct  1     MAYRRS--LTTRATLI--ARAYNPSFNYIIYEHDHKQNSPDETLSRTNIHSFIQSRSFGN  56

Query  255   RISLGVGVARIPFQDR--KFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV---LSDKA  419
              ++   G+       R  +FS  P ++   + R MST+VGEG +KIE IS+V    ++  
Sbjct  57    SLNNSYGLGNFFHGQRVSQFSLVP-SVGSAFCRYMSTTVGEGADKIELISDVADVFTETT  115

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             V+AVA+QAP VNEVA+AAADS+LPVAALQ+ ID +H  TGFNWWASI+ TTLLIR  T+P
Sbjct  116   VQAVANQAPAVNEVAIAAADSFLPVAALQHFIDAMHNFTGFNWWASIIVTTLLIRTATVP  175

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L+I QLK+TSKL L+RP+L++I+Q+MQ++ M P AV +GQ+RM++LF EY V P +  +G
Sbjct  176   LLINQLKSTSKLTLMRPRLEEIKQDMQDKAMDPMAVADGQKRMQNLFKEYGVHPLTPLKG  235

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             +FIQGP+F+SFFLAISNMAEKVPSFK GGAFWFTDL+TPDS YI P+LT L+F ITVECN
Sbjct  236   LFIQGPVFISFFLAISNMAEKVPSFKNGGAFWFTDLSTPDSFYILPILTGLSFLITVECN  295

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              QEG+EGNP+  T+KN+SR  A LSIP T +FPKA+FCYWITSN FSL YGLV+K P VK
Sbjct  296   MQEGLEGNPAAVTMKNISRGFAVLSIPLTMTFPKAIFCYWITSNFFSLVYGLVLKVPGVK  355

Query  1140  KLLGVPIIP  1166
             K+LGVP IP
Sbjct  356   KMLGVPEIP  364



>ref|XP_006439353.1| hypothetical protein CICLE_v10020194mg [Citrus clementina]
 gb|ESR52593.1| hypothetical protein CICLE_v10020194mg [Citrus clementina]
Length=436

 Score =   402 bits (1032),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 211/376 (56%), Positives = 277/376 (74%), Gaps = 11/376 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK-PESSSENPRVLTHLRHCYFGN  254
             MAYRRS   TTRA L+   + + PS ++I  D D ++K P+ +     + + ++   FG+
Sbjct  1     MAYRRS--LTTRATLI--ARAYNPSFNYIIYDHDHKQKSPDETLSRTNIHSFIQSRSFGS  56

Query  255   RISLGVGVARIPFQDR--KFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV---LSDKA  419
              ++   G+       R  +FS  P ++   + R MST+VGEG +KIE IS+V    ++  
Sbjct  57    SLNNSYGLGNFFHSQRVSQFSLVP-SVGSAFCRYMSTTVGEGADKIELISDVADVFTETT  115

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             V+A+A+QAP VNEVA+AAADS+LPVAALQ+ ID +H  TGFNWWASI+ TTLLIR  T+P
Sbjct  116   VQAIANQAPAVNEVAIAAADSFLPVAALQHFIDAMHNFTGFNWWASIIVTTLLIRTATVP  175

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L+I QLK+TSKL L+RP+L++I+Q+MQ++ M P AV +GQ++M++LF EY V P +  +G
Sbjct  176   LLINQLKSTSKLTLMRPRLEEIKQDMQDKAMDPMAVADGQKQMQNLFKEYGVHPLTPLKG  235

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             +FIQGP+F+SFFLAISNMAEKVPSFK GGAFWFTDL+TPDS YI P+LT L+F ITVECN
Sbjct  236   LFIQGPVFISFFLAISNMAEKVPSFKNGGAFWFTDLSTPDSFYILPILTGLSFLITVECN  295

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              QEG+EGNP+  T+KN+SR  A LSIP T +FPKA+FCYWITSN FSL YGLV+K P VK
Sbjct  296   MQEGLEGNPAAVTMKNISRGFAVLSIPLTMTFPKAIFCYWITSNFFSLVYGLVLKVPGVK  355

Query  1140  KLLGVPIIPPAPPRAD  1187
             K+LGVP IP      D
Sbjct  356   KMLGVPEIPVVQQTTD  371



>ref|XP_008239037.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Prunus 
mume]
 ref|XP_008239038.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Prunus 
mume]
Length=436

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 210/377 (56%), Positives = 267/377 (71%), Gaps = 16/377 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHL--RHCYFG  251
             MAY RS   +TRA     +++  PSI+HI +DDD +    S   +   L H   +  +FG
Sbjct  1     MAYWRS--LSTRASFTARRRQNHPSITHILQDDDRKHDFVSEQASSPNLNHFLSQKRFFG  58

Query  252   N---RISLGVGVARIPFQDRKFSPPPWAMAPIWM--RNMSTSVGEGMNKIEYISEV---L  407
             N   RIS   G A    QDR+ S    +    +   R MST++G G +K+E +S+V   +
Sbjct  59    NNLSRISGSGGFA----QDRRISNALLSSGSGFACSRYMSTAIGGGSDKVELLSDVSGVV  114

Query  408   SDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRW  587
             SD  + AVASQ   ++E+A+A ADS+LPV ALQYLI  VH  TG NWWA+I  TTLLIR 
Sbjct  115   SDATMGAVASQVSAMSEIAIATADSWLPVKALQYLIGSVHTYTGLNWWAAIAITTLLIRM  174

Query  588   LTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFS  767
              T+P++I QLKA SKLAL++P+L++ RQEMQ++GM   AV E Q++   L+ EY V P S
Sbjct  175   ATVPILINQLKAMSKLALMKPQLEEYRQEMQDKGMGREAVAEFQKKTGKLYKEYGVHPLS  234

Query  768   AFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWIT  947
             A +GIF+Q P+F+SFFLAISNMAEKVPSFK GGA+WF DLTTPDSMYIFPVL ALTF +T
Sbjct  235   AMKGIFVQAPVFISFFLAISNMAEKVPSFKSGGAYWFLDLTTPDSMYIFPVLAALTFLLT  294

Query  948   VECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKR  1127
             VECN QEGMEGNP+ GT+KNVSR +A L++PFT SFPKAVFCYW+TSN+FSL YGLV+K 
Sbjct  295   VECNLQEGMEGNPAAGTMKNVSRGLAVLTVPFTMSFPKAVFCYWVTSNLFSLGYGLVLKY  354

Query  1128  PKVKKLLGVPIIPPAPP  1178
               +KK LG+P +P  PP
Sbjct  355   SGLKKALGIPQLPSTPP  371



>ref|XP_004505010.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Cicer 
arietinum]
Length=427

 Score =   397 bits (1020),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 211/371 (57%), Positives = 274/371 (74%), Gaps = 13/371 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MAYRR  +   R  L+   +R  PS S++ H D+  R++P+    +  +   ++   FG+
Sbjct  1     MAYRRCLLQ--RGNLI--DRRCHPSFSYVFHSDEGKREQPDEKPSSTGINNFIQRRSFGS  56

Query  255   RISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEY---ISEVLSDKAVE  425
              ++  +G       +R  SP        + RNMSTS  +G +KI     +++VLSD  +E
Sbjct  57    SLNGSMGFFSSS-HNRILSP---YAGYNFCRNMSTS-DQGSDKIGIMTDVADVLSDTTLE  111

Query  426   AVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLM  605
             AV+SQAPVV+EVA+AAADSYLPV ALQY ID VH  TG NWWASIV TTLLIR  T+PL+
Sbjct  112   AVSSQAPVVSEVAIAAADSYLPVQALQYAIDAVHSFTGLNWWASIVLTTLLIRSATIPLL  171

Query  606   IQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIF  785
             + QLKATSKL L+RP+L++I++++  + M P AV EGQ++MK LF EY V+PF+  +G+F
Sbjct  172   VNQLKATSKLTLMRPRLEEIKEQLDGKTMDPEAVEEGQKKMKKLFKEYGVTPFTPLKGLF  231

Query  786   IQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQ  965
             IQGP+F+SFFLAI+NMAEK+PSFK GGAFWFTDLTTPD++YIFPV+TAL+F I VECN Q
Sbjct  232   IQGPVFISFFLAITNMAEKMPSFKHGGAFWFTDLTTPDALYIFPVITALSFLIVVECNMQ  291

Query  966   EGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKL  1145
             EGMEGNP  GT+KN SR +A LS+PFT SFPKA+FCYWITSN+FSLSYG+V+K P VKK 
Sbjct  292   EGMEGNPVAGTMKNFSRVLALLSVPFTMSFPKAIFCYWITSNLFSLSYGMVLKVPGVKKT  351

Query  1146  LGVPIIPPAPP  1178
             LG+P +P APP
Sbjct  352   LGIPDLPAAPP  362



>ref|XP_007209155.1| hypothetical protein PRUPE_ppa005941mg [Prunus persica]
 gb|EMJ10354.1| hypothetical protein PRUPE_ppa005941mg [Prunus persica]
Length=436

 Score =   397 bits (1019),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 210/377 (56%), Positives = 267/377 (71%), Gaps = 16/377 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHL--RHCYFG  251
             MAY RS   +TRA     +++  PSI+HI  DDD +    S   +   L H   +  +FG
Sbjct  1     MAYWRS--LSTRASFTARRRQNHPSITHILHDDDRKHDVVSEQASSPNLNHFLSQKRFFG  58

Query  252   N---RISLGVGVARIPFQDRKFSPPPWAMAPIWM--RNMSTSVGEGMNKIEYISEV---L  407
             N   RIS   G A     DR+ S    + +  +   R MST++G G +K+E +S+V   +
Sbjct  59    NNLGRISGFGGFA----PDRRISNALLSSSSGFACSRYMSTAIGGGSDKVELLSDVSGVV  114

Query  408   SDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRW  587
             SD  +EAVASQ   ++E+A+A ADS+LPV ALQYLI  VH  TG NWWA+I  TTLLIR 
Sbjct  115   SDATMEAVASQVSAMSEIAIATADSWLPVKALQYLIGSVHTYTGLNWWAAIAITTLLIRT  174

Query  588   LTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFS  767
              T+P++I QLKA SKLAL++P+L++ RQEMQ++GM   AV E Q++   L+ EY V P S
Sbjct  175   ATVPILINQLKAMSKLALMKPQLEEYRQEMQDKGMGREAVAEFQKKTGKLYKEYGVHPLS  234

Query  768   AFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWIT  947
             A +GIF+Q P+F+SFFLAISNMAEKVPSFK GGA+WF DLTTPDSMYIFPVL ALTF +T
Sbjct  235   AMKGIFVQAPVFISFFLAISNMAEKVPSFKSGGAYWFLDLTTPDSMYIFPVLAALTFLLT  294

Query  948   VECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKR  1127
             VECN QEGMEGNP+ GT+KNVSR +A L++PFT SFPKAVFCYW+TSN+FSL YGLV+K 
Sbjct  295   VECNLQEGMEGNPAAGTMKNVSRGLAVLTVPFTMSFPKAVFCYWVTSNMFSLGYGLVLKY  354

Query  1128  PKVKKLLGVPIIPPAPP  1178
               +KK LG+P +P  PP
Sbjct  355   SGLKKALGIPRLPSTPP  371



>ref|XP_007040516.1| Inner membrane protein isoform 1 [Theobroma cacao]
 gb|EOY25017.1| Inner membrane protein isoform 1 [Theobroma cacao]
Length=433

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 210/383 (55%), Positives = 262/383 (68%), Gaps = 13/383 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MA+ RS   + RA L+   +R+ PS +++ H DD   +    S    +    ++H YFG 
Sbjct  1     MAFSRS--LSNRATLI--ARRYRPSFAYVLHEDDRKNQSLNESQSQEKPGNFVQHRYFGT  56

Query  255   RISLGVGVARIPFQDRKFSP----PPWAMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAV  422
               S       + FQDR  S     P   M+  + R MST++G G +     S +    A 
Sbjct  57    GFSNSSSGFGVLFQDRICSQLSLHPSSGMS--FCRYMSTTIGGGADMSAAASAINGGGAD  114

Query  423   EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
              + A+ A     +A A  DS+  VAALQ++ID VH  TGF WWASIV TTLLIR  T+PL
Sbjct  115   MSAAASAVNEVAIAAA--DSWFLVAALQHVIDTVHSFTGFPWWASIVVTTLLIRGATIPL  172

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             +I QLKATSK  LLRP+L++I+++MQ++GM P  V EGQ+ MK LFNEY V+PFS  +G+
Sbjct  173   LINQLKATSKFTLLRPRLEEIKEQMQSKGMDPLTVAEGQKEMKKLFNEYGVTPFSPMKGL  232

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
             FIQGPIF+SFFLAISNMAEKVPSFK GGA+WF DLTTPD +YI PVLTAL+F ITVECN 
Sbjct  233   FIQGPIFISFFLAISNMAEKVPSFKCGGAYWFMDLTTPDDLYILPVLTALSFLITVECNM  292

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKK  1142
             QEGMEGNP+ GTIKNVSR +AAL++PFT SFPKA+FCYWITSN+FSL+YGLV+K P VKK
Sbjct  293   QEGMEGNPAAGTIKNVSRVLAALTVPFTMSFPKAIFCYWITSNLFSLTYGLVLKAPGVKK  352

Query  1143  LLGVPIIPPAPPRADQSSGLPFF  1211
              LGVP IP  PP A Q   +  F
Sbjct  353   ALGVPEIPKPPPGAAQKPSVDLF  375



>ref|XP_010055864.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Eucalyptus 
grandis]
 ref|XP_010055865.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Eucalyptus 
grandis]
 gb|KCW72410.1| hypothetical protein EUGRSUZ_E00860 [Eucalyptus grandis]
Length=438

 Score =   391 bits (1005),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 214/389 (55%), Positives = 276/389 (71%), Gaps = 16/389 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHL-RHCYFG  251
             MA+R S     R+ L+   QR+  S ++I HRD+D          N  +L ++ +   F 
Sbjct  1     MAFRHS--LCKRSGLV--AQRYRASFTYIPHRDEDHGGNTLDVDANQGMLNNVSQRRSFT  56

Query  252   NRISLGVGVARIPFQDRKFSPPPWAMAPIWM------RNMSTSVGEGMNKIEYISEV---  404
             N ++   G+    F+    S     +    +      R+MST+VGE  +KIE IS+V   
Sbjct  57    NNVNKSAGLGAF-FKSGSCSARSSLLFSSSIGISSFHRHMSTTVGESADKIELISDVAEA  115

Query  405   LSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIR  584
             ++D  ++AVASQAP V+EVAVAAADSYLPV ALQY+IDYVH  TG NWWASIV TTLLIR
Sbjct  116   ITDTTIQAVASQAPAVSEVAVAAADSYLPVQALQYVIDYVHQFTGLNWWASIVVTTLLIR  175

Query  585   WLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPF  764
              +T+PL+I QLK+T+KL++++P++++I+ EM  +GM P AV EGQ++MK LFNE  VSPF
Sbjct  176   TVTIPLLINQLKSTTKLSIIKPRMEEIKAEMDAKGMDPIAVAEGQRKMKQLFNESGVSPF  235

Query  765   SAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWI  944
             +  +GIFIQGPIF+SFFLA+SNMAEKVPSFK GGA+WFTDLTTPD++Y+FPVLT LTF I
Sbjct  236   TPLKGIFIQGPIFISFFLAVSNMAEKVPSFKTGGAYWFTDLTTPDALYVFPVLTGLTFLI  295

Query  945   TVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIK  1124
             TVE NAQEGMEGNP  GT+KNV RA A L++PFTASFPKA+FCYWIT+N FSL YGLV+K
Sbjct  296   TVESNAQEGMEGNPMAGTMKNVFRAFAVLTVPFTASFPKAIFCYWITTNFFSLVYGLVLK  355

Query  1125  RPKVKKLLGVPIIPPAPPRADQSSGLPFF  1211
                 KK++GVP +P A   A +      F
Sbjct  356   HTSFKKIVGVPELPVALKPAQKQPAFSIF  384



>ref|XP_010087269.1| Mitochondrial inner membrane protein OXA1 [Morus notabilis]
 gb|EXB28671.1| Mitochondrial inner membrane protein OXA1 [Morus notabilis]
Length=518

 Score =   391 bits (1005),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 215/383 (56%), Positives = 275/383 (72%), Gaps = 27/383 (7%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPES---SSENPRVLTHLRHCYF  248
             MAYRRS   +TRA +   Q    PS+ H+  DDD ++ P S   SS+N   L   R   F
Sbjct  1     MAYRRS--LSTRATITARQCH--PSVGHLVHDDDRKQNPVSESVSSQNWNSLLQKR--LF  54

Query  249   GNRIS-LGVGVARIPFQDRKFSPP---PWAMAPIWMRNMSTSVGEGMNK---IEYISEVL  407
             GN +  LG+G +    QDR+FS     P   +  + R MST++GE  +K   +  ++EV+
Sbjct  55    GNEVGKLGLGFS----QDRRFSSALASPSNSSFAFCRYMSTTIGEDSDKFGIMSDVAEVI  110

Query  408   SDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRW  587
             SD  V+AVASQ P VNEVA+AAADS+LPV  LQYLI+ VH   G +WW +I  TTLLIR 
Sbjct  111   SDSTVQAVASQVPQVNEVAIAAADSFLPVKLLQYLIEGVHTFVGVDWWLAIALTTLLIRT  170

Query  588   LTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVN--EGQQRMKDLFNEYKVSP  761
              T+PL+I QLK+TSKL+L+RP+L++I++++        AVN  EGQ++M DLF EY V+P
Sbjct  171   STVPLLINQLKSTSKLSLMRPRLEEIKRQIDE-----GAVNQIEGQRQMSDLFKEYGVTP  225

Query  762   FSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFW  941
             F+  +G+FIQGPIF+SFFLA+SNMAEKVPSFK GGA+WF DLTTPD++YIFPVLTALTF 
Sbjct  226   FTPLKGLFIQGPIFISFFLAVSNMAEKVPSFKTGGAYWFVDLTTPDALYIFPVLTALTFL  285

Query  942   ITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVI  1121
             ITVECN QEG+EGNP   T+KNVSR +A L++PFT SFPKA+FCYWITSN+FSL YGL +
Sbjct  286   ITVECNMQEGLEGNPVAATMKNVSRGIAVLTVPFTMSFPKAIFCYWITSNLFSLVYGLAL  345

Query  1122  KRPKVKKLLGVPIIPPAPPRADQ  1190
             K+P+VKK LG+P IP   P   Q
Sbjct  346   KKPQVKKFLGIPEIPVTQPSTTQ  368



>ref|XP_010274445.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Nelumbo nucifera]
Length=408

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 215/376 (57%), Positives = 264/376 (70%), Gaps = 32/376 (9%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MA+RRS   + R  LL  +QRF PS S+I  DDD + +P ++      LT     YF   
Sbjct  1     MAFRRS--ISFRVTLL--RQRFHPSFSYILHDDDRKCQPPAADP----LTRPAASYFLEE  52

Query  258   ISLGVGVARIPFQDRKFSPPPW--AMAPIWMRNMSTSVGEGMNKIEYI---SEVLSDKAV  422
              +    +  + FQD++FS       + P   R+MS++VG G +K EYI   ++VL++K V
Sbjct  53    GTYNSNI-NLKFQDKRFSSLYLLPGIGPSLCRHMSSTVGGGSDKFEYINDVADVLTEKGV  111

Query  423   EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
             E   +Q P V+EVA+AAADS+ PVAALQYLID VH  TG +WWASI  TT+LIR  T+PL
Sbjct  112   EV--AQVPSVSEVAIAAADSFYPVAALQYLIDGVHSFTGLHWWASIALTTILIRGATVPL  169

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             +I QLKATSKL  + PK                AV EGQ+RMK LF EY VSPF+ F+G+
Sbjct  170   LINQLKATSKLTAMDPK----------------AVTEGQKRMKALFKEYGVSPFTPFKGL  213

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
             FIQGPIF+SFF AISNMAEKVPSFK GGAFWFTDLTTPDS+YIFP+LT+L F ITVECN 
Sbjct  214   FIQGPIFISFFTAISNMAEKVPSFKGGGAFWFTDLTTPDSLYIFPILTSLIFLITVECNM  273

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKK  1142
             QEGMEGN   GT+KNVSR +A L+IPFT SFPKA+FCYW+TSN+FSL YGLV+KRP VK+
Sbjct  274   QEGMEGNSVAGTMKNVSRVLAVLTIPFTMSFPKAIFCYWVTSNLFSLMYGLVLKRPSVKE  333

Query  1143  LLGVPIIPPAPPRADQ  1190
              LG+P +P APP A Q
Sbjct  334   FLGLPKLPAAPPSATQ  349



>ref|XP_008451946.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Cucumis 
melo]
 ref|XP_008451947.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Cucumis 
melo]
 ref|XP_008451948.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Cucumis 
melo]
Length=449

 Score =   386 bits (992),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 209/374 (56%), Positives = 266/374 (71%), Gaps = 16/374 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK--PESSSENPRVLTHLRHCYFG  251
             MAYRRS    TR  L+  Q  + PSIS   + DD +K+   E S  + R+ + L+   FG
Sbjct  1     MAYRRS--LCTRGNLIARQ--YHPSISVFGQTDDRKKQHLDEDSISHDRINSFLQRRSFG  56

Query  252   NRISLGVGVARIPFQDRKFSPPPWAMAP----IWMRNMSTSVGEGMNKIEYIS---EVLS  410
                +     +R  F D     P   ++P     + R MS+++GEG   IE++S   EVL+
Sbjct  57    TSFNKS---SRSNFFDIDRKYPNTFISPSAGSFFCRYMSSTIGEGSENIEFMSNVAEVLT  113

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
             D  V++ ASQA   NEVA+AAADS+LPV  +QY ID +H  TG NWWA IV TTLLIR  
Sbjct  114   DTTVQSAASQAAAANEVALAAADSFLPVKGVQYFIDAIHSFTGLNWWACIVLTTLLIRGA  173

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
             T PL+I QLK+T+KL LLRP L+++++EMQ +GM P AV EGQQ+MK+LFNE+ VSPF+ 
Sbjct  174   TFPLLINQLKSTAKLTLLRPHLEEVKKEMQEKGMDPRAVAEGQQKMKNLFNEFGVSPFTP  233

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +G+FIQGP+F+SFFLA+SNMAEK+PSFK GGA+WF DLTTPD+MY+FPVLTALTFWITV
Sbjct  234   LKGLFIQGPVFISFFLAVSNMAEKMPSFKNGGAYWFVDLTTPDTMYVFPVLTALTFWITV  293

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             E N QEGMEGNP  GT+KNV R +A  ++P T  FPKA+FCYW+TSN+FSL+YG  +K P
Sbjct  294   EYNMQEGMEGNPVAGTMKNVMRGLAIATVPLTMHFPKAIFCYWVTSNLFSLAYGAALKVP  353

Query  1131  KVKKLLGVPIIPPA  1172
              VKK LGVP IP A
Sbjct  354   GVKKALGVPEIPQA  367



>ref|XP_003542770.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Glycine 
max]
Length=431

 Score =   385 bits (990),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 214/383 (56%), Positives = 273/383 (71%), Gaps = 15/383 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MAYRR  +   R  L+   +R   S S++ H ++  R++    S +  V    +   FG+
Sbjct  1     MAYRRCLLI--RGSLV--DRRCHLSFSYVLHSNEGKRERTNEKSSSGGVGDFTQTRSFGS  56

Query  255   RISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEY-----ISEVLSDKA  419
              ++  +G    P +DR  SP        + + MST V  G +KI       +++VL+D  
Sbjct  57    SLNGQMGFFS-PSRDRFLSP---CTGYGFCQYMST-VNRGSDKIGSDVMTDVADVLADTT  111

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             +++VASQAPVVNEVA+AAADS+LPV ALQY+ID VH  TG NWWA+IV TTLLIR  T+P
Sbjct  112   MDSVASQAPVVNEVAIAAADSFLPVQALQYVIDAVHFYTGLNWWAAIVLTTLLIRTATVP  171

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L+I QLKATSKL L+RP L++I+QEM+   M P AV +GQQ+MK LF EY VSPF+  +G
Sbjct  172   LLINQLKATSKLTLMRPHLEEIKQEMEGLTMDPVAVAKGQQQMKKLFKEYGVSPFTPLKG  231

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             +FIQGPIFVSFFLAI+NMAEKVPSFK GGA WF DL+TPD++Y+FPVLTAL+F ITVECN
Sbjct  232   LFIQGPIFVSFFLAITNMAEKVPSFKHGGASWFIDLSTPDALYVFPVLTALSFLITVECN  291

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              QEGMEGNP  GT+KNVSR +A L++PFT  FPKA+FCYW+TSN+FSL YGLV+K P VK
Sbjct  292   MQEGMEGNPVAGTMKNVSRGLAVLTVPFTMGFPKAIFCYWVTSNLFSLVYGLVLKVPGVK  351

Query  1140  KLLGVPIIPPAPPRADQSSGLPF  1208
             K LG+P IP APP    ++  PF
Sbjct  352   KTLGIPEIPVAPPTTTSATQSPF  374



>ref|XP_010325667.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Solanum 
lycopersicum]
Length=434

 Score =   385 bits (990),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 218/388 (56%), Positives = 262/388 (68%), Gaps = 31/388 (8%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK-PESSSENPRVLTHLRHCYFGN  254
             MAYRRS   TTRAKLLY QQR  PS S+ H+DDDDRK  PE + EN R+ +  +  Y G+
Sbjct  1     MAYRRS--ITTRAKLLYQQQRVTPSFSYFHKDDDDRKSCPEPTFENLRITSFSQSRYMGS  58

Query  255   RISLGVGV-ARIPFQDRKFSPP----PWAMAPIWMRNMSTSVGEGMNKIEY---ISEVLS  410
                +   + +R P+QDR+F       P +      RNMST +G   +KI Y   ++EVL+
Sbjct  59    VSGVNSFIGSRSPYQDRRFCASGLMIPMSYGSSLTRNMSTDIGGEADKINYMTDVAEVLA  118

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
             DKAVEAV SQAP +NEVA AAAD YLPV AL YL+DYVH  TGF WW SIV T+++IR +
Sbjct  119   DKAVEAVVSQAPALNEVANAAADCYLPVKALMYLMDYVHIFTGFEWWGSIVVTSIMIRLV  178

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
              LPLMI QLKATSKL +             +   A + +N            Y V+PF+ 
Sbjct  179   ILPLMINQLKATSKLTV-------------SFLSALSLLNYCHA------CRYGVTPFTP  219

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +G+ IQGPIF+SFF+AI NM + VPS K GG  WFTDLTTPD MYI PVLTALTFWITV
Sbjct  220   LKGLLIQGPIFISFFMAIRNMVDAVPSLKTGGPLWFTDLTTPDDMYILPVLTALTFWITV  279

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             E NAQEG+EGNP+  TIKNVSRA A L++P TASF KA+FCYWITSN+FSLSYGLVIK  
Sbjct  280   ELNAQEGLEGNPAGKTIKNVSRAFAVLTVPLTASFAKAIFCYWITSNLFSLSYGLVIKSH  339

Query  1131  KVKKLLGVPIIPPAPPR-ADQSSGLPFF  1211
              VKK LG+PII  +PP   +Q   LPFF
Sbjct  340   AVKKALGIPIIRYSPPSPTEQKPALPFF  367



>ref|XP_004149745.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Cucumis 
sativus]
 ref|XP_004162368.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Cucumis 
sativus]
 gb|KGN53404.1| hypothetical protein Csa_4G051560 [Cucumis sativus]
Length=446

 Score =   384 bits (987),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/384 (54%), Positives = 267/384 (70%), Gaps = 22/384 (6%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK--PESSSENPRVLTHLRHCYFG  251
             MAYRRS    TRA L+  Q  + PSI    + DD +K+   E S  + R+ + L+   FG
Sbjct  1     MAYRRS--LCTRANLIARQ--YHPSIGVFGQTDDRKKQHLDEDSISHDRINSFLQRRSFG  56

Query  252   NRISLGVGVARIPFQDRKFSPPPWAMAP----IWMRNMSTSVGEGMNKIEYIS---EVLS  410
                +      R  F D     P   ++P     + R MS+++GEG   IE++S   EVL+
Sbjct  57    TSFNKSY---RSNFFDLGRKYPNTFVSPSAGSFFCRYMSSTIGEGSENIEFMSNVAEVLT  113

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
             D  V++ ASQA   NEV +AAADS+LPV  +QY ID +H  TG NWWA IV TTLLIR  
Sbjct  114   DTTVQSAASQAAAANEVVLAAADSFLPVKGVQYFIDAIHSYTGLNWWACIVLTTLLIRGA  173

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
             T PL+I QLK+T+KL LLRP L+++++EMQ +GM P AV EGQ++MK+LFNE+ VSPF+ 
Sbjct  174   TFPLLINQLKSTAKLTLLRPHLEEVKKEMQEKGMDPGAVAEGQRKMKNLFNEFGVSPFTP  233

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +G+FIQGP+F+SFFLA+SNMAEK+PSFK GGA+WF DLTTPD+MYIFPVLTA+TFW+TV
Sbjct  234   LKGLFIQGPVFISFFLAVSNMAEKMPSFKNGGAYWFVDLTTPDTMYIFPVLTAVTFWVTV  293

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             E N QEGMEGNP  GT+KNV R +A  ++P T  FPKA+FCYW+TSN+FSL+YG  +K P
Sbjct  294   EYNMQEGMEGNPIAGTMKNVMRGLAIATVPLTMHFPKAIFCYWVTSNLFSLAYGAALKVP  353

Query  1131  KVKKLLGVPIIP------PAPPRA  1184
              VKK LGVP IP      P PP A
Sbjct  354   GVKKALGVPEIPEANRNNPTPPPA  377



>gb|KHN10035.1| Mitochondrial inner membrane protein OXA1 [Glycine soja]
Length=489

 Score =   385 bits (989),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 215/383 (56%), Positives = 272/383 (71%), Gaps = 15/383 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPS-ISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MAYRR  +   R  L+  +   + S + H ++   +R   +SSS      T  R   FG+
Sbjct  59    MAYRRCLLI--RGSLVDRRCHLSFSYVLHSNKGKRERTNEKSSSGGVGDFTQTRS--FGS  114

Query  255   RISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEY-----ISEVLSDKA  419
              ++  +G    P +DR  SP        + + MST V  G +KI       +++VL+D  
Sbjct  115   SLNGQMGFFS-PSRDRFLSP---CTGYGFCQYMST-VNRGSDKIGSDVMTDVADVLADTT  169

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             +++VASQAPVVNEVA+AAADS+LPV ALQY+ID VH  TG NWWA+IV TTLLIR  T+P
Sbjct  170   MDSVASQAPVVNEVAIAAADSFLPVQALQYVIDAVHFYTGLNWWAAIVLTTLLIRTATVP  229

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L+I QLKATSKL L+RP L++I+QEM+   M P AV +GQQ+MK LF EY VSPF+  +G
Sbjct  230   LLINQLKATSKLTLMRPHLEEIKQEMEGLTMDPVAVAKGQQQMKKLFKEYGVSPFTPLKG  289

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             +FIQGPIFVSFFLAI+NMAEKVPSFK GGA WF DL+TPD++Y+FPVLTAL+F ITVECN
Sbjct  290   LFIQGPIFVSFFLAITNMAEKVPSFKHGGASWFIDLSTPDALYVFPVLTALSFLITVECN  349

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              QEGMEGNP  GT+KNVSR +A L++PFT  FPKA+FCYW+TSN+FSL YGLV+K P VK
Sbjct  350   MQEGMEGNPVAGTMKNVSRGLAVLTVPFTMGFPKAIFCYWVTSNLFSLVYGLVLKVPGVK  409

Query  1140  KLLGVPIIPPAPPRADQSSGLPF  1208
             K LG+P IP APP    ++  PF
Sbjct  410   KTLGIPEIPVAPPTTTSATQSPF  432



>gb|KDO76532.1| hypothetical protein CISIN_1g0137752mg [Citrus sinensis]
Length=353

 Score =   380 bits (975),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 200/352 (57%), Positives = 262/352 (74%), Gaps = 11/352 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK-PESSSENPRVLTHLRHCYFGN  254
             MAYRRS   TTRA L+   + + PS ++I  D D ++K P+ +     + + ++   FGN
Sbjct  1     MAYRRS--LTTRATLI--ARAYNPSFNYIIYDHDHKQKSPDETLSRTNIHSFIQSRSFGN  56

Query  255   RISLGVGVARIPFQDR--KFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV---LSDKA  419
              ++   G+       R  +FS  P ++   + R MST+VGEG +KIE IS+V    ++  
Sbjct  57    SLNNSYGLGNFFHGQRVSQFSLVP-SVGSAFCRYMSTTVGEGADKIELISDVADVFTETT  115

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             V+A+A+QAP VNEVA+AAADS+LPVAALQ+ ID +H  TGFNWWASI+ TTLLIR  T+P
Sbjct  116   VQAIANQAPAVNEVAIAAADSFLPVAALQHFIDAMHNFTGFNWWASIIVTTLLIRTATVP  175

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L+I QLK+TSKL L+RP+L++I+Q+MQ++ M P AV +GQ+RM++LF EY V P +  +G
Sbjct  176   LLINQLKSTSKLTLMRPRLEEIKQDMQDKAMDPMAVADGQKRMQNLFKEYGVHPLTPLKG  235

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             +FIQGP+F+SFFLAISNMAEKVPSFK GGAFWFTDL+TPDS YI P+LT L+F ITVECN
Sbjct  236   LFIQGPVFISFFLAISNMAEKVPSFKNGGAFWFTDLSTPDSFYILPILTGLSFLITVECN  295

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGL  1115
              QEG+EGNP+  T+KN+SR  A LSIP T +FPKA+FCYWITSN FSL YGL
Sbjct  296   MQEGLEGNPAAVTMKNISRGFAVLSIPLTMTFPKAIFCYWITSNFFSLVYGL  347



>ref|XP_003529495.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Glycine max]
 gb|KHN28188.1| Mitochondrial inner membrane protein OXA1 [Glycine soja]
Length=430

 Score =   381 bits (978),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 207/385 (54%), Positives = 266/385 (69%), Gaps = 14/385 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MA+RR  +   R  L+   ++  PS S++ H ++  R+ P+  S +  +   ++   FGN
Sbjct  1     MAHRRCLLI--RGNLM--NRKCHPSFSYVLHSNEGKRECPDEKSSSAGISNSIQRRMFGN  56

Query  255   RISLG---VGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEY---ISEVLSDK  416
              +      V  +       +F  P       + R+MST V +G +KI+    I++VL D 
Sbjct  57    SVDGSMRFVSYSGQRMHSNRFLSPYSGYN--FCRHMST-VNQGSDKIDIMTDIADVLKDT  113

Query  417   AVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
              VEAV SQAP+V EVA+AAADS LPV ALQY+ID VH  TG NWWASIV TTLLIR  T+
Sbjct  114   TVEAVTSQAPIVKEVAIAAADSALPVKALQYIIDAVHSYTGLNWWASIVLTTLLIRSATV  173

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PL+I QLKATSKL ++RP ++ I+QE++++ M P AV EGQ+RMK LF EY  SPF+  +
Sbjct  174   PLLINQLKATSKLTIMRPHMEKIKQEIEDKAMDPVAVAEGQKRMKKLFKEYGASPFTPLK  233

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             G+FIQGP+F+SFFLAI NMAEK+PSFK GGA+WF DLTTPDS+YI PVLTAL+F ITVEC
Sbjct  234   GLFIQGPVFISFFLAIRNMAEKMPSFKHGGAYWFVDLTTPDSLYILPVLTALSFLITVEC  293

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             N QEG+EGNP  GT+K  SR +A L++PFT  FPKA+FCYWITSN+FSL YGLV+K P V
Sbjct  294   NMQEGLEGNPVAGTMKKFSRGLAVLTVPFTMGFPKAIFCYWITSNLFSLVYGLVLKFPGV  353

Query  1137  KKLLGVPIIPPAPPRADQSSGLPFF  1211
             KK L +PIIP A P +   S    F
Sbjct  354   KKALRIPIIPQAAPTSGPQSPFSIF  378



>ref|XP_010551130.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
Length=419

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 207/376 (55%), Positives = 267/376 (71%), Gaps = 14/376 (4%)
 Frame = +3

Query  78    MAYRRS-SITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MA RRS SI +T +   Y   + +PS    H +D D    +SS +     ++  H +   
Sbjct  1     MALRRSLSIRSTLSAHCY---QLSPSYIITHDNDRDL---DSSCQTQSQRSY--HSFLHQ  52

Query  255   RISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAVEAVA  434
             R S     +++      FS  P + +  + R MS++ G G +    I++VL+D A++AVA
Sbjct  53    RSSNHSVSSQMSRGCSHFSLFPTSGSAFY-RYMSSAPGAGSD----IADVLTDSALQAVA  107

Query  435   SQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQ  614
             SQA VV+EVA AA DS+ P+AALQ+ ID VH  TG +WW SIV  TLLIR + +PL+I+Q
Sbjct  108   SQAVVVSEVANAAKDSFFPIAALQHCIDMVHSFTGLDWWLSIVLATLLIRTMMVPLLIKQ  167

Query  615   LKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQG  794
             LKAT++L LLRP+L+ +R++MQN+GM P AV EGQ++MK LF EY VSPF+  +G+ IQG
Sbjct  168   LKATTQLTLLRPRLEAVREDMQNKGMDPTAVAEGQKQMKALFKEYGVSPFTPMKGLLIQG  227

Query  795   PIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGM  974
             P+FV FFLAI NMAEKVPSF+ GGA WFTDLTTPDS+YIFPVLT L+F ITVECNAQEGM
Sbjct  228   PLFVFFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYIFPVLTGLSFLITVECNAQEGM  287

Query  975   EGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGV  1154
             EGNP  GT+KNV RA A L++P T SF KA+FCYWITSN+FSL YGLVIKRP+VKK+LG+
Sbjct  288   EGNPMAGTVKNVCRAFAVLTVPLTMSFQKAIFCYWITSNLFSLMYGLVIKRPQVKKVLGI  347

Query  1155  PIIPPAPPRADQSSGL  1202
             P +PP  P +  S  L
Sbjct  348   PELPPPEPGSTPSFNL  363



>ref|XP_003529306.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Glycine 
max]
Length=431

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 215/385 (56%), Positives = 270/385 (70%), Gaps = 19/385 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK---PESSSENPRVLTHLRHCYF  248
             MAYRR  +   R  L+   +R  PS S++   D  + +    +SSS      T  R   F
Sbjct  1     MAYRRCLLI--RGNLV--DRRCHPSFSYVLHSDQGKHENTNEKSSSGGDGDFTQTRS--F  54

Query  249   GNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEY-----ISEVLSD  413
             G+ ++  +G      +DR  SP        + R MST V +G +KI       +++VL++
Sbjct  55    GSSLNGPMGFFAHS-RDRFLSP---CSRYGFCRYMST-VNQGSDKISSDVMTDVADVLTN  109

Query  414   KAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
               ++AV SQAPVVNEVA+AAADS+LPV ALQY+ID VH  TG NWWA+IV TTLLIR  T
Sbjct  110   TTMDAVVSQAPVVNEVAIAAADSFLPVQALQYVIDAVHSYTGLNWWAAIVLTTLLIRTAT  169

Query  594   LPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             +PL+I QLKATSKL L+RP L++I+Q+M+   M P AV +GQQ+MK LF EY VSPF+  
Sbjct  170   VPLLINQLKATSKLTLMRPHLEEIKQQMEGLTMDPVAVAKGQQQMKKLFKEYGVSPFTPL  229

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             +G+FIQGPIFVSFFLAI+NMAEKVPSFK GGA WF DL+TPD++YIFP LTAL+F ITVE
Sbjct  230   KGLFIQGPIFVSFFLAITNMAEKVPSFKHGGASWFIDLSTPDALYIFPALTALSFLITVE  289

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
             CN QEGMEGNP  GT+KNVSR +A L++PFT  FPKA+FCYW+TSN+FSL YGLV+K P 
Sbjct  290   CNMQEGMEGNPVAGTMKNVSRGLAVLTVPFTMGFPKAIFCYWVTSNLFSLVYGLVLKVPG  349

Query  1134  VKKLLGVPIIPPAPPRADQSSGLPF  1208
             VKK LG+P IP APP    +   PF
Sbjct  350   VKKTLGIPEIPVAPPTTTSAPQSPF  374



>ref|XP_009358591.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Pyrus 
x bretschneideri]
 ref|XP_009358600.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Pyrus 
x bretschneideri]
Length=437

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 197/364 (54%), Positives = 261/364 (72%), Gaps = 9/364 (2%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK--PESSSENPRVLTHLRHC-YF  248
             M+YRRS  TT+    +  + ++ PS++HI RDDD ++    E +S +P +   L    +F
Sbjct  1     MSYRRSLTTTSS---IARRHQYHPSVTHILRDDDRKQDVVSEQASASPILNQFLNQKRFF  57

Query  249   GNRISLGVGVARIPFQDRKFSPPPWAMAP--IWMRNMSTSVGEGMNKIEYISEVLSDKAV  422
             GN +S   G      QDR+ S    +      + R+MS S  E +  +  +S VLSD  +
Sbjct  58    GNNLSRVSGFGGGFAQDRRISNALLSSTSGFAFSRSMS-SASEKVELLSDVSGVLSDTGI  116

Query  423   EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
             E + SQ P ++EVAVAAADS+LPV  LQY I+ VH  TG NWWA+I  TTLLIR  T+PL
Sbjct  117   EGLTSQVPAMSEVAVAAADSWLPVKGLQYFIEAVHVHTGLNWWAAIAITTLLIRTATVPL  176

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             +I QLKATSKL+L++P+L++++QEMQ+RG   +A  E QQ+ K LF EY V+P +  +G+
Sbjct  177   LINQLKATSKLSLMKPQLEELKQEMQDRGSDRSAQLEFQQKTKKLFKEYGVTPLTPMKGL  236

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
              IQGP+F+SFFLAI NMAEKVPSFK GGA+WF DLTTPD+MY+FPVL A+TF +TVECN 
Sbjct  237   LIQGPVFISFFLAIGNMAEKVPSFKTGGAYWFLDLTTPDAMYVFPVLAAMTFLLTVECNL  296

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKK  1142
             QEGMEGNP+ GT+KNVSR +A L++PFT SFPKAVFCYW+TSN+FSLSYGLV+K   +K+
Sbjct  297   QEGMEGNPAAGTMKNVSRGLAVLTVPFTMSFPKAVFCYWVTSNLFSLSYGLVLKYTGLKE  356

Query  1143  LLGV  1154
              LG+
Sbjct  357   ALGI  360



>ref|XP_008346707.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Malus 
domestica]
Length=437

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 198/366 (54%), Positives = 263/366 (72%), Gaps = 13/366 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK--PESSSENP---RVLTHLRHC  242
             MAYRRS  TT+    +  + ++ PS++HI RDDD ++    E +S +P   + L+  R  
Sbjct  1     MAYRRSLTTTSS---IARRHQYHPSVTHILRDDDRKQDVVSEHASASPILNQFLSQKR--  55

Query  243   YFGNRISLGVGVARIPFQDRKFSPPPWAMAP--IWMRNMSTSVGEGMNKIEYISEVLSDK  416
             +FGN +S   G      QDR+ S    +      + R+MS S  E +  +  +S VLSD 
Sbjct  56    FFGNNLSRVSGFGGGFAQDRRISNALLSSTSGFAFSRSMS-SASEKVELLSDVSGVLSDT  114

Query  417   AVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
              +E + SQ P ++EVAVAAADS+LPV  LQY I+ VH  TG NWWA+I  TT+LIR  T+
Sbjct  115   GIEGLTSQVPAMSEVAVAAADSWLPVKGLQYFIEAVHVHTGLNWWAAIAITTILIRTATV  174

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PL+I QLKATSKL+L++P+L++++QEMQ+RG   +A  E QQ+ K LF EY V+P +  +
Sbjct  175   PLLINQLKATSKLSLMKPQLEELKQEMQDRGSDRSAQLEFQQKTKKLFKEYGVTPLTPMK  234

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             G+ IQGP+F+SFFLAI NMAEKVPSFK GGA+WF DLTTPD+MY+FPVL A+TF +TVEC
Sbjct  235   GLLIQGPVFISFFLAIGNMAEKVPSFKTGGAYWFLDLTTPDAMYVFPVLAAMTFLLTVEC  294

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             N QEGMEGNP+ GT+KNVSR +A L++PFT SFPKAVFCYW+TSN+FSLSYGLV+K   +
Sbjct  295   NLQEGMEGNPAAGTMKNVSRGLAVLTVPFTMSFPKAVFCYWVTSNLFSLSYGLVLKYTGL  354

Query  1137  KKLLGV  1154
             K+ LG+
Sbjct  355   KEALGI  360



>gb|EPS73660.1| hypothetical protein M569_01093 [Genlisea aurea]
Length=433

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 252/362 (70%), Gaps = 13/362 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI--HRDDDDRKKPESSSENPRVLTHLRHCYFG  251
             MA+RR     TRAKLL+  QR APS+  I  H +DDD      +      +++  H   G
Sbjct  1     MAFRRC--IATRAKLLHQHQRVAPSVFPIGLHDNDDDDGGSRVNG-----ISNYFHHRRG  53

Query  252   NRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAVEAV  431
             N +    G   +  ++R F  P W+M P+  RNMS       +K   + + + D+  +A 
Sbjct  54    NNVDSRQGFGFLS-RNRIFGSPMWSM-PV--RNMSNLSEGSSDKTAILIDAIGDQGYDAA  109

Query  432   ASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQ  611
                 P+VNEVA+AAADSY PVA L YLIDYVH  TGFNWWASIV TTLLIRW+ +P MI 
Sbjct  110   IKAVPLVNEVAIAAADSYFPVAGLMYLIDYVHNYTGFNWWASIVVTTLLIRWIQIPFMIS  169

Query  612   QLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQ  791
              LK+TS+  L+RP+L++++ EMQ RGM+PAAV EGQ RM  LF EY V  ++  +G+ + 
Sbjct  170   HLKSTSRFMLVRPQLEEVKLEMQRRGMSPAAVAEGQARMDALFKEYDVRWYTPVKGLLVT  229

Query  792   GPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEG  971
              PIF  FF AI NMAEKV SFK GG  WFTDLTTPDS Y+FP++TALTFWITVE NAQEG
Sbjct  230   APIFCCFFFAIKNMAEKVESFKGGGTLWFTDLTTPDSFYVFPIMTALTFWITVELNAQEG  289

Query  972   MEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLG  1151
             ME   + GT+KNVSRA AAL++ FTASFPKA+FCYWITSN+FSLSYGLV+K+P+VKKLLG
Sbjct  290   MESGATAGTVKNVSRAFAALTVFFTASFPKAIFCYWITSNLFSLSYGLVMKKPEVKKLLG  349

Query  1152  VP  1157
             +P
Sbjct  350   LP  351



>gb|KHN07284.1| Mitochondrial inner membrane protein OXA1 [Glycine soja]
Length=347

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 230/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  357   TSVGEGMNKIEY-----ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDY  521
             ++V +G +KI       +++VL++  ++AV SQAPVVNEVA+AAADS+LPV ALQY+ID 
Sbjct  2     STVNQGSDKISSDVMTDVADVLTNTTMDAVVSQAPVVNEVAIAAADSFLPVQALQYVIDA  61

Query  522   VHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPA  701
             VH  TG NWWA+IV TTLLIR  T+PL+I QLKATSKL L+RP L++I+Q+M+   M P 
Sbjct  62    VHSYTGLNWWAAIVLTTLLIRTATVPLLINQLKATSKLTLMRPHLEEIKQQMEGLTMDPV  121

Query  702   AVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFT  881
             AV +GQQ+MK LF EY VSPF+  +G+FIQGPIFVSFFLAI+NMAEKVPSFK GGA WF 
Sbjct  122   AVAKGQQQMKKLFKEYGVSPFTPLKGLFIQGPIFVSFFLAITNMAEKVPSFKHGGASWFI  181

Query  882   DLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPK  1061
             DL+TPD++YIFP LTAL+F ITVECN QEGMEGNP  GT+KNVSR +A L++PFT  FPK
Sbjct  182   DLSTPDALYIFPALTALSFLITVECNMQEGMEGNPVAGTMKNVSRGLAVLTVPFTMGFPK  241

Query  1062  AVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSSGLPF  1208
             A+FCYW+TSN+FSL YGLV+K P VKK LG+P IP APP    +   PF
Sbjct  242   AIFCYWVTSNLFSLVYGLVLKVPGVKKTLGIPEIPVAPPTTTSAPQSPF  290



>ref|XP_011026896.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Populus 
euphratica]
Length=436

 Score =   375 bits (962),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 210/378 (56%), Positives = 267/378 (71%), Gaps = 22/378 (6%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENP-RVLTHL--RHCYF  248
             MA  RS   +TRA ++  ++R+  S S+I  DDD  +K  S  E P + +++L  +  + 
Sbjct  1     MASVRS--LSTRANIV--RRRYNASFSYILHDDD--RKHNSIEEGPSKGMSNLFQQRSFG  54

Query  249   GNRISLGVGVARIPF------QDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---SE  401
              +R      +A   F       D   SP   ++   + R+MST +G G   IE I   ++
Sbjct  55    SSRKRFDDNLAVFGFFHNRRCLDLSLSP---SIGVSFCRDMST-IGGGSEDIELINDVAD  110

Query  402   VLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLI  581
             VL+D  + AV++QAPVVNEVA+AAADSY PVAALQ++ID VH  TGFNWWASI+ TTLLI
Sbjct  111   VLTDTTIGAVSAQAPVVNEVAIAAADSYFPVAALQHVIDAVHSFTGFNWWASIIVTTLLI  170

Query  582   RWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSP  761
             R  T+PL+I QLKAT+KL L+RP L++IRQ+M ++ M P A+ EGQ++MK LF EY VSP
Sbjct  171   RGATVPLLINQLKATTKLTLMRPHLEEIRQQMSDKAMDPMALAEGQKQMKKLFKEYGVSP  230

Query  762   FSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFW  941
              +  +G+FIQGPIFVSFFLAISNM EKVPSFK GGA+WF DLTTPDS+YI P+LT LTFW
Sbjct  231   LTPLKGLFIQGPIFVSFFLAISNMTEKVPSFKSGGAYWFLDLTTPDSLYILPILTGLTFW  290

Query  942   ITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVI  1121
             ITVECN QEG+EGNP  GT+K VSR  A  S+P T  FP A+FCYW+TSN+FSL YGL +
Sbjct  291   ITVECNMQEGLEGNPIAGTMKKVSRVFAVASVPLTMGFPNAIFCYWVTSNLFSLFYGLAL  350

Query  1122  KRPKVKKLLGVPIIPPAP  1175
             K P VKK LG+P IP AP
Sbjct  351   KAPGVKKFLGLPEIPVAP  368



>ref|XP_002509958.1| cytochrome oxidase biogenesis protein, putative [Ricinus communis]
 gb|EEF51345.1| cytochrome oxidase biogenesis protein, putative [Ricinus communis]
Length=421

 Score =   374 bits (961),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 210/381 (55%), Positives = 264/381 (69%), Gaps = 30/381 (8%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSIS---HIHRDDDDRKK-PESSSENPRVLTHLRHCY  245
             MAY RS   TTR+ LL  ++   PS +   H H DD +     E SS   R         
Sbjct  1     MAYIRS--LTTRSTLL--KRHCHPSFTFFLHQHSDDHNNTSIDEFSSVQGRGFHSKSSGS  56

Query  246   FGNRISLGVGVARIPFQDRKFSPPPWAMAPI----WMRNMSTSVGEGMN-KIEYISEV--  404
             F  R          PFQ+ +F    ++++P     + R MS++VGEG + KIE IS+V  
Sbjct  57    FDIR----------PFQEIRFRDA-YSLSPSIGASFCRYMSSTVGEGSDHKIELISDVAD  105

Query  405   --LSDKAVEAVASQapv--vnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
               L+D + ++VA+      VNEVA AAAD + PVA LQ++ID VH +TGFNWWASIV TT
Sbjct  106   VVLTDASAQSVATNVTAPVVNEVAAAAADCFAPVAVLQHVIDAVHNLTGFNWWASIVLTT  165

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYK  752
             L+IR + +PLMI QLKATSKL L+RP+L++I+Q+M N  M PAA+ EG +RMK LF EY 
Sbjct  166   LIIRTMMVPLMINQLKATSKLTLMRPRLEEIKQQMDNTAMDPAAIAEGNKRMKMLFKEYG  225

Query  753   VSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTAL  932
              SPF+  +GIF+QGP+FV FFLAI NMAEKVPSFK GGAFWF DL+TPDS+YIFPVLTAL
Sbjct  226   ASPFTPMKGIFVQGPVFVCFFLAIRNMAEKVPSFKNGGAFWFVDLSTPDSLYIFPVLTAL  285

Query  933   TFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYG  1112
             TFWITVE N QEG+EGNP  GT+KN+SR  AAL++P T  FPKA+FCYW+T+N+FS +YG
Sbjct  286   TFWITVELNMQEGLEGNPVAGTMKNISRVFAALTVPLTMGFPKAIFCYWVTTNLFSFAYG  345

Query  1113  LVIKRPKVKKLLGVPIIPPAP  1175
              V+K P VK+ LGVP IP AP
Sbjct  346   GVLKLPGVKQFLGVPKIPVAP  366



>ref|XP_007146149.1| hypothetical protein PHAVU_006G016400g [Phaseolus vulgaris]
 gb|ESW18143.1| hypothetical protein PHAVU_006G016400g [Phaseolus vulgaris]
Length=429

 Score =   374 bits (961),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 203/385 (53%), Positives = 271/385 (70%), Gaps = 14/385 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MAYRR  +   R  L+   ++  PS S + H D+   + P+  S +  +   ++   FGN
Sbjct  1     MAYRRCLLI--RGNLV--NRKCHPSFSFVLHSDEGKSECPDEKSPSAGISNSIQRRMFGN  56

Query  255   RISLGVGVARIPFQD-RKFSPPPWAMAPIW--MRNMSTSVGEGMNKIEY---ISEVLSDK  416
               S+   + R  + + R  S    + + ++   R+MST+  +G +KIE    I++VL D+
Sbjct  57    --SVDGSMWRFAYSEPRMHSNIFLSPSSVYNLCRHMSTT-NQGSDKIEIMSDIADVLKDQ  113

Query  417   AVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
             A+EAV SQ P++ EVA+A+ADS LPV ALQY+ID +H  TG NWWA+IV TTLLIR  T+
Sbjct  114   AMEAVTSQGPILREVAIASADSVLPVKALQYIIDAMHSYTGLNWWAAIVLTTLLIRSATV  173

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PL+I QLKATSKL L+RP ++ I++EM+++ M P AV EGQ++MK LF EY  SPF+  +
Sbjct  174   PLLINQLKATSKLTLMRPHMEKIKEEMEDKAMDPNAVAEGQKKMKMLFKEYGASPFTPLK  233

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             G+FIQGP+F+SFFLAI  MAEK+PSFK GGA+ F DLTTPD++YI PV+TALTF ITVEC
Sbjct  234   GLFIQGPVFISFFLAIRTMAEKMPSFKHGGAYLFVDLTTPDALYILPVVTALTFLITVEC  293

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             N QEGMEGNP+ GT+K VSR +A L++PFT  FPKA+FCYWITSN+FSL YGLV+K P V
Sbjct  294   NMQEGMEGNPAAGTMKKVSRVLAVLTVPFTMGFPKAIFCYWITSNLFSLGYGLVLKAPGV  353

Query  1137  KKLLGVPIIPPAPPRADQSSGLPFF  1211
             K+ LG+PII  A P +  SS    F
Sbjct  354   KRALGIPIIQQAAPASGSSSPFSIF  378



>ref|XP_006387873.1| hypothetical protein POPTR_0513s00210g [Populus trichocarpa]
 gb|ERP46787.1| hypothetical protein POPTR_0513s00210g [Populus trichocarpa]
Length=420

 Score =   372 bits (956),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 260/383 (68%), Gaps = 23/383 (6%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MAY RS   ++R+ +L  ++++ P  ++I  DD  +K+      NP     +    +   
Sbjct  1     MAYMRS--LSSRSTIL--KRQYYPRFAYILHDDHQQKEKNQEQLNPSEKPAITPTNY---  53

Query  258   ISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAVEAVAS  437
                        F  R F   P A     +R  + +   G   + Y+S   +  A E +  
Sbjct  54    -----------FPQRSFYTAPTASFGSLLREPNHTHFAGACLVRYMSTTTATSAAENIDV  102

Query  438   ----QapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLM  605
                  AP VNEVA+AAADS+LPVA LQ+ ID VH  TGFNWWASIV TTLLIR  TLPL+
Sbjct  103   VMDMAAPAVNEVAIAAADSFLPVAVLQHAIDAVHNFTGFNWWASIVVTTLLIRSFTLPLL  162

Query  606   IQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIF  785
             I QLKATSKL+++RP L++++Q ++ +GM P AV+EGQ+ MK LF E+ VSPF+  +G+F
Sbjct  163   INQLKATSKLSIVRPHLEEVKQRVERQGMDPTAVSEGQKEMKKLFKEHGVSPFTPLKGLF  222

Query  786   IQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQ  965
             IQ P+F+SFFLAI+NMAEKVPSFK GGAFWF DLTT D +YIFPVLTALTF ITVECN Q
Sbjct  223   IQAPVFISFFLAITNMAEKVPSFKSGGAFWFVDLTTADDLYIFPVLTALTFLITVECNTQ  282

Query  966   EGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKL  1145
             EGMEGNP+ GT+KNVSRA+AA S+P T SFPKA+FCYWITSN+FSL+YGLV+K P VK+ 
Sbjct  283   EGMEGNPAAGTMKNVSRALAAASVPLTMSFPKAIFCYWITSNLFSLTYGLVLKAPGVKEF  342

Query  1146  LGVPIIPPAPP-RADQSSGLPFF  1211
             LGVP +P APP  A +SS    F
Sbjct  343   LGVPKVPVAPPTTAAKSSSFDLF  365



>ref|XP_010676296.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Beta 
vulgaris subsp. vulgaris]
Length=442

 Score =   372 bits (956),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 208/367 (57%), Positives = 261/367 (71%), Gaps = 14/367 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-----HRDDDDRKKPESSSENPRVLTHLRHC  242
             MAYRRS    TRA  L   +R  PS S+I       +++D+ +  S  +    L+ +R  
Sbjct  1     MAYRRS--VCTRATFL--ARRLNPSFSYITHDHDKNNNNDKNEAPSGRKIDEYLSQMRS-  55

Query  243   YFGNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV---LSD  413
              FG+  +     + +    R F P          R MSTS+G+G   +E+IS+V   +SD
Sbjct  56    -FGSYRNNFTSSSSLFNHQRSFLPGIGNGVMNSHRYMSTSIGKGTENVEFISDVAGVISD  114

Query  414   KAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
               VE VASQAPV++EVA AAADS  PVAALQY+ID VH  TG NWWASIV TTLLIR LT
Sbjct  115   APVEVVASQAPVLSEVATAAADSAYPVAALQYVIDGVHTFTGLNWWASIVLTTLLIRGLT  174

Query  594   LPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             +P +I QLKATSKL+++RP+L++I++EMQ R   P AV EG+++M  LF EY V+PF+  
Sbjct  175   VPFLINQLKATSKLSIMRPRLEEIKEEMQARADDPNAVREGKEKMNVLFKEYGVTPFTPL  234

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             +G+FIQGPIF+SFFLAISNMAEKVPSFK GGAFWFTDLTTPD+MYIFPVLTA++F ITVE
Sbjct  235   KGLFIQGPIFISFFLAISNMAEKVPSFKNGGAFWFTDLTTPDAMYIFPVLTAVSFLITVE  294

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
              N QEGMEGNP   T+K  SR +A L++PFT SFPKA+FCYW+TSNIFS +YG V+K P 
Sbjct  295   FNMQEGMEGNPVASTMKKFSRGLAVLTVPFTMSFPKAIFCYWVTSNIFSFAYGSVLKVPG  354

Query  1134  VKKLLGV  1154
             VKK +GV
Sbjct  355   VKKAIGV  361



>ref|XP_004306681.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Fragaria 
vesca subsp. vesca]
Length=448

 Score =   372 bits (956),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 200/402 (50%), Positives = 253/402 (63%), Gaps = 42/402 (10%)
 Frame = +3

Query  78    MAYRRS-SITTTRAKLLYDQQRFAPSISHIH--RDDDDRKKPES--SSENPRVLTHLRHC  242
             MA RR+ S T T A      +RF PS+ H+H   DD++  K  S  SS  P + + L   
Sbjct  1     MACRRAVSTTATLAT-----RRFHPSLGHVHVLHDDNEDTKSHSPSSSTRPNIKSILPSG  55

Query  243   YFGNRISLGVGVARIPFQDRKFSPPPWAM--APIWMRNMSTSVGEG--------------  374
              + + +    G      + R  S   W M  +    R+MSTS+G+G              
Sbjct  56    SYSSIVGFSFGSHS---RRRTGSSLAWKMGLSSFNFRHMSTSIGDGSDKMDDIGFVGEVI  112

Query  375   ----------MNKIEYISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYV  524
                       M+ I Y++EV++DK VE V S    V   A    DS+ PVA LQY I Y+
Sbjct  113   TDKIGDGSDKMDAIGYVAEVITDKTVEVVTSHGAEVAVAAA---DSFFPVAGLQYAIYYI  169

Query  525   HCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAA  704
             H  TG NWWA+I  TT+LIR  T+PL+I QL+AT+KL L+RP+L+ ++QEMQN    P  
Sbjct  170   HSFTGLNWWAAIALTTVLIRVATIPLLIGQLRATAKLNLMRPRLEQLKQEMQNMEQDPEV  229

Query  705   VNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTD  884
             + EGQ+RM  LFNEY V+PFS  +G+FIQGPIF+SFFLAI NMAEKVPSF+ GGA WFTD
Sbjct  230   LREGQKRMMALFNEYGVTPFSQLKGLFIQGPIFISFFLAIRNMAEKVPSFQNGGALWFTD  289

Query  885   LTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKA  1064
             LTTPDS+ I P+LTA+TFWITVECN QEGMEGNP   T+K  SR +A ++IP   SFPKA
Sbjct  290   LTTPDSLVILPILTAMTFWITVECNMQEGMEGNPVAQTMKTYSRILAVIAIPVMMSFPKA  349

Query  1065  VFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQ  1190
             +FCYW+TSNIFSL+YGL I+ PKVK LL +P     PP A Q
Sbjct  350   LFCYWLTSNIFSLTYGLAIRSPKVKSLLNLPQFSEPPPTASQ  391



>ref|XP_003622394.1| Mitochondrial inner membrane protein OXA1 [Medicago truncatula]
 gb|KEH31884.1| 60 kDa inner membrane protein [Medicago truncatula]
Length=446

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 202/371 (54%), Positives = 261/371 (70%), Gaps = 24/371 (6%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDD---RKKPESSSENPRVLTHLRHCYF  248
             MAYRR  +   R K L D+ R  PS ++I   DD+   R +P+S+       T  R   F
Sbjct  1     MAYRRCLLQ--RGKNLIDR-RCNPSFTYILHSDDEGKQRDQPDSAGRISNSFTQTRSFGF  57

Query  249   GNRISLGVGVARIPFQDRKFSPP-PWAMAPI--WMRNMSTSVGEGMNKIEY----ISEVL  407
             GN ++  +G          FSP  P+A      + RNMST+  +G +KI      ++ VL
Sbjct  58    GNSLNGSMG----------FSPSSPFAAGYYNNFCRNMSTTPDQGFDKITELTTDVAHVL  107

Query  408   SDKAVEAVASQap-vvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIR  584
             SD AV+A++SQA  VV+EVA+AAADS+LPV  LQY ID VH  TG NWW++IV TTLLIR
Sbjct  108   SDTAVDAISSQAAPVVSEVAIAAADSFLPVQVLQYAIDAVHTYTGLNWWSAIVVTTLLIR  167

Query  585   WLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPF  764
               T+PL+I QLK TSKL ++RP+L++++ EM  +   P AV EGQ++MK LF EY V+PF
Sbjct  168   IATVPLLINQLKTTSKLTIMRPRLEELKAEMDGKTFDPQAVAEGQEKMKQLFKEYGVTPF  227

Query  765   SAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWI  944
             S  +G+ IQGP+F+SFFLAI+NMAEK+PSFK GGAFWFTDLTTPD++Y+FPVLTAL+F +
Sbjct  228   SPLKGLLIQGPVFISFFLAITNMAEKMPSFKHGGAFWFTDLTTPDALYVFPVLTALSFLV  287

Query  945   TVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIK  1124
              VE N QEGMEGNP   T+K  SR +A LS+PFT SFPKA+FCYW+TSN+FS +YG+V+K
Sbjct  288   VVEFNMQEGMEGNPMGDTMKKFSRVLAFLSVPFTMSFPKALFCYWLTSNLFSFTYGMVLK  347

Query  1125  RPKVKKLLGVP  1157
              P VKK LGVP
Sbjct  348   VPGVKKTLGVP  358



>ref|XP_011017708.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Populus euphratica]
 ref|XP_011017709.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Populus euphratica]
Length=420

 Score =   370 bits (949),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 209/395 (53%), Positives = 262/395 (66%), Gaps = 47/395 (12%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSEN--------PRVLTHL  233
             MAY RS   ++R+ +L  ++++ P  ++I  DD  +K+      N        P      
Sbjct  1     MAYMRS--LSSRSTIL--KRQYYPRFTYILLDDHHQKEKNQEQLNHSAKPAITPTNCFPQ  56

Query  234   RHCYFGNRISLGVGVARIPFQD--------RKFSPPPWAMAPIWMRNMSTSVGEGMNKIE  389
             R  Y     S G  + R P           R  SPPP           +TS  E +    
Sbjct  57    RSFYTAPTASFG-SLLREPNHTHFAGACLVRHMSPPP-----------TTSAAENI----  100

Query  390   YISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCT  569
                +V+ D A  AV       NEVA+AAADS+LPVA LQ+ ID VH  TGFNWWASIV T
Sbjct  101   ---DVVMDMAAPAV-------NEVAIAAADSFLPVAVLQHAIDAVHNFTGFNWWASIVVT  150

Query  570   TLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEY  749
             TLLIR  TLPL+I QLKATSKL+++RP+L++++Q ++ +GM P AV+EGQ+ MK LF E+
Sbjct  151   TLLIRSFTLPLLINQLKATSKLSIVRPQLEEVKQRVERQGMDPTAVSEGQKEMKKLFKEH  210

Query  750   KVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTA  929
              VSPF+  +G+FIQ P+F+SFFLAI+NMAEKVPSFK GGAFWF DLTT D +YIFPVLTA
Sbjct  211   GVSPFTPLKGLFIQAPVFISFFLAITNMAEKVPSFKSGGAFWFVDLTTADDLYIFPVLTA  270

Query  930   LTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSY  1109
             LTF ITVECN QEGMEGNP+ GT+KNVSRA+AA S+P T SFPKA+FCYWITSN+FSL+Y
Sbjct  271   LTFLITVECNTQEGMEGNPAAGTMKNVSRALAAASVPLTMSFPKAIFCYWITSNLFSLTY  330

Query  1110  GLVIKRPKVKKLLGVPIIPPAPP-RADQSSGLPFF  1211
             GLV+K P VK+ LGVP +P APP  A +SS    F
Sbjct  331   GLVLKAPGVKEFLGVPKVPVAPPTTAAKSSSFDLF  365



>ref|XP_006394440.1| hypothetical protein EUTSA_v10004275mg [Eutrema salsugineum]
 gb|ESQ31726.1| hypothetical protein EUTSA_v10004275mg [Eutrema salsugineum]
Length=427

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/364 (52%), Positives = 253/364 (70%), Gaps = 15/364 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MA+RR+   + R+ L+  +++ A  I  I R++D  +   +S  +   L H R     + 
Sbjct  1     MAFRRA--LSIRSTLIGRRKQLAYHI--IPRENDHEEDSFTSQRSYHSLLHQRSSINSDF  56

Query  258   ISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEY---ISEVLSDKAVEA  428
               +  G   +P        P  A A  + R MS++ G G +KI     I+EV++D  ++ 
Sbjct  57    SQISGGGLHVPL-----GAPTSAFA--FYRYMSSAHGVGSDKIGVMSDIAEVITDSTLQD  109

Query  429   VASQapvvnevav-aaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLM  605
               +Q          AA++S+LP+AALQ+ ID VH  TGF WWASIV  T+LIR  T+PL+
Sbjct  110   APAQVAAAVSEVSLAASESFLPIAALQHCIDMVHSFTGFEWWASIVVATILIRSSTVPLL  169

Query  606   IQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIF  785
             I+Q+K T+KL+L+RP+L+ IR+EMQN+GM P  + EGQ++MK+LF EY V+PF+  +G+F
Sbjct  170   IKQMKDTTKLSLMRPRLESIREEMQNKGMDPVTMAEGQKKMKNLFKEYGVTPFTPMKGMF  229

Query  786   IQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQ  965
             IQGP+F+ FFLAI NMAEKVPSF+ GGA WFTDLTTPDS+YI PV+TALTF ITVECNAQ
Sbjct  230   IQGPLFICFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYILPVITALTFLITVECNAQ  289

Query  966   EGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKL  1145
             EGMEGNP  GT+KNV R  A L++P T SFP+A+FCYWITSN+FSL YGLVIKRP+VKK+
Sbjct  290   EGMEGNPMAGTVKNVCRGFALLTVPMTMSFPQAIFCYWITSNLFSLMYGLVIKRPRVKKM  349

Query  1146  LGVP  1157
             L +P
Sbjct  350   LKIP  353



>ref|XP_002324680.2| hypothetical protein POPTR_0018s13680g [Populus trichocarpa]
 gb|EEF03245.2| hypothetical protein POPTR_0018s13680g [Populus trichocarpa]
Length=420

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/390 (52%), Positives = 258/390 (66%), Gaps = 37/390 (9%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MAY RS   ++R+ +L  ++++ P  ++I  DD  +K+      NP     +    +   
Sbjct  1     MAYMRS--LSSRSTIL--KRQYYPRFTYILHDDHQQKEKNQEQLNPSEKPAITPTNY---  53

Query  258   ISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYIS-----------EV  404
                        F  R F   P A     +R  + +   G   + Y+S           +V
Sbjct  54    -----------FPQRSFYTAPTASFGSLLREPNHTHFAGACLVRYMSTTTTTSAAENIDV  102

Query  405   LSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIR  584
             + D A  AV         VA+AAADS+LPVA LQ+ ID VH  TGFNWWASIV TTLLIR
Sbjct  103   VMDMAAPAVNE-------VAIAAADSFLPVAVLQHAIDAVHNFTGFNWWASIVVTTLLIR  155

Query  585   WLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPF  764
               TLPL+I QLKATSKL+++RP L++++Q ++ +GM P AV+EGQ+ MK LF E+ VSPF
Sbjct  156   SFTLPLLINQLKATSKLSIVRPHLEEVKQRVERQGMDPTAVSEGQKEMKKLFKEHGVSPF  215

Query  765   SAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWI  944
             +  +G+FIQ P+F+SFFLAI+NMAEKVPSFK GGAFWF DLTT D +YIFPVLTALTF I
Sbjct  216   TPLKGLFIQAPVFISFFLAITNMAEKVPSFKSGGAFWFVDLTTADDLYIFPVLTALTFLI  275

Query  945   TVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIK  1124
             TVECN QEGMEGNP+ GT+KNVSRA+AA S+P T SFPKA+FCYWITSN+FSL+YGLV+K
Sbjct  276   TVECNTQEGMEGNPAAGTMKNVSRALAAASVPLTMSFPKAIFCYWITSNLFSLTYGLVLK  335

Query  1125  RPKVKKLLGVPIIPPAPP-RADQSSGLPFF  1211
              P VK+ LGVP +P APP  A +SS    F
Sbjct  336   APGVKEFLGVPKVPVAPPTTAAKSSSFDLF  365



>ref|XP_007040517.1| Inner membrane protein isoform 2 [Theobroma cacao]
 gb|EOY25018.1| Inner membrane protein isoform 2 [Theobroma cacao]
Length=363

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 243/351 (69%), Gaps = 13/351 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
             MA+ RS   + RA L+   +R+ PS +++ H DD   +    S    +    ++H YFG 
Sbjct  1     MAFSRS--LSNRATLI--ARRYRPSFAYVLHEDDRKNQSLNESQSQEKPGNFVQHRYFGT  56

Query  255   RISLGVGVARIPFQDRKFSP----PPWAMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAV  422
               S       + FQDR  S     P   M+  + R MST++G G +     S +    A 
Sbjct  57    GFSNSSSGFGVLFQDRICSQLSLHPSSGMS--FCRYMSTTIGGGADMSAAASAINGGGAD  114

Query  423   EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
              + A+ A     +A A  DS+  VAALQ++ID VH  TGF WWASIV TTLLIR  T+PL
Sbjct  115   MSAAASAVNEVAIAAA--DSWFLVAALQHVIDTVHSFTGFPWWASIVVTTLLIRGATIPL  172

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             +I QLKATSK  LLRP+L++I+++MQ++GM P  V EGQ+ MK LFNEY V+PFS  +G+
Sbjct  173   LINQLKATSKFTLLRPRLEEIKEQMQSKGMDPLTVAEGQKEMKKLFNEYGVTPFSPMKGL  232

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
             FIQGPIF+SFFLAISNMAEKVPSFK GGA+WF DLTTPD +YI PVLTAL+F ITVECN 
Sbjct  233   FIQGPIFISFFLAISNMAEKVPSFKCGGAYWFMDLTTPDDLYILPVLTALSFLITVECNM  292

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGL  1115
             QEGMEGNP+ GTIKNVSR +AAL++PFT SFPKA+FCYWITSN+FSL+YGL
Sbjct  293   QEGMEGNPAAGTIKNVSRVLAALTVPFTMSFPKAIFCYWITSNLFSLTYGL  343



>ref|XP_008233188.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Prunus mume]
Length=431

 Score =   365 bits (936),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 198/367 (54%), Positives = 254/367 (69%), Gaps = 15/367 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK---PESSSENPRVLTHLRHCYF  248
             MA RRS  TT    + +  +RF PS SHI  D+++  K   P SS   P + + L    +
Sbjct  1     MACRRSVSTT----VTFGTRRFHPSFSHILHDNNEDTKSHAPNSSLPPPVIKSTLPRGSY  56

Query  249   GNRISLGVGVARIPFQDRKFSPPPWAMA--PIWMRNMSTSVGEGMNKIE---YISEVLSD  413
              + +    G      ++R  S   W M       R MS  + +G +KI    Y +EV++D
Sbjct  57    NSTLGFCFGSL---CRERTGSSLSWKMGLGSFHCRYMSAIIDDGSDKINDVGYFAEVITD  113

Query  414   KAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
             K VE V SQAP V+EVA AAADS+ PVAALQYLID VH  TG NWWASI  TT+LIR  T
Sbjct  114   KTVEVVTSQAPAVSEVAAAAADSFFPVAALQYLIDGVHSFTGCNWWASIALTTILIRGAT  173

Query  594   LPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             +PL+I QL+AT++L L+RP L++++Q+MQ+  M P  + EGQ+RMK LF EY V+P S  
Sbjct  174   IPLLINQLRATTQLNLMRPHLEELKQQMQDMAMDPNVLQEGQKRMKALFKEYGVNPLSQL  233

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             + +FIQGPIF+SFFLA+ NMAEKVPSF+ GGA WFTDLTTPDS+ I PVLT+LTF ITVE
Sbjct  234   QPLFIQGPIFISFFLAVRNMAEKVPSFQSGGALWFTDLTTPDSLLILPVLTSLTFLITVE  293

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
             CN QEG+EGNP   T+KN SR +AA+S+P   SFPKA+FCYW+TSN+FSL+YGLVI+ P+
Sbjct  294   CNMQEGLEGNPIAQTMKNYSRILAAISVPVMMSFPKALFCYWLTSNLFSLTYGLVIRLPE  353

Query  1134  VKKLLGV  1154
             VK  LG+
Sbjct  354   VKSFLGL  360



>ref|XP_006583991.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Glycine max]
Length=362

 Score =   362 bits (929),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 214/271 (79%), Gaps = 0/271 (0%)
 Frame = +3

Query  399   EVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLL  578
             +VL D  VEAV SQAP+V EVA+AAADS LPV ALQY+ID VH  TG NWWASIV TTLL
Sbjct  40    DVLKDTTVEAVTSQAPIVKEVAIAAADSALPVKALQYIIDAVHSYTGLNWWASIVLTTLL  99

Query  579   IRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVS  758
             IR  T+PL+I QLKATSKL ++RP ++ I+QE++++ M P AV EGQ+RMK LF EY  S
Sbjct  100   IRSATVPLLINQLKATSKLTIMRPHMEKIKQEIEDKAMDPVAVAEGQKRMKKLFKEYGAS  159

Query  759   PFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTF  938
             PF+  +G+FIQGP+F+SFFLAI NMAEK+PSFK GGA+WF DLTTPDS+YI PVLTAL+F
Sbjct  160   PFTPLKGLFIQGPVFISFFLAIRNMAEKMPSFKHGGAYWFVDLTTPDSLYILPVLTALSF  219

Query  939   WITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLV  1118
              ITVECN QEG+EGNP  GT+K  SR +A L++PFT  FPKA+FCYWITSN+FSL YGLV
Sbjct  220   LITVECNMQEGLEGNPVAGTMKKFSRGLAVLTVPFTMGFPKAIFCYWITSNLFSLVYGLV  279

Query  1119  IKRPKVKKLLGVPIIPPAPPRADQSSGLPFF  1211
             +K P VKK L +PIIP A P +   S    F
Sbjct  280   LKFPGVKKALRIPIIPQAAPTSGPQSPFSIF  310



>ref|XP_008233186.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Prunus mume]
 ref|XP_008233187.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Prunus mume]
Length=431

 Score =   364 bits (935),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 198/367 (54%), Positives = 254/367 (69%), Gaps = 15/367 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK---PESSSENPRVLTHLRHCYF  248
             MA RRS  TT    + +  +RF PS SHI  D+++  K   P SS   P + + L    +
Sbjct  1     MACRRSVSTT----VTFGTRRFHPSFSHILHDNNEDTKSHAPNSSLPPPVIKSTLPRGSY  56

Query  249   GNRISLGVGVARIPFQDRKFSPPPWAMA--PIWMRNMSTSVGEGMNKIE---YISEVLSD  413
              + +    G      ++R  S   W M       R MS  + +G +KI    Y +EV++D
Sbjct  57    NSTLGFCFGSL---CRERTGSSLSWKMGLGSFHCRYMSAIIDDGSDKINDVGYFAEVITD  113

Query  414   KAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
             K VE V SQAP V+EVA AAADS+ PVAALQYLID VH  TG NWWASI  TT+LIR  T
Sbjct  114   KTVEVVTSQAPAVSEVAAAAADSFFPVAALQYLIDGVHSFTGCNWWASIALTTILIRGAT  173

Query  594   LPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             +PL+I QL+AT++L L+RP L++++Q+MQ+  M P  + EGQ+RMK LF EY V+P S  
Sbjct  174   IPLLINQLRATTQLNLMRPHLEELKQQMQDMAMDPNVLQEGQKRMKALFKEYGVNPLSQL  233

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             + +FIQGPIF+SFFLA+ NMAEKVPSF+ GGA WFTDLTTPDS+ I PVLT+LTF ITVE
Sbjct  234   QPLFIQGPIFISFFLAVRNMAEKVPSFQSGGALWFTDLTTPDSLLILPVLTSLTFLITVE  293

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
             CN QEG+EGNP   T+KN SR +AA+S+P   SFPKA+FCYW+TSN+FSL+YGLVI+ P+
Sbjct  294   CNMQEGLEGNPIAQTMKNYSRILAAISVPVMMSFPKALFCYWLTSNLFSLTYGLVIRLPE  353

Query  1134  VKKLLGV  1154
             VK  LG+
Sbjct  354   VKSFLGL  360



>ref|XP_002297976.1| Inner membrane protein OXA1 [Populus trichocarpa]
 gb|EEE82781.1| Inner membrane protein OXA1 [Populus trichocarpa]
Length=459

 Score =   365 bits (936),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 207/398 (52%), Positives = 264/398 (66%), Gaps = 40/398 (10%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHL--RHCYFG  251
             MAY RS   +TRA ++  ++R+  S S+I  DDD +        + + +++L  +  +  
Sbjct  1     MAYVRS--LSTRANIV--RRRYNASFSYILHDDDRKHNSIEEGPSSKGMSNLFQQRSFGS  56

Query  252   NRISLGVGVARIPF------QDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---SEV  404
             +R      +A   F       D   SP   ++   + R+MST +G G   IE I   ++V
Sbjct  57    SRKRFDNNLAVFGFFHNRRCLDLSLSP---SIGVSFCRDMST-IGGGSENIELINDVADV  112

Query  405   LSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIR  584
             L+D   EAV++QAPVVNEVA+AAADSY PVAALQ++ID VH  TGFNWWASI+ TTLLIR
Sbjct  113   LTDTTFEAVSAQAPVVNEVAIAAADSYFPVAALQHVIDAVHSFTGFNWWASIIVTTLLIR  172

Query  585   WLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPF  764
               T+PL+I QLKAT+KL L+RP L++IRQ+M ++ M P A+ EGQ++MK LF EY VSP 
Sbjct  173   GATVPLLINQLKATTKLTLMRPHLEEIRQQMSDKAMDPMALAEGQKQMKKLFKEYGVSPL  232

Query  765   SAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWI  944
             +  +G+FIQGPIFVSFFLAISNM EKVPSFK GGA+WF DLTTPDS+YI P+LT LTFWI
Sbjct  233   TPLKGLFIQGPIFVSFFLAISNMTEKVPSFKSGGAYWFLDLTTPDSLYILPILTGLTFWI  292

Query  945   TVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGL---  1115
             TVECN QEG+EGNP   T+K VSR  A  S+P T  FP A+FCYW+TSN+FSL YGL   
Sbjct  293   TVECNMQEGLEGNPIAATMKKVSRVFAVASVPLTMGFPNAIFCYWVTSNLFSLFYGLGNL  352

Query  1116  ------------------VIKRPKVKKLLGVPIIPPAP  1175
                                +K P VKK LG+P IP AP
Sbjct  353   GSFNVQQLLDFCYFMNQQTLKAPGVKKFLGLPEIPVAP  390



>ref|XP_007218039.1| hypothetical protein PRUPE_ppa006036mg [Prunus persica]
 gb|EMJ19238.1| hypothetical protein PRUPE_ppa006036mg [Prunus persica]
Length=431

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 197/367 (54%), Positives = 255/367 (69%), Gaps = 15/367 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKK---PESSSENPRVLTHLRHCYF  248
             MA RRS  TT    + +  +RF P+ SHI  D+++  K   P SS   P + + L    +
Sbjct  1     MACRRSVSTT----VTFGTRRFHPAFSHILHDNNEDTKSHAPNSSLPPPVIKSTLPRGSY  56

Query  249   GNRISLGVGVARIPFQDRKFSPPPWAMA--PIWMRNMSTSVGEG---MNKIEYISEVLSD  413
              + +    G +R   ++R  S   W M       R MST + +G   +N I Y +EV++D
Sbjct  57    NSTLGFCFG-SRC--RERTGSSLSWKMGLGSFHCRYMSTIIDDGSDKINDIGYFAEVITD  113

Query  414   KAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
             K VE V SQAP  +EVA AAADS+ PVAALQYLID VH  TG NWWASI  TT+LIR  T
Sbjct  114   KTVEVVTSQAPAASEVAAAAADSFFPVAALQYLIDGVHSFTGCNWWASIALTTILIRGAT  173

Query  594   LPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             +PL+I QL+AT++L L+RP L++++Q+MQ+  M P  + EGQ+RMK LF EY V+P S  
Sbjct  174   IPLLINQLRATTQLNLMRPHLEELKQQMQDMAMDPNVLQEGQKRMKALFKEYGVNPLSQL  233

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             + +FIQGPIF+SFFLA+ NMAEKVPSF+ GGA WFTDLTTPDS+ I PVLT+LTF ITVE
Sbjct  234   QPLFIQGPIFISFFLAVRNMAEKVPSFQSGGALWFTDLTTPDSLLILPVLTSLTFLITVE  293

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
             CN QEG+EGNP   T+KN SR +AA+S+P    FPKA+FCYW+TSN+FSL+YGLVI+ P+
Sbjct  294   CNMQEGLEGNPIAQTMKNYSRILAAISVPVMMGFPKALFCYWLTSNLFSLTYGLVIRLPE  353

Query  1134  VKKLLGV  1154
             VK  LG+
Sbjct  354   VKTFLGL  360



>ref|XP_008376101.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Malus 
domestica]
 ref|XP_008376102.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Malus 
domestica]
Length=431

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 256/372 (69%), Gaps = 30/372 (8%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSEN----------PRVLT  227
             MA RRS  TT    + +  +RF PS SHI  D+++  KP S + +          P    
Sbjct  1     MACRRSVSTT----VTFVARRFNPSFSHILHDNNEDTKPTSPNSSSTPSVIKSILPSAHN  56

Query  228   HLRHCYFGNRISLGVGVARIPFQDRKFSPPPWAMA--PIWMRNMSTSVGEGMNKIE---Y  392
              +    FG++            ++R  S   W M       R MS+ +G+G +KI    Y
Sbjct  57    SITRFCFGSQC-----------RERTGSSLAWKMGLGSFSCRYMSSVIGDGSDKINDTGY  105

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
              +EV++DK +E V SQAP V+EVAVAAADS+ PVAALQYLID +H  TG NWWASI  TT
Sbjct  106   FAEVITDKTLEVVTSQAPAVSEVAVAAADSFPPVAALQYLIDGIHSFTGLNWWASIALTT  165

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYK  752
             +LIR  T+PL+I QL+AT++L L+RP+L+++RQ+MQN    P  + EGQ+RMK LFNEY 
Sbjct  166   ILIRGATVPLLIDQLRATTQLNLMRPRLEELRQQMQNMATDPNVMQEGQRRMKALFNEYG  225

Query  753   VSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTAL  932
             V+PFS  +G+FIQGPIFV FFLAI NMAEKVPSF+ GGA WFT+L TPDS+ I PVLT+L
Sbjct  226   VTPFSQLKGLFIQGPIFVCFFLAIRNMAEKVPSFESGGALWFTNLATPDSLLILPVLTSL  285

Query  933   TFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYG  1112
             TF ITVECN QEG+EGNP   T+KN SR +AA+SIP   SFPKA+FCYW+TSN+FSL+YG
Sbjct  286   TFLITVECNMQEGLEGNPIAQTMKNYSRILAAISIPVMMSFPKALFCYWLTSNMFSLAYG  345

Query  1113  LVIKRPKVKKLL  1148
             LVI+RP+VK  L
Sbjct  346   LVIRRPEVKSYL  357



>ref|XP_002530480.1| cytochrome oxidase biogenesis protein, putative [Ricinus communis]
 gb|EEF31903.1| cytochrome oxidase biogenesis protein, putative [Ricinus communis]
Length=423

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 204/378 (54%), Positives = 261/378 (69%), Gaps = 16/378 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDD-DDRKKPESSSENPRVLTHLRHCYFGN  254
             MAY RS   TTR+ LL  Q R A + S  H+D  DD K+  +S +     ++++   F +
Sbjct  1     MAYIRS--LTTRSTLLKQQYRPAFTFSLHHQDHYDDHKQHNNSIDE---FSYVQERGFRS  55

Query  255   RISLGVGVARIPFQDRK----FSPPPWAMAPIWMRNMSTSVGEGMN-KIEYISEV---LS  410
             + S    +    FQ+ +    +S  P   A       +T+VGEG + KIE +S+V   + 
Sbjct  56    KSSGSFNIKS--FQEIRLRDAYSLSPSIGASFCRYMSTTTVGEGSDHKIELMSDVADVVI  113

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
                     + A  VNEVA AAAD + PVA L ++ID VH +TGFNWWASIV TTL+IR L
Sbjct  114   TDTSAQSVAAASAVNEVAAAAADCFPPVAVLHHIIDAVHNLTGFNWWASIVLTTLVIRTL  173

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
              +PLMI QLKATSKL L+RP+L++I+Q+MQ+ GM PA + EG ++MK LF EY VSPF+ 
Sbjct  174   MVPLMINQLKATSKLTLMRPRLEEIKQQMQDTGMDPATIAEGNKQMKMLFKEYGVSPFTP  233

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +G+FIQGP+FV FFLAI NMAE VPSFK GGAFWF DL+TPDS+YIFPVLTALTFWIT+
Sbjct  234   MKGLFIQGPVFVCFFLAIRNMAENVPSFKNGGAFWFVDLSTPDSLYIFPVLTALTFWITI  293

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             E N QEG+EGNP  GT+KN+SR  AAL++P T  FPKA+FCYW+T+N+FS +YG V+K  
Sbjct  294   ELNMQEGLEGNPVAGTMKNISRVFAALTVPLTMGFPKAIFCYWVTTNLFSFAYGGVLKLH  353

Query  1131  KVKKLLGVPIIPPAPPRA  1184
              VKK LGVP IP APP A
Sbjct  354   GVKKFLGVPEIPVAPPSA  371



>ref|XP_010458195.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Camelina 
sativa]
Length=434

 Score =   361 bits (926),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 219/287 (76%), Gaps = 4/287 (1%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEY---ISEVLSDKAVEAVASQapvvnevav-aaaDSYLPVAALQYL  512
             R MS++ G G   I     I+EV+S+  ++ V +QA         AAADS+ P+AALQ+ 
Sbjct  86    RYMSSAPGVGSENIGVMSDIAEVISESTLQDVPAQAAAAVSEVTLAAADSFFPIAALQHC  145

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGF WWASIV  T+LIR  T+PL+I+Q+K T+KLAL++P+L+ IR+EMQN+GM
Sbjct  146   IDMVHSFTGFEWWASIVVATILIRSSTVPLLIKQMKDTTKLALMKPRLESIREEMQNKGM  205

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 + EGQ++MK+LF EY V+PF+  +G+ IQGP+F+ FFLAI NMAEKVPSF+ GGA 
Sbjct  206   DAVTMAEGQKKMKNLFKEYGVTPFTPMKGMLIQGPLFICFFLAIRNMAEKVPSFQTGGAL  265

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPDS+YI PV+T LTF ITVECNAQEGMEGNP  GTIKNV R  A L++P T S
Sbjct  266   WFTDLTTPDSLYILPVITGLTFLITVECNAQEGMEGNPMAGTIKNVFRGFALLTVPMTMS  325

Query  1053  FPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQS  1193
             FP+A+FCYWITSN+FSL YGLVIKRP+VKK+L +P +PP PP   QS
Sbjct  326   FPQAIFCYWITSNMFSLMYGLVIKRPQVKKMLRIPELPPTPPGQQQS  372



>ref|XP_011020075.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Populus 
euphratica]
 ref|XP_011020076.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Populus 
euphratica]
Length=425

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/290 (62%), Positives = 224/290 (77%), Gaps = 9/290 (3%)
 Frame = +3

Query  339   WMRNMSTSVGEGMNKIEYISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLID  518
             ++R MST+     +KI  +        ++ VA  AP  NEVA+AAADSYLPVAALQ++ID
Sbjct  79    FVRYMSTTTSAAADKINVV--------MDTVAQAAPATNEVAIAAADSYLPVAALQHVID  130

Query  519   YVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAP  698
              VH  TG NWWAS+V TTLLIR   LPL+I QLKATSKL++LRP L++++Q +  + M P
Sbjct  131   AVHNFTGLNWWASMVVTTLLIRSAMLPLLINQLKATSKLSILRPHLEEVKQRVDCQVMDP  190

Query  699   AAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWF  878
              AV+EGQ+ M+ LF E+ VSPF+  +GIFIQGP+F+SFFLAISNMAEKVPSFK GGA+WF
Sbjct  191   TAVSEGQKEMQKLFKEHGVSPFTPLKGIFIQGPVFISFFLAISNMAEKVPSFKSGGAYWF  250

Query  879   TDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFP  1058
              DLTTPD +YIFPVLTALTF +TVECN QEGMEGNP+ GT+KNVSRA+A  S+P T +FP
Sbjct  251   VDLTTPDGLYIFPVLTALTFLLTVECNTQEGMEGNPAAGTMKNVSRALAVASVPLTMNFP  310

Query  1059  KAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSSGLPF  1208
             KAVFCYW+TSN+FSL+YGLV+K P VKK+L +P +P  PP     S  PF
Sbjct  311   KAVFCYWVTSNLFSLAYGLVLKAPGVKKILRIPEVPVTPPTTGAKSS-PF  359



>gb|KEH31120.1| 60 kDa inner membrane protein [Medicago truncatula]
Length=425

 Score =   359 bits (922),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 198/384 (52%), Positives = 257/384 (67%), Gaps = 25/384 (7%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MAYRR  +   R KL+   +R  PS +++   DD+ K  E  S         +   F  R
Sbjct  1     MAYRRCLLQ--RGKLI--DRRSHPSFTYLLHTDDETKPDEKRSSTGFSNNSTQSRSF--R  54

Query  258   ISLGVGVARIPF----QDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV--LSDKA  419
              SL  G   I F    Q +  SP        + RNMS  + +  +KI  I++V  ++ +A
Sbjct  55    TSLNGG--SIGFFSSSQHKHLSP---FAGYNYCRNMSI-MDQSSDKITVITDVADVTSQA  108

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
                V+        VA+AAADSYLPV ALQY+ID VH  TG +WWA+I  TTL+IR  T+P
Sbjct  109   ATGVSE-------VAIAAADSYLPVQALQYVIDAVHLYTGLDWWAAIALTTLVIRTATVP  161

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L++ QLKATSKL L+RP+L+ I++EM  +   PAAV +GQ+RM  LF EY V+PF+  +G
Sbjct  162   LLVNQLKATSKLTLMRPRLEQIKEEMDGKTSDPAAVAQGQERMSKLFKEYGVTPFTPLKG  221

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             +FIQGP+F+SFFLAI+NMAEK+PSFK GGAFWFTDLTTPD++YIFPVLTAL+F I VE N
Sbjct  222   LFIQGPVFISFFLAITNMAEKMPSFKHGGAFWFTDLTTPDALYIFPVLTALSFLIVVETN  281

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              QEGMEGNP   T+K  SR +A LS+PFT SFPKA+FCYWITSN+FSL+YG+V++ P VK
Sbjct  282   MQEGMEGNPMGNTMKKFSRVLALLSVPFTLSFPKAIFCYWITSNLFSLTYGMVLRTPGVK  341

Query  1140  KLLGVPIIPPAPPRADQSSGLPFF  1211
             K LG+P +PPA P + + S    F
Sbjct  342   KTLGIPDLPPAEPTSSRQSPFSIF  365



>ref|XP_004298901.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Fragaria 
vesca subsp. vesca]
Length=423

 Score =   359 bits (921),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 197/361 (55%), Positives = 251/361 (70%), Gaps = 14/361 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MAY R    ++RA ++  +++  P I H+H D+D   +P  S      LT  R  +FG+ 
Sbjct  1     MAYWRG--LSSRATIVARRKQHHPFIYHLH-DNDVVSEPSPSPNTNHFLTQKR--FFGST  55

Query  258   ISLGV-GVARIPFQDRKFSPPPWAMAPI-WMRNMSTSVGEGMNKIEYISEVLSDKAVEAV  431
             +   V G        R  +    + A   + RNMST+ G G   +    E+LS    EAV
Sbjct  56    LDYKVSGFGGFGRNQRVSNALLLSAAGFGFGRNMSTASGGGFGDVP---ELLS----EAV  108

Query  432   ASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQ  611
               Q P VNEVA+AAADSYLPV  LQYLIDYVH  +G NWWA+IV TTLLIR  T+PL++ 
Sbjct  109   TKQLPAVNEVAIAAADSYLPVKGLQYLIDYVHTTSGLNWWAAIVVTTLLIRSCTVPLLVN  168

Query  612   QLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQ  791
             QLKAT+KL L+RP+L+++++EM+++GM   A  E Q+++K LF EY  SP +  +G+FIQ
Sbjct  169   QLKATAKLTLMRPRLEELKEEMESKGMDLEAKLEYQKKIKMLFKEYGCSPLTPLKGLFIQ  228

Query  792   GPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEG  971
              P+F+SFFLAISNMAEKVPSFK+GGA+WF DLTTPD MYIFP+L  LTF ITVECN QEG
Sbjct  229   APVFISFFLAISNMAEKVPSFKDGGAYWFVDLTTPDPMYIFPILAGLTFLITVECNLQEG  288

Query  972   MEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLG  1151
             MEGNP   T+KNVSR MA L++PFT SFPKAVFCYW+TSN+FSL YG V+K P VKK LG
Sbjct  289   MEGNPVAKTMKNVSRGMAVLTVPFTMSFPKAVFCYWVTSNLFSLGYGFVVKNPFVKKTLG  348

Query  1152  V  1154
             +
Sbjct  349   L  349



>ref|XP_002866467.1| hypothetical protein ARALYDRAFT_496379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42726.1| hypothetical protein ARALYDRAFT_496379 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   358 bits (918),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/285 (61%), Positives = 219/285 (77%), Gaps = 8/285 (3%)
 Frame = +3

Query  327   MAPI----WMRNMSTSVGEGMNKIEY---ISEVLSDKAVEAVASQapvvnevav-aaaDS  482
             MAP+    + R MST+ G G  KI     I+EV++D  ++ V +QA         AAADS
Sbjct  71    MAPMSAFAFYRYMSTAPGVGSEKIGVMSDIAEVITDSTLQDVPAQAAAAVSEVTLAAADS  130

Query  483   YLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDD  662
             + P+AALQ+ ID VH  TGF WWASIV  T+LIR  T+PL+I+Q+K T+KLAL+RP+L+ 
Sbjct  131   FFPIAALQHCIDMVHSFTGFGWWASIVVATILIRSSTVPLLIKQMKDTTKLALMRPRLES  190

Query  663   IRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEK  842
             IR+EMQN+GM    + EGQ++MK+LF EY V+PF+  +G+FIQGP+F+ FFLAI NMAEK
Sbjct  191   IREEMQNKGMDSVTMAEGQKKMKNLFKEYGVTPFTPMKGMFIQGPLFICFFLAIRNMAEK  250

Query  843   VPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAM  1022
             VPSF+ GGA WFTDLTTPDS+YI PV+T LTF ITVECNAQEGMEGNP  GT+KNV R  
Sbjct  251   VPSFQTGGALWFTDLTTPDSLYILPVITGLTFLITVECNAQEGMEGNPMAGTVKNVCRGF  310

Query  1023  AALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             A L++P T SFP+A+FCYWITSN+FSL YGLVIKRP+VKK+L +P
Sbjct  311   ALLTVPMTMSFPQAIFCYWITSNLFSLMYGLVIKRPQVKKMLRIP  355



>ref|XP_010483945.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Camelina 
sativa]
Length=433

 Score =   355 bits (910),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 176/282 (62%), Positives = 221/282 (78%), Gaps = 4/282 (1%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEY---ISEVLSDKAVE-AVASQapvvnevavaaaDSYLPVAALQYL  512
             R MS++ G G   I     I+EV+S+  ++ A A  A  V+EV +AAADS+ P+AALQ+ 
Sbjct  85    RYMSSAQGVGSENIGVMSDIAEVISESTLQDAPAQAAAAVSEVTLAAADSFFPIAALQHC  144

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGF WWASIV  T+LIR  T+PL+I+Q+K T+KLAL++P+L+ IR+EMQN+GM
Sbjct  145   IDMVHSFTGFEWWASIVVATILIRSSTVPLLIKQMKDTTKLALMKPRLESIREEMQNKGM  204

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 + EGQ++MK+LF EY V+PF+  +G+ IQGP+F+ FFLAI NMAEKVPSF+ GGA 
Sbjct  205   DAVTMAEGQKKMKNLFKEYGVTPFTPMKGMLIQGPLFICFFLAIRNMAEKVPSFQTGGAL  264

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPDS+YI PV+T LTF ITVECNAQEGMEGNP  GTIKNV R  A L++P T S
Sbjct  265   WFTDLTTPDSLYILPVITGLTFLITVECNAQEGMEGNPMAGTIKNVFRGFALLTVPMTMS  324

Query  1053  FPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPP  1178
             FP+A+FCYWITSNIFSL YGLVIKRP+VKK+L +P +PP PP
Sbjct  325   FPQAIFCYWITSNIFSLMYGLVIKRPQVKKMLRIPELPPTPP  366



>ref|XP_009151326.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Brassica 
rapa]
Length=429

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 194/367 (53%), Positives = 249/367 (68%), Gaps = 17/367 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDD-DRKKPESSSENPRVLTHLRHCYFGN  254
             MA+RR+   + R+ L+  + + A  I  I RD+D D    E S  + R      H    +
Sbjct  1     MAFRRA--LSIRSTLISRRNQLAFHI--IPRDNDHDHDHEEGSFTSQRSYHSFLHQKNAD  56

Query  255   RISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---SEVLSDKAV-  422
                   G  R+P        P  A A  + R MS++ G G  KI  I   +EV++D    
Sbjct  57    LSHFPGGGLRVPL------APSSASAFAFYRYMSSAHGVGSEKIGVINDIAEVITDSTTL  110

Query  423   --EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
                   + A  V EVA+AA DS+LP+AALQ+ ID VHC TG  WWASIV  T+LIR  T+
Sbjct  111   QDVPAQAAAAAVGEVALAANDSFLPIAALQHCIDMVHCYTGLEWWASIVLATVLIRSSTV  170

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PL+I+Q+K T KL+L++P+L+ IR+EMQN+GM    + EGQ++MK+LF EY V+PF+  +
Sbjct  171   PLLIKQMKDTMKLSLMKPRLEAIREEMQNKGMDQVTMAEGQKKMKNLFKEYGVTPFTPMK  230

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             G+ IQGP+F+ FFLAI NMAEKVPSF+ GGA WFTDLTTPDS+YI PV+TALTF ITVE 
Sbjct  231   GMLIQGPLFICFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYILPVITALTFLITVEL  290

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             NAQEGMEGNP  GTIKNV R  A L++P T SFP+A+FCYWITSN+FSL+YGLVIKRP+V
Sbjct  291   NAQEGMEGNPMAGTIKNVFRGFALLTVPMTMSFPQAIFCYWITSNLFSLTYGLVIKRPQV  350

Query  1137  KKLLGVP  1157
             KKLL +P
Sbjct  351   KKLLKIP  357



>ref|XP_010659217.1| PREDICTED: mitochondrial inner membrane protein OXA1 [Vitis vinifera]
Length=445

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 183/364 (50%), Positives = 240/364 (66%), Gaps = 17/364 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENP-RVLTHLRHCYFGN  254
             MAYRRS IT  R   L   +R  PS  +I  D+D +++   S ++P R+   L    FG+
Sbjct  1     MAYRRSVIT--RGGFL--ARRIHPSFGYISHDEDRKQRSADSYQSPQRISDFLLRRSFGS  56

Query  255   RISLGVGVARIPFQDRKFSPPPW--AMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAVEA  428
             +I+   G     FQ + FSP     A+   + R MST++GEG   I  I+E   D    A
Sbjct  57    KINTSGGFGAF-FQGKGFSPLSHQVAVGSSYSRYMSTAIGEGSENIGVIAETPVDLIANA  115

Query  429   ---VASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
                VAS+  +         DS+  V  LQ+LI  VH  TG +W ASI  TTLLIR +T+P
Sbjct  116   TVDVASEVSIAAA------DSFFLVGILQHLIGGVHSYTGLSWAASIALTTLLIRGMTVP  169

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L++ QLK+TSKL L+RP L+ IR+EMQ +GM P+AV EG +RM+ +F EY V+PF+  +G
Sbjct  170   LLVNQLKSTSKLTLMRPHLEAIREEMQAKGMEPSAVAEGNKRMQQIFKEYGVTPFTPLKG  229

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             + IQGP+FVSFFL ISNM +KVPSFK GGA WFTDLTTPDS YI P+L  LTF ITVE N
Sbjct  230   LIIQGPVFVSFFLGISNMVQKVPSFKTGGALWFTDLTTPDSFYIMPILAGLTFLITVEFN  289

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              Q+GM+GNP+ GT+K  SRA+A LS+PFT +F + +FCYWI SN+FSL+YG  +K+P VK
Sbjct  290   MQDGMQGNPTAGTMKKFSRALAFLSVPFTMNFAQGIFCYWIPSNLFSLAYGFAVKQPAVK  349

Query  1140  KLLG  1151
             K+ G
Sbjct  350   KMFG  353



>ref|XP_010444079.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Camelina 
sativa]
Length=433

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/282 (62%), Positives = 221/282 (78%), Gaps = 4/282 (1%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEY---ISEVLSDKAVE-AVASQapvvnevavaaaDSYLPVAALQYL  512
             R MS++ G G   I     I+EV+S+  ++ A A  A  V+EV +AAADS+ P+AALQ+ 
Sbjct  85    RYMSSAQGVGSENIGVMSDIAEVISESTLQDAPAQAAAAVSEVTLAAADSFFPIAALQHC  144

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGF WWASIV  T+LIR  T+PL+I+Q+K T+KLAL++P+L+ IR+EMQN+GM
Sbjct  145   IDMVHSFTGFEWWASIVVATILIRSSTVPLLIKQMKDTTKLALMKPRLESIREEMQNKGM  204

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 + EGQ++MK+LF EY V+PF+  +G+ IQGP+F+ FFLAI NMAEKVPSF+ GGA 
Sbjct  205   DAVTMVEGQKKMKNLFKEYGVTPFTPMKGMLIQGPLFICFFLAIRNMAEKVPSFQTGGAL  264

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPDS+YI PV+T LTF ITVECNAQEGMEGNP  GTIKNV R  A L++P T S
Sbjct  265   WFTDLTTPDSLYILPVITGLTFLITVECNAQEGMEGNPMAGTIKNVFRGFALLTVPMTMS  324

Query  1053  FPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPP  1178
             FP+A+FCYWITSN+FSL YGLVIKRP+VKK+L +P +PP PP
Sbjct  325   FPQAIFCYWITSNMFSLMYGLVIKRPQVKKMLRIPELPPTPP  366



>ref|NP_201011.1| mitochondrial inner membrane protein OXA1 [Arabidopsis thaliana]
 sp|Q42191.2|OXA1_ARATH RecName: Full=Mitochondrial inner membrane protein OXA1; AltName: 
Full=Oxidase assembly 1 protein; Short=AtOXA1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA72619.1| Oxa1 protein [Arabidopsis thaliana]
 dbj|BAA88473.1| AtOXA1 [Arabidopsis thaliana]
 dbj|BAB10166.1| Oxa1 protein [Arabidopsis thaliana]
 gb|AAM67144.1| AtOXA1 [Arabidopsis thaliana]
 gb|AAM98148.1| AtOXA1 [Arabidopsis thaliana]
 gb|AAP31918.1| At5g62050 [Arabidopsis thaliana]
 gb|AED97555.1| mitochondrial inner membrane protein OXA1 [Arabidopsis thaliana]
Length=429

 Score =   353 bits (905),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 245/367 (67%), Gaps = 19/367 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKP---ESSSENPRVLTHLRHCYF  248
             MA+R++   + R++L    +R  P    I R+ D  +     E+S  +     H R    
Sbjct  1     MAFRQT--LSIRSRLF--ARRNQPVYHIIPRESDHERDSFCQETSQRSYHSFLHQRSVNN  56

Query  249   GNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEY---ISEVLSDKA  419
              +   +  G   +P        P    A  + R MS++ G G  KI     I+EV++D  
Sbjct  57    SDFSKVSGGSLHLPL------APTSGFA--FYRYMSSAPGVGSEKIGVMSDIAEVITDST  108

Query  420   VEAVASQapvvnevav-aaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
             ++ V +QA         AAADS+ P+AALQ  ID VH  TGF WWASIV  T+LIR  T+
Sbjct  109   LQDVPAQAAAAVSEVTLAAADSFFPIAALQQCIDMVHTFTGFEWWASIVVATILIRSSTV  168

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PL+I+Q+K T+KLAL+RP+L+ IR+EMQN+GM    + EGQ++MK+LF EY V+PF+  +
Sbjct  169   PLLIKQMKDTTKLALMRPRLESIREEMQNKGMDSVTMAEGQKKMKNLFKEYGVTPFTPMK  228

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             G+FIQGP+F+ FFLAI NMAEKVPSF+ GGA WFTDLTTPDS+YI PV+T LTF ITVEC
Sbjct  229   GMFIQGPLFICFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYILPVITGLTFLITVEC  288

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             NAQEGMEGNP  GT+K V R  A L++P T SFP+A+FCYWITSN+FSL YGLVIKRP+V
Sbjct  289   NAQEGMEGNPMAGTVKTVCRVFALLTVPMTMSFPQAIFCYWITSNLFSLMYGLVIKRPQV  348

Query  1137  KKLLGVP  1157
             KK+L +P
Sbjct  349   KKMLRIP  355



>emb|CBI34480.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   353 bits (906),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/364 (50%), Positives = 240/364 (66%), Gaps = 17/364 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENP-RVLTHLRHCYFGN  254
             MAYRRS IT  R   L   +R  PS  +I  D+D +++   S ++P R+   L    FG+
Sbjct  1     MAYRRSVIT--RGGFL--ARRIHPSFGYISHDEDRKQRSADSYQSPQRISDFLLRRSFGS  56

Query  255   RISLGVGVARIPFQDRKFSPPPW--AMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAVEA  428
             +I+   G     FQ + FSP     A+   + R MST++GEG   I  I+E   D    A
Sbjct  57    KINTSGGFGAF-FQGKGFSPLSHQVAVGSSYSRYMSTAIGEGSENIGVIAETPVDLIANA  115

Query  429   ---VASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
                VAS+  +         DS+  V  LQ+LI  VH  TG +W ASI  TTLLIR +T+P
Sbjct  116   TVDVASEVSIAAA------DSFFLVGILQHLIGGVHSYTGLSWAASIALTTLLIRGMTVP  169

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L++ QLK+TSKL L+RP L+ IR+EMQ +GM P+AV EG +RM+ +F EY V+PF+  +G
Sbjct  170   LLVNQLKSTSKLTLMRPHLEAIREEMQAKGMEPSAVAEGNKRMQQIFKEYGVTPFTPLKG  229

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             + IQGP+FVSFFL ISNM +KVPSFK GGA WFTDLTTPDS YI P+L  LTF ITVE N
Sbjct  230   LIIQGPVFVSFFLGISNMVQKVPSFKTGGALWFTDLTTPDSFYIMPILAGLTFLITVEFN  289

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              Q+GM+GNP+ GT+K  SRA+A LS+PFT +F + +FCYWI SN+FSL+YG  +K+P VK
Sbjct  290   MQDGMQGNPTAGTMKKFSRALAFLSVPFTMNFAQGIFCYWIPSNLFSLAYGFAVKQPAVK  349

Query  1140  KLLG  1151
             K+ G
Sbjct  350   KMFG  353



>ref|XP_008799548.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Phoenix dactylifera]
Length=426

 Score =   351 bits (901),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 202/390 (52%), Positives = 260/390 (67%), Gaps = 39/390 (10%)
 Frame = +3

Query  78    MAYRRSSIT---TTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYF  248
             MA  R S+T   TTR       +RF PS +HI+ DD DR    SS       +   H Y 
Sbjct  1     MACARRSLTSNFTTRIT-----RRFHPSFAHINHDDRDRPPLPSSPPA-SAFSRSVHGYG  54

Query  249   GNRI-----SLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV---  404
             G        +LG  +             P  + P  +R+ S+S  EG N+++YI +V   
Sbjct  55    GGSSLRDPRTLGFSL-------------PLGLEPSLLRSYSSS-AEGSNEVDYIKDVAGV  100

Query  405   LSDKAVEAVASQapvvn------evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVC  566
             L+D +VE  A+ A          EVA AAADS+LPVAALQYLID VH  TG NWWASI  
Sbjct  101   LTDNSVETAAATAAAAAPAPFAGEVAAAAADSFLPVAALQYLIDGVHSFTGLNWWASIAL  160

Query  567   TTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNE  746
             TT+LIR  T+PL++ Q+KAT KL  +RP+L+ ++Q++ +  M P +V EGQ+RMK LF +
Sbjct  161   TTVLIRGATVPLLLNQMKATVKLNTMRPELEQLKQQINS--MDPESVQEGQKRMKALFQK  218

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLT  926
             + V+PF+  +G+FIQGPIF+SF+LAISNM EKVPSFK GGAFWFTDLTTPD++Y+ PVLT
Sbjct  219   HGVTPFTPLKGMFIQGPIFISFYLAISNMVEKVPSFKGGGAFWFTDLTTPDTLYMLPVLT  278

Query  927   ALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLS  1106
             +L+F +TVE N QEGMEGNP   T+KN SR +A L+IPFTA+FPKA+FCYWITSN+FSL+
Sbjct  279   SLSFLMTVELNMQEGMEGNPMASTMKNFSRILALLTIPFTANFPKAIFCYWITSNLFSLT  338

Query  1107  YGLVIKRPKVKKLLGVPIIPPAPPRADQSS  1196
             YGLVIKRP V++ L +P I P P  A Q S
Sbjct  339   YGLVIKRPPVRRYLNLPDIVPQPNPAPQPS  368



>emb|CDY00249.1| BnaA06g21500D [Brassica napus]
Length=489

 Score =   353 bits (906),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/367 (52%), Positives = 254/367 (69%), Gaps = 17/367 (5%)
 Frame = +3

Query  72    SRMAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFG  251
             S MA+RR+   + R+ L+  + + A  I  I RD+++     +S  +     H +     
Sbjct  63    SAMAFRRA--LSIRSTLISRRNQLAFHI--IPRDNEE--GSFTSQRSYHSFLHQKTAVSS  116

Query  252   NRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---SEVLSDK-A  419
             +      G  R+P        P  A A  + R MS++ G G  KI  I   +EV++D  +
Sbjct  117   DLSHFPGGGLRVPLA------PSSASAFAFYRYMSSAHGVGSEKIGVINDIAEVITDSTS  170

Query  420   VEAVASQapvvn-evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
             ++ V +QA     EVA+AA DS+LP+AALQ+ ID VHC TG  WWASIV  T+LIR  T+
Sbjct  171   LQDVPAQAAAAVGEVALAANDSFLPIAALQHCIDMVHCYTGLEWWASIVLATVLIRSSTV  230

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             PL+I+Q+K T KL+L++P+L+ IR+EMQN+GM    + EGQ++MK+LF EY V+PF+  +
Sbjct  231   PLLIKQMKDTMKLSLMKPRLEAIREEMQNKGMDQVTMAEGQKKMKNLFKEYGVTPFTPMK  290

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             G+ IQGP+F+ FFLAI NMAEKVPSF+ GGA WFTDLTTPDS+YI PV+TALTF ITVE 
Sbjct  291   GMLIQGPLFICFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYILPVITALTFLITVEL  350

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKV  1136
             NAQEGMEGNP  GTIKNV R  A L++P T SFP+A+FCYWITSN+FSL+YGLVIKRP+V
Sbjct  351   NAQEGMEGNPMAGTIKNVFRGFALLTVPMTMSFPQAIFCYWITSNLFSLTYGLVIKRPQV  410

Query  1137  KKLLGVP  1157
             KKLL +P
Sbjct  411   KKLLKIP  417



>emb|CDX86930.1| BnaC03g52000D [Brassica napus]
Length=499

 Score =   353 bits (906),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 251/369 (68%), Gaps = 16/369 (4%)
 Frame = +3

Query  72    SRMAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFG  251
             S MA+RR+   + R+ L+  + + A    HI   D+D    E S  + R      H +  
Sbjct  68    SAMAFRRA--LSIRSTLISRRNQLA---FHIIPRDNDHDHEEGSFTSQRSY----HSFLH  118

Query  252   NRISLGVGVARIPFQDRKFS-PPPWAMAPIWMRNMSTSVGEGMNKIEYI---SEVLSDKA  419
              R ++   ++  P    +    P  A A  + R MS++ G G  KI  I   +EV++D  
Sbjct  119   QRSAISSDLSHFPGGGLRVPLAPTSASAFAFYRYMSSAHGVGSEKIGVINDIAEVITDST  178

Query  420   V---EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
                     + A  V EVA+AA DS+LP+AALQ+ ID VHC TG  WWASIV  T+LIR  
Sbjct  179   TLQDVPAQAAAAAVGEVALAANDSFLPIAALQHCIDMVHCYTGLEWWASIVLATVLIRSS  238

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
             T+PL+I+Q+K T KL+L++P+L+ IR+EMQN+GM    + EGQ++MK+LF EY V+PF+ 
Sbjct  239   TVPLLIKQMKDTMKLSLMKPRLEAIREEMQNKGMDQVTMAEGQKKMKNLFKEYGVTPFTP  298

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +G+ IQGP+F+ FFLAI NMAEKVPSF+ GGA WFTDLTTPDS+YI PV+TALTF ITV
Sbjct  299   MKGMLIQGPLFICFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYILPVITALTFLITV  358

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             E NAQEGMEGNP  GTIKNV R  A L++P T SFP+A+FCYWITSN+FSL+YGLVIKRP
Sbjct  359   ELNAQEGMEGNPMAGTIKNVFRGFALLTVPMTMSFPQAIFCYWITSNLFSLTYGLVIKRP  418

Query  1131  KVKKLLGVP  1157
             +VKKLL +P
Sbjct  419   QVKKLLKIP  427



>gb|KHF97323.1| Mitochondrial inner membrane OXA1 -like protein [Gossypium arboreum]
Length=440

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 255/375 (68%), Gaps = 18/375 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPES---SSENPRVLTHLRHCYF  248
             MA+ RS   ++RA L+   +R+ PS ++I  DD+ +  P +   S++ P      R   F
Sbjct  1     MAFSRS--LSSRATLI--ARRYQPSFAYIFHDDERKTHPSTEPQSTQKPGNFVQQRS--F  54

Query  249   GNRIS-LGVGVARIPFQDRKFSPPPW--AMAPIWMRNMSTSVGEGMNKIEY---ISEVLS  410
             G   S    G+  + FQDR+ S   +       + R MST V +G  ++E+   ++E   
Sbjct  55    GTGFSNSSSGLCGLLFQDRRCSQLAFLPGTGVSFGRFMSTKVNDGAKEVEFMTDVAEAFK  114

Query  411   DKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWL  590
             D A+EAV SQ P VNEVA+AAAD +LPVA LQY+ID VH  TGFNWWASIV TTLLIR  
Sbjct  115   DTAIEAVTSQVPAVNEVAIAAADCWLPVATLQYVIDAVHSFTGFNWWASIVVTTLLIRSA  174

Query  591   TLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSA  770
             T+PL+I QLKAT+K+ L+RP+L+++++ M ++G    ++ EGQ  M+ LF EY V+PF+ 
Sbjct  175   TVPLLINQLKATTKMTLMRPRLEEVKERMSSKGSDALSMAEGQNEMQKLFKEYGVTPFTP  234

Query  771   FRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
              +GIFIQGPIFVSFFLAIS MAEK+ SFK GGA+WFTDL+TPDS+YIFPV+TALTF +TV
Sbjct  235   LKGIFIQGPIFVSFFLAISTMAEKMESFKSGGAYWFTDLSTPDSLYIFPVMTALTFLLTV  294

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             ECN QEGMEGNP+  TIKNVSR  A L++PFT SFPK +   W     F L+   V+K P
Sbjct  295   ECNMQEGMEGNPAAATIKNVSRVFAVLTVPFTMSFPKVI---WAFLKRFPLTSLYVLKAP  351

Query  1131  KVKKLLGVPIIPPAP  1175
              VKK LGVP IP  P
Sbjct  352   GVKKALGVPEIPKQP  366



>ref|XP_006280517.1| hypothetical protein CARUB_v10026454mg [Capsella rubella]
 gb|EOA13415.1| hypothetical protein CARUB_v10026454mg [Capsella rubella]
Length=429

 Score =   350 bits (898),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/282 (62%), Positives = 221/282 (78%), Gaps = 4/282 (1%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEY---ISEVLSDKAVE-AVASQapvvnevavaaaDSYLPVAALQYL  512
             R MS++ G G   I     I+EV+S+  ++ A A  A  V+EV +AAADS+ P+AALQ+ 
Sbjct  81    RYMSSAPGVGSENIGVMTDIAEVISESTLQDAPAQAAAAVSEVTIAAADSFPPIAALQHC  140

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGF WWASIV  T+LIR  T+PL+I+Q+K T+KLAL++P+L+ IR+EMQN+GM
Sbjct  141   IDMVHSFTGFGWWASIVVATILIRSATVPLLIKQMKDTTKLALMKPRLESIREEMQNKGM  200

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 + EGQ++MK+LF EY V+PF+  +G+ IQGP+F+SFFLAI NMAEKVPSF+ GGA 
Sbjct  201   DAVTMAEGQKKMKNLFKEYGVTPFTPMKGMLIQGPLFISFFLAIRNMAEKVPSFQTGGAL  260

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPDS+YI PV+T LTF ITVECNAQEGMEGNP  GTIKNV R  A L++P T S
Sbjct  261   WFTDLTTPDSLYILPVITGLTFLITVECNAQEGMEGNPMAGTIKNVFRGFALLTVPMTMS  320

Query  1053  FPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPP  1178
             FP+A+FCYWITSN+FSL YGLVIKRP+VKK+L +P +PP  P
Sbjct  321   FPQAIFCYWITSNMFSLMYGLVIKRPQVKKMLRIPELPPPTP  362



>ref|XP_010919268.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Elaeis guineensis]
Length=430

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 251/378 (66%), Gaps = 11/378 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MA  R S+T+     +   +R  PS +HI  +D D          P   +     +  + 
Sbjct  1     MACARRSLTSNFTTHII--RRLHPSFAHILHEDRDDATAGHLQRPPLPSSPPASAFSRSV  58

Query  258   ISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---SEVLSDKAVEA  428
                G G      +   FS P   + P  +R+ S S  EG N+++YI   +EVL+D +VE 
Sbjct  59    TGFGGGFLLRDPRTIGFSLP-LGLEPSLLRSYS-SRAEGSNEVDYIKDVAEVLTDNSVET  116

Query  429   VASQapvvn--evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
              A+ AP     EVA AAADS+ PVAALQYLID VH  TG NWWASI  TT+LIR  T+PL
Sbjct  117   AAAMAPAPFAGEVAAAAADSFFPVAALQYLIDGVHSFTGLNWWASIALTTVLIRGATIPL  176

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             ++ Q+KAT KL  +RP+L+ ++Q++    M P +V EGQ+RM  LF ++ V+PF+  +G+
Sbjct  177   LLNQMKATVKLNTMRPELEQLKQQINT--MDPESVQEGQKRMNALFRKHGVTPFTPLKGM  234

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
             FIQGPIF+SF+LAISNM EKVPSFK GGAFWFTDLTTPD +Y+ PVLTALTF  TVE N 
Sbjct  235   FIQGPIFISFYLAISNMVEKVPSFKGGGAFWFTDLTTPDPLYMLPVLTALTFLTTVELNM  294

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKK  1142
             QEGMEGNP  GT+KN SR +A L++PFTA+FPKA+FCYWITSN+FSL YGLVIKRP V++
Sbjct  295   QEGMEGNPMVGTMKNFSRILALLTVPFTANFPKAIFCYWITSNLFSLIYGLVIKRPPVRR  354

Query  1143  LLGVPIIPPAPPRADQSS  1196
              L +P I P P  A Q S
Sbjct  355   YLNLPDIVPQPNPAPQPS  372



>ref|XP_009382302.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Musa 
acuminata subsp. malaccensis]
Length=426

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 195/393 (50%), Positives = 251/393 (64%), Gaps = 35/393 (9%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLR-------  236
             MA  R S+T+    L    +R  PS +HI RDD +  +P +        +  R       
Sbjct  1     MACGRRSLTSNFTHL---TRRLHPSFAHILRDDRESTEPPNRPPLSPTPSLPRPSSFAPS  57

Query  237   HCYFGNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---SEVL  407
                FG R SLG  +             P  + P  +R+ S+S  EG N+I+YI   SEVL
Sbjct  58    FSGFGGRRSLGFSL-------------PLGLDPCLLRSYSSS-AEGSNEIDYIKDVSEVL  103

Query  408   SDKAVEAVASQapvvn-----evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             S   VE     A         EVA AAADS+LPVAALQ+LID VH  +G NWWASI  TT
Sbjct  104   SGSTVETATVAAAAAPAPFPGEVAAAAADSFLPVAALQHLIDGVHTFSGLNWWASIALTT  163

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYK  752
             +LIR  T+PL++ Q+K+T KL+++RP++++++++M    M P +V EGQ++MK LF +Y 
Sbjct  164   VLIRGATIPLLLNQMKSTVKLSMMRPEMEELKKQMDT--MDPKSVQEGQKQMKALFQKYG  221

Query  753   VSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTAL  932
             V+PF+  +G+FIQGP+F+SFF AISNM EKVPSFK GGAFWFTDLTTPD  YI P LTAL
Sbjct  222   VTPFTPLKGLFIQGPVFISFFFAISNMVEKVPSFKGGGAFWFTDLTTPDPQYILPALTAL  281

Query  933   TFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYG  1112
             TF  TVE N QEGMEGNP   T+KN SR +A +++PFTA FPKA+FCYWITSN+FSL YG
Sbjct  282   TFLATVEFNLQEGMEGNPMAKTMKNFSRVLALMTVPFTAHFPKAIFCYWITSNLFSLMYG  341

Query  1113  LVIKRPKVKKLLGVPIIPPAPPRADQSSGLPFF  1211
              VI+ P V+K L +P + P P  A Q  G  FF
Sbjct  342   FVIRHPPVRKFLDLPDMVPPPTPASQ-PGFSFF  373



>ref|XP_006381144.1| hypothetical protein POPTR_0006s07260g [Populus trichocarpa]
 gb|ERP58941.1| hypothetical protein POPTR_0006s07260g [Populus trichocarpa]
Length=365

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/259 (65%), Positives = 206/259 (80%), Gaps = 8/259 (3%)
 Frame = +3

Query  339   WMRNMSTSVGEGMNKIEYISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLID  518
             ++R MST+     +KI  +        ++ VA  AP  NEVA+AAADSYLPVAALQY+ID
Sbjct  81    FVRYMSTTTTAAADKINVV--------MDTVAQAAPAANEVAIAAADSYLPVAALQYVID  132

Query  519   YVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAP  698
              VH  TG NWWAS+V TTLLIR   LPL+I QLKATSKL++LRP L++++Q +  + M P
Sbjct  133   AVHNFTGLNWWASMVVTTLLIRSAMLPLLINQLKATSKLSILRPHLEEVKQRVDCQVMDP  192

Query  699   AAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWF  878
              AV+EGQ+ M+ LF E+ VSPF+  +GIFIQGP+F+SFFLAISNMAEKVPSFK GGA+WF
Sbjct  193   TAVSEGQKEMQKLFKEHGVSPFTPLKGIFIQGPVFISFFLAISNMAEKVPSFKSGGAYWF  252

Query  879   TDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFP  1058
              DLTTPD +YIFPVLTALTF +TVECN QEGMEGNP+ GT+KNVSRA+A  S+P T +FP
Sbjct  253   VDLTTPDGLYIFPVLTALTFLLTVECNTQEGMEGNPAAGTMKNVSRALAVASVPLTMNFP  312

Query  1059  KAVFCYWITSNIFSLSYGL  1115
             KAVFCYW+TSN+FSL+YGL
Sbjct  313   KAVFCYWVTSNLFSLAYGL  331



>ref|XP_010551119.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
Length=410

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 244/372 (66%), Gaps = 19/372 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPS--ISHIHRDDDDRKKPESSSENPRVLTHLRHCYFG  251
             MA+R S   + R+ L   + + +PS  I+H +  D D      S  +     H R     
Sbjct  1     MAFRHS--LSIRSTLSARRYQLSPSCIITHDNDHDLDLSCQTQSQRSYHSFLHQRSSNHS  58

Query  252   NRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAVEAV  431
                 +  G +        FS  P + +  + R MS++ G G +    I++VL+D A++AV
Sbjct  59    VSSQMSRGCSH-------FSLFPTSGSAFY-RYMSSAPGAGSD----IADVLTDSALQAV  106

Query  432   ASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQ  611
             ASQ  VV+EVA AA DS+ P+AALQ+ I  VH  TG +WW SIV  TLLIR + +PL+I 
Sbjct  107   ASQTVVVSEVANAAKDSFFPIAALQHFIGMVHSFTGLDWWLSIVLATLLIRTMMVPLLID  166

Query  612   QLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFI-  788
             QLK T++ ALLRP+L+ ++++MQN  M P A  +G+++MK L  EY VS F+  +G+FI 
Sbjct  167   QLKTTTQCALLRPQLEAVQRDMQNERMDPTAAADGEKQMKALMKEYGVSSFTPMKGLFIL  226

Query  789   --QGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
               QGP+FV FFLAI NMAEKVPSF+ GGA WFTDLTTPDS+YIFPVLT L+F I VECN+
Sbjct  227   LIQGPLFVCFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYIFPVLTGLSFLIAVECNS  286

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKK  1142
             QEG E N   G +KN  RA A L++P T SFPKA+F YWITSN+FSL Y LVIKRP+VKK
Sbjct  287   QEGTEWNTMAGAVKNFYRAFAVLTVPLTMSFPKAIFFYWITSNLFSLIYDLVIKRPQVKK  346

Query  1143  LLGVPIIPPAPP  1178
             +LGVP +PP  P
Sbjct  347   VLGVPELPPPEP  358



>ref|XP_009133781.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Brassica 
rapa]
Length=435

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 240/366 (66%), Gaps = 40/366 (11%)
 Frame = +3

Query  111   RAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYF---GNRIS------  263
             R  LL  Q+R  P+  H+  DD D  KP S        T +R  +    GN+++      
Sbjct  10    RVNLL--QRRVYPTCGHLISDDRDETKPSSD-------TMIRKVFAFNGGNKLTSMFMER  60

Query  264   -----LGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYIS-EVLSDKAVE  425
                  LG+G++   F     +PP W+              + ++ I++++ EV+ D+ VE
Sbjct  61    QGAAPLGLGLSSCRFMSSSNTPPEWS--------------DKVDGIDFVAPEVVPDQIVE  106

Query  426   AVASQapv--vnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             AV +   V  VNEVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT+LIR +T+P
Sbjct  107   AVTTSQAVPVVNEVAIAAADSAFPVAALQHLIDGVHSFTGLNWWASIALTTVLIRGVTIP  166

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             +++ QLKAT KL LLRP+L+++RQEM  +G  P A+ EGQ+RM+ LF ++ V+PF+  +G
Sbjct  167   ILLNQLKATYKLNLLRPQLEELRQEMGTKGTDPEAMAEGQRRMQLLFKQHGVTPFTPLKG  226

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             + IQGPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA+TF I VE N
Sbjct  227   LIIQGPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTADTTYILPLLTAITFIIMVESN  286

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              QEGMEGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL ++RP V+
Sbjct  287   MQEGMEGNPVAGTMKKFSRIIAFLSIPILMGIEKALFCYWLTSNLFTLGYGLALRRPDVR  346

Query  1140  KLLGVP  1157
             KLL +P
Sbjct  347   KLLNLP  352



>ref|XP_010559124.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
Length=417

 Score =   328 bits (841),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 243/359 (68%), Gaps = 18/359 (5%)
 Frame = +3

Query  132   QQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNRISLGVGVARIPF--QDRK  305
             Q+R  PS  H+  ++ D     ++S+NP     +      N      G  R+    Q+R+
Sbjct  15    QRRIYPSCVHLIGNNKDDTG--TTSQNPGSGETIHKVLPHN------GTHRLSSLPQERQ  66

Query  306   ----FSPPPWAMAPI-WMRNMSTSVGEGMNKIEYIS-EVLSDKAVEAVASQapvvnevav  467
                 F P  +  +   +M +      + ++ IE+++ EV+ D  +EAV S    VNEVAV
Sbjct  67    YQSLFGPAGFCFSSCRYMSSTPVEWSDKVDGIEFVTNEVIPDGTIEAVTSHVSAVNEVAV  126

Query  468   aaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLR  647
             AAADS  PVAALQY+ID VH  TG NWWASIV TT++IR LT+PL++ QLKATSKL ++R
Sbjct  127   AAADSAYPVAALQYVIDGVHSFTGLNWWASIVLTTVMIRGLTVPLLLNQLKATSKLNMMR  186

Query  648   PKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAIS  827
             P+L++IRQE+ ++ M P A+ EGQ+RM+ LF+EY V+PF+  +G+ IQGPIF+SFF AI 
Sbjct  187   PRLEEIRQEISSKAMDPEAMAEGQKRMQALFHEYGVTPFTPLKGLLIQGPIFISFFFAIR  246

Query  828   NMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             NMAEKVPS K GG  WFTDL+ PDS Y+ P+LTALTF ITVE N QEG+EGNP  GT+K 
Sbjct  247   NMAEKVPSLKSGGTLWFTDLSIPDSSYVLPLLTALTFLITVEYNMQEGLEGNPVAGTMKT  306

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII--PPAPP  1178
              SR +A +S+P    F  A+FCYW+TSN+FSL YGLV+KRP+VK+LL +  +  PP+ P
Sbjct  307   FSRILAFVSVPVMMGFETALFCYWLTSNLFSLGYGLVLKRPEVKRLLNIANVDAPPSQP  365



>ref|XP_009411464.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009411465.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=429

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 186/394 (47%), Positives = 245/394 (62%), Gaps = 36/394 (9%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCY----  245
             MA  R ++T+    L    +RF PS +HI RDD +  +P +    P   +  RH      
Sbjct  1     MACGRRTLTSNFTHL---TRRFHPSFAHILRDDREYTEPSNPLPLPPTPSR-RHASSSAP  56

Query  246   ----FGNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---SEV  404
                 FG   SLG  +                     +    +S  EG N+I YI   +EV
Sbjct  57    SVSGFGRWRSLGFSLP--------------LGLEPGLLRTYSSGAEGSNEINYIKDVAEV  102

Query  405   LSDKAVEAVASQapvvn-----evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCT  569
             LSD ++E     A  V      EVA AAADS+LPVAALQ+LID VH   G NWWASIV T
Sbjct  103   LSDSSLETATVAAAAVPTPFPGEVAAAAADSFLPVAALQHLIDAVHSFCGLNWWASIVLT  162

Query  570   TLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEY  749
             TLLIR +T+PL++ Q+KAT KL ++RP+L+ +++++ +  M P +V EGQ++MK LF ++
Sbjct  163   TLLIRGVTVPLLLNQMKATVKLNVMRPELEQLKEQINS--MDPESVQEGQKQMKALFQKH  220

Query  750   KVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTA  929
              ++PF+  +G+ IQGPIF+SFFLAISNM EKVPSFK GGAFWFTDLTTPD  Y+ P LT 
Sbjct  221   GITPFTPLKGLLIQGPIFISFFLAISNMVEKVPSFKGGGAFWFTDLTTPDPQYMLPALTG  280

Query  930   LTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSY  1109
             LTF  T E N QEGMEGNP   T+KN SR +A +++PFTA+FPKA+FCYWITSN+FSL Y
Sbjct  281   LTFLATAELNMQEGMEGNPMANTMKNFSRVLAFMTVPFTANFPKAIFCYWITSNLFSLGY  340

Query  1110  GLVIKRPKVKKLLGVPIIPPAPPRADQSSGLPFF  1211
             G V+K  +V+K L +P   P P ++        F
Sbjct  341   GFVLKLTRVRKFLNLPDSVPEPTKSAAQPNFTLF  374



>ref|XP_002880242.1| hypothetical protein ARALYDRAFT_483801 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56501.1| hypothetical protein ARALYDRAFT_483801 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   327 bits (837),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 247/377 (66%), Gaps = 16/377 (4%)
 Frame = +3

Query  105   TTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNRIS-LGVGVA  281
             T R  LL  Q+R  PS  H+ RDD D  K +SS+ +    T +R     N  S L     
Sbjct  9     TKRVNLL--QRRVYPSCGHLIRDDRDETKSDSSNSH----TMIRKVLASNGTSKLSSMSL  62

Query  282   RIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI----SEVLSDKAVEAVASQapv  449
                +Q   FS P   +     R MS++  E  +K++ I    +EV+ D+ +EAV + +  
Sbjct  63    ERHYQSFSFSGP-LGLGLSSCRYMSSTPPEWSDKVDGIDFVATEVVPDEIIEAVTTTSQA  121

Query  450   v---nevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLK  620
             V   NEVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT+LIR +T+P+++ QLK
Sbjct  122   VPAINEVAIAAADSAFPVAALQHLIDGVHSFTGLNWWASIALTTVLIRGVTIPILLNQLK  181

Query  621   ATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPI  800
             AT KL +LRP+L+++RQEM  +   P A+ EGQ+RM+ LF E+ V+PF+  +G+ IQGPI
Sbjct  182   ATYKLNVLRPQLEELRQEMSTKAQDPEAMAEGQRRMQLLFKEHGVTPFTPLKGLIIQGPI  241

Query  801   FVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEG  980
             F+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA+TF I VE N QEG+EG
Sbjct  242   FISFFFAIRNMAEKVPSFKTGGTLWFTDLTTADTTYILPLLTAVTFLIMVESNMQEGLEG  301

Query  981   NPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP-  1157
             NP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL ++RP V+K L +P 
Sbjct  302   NPVAGTMKKFSRIIAFLSIPVLIGIEKALFCYWLTSNLFTLVYGLTLRRPDVRKFLNLPD  361

Query  1158  IIPPAPPRADQSSGLPF  1208
             ++  +  +   +S LPF
Sbjct  362   VVNSSTRQPSPASPLPF  378



>gb|EPS65404.1| hypothetical protein M569_09370, partial [Genlisea aurea]
Length=290

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 166/293 (57%), Positives = 212/293 (72%), Gaps = 7/293 (2%)
 Frame = +3

Query  336   IWMRNMST-SVGEGM-NKIEYISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQY  509
             ++ RN S+ SVGEG+ +KI  ++ V++   +   A   P V+EVA  AADSY PVAALQY
Sbjct  3     VFHRNFSSASVGEGVPDKIAILNNVVN--VLGDNAEVTPAVSEVAAVAADSYFPVAALQY  60

Query  510   LIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRG  689
             LIDYVH   G +WWA+I  TT+ IR + LP+MI QLK TSKL LLRP+++ +++EMQN  
Sbjct  61    LIDYVHVTAGLDWWAAIAATTIFIRLIQLPVMIHQLKVTSKLTLLRPEMEKLQEEMQNSD  120

Query  690   MAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGA  869
             +      E   ++K L+NE+ V+PF+  +GI I GPIF SFF A+  MAE VPSF  GG 
Sbjct  121   LTTL---ERHAKVKALYNEHGVNPFTPLKGILISGPIFCSFFFAVRKMAEGVPSFNGGGT  177

Query  870   FWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTA  1049
              WF+DLTTPDS+YI PVLTALTFWITVE N+QEGMEGNP+   +K VSR  A L++P T 
Sbjct  178   LWFSDLTTPDSLYILPVLTALTFWITVELNSQEGMEGNPNASAVKWVSRVFAVLTVPLTL  237

Query  1050  SFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSSGLPF  1208
             +FPKA+FCYW+ +N+FSL+YGLVIKRP VKK LGVPII  APP A+    + F
Sbjct  238   TFPKAIFCYWVPTNLFSLAYGLVIKRPAVKKFLGVPIIAVAPPSANGKPAISF  290



>emb|CDX95701.1| BnaC03g25820D [Brassica napus]
Length=429

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 181/365 (50%), Positives = 236/365 (65%), Gaps = 36/365 (10%)
 Frame = +3

Query  111   RAKLLYDQQRFAPSISHIHRDDDDRKKPESSS--------ENPRVLTHL---RHCYFGNR  257
             R  LL  Q+R  P+  H+  DD D  KP S +             LT +   R C  G  
Sbjct  10    RVNLL--QRRVYPTCGHLISDDRDETKPSSDTMIRKVFAFNGANTLTSMFMERQCAAG--  65

Query  258   ISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYIS-EVLSDKAVEAVA  434
               LG+G++   F     +PP W+              + ++ I++++ EV+ D+ VEAV 
Sbjct  66    -PLGLGLSSCRFMSSSTTPPEWS--------------DKVDGIDFVAPEVVPDQIVEAVT  110

Query  435   SQapvvn----evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
             + +  V     EVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT+LIR +T+P+
Sbjct  111   TTSQAVVPAVNEVAIAAADSAFPVAALQHLIDGVHSFTGLNWWASIALTTVLIRGVTVPI  170

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             ++ QLKAT KL LLRP+L+++RQEM  +G  P A+ EGQ+RM+ LF ++ V+PF+  +G+
Sbjct  171   LLNQLKATYKLNLLRPQLEELRQEMGTKGTDPEAMAEGQRRMQLLFKQHGVTPFTPLKGL  230

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
              IQGPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA+TF I VE N 
Sbjct  231   IIQGPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTADTTYILPLLTAITFIIMVESNM  290

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKK  1142
             QEGMEGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL  KRP V+K
Sbjct  291   QEGMEGNPVAGTMKKFSRIIAFLSIPILMGIEKALFCYWLTSNLFTLGYGLG-KRPDVRK  349

Query  1143  LLGVP  1157
             LL +P
Sbjct  350   LLNLP  354



>emb|CDX83365.1| BnaA03g21410D [Brassica napus]
Length=427

 Score =   323 bits (828),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 238/368 (65%), Gaps = 43/368 (12%)
 Frame = +3

Query  111   RAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYF---GNRIS------  263
             R  LL  Q+R  P+  H+  DD D  KP S        T +R  +    GN+++      
Sbjct  10    RVNLL--QRRVYPTCGHLISDDRDETKPSSD-------TMIRKVFAFNGGNKLTSMFMER  60

Query  264   -----LGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYIS-EVLSDKAVE  425
                  LG+G++   F     +PP W+              + ++ I++++ EV+ D+ VE
Sbjct  61    QCAAPLGLGLSSCRFMSSSNTPPEWS--------------DKVDGIDFVAPEVVPDQIVE  106

Query  426   AVASQapvvn----evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
             AV + +  V     EVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT+LIR +T
Sbjct  107   AVTTSSQAVVPAVNEVAIAAADSAFPVAALQHLIDGVHSFTGLNWWASIALTTVLIRGVT  166

Query  594   LPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             +P+++ QLKAT KL LLRP+L+++RQEM  +G  P A+ EGQ+RM+ LF ++ V+PF+  
Sbjct  167   IPILLNQLKATYKLNLLRPQLEELRQEMGTKGTDPEAMAEGQRRMQLLFKQHGVTPFTPL  226

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             +G+ IQGPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA+TF I VE
Sbjct  227   KGLIIQGPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTADTTYILPLLTAITFIIMVE  286

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
              N QEGMEGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL  KRP 
Sbjct  287   SNMQEGMEGNPVAGTMKKFSRIIAFLSIPILMGIEKALFCYWLTSNLFTLGYGLG-KRPD  345

Query  1134  VKKLLGVP  1157
             V+KLL +P
Sbjct  346   VRKLLNLP  353



>ref|XP_010919269.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Elaeis guineensis]
Length=361

 Score =   321 bits (822),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 234/351 (67%), Gaps = 11/351 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MA  R S+T+     +   +R  PS +HI  +D D          P   +     +  + 
Sbjct  1     MACARRSLTSNFTTHII--RRLHPSFAHILHEDRDDATAGHLQRPPLPSSPPASAFSRSV  58

Query  258   ISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---SEVLSDKAVEA  428
                G G      +   FS P   + P  +R+ S S  EG N+++YI   +EVL+D +VE 
Sbjct  59    TGFGGGFLLRDPRTIGFSLP-LGLEPSLLRSYS-SRAEGSNEVDYIKDVAEVLTDNSVET  116

Query  429   VASQapvvn--evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
              A+ AP     EVA AAADS+ PVAALQYLID VH  TG NWWASI  TT+LIR  T+PL
Sbjct  117   AAAMAPAPFAGEVAAAAADSFFPVAALQYLIDGVHSFTGLNWWASIALTTVLIRGATIPL  176

Query  603   MIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGI  782
             ++ Q+KAT KL  +RP+L+ ++Q++    M P +V EGQ+RM  LF ++ V+PF+  +G+
Sbjct  177   LLNQMKATVKLNTMRPELEQLKQQINT--MDPESVQEGQKRMNALFRKHGVTPFTPLKGM  234

Query  783   FIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNA  962
             FIQGPIF+SF+LAISNM EKVPSFK GGAFWFTDLTTPD +Y+ PVLTALTF  TVE N 
Sbjct  235   FIQGPIFISFYLAISNMVEKVPSFKGGGAFWFTDLTTPDPLYMLPVLTALTFLTTVELNM  294

Query  963   QEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGL  1115
             QEGMEGNP  GT+KN SR +A L++PFTA+FPKA+FCYWITSN+FSL YGL
Sbjct  295   QEGMEGNPMVGTMKNFSRILALLTVPFTANFPKAIFCYWITSNLFSLIYGL  345



>ref|XP_010506652.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Camelina sativa]
Length=440

 Score =   319 bits (817),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 241/370 (65%), Gaps = 28/370 (8%)
 Frame = +3

Query  96    SITTTRAKLLYDQQRFAPSISH-IHRDDDDRKKPESSSENPRVLTHLRHCYFGNRISLGV  272
             SI T RA +L  Q+R  PS  H IH D DD  KP S +      T +R     N    G 
Sbjct  6     SIITKRANVL--QRRAYPSCGHLIHDDRDDDTKPRSDT------TMIRKVLARN----GT  53

Query  273   GVARIP--FQDRKF-----SPPPWAMAPIWMRNMSTSVGEGMNKIEYI----SEVLSDKA  419
                ++   F+ R +     S P   +     R MS++  E  +K++ I    +EV+ D+ 
Sbjct  54    SNYKLSSMFEGRHYYHSFASGPLSGLGLSSCRYMSSTQPEWSDKVDGIDFVATEVVPDEI  113

Query  420   VEAVASQa----pvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRW  587
             VEA+ + +      VNEVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT++IR 
Sbjct  114   VEALTTTSQAVPAAVNEVAIAAADSAFPVAALQHLIDGVHSFTGLNWWASIALTTVIIRG  173

Query  588   LTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFS  767
             +T+P+++ QLKAT KL +LRP+L+++R+EM  +   P A+ EGQ+RM+ LF E+ V+PF+
Sbjct  174   VTVPILLNQLKATYKLNVLRPQLEELRREMSTKAQDPEAMAEGQRRMQLLFKEHGVTPFT  233

Query  768   AFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWIT  947
               +G+ IQGPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA TF I 
Sbjct  234   PLKGLIIQGPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTADTTYILPLLTAATFLIM  293

Query  948   VECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKR  1127
             VE N QEG+EGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL ++R
Sbjct  294   VESNMQEGLEGNPVAGTMKKFSRIIAFLSIPVLIGIEKALFCYWLTSNLFTLVYGLTLRR  353

Query  1128  PKVKKLLGVP  1157
             P V+KLL +P
Sbjct  354   PDVRKLLNLP  363



>ref|XP_010508013.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Camelina 
sativa]
 ref|XP_010508014.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Camelina 
sativa]
Length=440

 Score =   318 bits (815),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 182/366 (50%), Positives = 241/366 (66%), Gaps = 22/366 (6%)
 Frame = +3

Query  99    ITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNRISLGVGV  278
             I T RA +L  Q+R  PS  H+  DD D  K +SSS+     T +R     N  S     
Sbjct  7     IITKRANVL--QRRAYPSCGHLIHDDRDETKSDSSSD-----TTIRKVLARNGSSNYKLS  59

Query  279   ARIPFQDRKF-----SPPPWAMAPIWMRNMSTSVGEGMNKIEYI----SEVLSDKAVEAV  431
             +R  F++R +     S     +     R MS++  E  +K++ I    +E++ D+ VEAV
Sbjct  60    SR--FEERHYYQSFASGSLGGLGLSSCRYMSSTQPEWSDKVDGIDFVATEIVPDEIVEAV  117

Query  432   ASQa----pvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
              + +      VNEVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT+LIR +T+P
Sbjct  118   TTTSQAVPAAVNEVAIAAADSAFPVAALQHLIDGVHSFTGLNWWASIALTTVLIRGVTVP  177

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             +++ QLKAT KL +LRP+L+++R+EM  +   P A+ EGQ+RM+ LF E+ V+PF+  +G
Sbjct  178   ILLNQLKATYKLNVLRPQLEELRREMSTKAQDPEAMAEGQRRMQLLFKEHGVTPFTPLKG  237

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             + IQGPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA TF I VE N
Sbjct  238   LIIQGPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTADTTYILPLLTAATFLIMVESN  297

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              QEG+EGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL ++RP V+
Sbjct  298   MQEGLEGNPVAGTMKKFSRIIAFLSIPVLIGIEKALFCYWLTSNLFTLVYGLTLRRPDVR  357

Query  1140  KLLGVP  1157
             KLL +P
Sbjct  358   KLLNLP  363



>ref|XP_010544829.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010544831.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Tarenaya hassleriana]
Length=424

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 248/369 (67%), Gaps = 22/369 (6%)
 Frame = +3

Query  132   QQRFAPSISHI---HRDDDDRKKPESSSENPRVLTHLRHCYFG-NRISLGVGVARIPFQD  299
             Q+RF PS  H+   ++DD D     ++S+N   + H    + G NR+S         F++
Sbjct  15    QRRFYPSCGHLLGNNKDDTD-----TASQNLGTMIHKVLPHNGTNRLS-------SLFRE  62

Query  300   RKFS--PPPWAMAPIWMRNMSTSVGEGMNKIEYI----SEVLSDKAVEAVASQapvvnev  461
             R++     P        R+MS++  E  +K++       E++ D  +EAVAS  PV+NEV
Sbjct  63    RQYRSLAGPVGFGFSSCRHMSSTPEEWSDKVDGFDFAAEEIIPDGTIEAVASSVPVINEV  122

Query  462   avaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLAL  641
             A+AAADS+ PVAALQYL+D VH  TG NWWASIV TTL+IR LT+P  + QLKAT KL +
Sbjct  123   AIAAADSFYPVAALQYLVDGVHSFTGLNWWASIVMTTLIIRGLTVPAHLNQLKATFKLEM  182

Query  642   LRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLA  821
             L+P+L+++R+EM ++ M P  + +G++RM+ LF+EY V+P +  +G+ IQG IFVSFF A
Sbjct  183   LKPRLEELREEMNSKTMDPETMADGKKRMQALFHEYGVTPLTPLKGVLIQGTIFVSFFFA  242

Query  822   ISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
             I NMAEKVPSFK GG  WFTDL+ PDS Y+ P+LTALT+ ITVEC+   G EGNP  GT+
Sbjct  243   IRNMAEKVPSFKSGGTLWFTDLSIPDSSYVLPLLTALTYLITVECDMAAGHEGNPMAGTM  302

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR  1181
             K VSR ++ + +P   SF  A+F +W+TSN+FS+ YGLV+KRP+V++LL +PI+  +P +
Sbjct  303   KKVSRILSFVLVPVMMSFETALFGFWLTSNLFSIGYGLVLKRPEVRRLLNIPILGNSPTQ  362

Query  1182  ADQSSGLPF  1208
                 S + F
Sbjct  363   QSPPSPMHF  371



>gb|EYU40019.1| hypothetical protein MIMGU_mgv1a025462mg [Erythranthe guttata]
Length=421

 Score =   315 bits (808),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 188/384 (49%), Positives = 249/384 (65%), Gaps = 14/384 (4%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKP---ESSSENPRVLTHLRHCYF  248
             MA+RRS     RAKL   QQRFA    HIH+ DDDRK P   ++  +NP++  HL    F
Sbjct  1     MAFRRS--IAARAKLFSQQQRFATPFPHIHQFDDDRKNPPRNDAVFKNPQISNHLHRRLF  58

Query  249   GNRISLGVGVA-RIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAVE  425
             G+  +LG   + R  F DR+F+ P     PI+ RNMS S+GEG    E I E+++DKAV+
Sbjct  59    GSGNNLGASFSSRNLFHDRRFAIPA-GCGPIFARNMS-SLGEG--PPENI-EIMTDKAVD  113

Query  426   AVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLM  605
               +   P VNEVA+AAADS +PVAA+QYLIDYVHC TGFNWWASIV TT+LIR + LPL 
Sbjct  114   VASHVGPAVNEVAIAAADSSMPVAAIQYLIDYVHCYTGFNWWASIVVTTVLIRSILLPLG  173

Query  606   IQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIF  785
             I   K   K  LL P+L +I++EM+++ M+P  V E Q RMK+L+ EY V+PF+ ++G  
Sbjct  174   IHLRKCELKYKLLEPRLIEIKKEMRDKDMSPRDVAERQARMKELYKEYGVTPFTRWKGSL  233

Query  786   IQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQ  965
             I  PI      A++NMA  VPSFKEGGA WFTDL+TPDSM+I P+LT L+FWI  E   Q
Sbjct  234   INIPILCCILSALTNMAANVPSFKEGGALWFTDLSTPDSMFILPILTGLSFWIRSEIFTQ  293

Query  966   EGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKL  1145
               ++G+ +   +K      ++L IP TA F K +  Y+IT N+FSL+  +V+++  VK  
Sbjct  294   P-LKGSITERPLKIFGLVFSSLIIPLTAMFSKVICFYFITFNLFSLACDIVLRKRGVKLF  352

Query  1146  LGVPIIPPA--PPRADQSSGLPFF  1211
             LG+PIIP A  PP   +  GL F 
Sbjct  353   LGLPIIPMAQLPPALKRKPGLSFL  376



>ref|XP_006397838.1| hypothetical protein EUTSA_v10001727mg [Eutrema salsugineum]
 gb|ESQ39291.1| hypothetical protein EUTSA_v10001727mg [Eutrema salsugineum]
Length=429

 Score =   314 bits (804),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 246/379 (65%), Gaps = 24/379 (6%)
 Frame = +3

Query  105   TTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFG-NRISLGVGVA  281
             + R  LL  Q+R  PS  H+  DD D    E+ S +P   T +R    G N++S      
Sbjct  8     SKRVNLL--QRRVYPSCGHLIGDDKD----ETRSASPNPDTMIRKANNGANKLSSM----  57

Query  282   RIPFQDRKFSP--PPWAMAPIWMRNMSTSVGEGMNKIEYI-----SEVLSDKAVEAVASQ  440
                F +R +     P  +     R MS++  E  +K++ I     +EV+ D+ +E+V + 
Sbjct  58    ---FTERHYQSFYGPLGLGLSSCRYMSSTPPEWSDKVDGIDFVAATEVVPDQIIESVTTS  114

Query  441   ap--vvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQ  614
                  +NEVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT++IR +T+P+++ Q
Sbjct  115   QAVPAINEVAIAAADSVFPVAALQHLIDGVHSFTGLNWWASIALTTVIIRGVTVPILLNQ  174

Query  615   LKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQG  794
             LKAT KL  LRP+L+++RQEM  +   P A+ EGQ+RM+ LF ++ V+PF+  +G+ IQG
Sbjct  175   LKATYKLNALRPQLEELRQEMSTKASDPEAMAEGQRRMQLLFKQHGVTPFTPLKGLIIQG  234

Query  795   PIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGM  974
             PIF+SFF AI NMAEKVPSFK GG  WFTDLT+ D+ YI P+LTA+TF I VE N QEG+
Sbjct  235   PIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTSADTTYILPLLTAVTFLIMVESNMQEGV  294

Query  975   EGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGV  1154
             EGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL I+RP V+KLL +
Sbjct  295   EGNPVAGTMKKFSRIIAFLSIPVLIGIEKALFCYWLTSNLFTLGYGLAIRRPDVRKLLNL  354

Query  1155  P-IIPPAPPRADQSSGLPF  1208
             P +I  +  +   +S +PF
Sbjct  355   PDVIISSTRQPSPASPMPF  373



>ref|NP_182170.1| inner membrane OXA1-like protein [Arabidopsis thaliana]
 sp|Q9SKD3.1|OXA1L_ARATH RecName: Full=Mitochondrial inner membrane protein OXA1-like; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD23047.1| putative cytochrome oxidase biogenesis protein [Arabidopsis thaliana]
 gb|AAL85994.1| putative cytochrome oxidase biogenesis protein [Arabidopsis thaliana]
 gb|AAN41393.1| putative cytochrome oxidase biogenesis protein [Arabidopsis thaliana]
 dbj|BAC42453.1| putative cytochrome oxidase biogenesis protein [Arabidopsis thaliana]
 gb|AEC10702.1| inner membrane OXA1-like protein [Arabidopsis thaliana]
Length=431

 Score =   313 bits (803),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 236/362 (65%), Gaps = 23/362 (6%)
 Frame = +3

Query  105   TTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNRISLGVGVAR  284
             T R  LL  Q+R  PS  H+ RDD D  K  SS       T +R     N    G     
Sbjct  9     TKRVNLL--QRRVYPSCGHLIRDDRDETKSGSSD------TMIREVLARN----GTNKLS  56

Query  285   IPFQDRK---FSPPPWAMAPIWMRNMSTSVGEGMNKIEYI----SEVLSDKAVEAVASQa  443
               F DR    F+  P  +     R+MS++  E  +K++ I    +EV+ D+ +EAV + +
Sbjct  57    SMFADRHYQSFATGPLGLGLSSCRHMSSTPPEWSDKVDGIDFVATEVVPDEIIEAVTTTS  116

Query  444   pvvn----evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQ  611
               V     EVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT+LIR +T+P+++ 
Sbjct  117   QAVVPAINEVAIAAADSAFPVAALQHLIDAVHSFTGLNWWASIALTTVLIRGVTIPILLN  176

Query  612   QLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQ  791
             QLKAT KL +LRP+L+++RQEM  +   P A+ EGQ+RM+ LF E+ V+PF+  +G+ IQ
Sbjct  177   QLKATYKLNVLRPQLEELRQEMSTKAQDPEAMAEGQRRMQLLFKEHGVTPFTPLKGLIIQ  236

Query  792   GPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEG  971
             GPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA+TF I VE N QEG
Sbjct  237   GPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTTDTTYILPLLTAVTFLIMVESNMQEG  296

Query  972   MEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLG  1151
             +EGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL ++RP V+KLL 
Sbjct  297   LEGNPVAGTMKKFSRIIAFLSIPVLIGIEKALFCYWLTSNLFTLVYGLTLRRPDVRKLLN  356

Query  1152  VP  1157
             +P
Sbjct  357   LP  358



>ref|XP_009411468.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=345

 Score =   310 bits (793),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 231/364 (63%), Gaps = 40/364 (11%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCY----  245
             MA  R ++T+    L    +RF PS +HI RDD +  +P +    P   +  RH      
Sbjct  1     MACGRRTLTSNFTHL---TRRFHPSFAHILRDDREYTEPSNPLPLPPTPSR-RHASSSAP  56

Query  246   ----FGNRISLGVGVARIPFQD--RKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI---S  398
                 FG   SLG  +         R +S                S  EG N+I YI   +
Sbjct  57    SVSGFGRWRSLGFSLPLGLEPGLLRTYS----------------SGAEGSNEINYIKDVA  100

Query  399   EVLSDKAVEAVASQapvvn-----evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIV  563
             EVLSD ++E     A  V      EVA AAADS+LPVAALQ+LID VH   G NWWASIV
Sbjct  101   EVLSDSSLETATVAAAAVPTPFPGEVAAAAADSFLPVAALQHLIDAVHSFCGLNWWASIV  160

Query  564   CTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFN  743
              TTLLIR +T+PL++ Q+KAT KL ++RP+L+ +++++ +  M P +V EGQ++MK LF 
Sbjct  161   LTTLLIRGVTVPLLLNQMKATVKLNVMRPELEQLKEQINS--MDPESVQEGQKQMKALFQ  218

Query  744   EYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             ++ ++PF+  +G+ IQGPIF+SFFLAISNM EKVPSFK GGAFWFTDLTTPD  Y+ P L
Sbjct  219   KHGITPFTPLKGLLIQGPIFISFFLAISNMVEKVPSFKGGGAFWFTDLTTPDPQYMLPAL  278

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
             T LTF  T E N QEGMEGNP   T+KN SR +A +++PFTA+FPKA+FCYWITSN+FSL
Sbjct  279   TGLTFLATAELNMQEGMEGNPMANTMKNFSRVLAFMTVPFTANFPKAIFCYWITSNLFSL  338

Query  1104  SYGL  1115
              YG 
Sbjct  339   GYGF  342



>gb|KHG27847.1| Mitochondrial inner membrane OXA1 -like protein [Gossypium arboreum]
Length=357

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/282 (58%), Positives = 211/282 (75%), Gaps = 5/282 (2%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEYISEV---LSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLI  515
             R+MST+  +  +K E I +V   L D AVEAVASQAP VNEVAVA AD +LPVA+LQY+I
Sbjct  5     RHMSTTGIDKPDKFELIGDVVDVLKDTAVEAVASQAPAVNEVAVAGADCWLPVASLQYVI  64

Query  516   DYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA  695
             D VH  TG NWWASI  TTLLIR  TLPL+I +LKAT+K+  ++P+L ++ + + ++ + 
Sbjct  65    DAVHSFTGLNWWASIAVTTLLIRGATLPLLINELKATTKMTAMKPRLVEMWEWLASKDVN  124

Query  696   PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFW  875
               +V E Q  +K LF EY  +PF+   G+FI+  IF+S +LAI+ MA+K+PSFK GGA+W
Sbjct  125   SLSVVEVQNEIKKLFKEYGSTPFTPMIGLFIRCSIFISSYLAITTMAKKMPSFKCGGAYW  184

Query  876   FTDLTTPDSMYIFPVLTALTFWITV--ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTA  1049
             FTDLT PDS+Y+FP+LTALTF ITV   CN Q+GMEG P+  T K VS  +A L++PFT 
Sbjct  185   FTDLTAPDSLYVFPILTALTFLITVGASCNMQDGMEGKPASATKKIVSSVLAILTVPFTM  244

Query  1050  SFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAP  1175
             +FPKA+FCYWITSN+FS+SYGLV+K P VKK LG+P IP  P
Sbjct  245   NFPKAIFCYWITSNLFSISYGLVLKGPGVKKALGIPKIPDQP  286



>ref|XP_010506653.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Camelina sativa]
Length=398

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 205/279 (73%), Gaps = 8/279 (3%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEYI----SEVLSDKAVEAVASQa----pvvnevavaaaDSYLPVAA  500
             R MS++  E  +K++ I    +EV+ D+ VEA+ + +      VNEVA+AAADS  PVAA
Sbjct  43    RYMSSTQPEWSDKVDGIDFVATEVVPDEIVEALTTTSQAVPAAVNEVAIAAADSAFPVAA  102

Query  501   LQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQ  680
             LQ+LID VH  TG NWWASI  TT++IR +T+P+++ QLKAT KL +LRP+L+++R+EM 
Sbjct  103   LQHLIDGVHSFTGLNWWASIALTTVIIRGVTVPILLNQLKATYKLNVLRPQLEELRREMS  162

Query  681   NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKE  860
              +   P A+ EGQ+RM+ LF E+ V+PF+  +G+ IQGPIF+SFF AI NMAEKVPSFK 
Sbjct  163   TKAQDPEAMAEGQRRMQLLFKEHGVTPFTPLKGLIIQGPIFISFFFAIRNMAEKVPSFKT  222

Query  861   GGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIP  1040
             GG  WFTDLTT D+ YI P+LTA TF I VE N QEG+EGNP  GT+K  SR +A LSIP
Sbjct  223   GGTLWFTDLTTADTTYILPLLTAATFLIMVESNMQEGLEGNPVAGTMKKFSRIIAFLSIP  282

Query  1041  FTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
                   KA+FCYW+TSN+F+L YGL ++RP V+KLL +P
Sbjct  283   VLIGIEKALFCYWLTSNLFTLVYGLTLRRPDVRKLLNLP  321



>ref|XP_006294256.1| hypothetical protein CARUB_v10023251mg [Capsella rubella]
 gb|EOA27154.1| hypothetical protein CARUB_v10023251mg [Capsella rubella]
Length=433

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 214/302 (71%), Gaps = 20/302 (7%)
 Frame = +3

Query  264   LGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYI-SEVLSDKAVEAVA--  434
             LG+G++   +     +PP W+              E ++ I++  +EV+ D+ VEAV   
Sbjct  73    LGLGLSSCRYMSS--TPPEWS--------------EKVDGIDFAATEVVPDEIVEAVTMT  116

Query  435   SQap-vvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQ  611
             SQA   +NEVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT++IR +T+P+++ 
Sbjct  117   SQAAPAINEVAIAAADSAFPVAALQHLIDGVHSFTGLNWWASIALTTVIIRGVTVPILLN  176

Query  612   QLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQ  791
             QLKAT KL +LRP+L+++R+EM  +   P A+ EGQ+RM+ LF E+ V+PF+  +G+ IQ
Sbjct  177   QLKATYKLNVLRPQLEELRREMSTKAQDPEAMAEGQRRMQLLFKEHGVTPFTPLKGLIIQ  236

Query  792   GPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEG  971
             GPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA+TF I VE N QEG
Sbjct  237   GPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTGDTTYILPLLTAVTFLIMVESNMQEG  296

Query  972   MEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLG  1151
             +EGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+F+L YGL ++RP V+KLL 
Sbjct  297   LEGNPVAGTMKKFSRIIAFLSIPVLIGIEKALFCYWLTSNLFTLVYGLTLRRPDVRKLLN  356

Query  1152  VP  1157
             +P
Sbjct  357   LP  358



>ref|XP_010055019.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010055021.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010055022.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Eucalyptus grandis]
Length=388

 Score =   301 bits (772),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 237/377 (63%), Gaps = 13/377 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRK---KPESSSENPRV-LTHLRHCY  245
             MA+RRS  TT    L+   +R  PS  HIHRD+ D      P     +P   +  L    
Sbjct  1     MAWRRSLSTT--GTLI--ARRLRPSFFHIHRDNRDEPIICSPGRHYSSPSTSINSLPRAA  56

Query  246   FGNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMN-KIE-YISEVLSDKA  419
              G+R  L      +  Q   F PPP  ++    R MS + G+  + KI+ ++ E   +K 
Sbjct  57    SGSRNLLSP--RSMERQGLLFMPPP-GISSSLCRYMSNASGDDSSFKIDDFVREATPEKV  113

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             ++ V SQ   ++EVA+AAADS  PVA ++YLI  VH  TG NWWASI  TT+LIR  T+P
Sbjct  114   MDVVTSQPSAMSEVALAAADSSYPVAGIEYLIGAVHSFTGLNWWASIALTTVLIRGATVP  173

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L I Q+++T+KL+L+RP+++++ Q ++    AP A ++  Q    LF EY VSPF+  +G
Sbjct  174   LQINQMRSTAKLSLMRPRVEELNQTLRETANAPDAASKYLQSFTSLFKEYGVSPFTPLKG  233

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             + ++GPIF+SFF AI NMAEK+PSF+ GG  WF +L TPDS+YI P+LTALTFWI VE +
Sbjct  234   LLMRGPIFISFFFAIKNMAEKIPSFQTGGTLWFVNLATPDSLYILPILTALTFWIAVEFH  293

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              +EG++G    GT+K   R    LSIP    FPKA+F YW+TSN+FSL++GLV+++P VK
Sbjct  294   LEEGLDGTAVVGTLKKFFRVFTILSIPVMMCFPKAMFGYWLTSNMFSLAFGLVVQQPGVK  353

Query  1140  KLLGVPIIPPAPPRADQ  1190
             K L VP IP +P  A Q
Sbjct  354   KFLKVPDIPVSPASASQ  370



>ref|XP_002467635.1| hypothetical protein SORBIDRAFT_01g031260 [Sorghum bicolor]
 gb|EER94633.1| hypothetical protein SORBIDRAFT_01g031260 [Sorghum bicolor]
Length=420

 Score =   300 bits (767),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 176/233 (76%), Gaps = 2/233 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ++ID +H  TG NWWA I  TTL+IR  T+PL++ QLKAT+KL  + P++
Sbjct  127   DSFPPVAALQHIIDAIHTFTGLNWWACIALTTLIIRSATIPLLVNQLKATTKLRAINPEM  186

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I+ +M +  M P +  EGQ +MK LF ++ VSPF+  +G+ IQGP+F+SF+ AISNM 
Sbjct  187   EAIKDQMNS--MDPKSAQEGQAKMKALFKKHGVSPFTPMKGLLIQGPMFMSFYFAISNMV  244

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             EKVPSFK GGA WFTDLTTPDS+Y+ PVLT LTF +TVE N QEGMEGNP  G +K  SR
Sbjct  245   EKVPSFKGGGALWFTDLTTPDSLYVLPVLTGLTFLVTVELNLQEGMEGNPMAGKMKTFSR  304

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAP  1175
              MA L++PFT +F KA+FCYWITSNIF+L YG+VI+RP V+K   +P +   P
Sbjct  305   GMAVLTVPFTMNFAKAIFCYWITSNIFTLLYGIVIRRPAVRKWFNLPALEAQP  357



>ref|XP_010055023.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW71506.1| hypothetical protein EUGRSUZ_E00058 [Eucalyptus grandis]
Length=388

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/377 (45%), Positives = 235/377 (62%), Gaps = 13/377 (3%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRK---KPESSSENPRV-LTHLRHCY  245
             MA+RRS  TT    L+   +R  PS  HIHRD+ D      P     +P   +  L    
Sbjct  1     MAWRRSLSTT--GTLI--ARRLRPSFFHIHRDNRDEPIICSPGRHYSSPSTSINSLPRAA  56

Query  246   FGNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMN-KIE-YISEVLSDKA  419
              G+R  L      +  Q   F PPP  ++    R MS + G+  + KI+ ++ E   +K 
Sbjct  57    SGSRNLLSP--RSMERQGLLFMPPP-GISSSLCRYMSNASGDDSSFKIDDFVREATPEKV  113

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             ++ V SQ   ++EVA+AAADS  PVA ++YLI  VH  TG NWWASI  TT+LIR  T+P
Sbjct  114   MDVVTSQPSAMSEVALAAADSSYPVAGIEYLIGAVHSFTGLNWWASIALTTVLIRGATVP  173

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L I Q+++T+KL+L+RP+++++ Q ++     P A ++  Q    LF EY +SPF+  +G
Sbjct  174   LQINQMRSTAKLSLMRPRVEELNQTLRETANDPDAASKYLQSFASLFKEYGISPFTPLKG  233

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             + ++GPIF+SFF AI NMAEK+PSF+ GG  WF +L TPDS+YI P+LTALTFWI VE +
Sbjct  234   LLMRGPIFISFFFAIKNMAEKIPSFQTGGTLWFVNLATPDSLYILPILTALTFWIAVEFH  293

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              +EG+ G    GT+K   R    LSIP    FPKA+F YW+TSN+FSL++GLV+++P VK
Sbjct  294   LEEGLNGTAVAGTMKKFFRVFTVLSIPVMMCFPKAMFGYWLTSNMFSLAFGLVVQQPGVK  353

Query  1140  KLLGVPIIPPAPPRADQ  1190
             K L VP IP +P  A Q
Sbjct  354   KFLKVPDIPVSPASASQ  370



>ref|XP_008799549.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Phoenix dactylifera]
Length=341

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 228/340 (67%), Gaps = 29/340 (9%)
 Frame = +3

Query  78    MAYRRSSIT---TTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYF  248
             MA  R S+T   TTR       +RF PS +HI+ DD DR    SS       +   H Y 
Sbjct  1     MACARRSLTSNFTTRIT-----RRFHPSFAHINHDDRDRPPLPSSPPA-SAFSRSVHGYG  54

Query  249   GNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEV---LSDKA  419
             G   SL     R P +   FS P   + P  +R+ S+S  EG N+++YI +V   L+D +
Sbjct  55    GGS-SL-----RDP-RTLGFSLP-LGLEPSLLRSYSSSA-EGSNEVDYIKDVAGVLTDNS  105

Query  420   VEAVASQapvvn------evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLI  581
             VE  A+ A          EVA AAADS+LPVAALQYLID VH  TG NWWASI  TT+LI
Sbjct  106   VETAAATAAAAAPAPFAGEVAAAAADSFLPVAALQYLIDGVHSFTGLNWWASIALTTVLI  165

Query  582   RWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSP  761
             R  T+PL++ Q+KAT KL  +RP+L+ ++Q++ +  M P +V EGQ+RMK LF ++ V+P
Sbjct  166   RGATVPLLLNQMKATVKLNTMRPELEQLKQQINS--MDPESVQEGQKRMKALFQKHGVTP  223

Query  762   FSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFW  941
             F+  +G+FIQGPIF+SF+LAISNM EKVPSFK GGAFWFTDLTTPD++Y+ PVLT+L+F 
Sbjct  224   FTPLKGMFIQGPIFISFYLAISNMVEKVPSFKGGGAFWFTDLTTPDTLYMLPVLTSLSFL  283

Query  942   ITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPK  1061
             +TVE N QEGMEGNP   T+KN SR +A L+IPFTA+FPK
Sbjct  284   MTVELNMQEGMEGNPMASTMKNFSRILALLTIPFTANFPK  323



>ref|XP_004983890.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Setaria italica]
 ref|XP_004983891.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Setaria italica]
Length=423

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 178/245 (73%), Gaps = 2/245 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+LPVAALQ+ ID +H  TG NWWA IV TTL+IR  T+P+++ QLKA +KL  ++P++
Sbjct  133   DSFLPVAALQHFIDAIHTFTGLNWWACIVLTTLIIRTATVPMLVSQLKAMTKLNAIKPEM  192

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I+   Q   M   +  EG+ +M+ LF ++ VSPF+  +G+ IQGPIF+SFF AISNM 
Sbjct  193   EAIKD--QTDTMDLKSAEEGKAKMQALFKKHGVSPFAPMKGLLIQGPIFMSFFFAISNMV  250

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             EKVPS K GG  WFTDLTTPDS+Y+ PVLT LT   TVE N Q+GMEG+P  G +KNV+R
Sbjct  251   EKVPSLKGGGTLWFTDLTTPDSLYLLPVLTGLTALATVEFNLQQGMEGSPMTGKMKNVAR  310

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSS  1196
              MA +++PFT +F K +FCYWITSNIFSL+YG+VI+RP VKKL  +P +P  P  A Q  
Sbjct  311   GMAFMAVPFTMNFAKGIFCYWITSNIFSLAYGVVIRRPAVKKLFNLPDLPAQPSPATQMP  370

Query  1197  GLPFF  1211
                FF
Sbjct  371   TFNFF  375



>gb|EMS59812.1| Mitochondrial inner membrane protein OXA1 [Triticum urartu]
Length=342

 Score =   291 bits (746),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 178/240 (74%), Gaps = 1/240 (0%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQY ID VH  TG NWWASI  TT+LIR +T+PL++ QLK+T KL  +RP++
Sbjct  33    DSFPPVAALQYAIDAVHSFTGLNWWASIAVTTILIRTVTIPLLVNQLKSTMKLNAMRPEI  92

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I  EM+N  M P ++ EG++++ +LF ++ V+P +  +G+ IQGPIF+SFF AI NM 
Sbjct  93    EAINMEMRN-SMDPQSMLEGKKKLGELFTKHGVNPLTPLKGLLIQGPIFMSFFFAIQNMV  151

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             EKVPS K GGA+WFTDLTTPD +YI PVLT++TF  TVE N QEGMEGNP   T+KN SR
Sbjct  152   EKVPSLKGGGAYWFTDLTTPDELYILPVLTSVTFLATVELNMQEGMEGNPMLQTMKNFSR  211

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSS  1196
              +A ++IPFT  FPKA+FCYW+T+N+FSL YG  +++  V+  L +P + P P  A  S+
Sbjct  212   ILALMTIPFTMHFPKAIFCYWVTANLFSLGYGFALRKTAVRYFLNLPEVVPQPEAAQVST  271



>gb|EAZ16712.1| hypothetical protein OsJ_32188 [Oryza sativa Japonica Group]
Length=413

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 170/229 (74%), Gaps = 2/229 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ++IDY+H  TG NWWA I   T+LIR  T+PL++ QLKAT KL  +RP++
Sbjct  120   DSFFPVAALQHVIDYIHTFTGLNWWACIALATVLIRSATVPLLVNQLKATQKLNAIRPEM  179

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I++EM    M P +  EG+ +M  LF ++ VSPF+  +G+ IQGPIF+SFF AI NM 
Sbjct  180   EAIKEEMN--AMDPKSAKEGKAKMTALFQKHGVSPFTPLKGLLIQGPIFMSFFFAIRNMI  237

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             +KVPS K GG+ WFTDLTTPD +YI PVLTAL F +TVE N QEGMEGNP    +KN SR
Sbjct  238   DKVPSMKGGGSLWFTDLTTPDPLYILPVLTALIFLVTVELNLQEGMEGNPMARKMKNFSR  297

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
              MA L++PFT SF K +FCYWITSN+F+L+YG VI+RP V+K   +P +
Sbjct  298   GMAVLTVPFTMSFAKGIFCYWITSNLFTLTYGFVIRRPAVRKFCNLPAL  346



>gb|AAM92288.1| putative cytochrome oxidase assembly protein [Oryza sativa Japonica 
Group]
 gb|ABB47899.1| Inner membrane protein OXA1-like, mitochondrial precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=413

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 170/229 (74%), Gaps = 2/229 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ++IDY+H  TG NWWA I   T+LIR  T+PL++ QLKAT KL  +RP++
Sbjct  120   DSFFPVAALQHVIDYIHTFTGLNWWACIALATVLIRSATVPLLVNQLKATQKLNAIRPEM  179

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I++EM    M P +  EG+ +M  LF ++ VSPF+  +G+ IQGPIF+SFF AI NM 
Sbjct  180   EAIKEEMN--AMDPKSAKEGKAKMTALFQKHGVSPFTPLKGLLIQGPIFMSFFFAIRNMI  237

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             +KVPS K GG+ WFTDLTTPD +YI PVLTAL F +TVE N QEGMEGNP    +KN SR
Sbjct  238   DKVPSMKGGGSLWFTDLTTPDPLYILPVLTALIFLVTVELNLQEGMEGNPMARKMKNFSR  297

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
              MA L++PFT SF K +FCYWITSN+F+L+YG VI+RP V+K   +P +
Sbjct  298   GMAVLTVPFTMSFAKGIFCYWITSNLFTLTYGFVIRRPAVRKFCNLPAL  346



>ref|XP_010413084.1| PREDICTED: mitochondrial inner membrane protein OXA1-like, partial 
[Camelina sativa]
Length=345

 Score =   290 bits (741),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 222/346 (64%), Gaps = 21/346 (6%)
 Frame = +3

Query  99    ITTTRAKLLYDQQRFAPSISH-IHRDDDDRKKPESSSENPRVLTHLRHCYFGNRISLGVG  275
             I T RA +L  Q+R  PS  H IH D DD  K  SSS +  ++  +      +   L   
Sbjct  7     IITKRANVL--QRRAYPSCGHLIHDDRDDDTKSGSSSSDTMMIRKVLASNGTSNYKLSS-  63

Query  276   VARIPFQDRKF-----SPPPWAMAPIWMRNMSTSVGEGMNKIEYI----SEVLSDKAVEA  428
                  F++R +     S P         R MS++  E  +K++ I    +E++ D+ VEA
Sbjct  64    ----MFEERHYYQSFGSGPLGGFGLSSCRYMSSTQPEWSDKVDGIDFVATEIVPDEIVEA  119

Query  429   VASQa----pvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
             V + +      +NEVA+AAADS  PVAALQ+LID VH  TG NWWASI  TT++IR +T+
Sbjct  120   VTTTSQAVPAAINEVAIAAADSAFPVAALQHLIDGVHSFTGLNWWASIALTTVIIRGVTV  179

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFR  776
             P+++ QLKAT KL +LRP+L+++R+EM  +   P A+ EGQ+RM+ LF E+ V+PF+  +
Sbjct  180   PILLNQLKATYKLNVLRPQLEELRREMSTKAQDPEAMAEGQRRMQLLFKEHGVTPFTPLK  239

Query  777   GIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVEC  956
             G+ IQGPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+LTA TF I VE 
Sbjct  240   GLIIQGPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTGDTTYILPLLTAATFLIMVES  299

Query  957   NAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNI  1094
             N QEG+EGNP  GT+K  SR +A LSIP      KA+FCYW+TSN+
Sbjct  300   NMQEGLEGNPVAGTMKKFSRIIAFLSIPVLIGIEKALFCYWLTSNL  345



>gb|AAG13422.1|AC051634_3 putative Oxa1 protein [Oryza sativa Japonica Group]
Length=487

 Score =   294 bits (752),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 170/229 (74%), Gaps = 2/229 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ++IDY+H  TG NWWA I   T+LIR  T+PL++ QLKAT KL  +RP++
Sbjct  120   DSFFPVAALQHVIDYIHTFTGLNWWACIALATVLIRSATVPLLVNQLKATQKLNAIRPEM  179

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I++EM    M P +  EG+ +M  LF ++ VSPF+  +G+ IQGPIF+SFF AI NM 
Sbjct  180   EAIKEEMN--AMDPKSAKEGKAKMTALFQKHGVSPFTPLKGLLIQGPIFMSFFFAIRNMI  237

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             +KVPS K GG+ WFTDLTTPD +YI PVLTAL F +TVE N QEGMEGNP    +KN SR
Sbjct  238   DKVPSMKGGGSLWFTDLTTPDPLYILPVLTALIFLVTVELNLQEGMEGNPMARKMKNFSR  297

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
              MA L++PFT SF K +FCYWITSN+F+L+YG VI+RP V+K   +P +
Sbjct  298   GMAVLTVPFTMSFAKGIFCYWITSNLFTLTYGFVIRRPAVRKFCNLPAL  346



>ref|XP_006662522.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Oryza 
brachyantha]
Length=330

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 170/229 (74%), Gaps = 2/229 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVA LQ++ID VH  TG NWWA I  TT+LIR  T+PL+++QLKAT KL+ +RP++
Sbjct  37    DSFFPVAVLQHMIDAVHTFTGLNWWACIALTTVLIRSATVPLLVKQLKATQKLSAIRPEM  96

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I+ EM    M P +  EG+ +M  LF +  VSPF+  +G+ IQ PIF+SFF AI NM 
Sbjct  97    EAIQSEMN--AMDPKSAQEGKVKMTALFRKNGVSPFTPLKGMLIQAPIFMSFFFAIRNMV  154

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             +KVPS K GGA WFTDLTTPD++YIFPVLT L FW++VE N QEGME NP    +K+ SR
Sbjct  155   DKVPSMKGGGALWFTDLTTPDALYIFPVLTGLIFWVSVELNLQEGMEANPMANKMKSFSR  214

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
              MA L++PFT +F K VFCYWITSN+FSL+YG+VI+RP V+K   +P +
Sbjct  215   VMAILTVPFTMNFAKGVFCYWITSNLFSLTYGIVIRRPTVRKFFELPAL  263



>ref|XP_003574213.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Brachypodium 
distachyon]
Length=423

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 179/246 (73%), Gaps = 5/246 (2%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ+LID +H  TG NWWA I  TT+LIR  T+PL++ QLK+T KL  ++P++
Sbjct  131   DSFFPVAALQHLIDTIHTFTGLNWWACIALTTVLIRSATIPLLVNQLKSTHKLNAIKPEM  190

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I+ EM +  M   +  EG++++K LF ++ VSPFS  +G+ IQGP+F+SF+ AI+NM 
Sbjct  191   EAIKDEMNS--MDQKSAMEGRKKIKALFKKHGVSPFSPLKGLLIQGPMFMSFYFAINNMV  248

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             EKVPS K GGAFWFTDLTTPD +YI PVLT LTF  TVE N QEGME NP  G +K  SR
Sbjct  249   EKVPSLKGGGAFWFTDLTTPDPLYILPVLTGLTFLATVEINLQEGMETNPMAGKMKMFSR  308

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGV-PIIPPAPPRADQS  1193
              MA +++PFT +F K +FCYWITSN+F+L YG+VI+RP V+KL  +  ++ P+ P   Q 
Sbjct  309   GMAVMTVPFTMNFAKGIFCYWITSNLFTLVYGIVIRRPTVRKLFNLHALVAPSAP--GQK  366

Query  1194  SGLPFF  1211
             S   FF
Sbjct  367   SAFSFF  372



>ref|XP_010229306.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Brachypodium 
distachyon]
Length=434

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 225/379 (59%), Gaps = 16/379 (4%)
 Frame = +3

Query  87    RRSSITTTRAKLLYDQQRFAPSISHI---HRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             RRS  ++    L    +R  PS+SH+   H D  +     S     +   H        R
Sbjct  6     RRSLASSLSGHL---TRRLHPSLSHLIPSHHDHSENTSSSSPPPPTQQPQHFPSADLRRR  62

Query  258   ISLGVGVARIPFQ-----DRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISEVLSDKAV  422
                      +PF       R FS        I       S G     I+  ++VLSD A 
Sbjct  63    TRSQNLTLPLPFGAHLAGHRNFSTSSSGAPEIDAATGVLSDGAA-GDIDVAADVLSDAAS  121

Query  423   EAV-ASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
               V A  AP   EVA AAADS+ PVAALQY+ID VH  TG NWWA I  TT+LIR  T+P
Sbjct  122   SVVPAFPAPFPGEVAAAAADSFPPVAALQYVIDAVHSFTGLNWWACIALTTVLIRTATVP  181

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L++ QLK+T KL  +RP+++ I  EM+N    P ++ EG++++ +LF ++ V+P +  +G
Sbjct  182   LLVNQLKSTMKLNAMRPEMEAINMEMRND---PGSMLEGKKKLGELFTKHGVNPLTPLKG  238

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             +FIQGPIF+SFF AI NM EKVPS K GGA+WFTDLTTPD +YI PVLT++TF  TVE N
Sbjct  239   LFIQGPIFMSFFFAIQNMVEKVPSLKGGGAYWFTDLTTPDELYILPVLTSVTFLATVELN  298

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
              Q+GMEGNP   T+K  SR +A +++PFT  FPKA+F YW+T+N+FSL YG  +++P V+
Sbjct  299   MQDGMEGNPMLQTMKKFSRVLAVMTVPFTMHFPKAIFFYWVTANLFSLGYGFALRKPAVR  358

Query  1140  KLLGVPIIPPAPPRADQSS  1196
               L +P I P P  A  S+
Sbjct  359   GYLNLPHIVPQPVPAQLST  377



>gb|EPS67807.1| hypothetical protein M569_06967, partial [Genlisea aurea]
Length=242

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 169/234 (72%), Gaps = 9/234 (4%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQYLIDYVH  TG +WWASI   TL IR + +P+MI QLK TSK+ LLRP +
Sbjct  17    DSFFPVAALQYLIDYVHVSTGLDWWASIALATLFIRVVQIPVMIHQLKVTSKINLLRPHM  76

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + ++QEM+N GM      E Q ++K L+ E+ VSPF+  +GI I GPIF SFF A+  +A
Sbjct  77    EKLQQEMENVGMDHV---ERQAKLKALYKEHGVSPFTPLKGILISGPIFCSFFFAVRKLA  133

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             E VPSFK+GG  WFTDLTTPDS+YI P+LTAL FW TVE N++EG       G +K +SR
Sbjct  134   ENVPSFKQGGTLWFTDLTTPDSLYILPLLTALLFWSTVELNSEEG------NGAVKWMSR  187

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPP  1178
               A L +PFT S PKA+FCYW+ SN+FSL+YG V+KR +VKK LG+PI    PP
Sbjct  188   VFAVLIVPFTLSLPKAIFCYWVPSNLFSLAYGRVLKRVEVKKFLGIPIPTVDPP  241



>ref|NP_001168896.1| hypothetical protein [Zea mays]
 gb|ACN30955.1| unknown [Zea mays]
 tpg|DAA45972.1| TPA: hypothetical protein ZEAMMB73_951394 [Zea mays]
Length=423

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 169/229 (74%), Gaps = 2/229 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ++ID +H  TG NWW  I  TT +IR  T+PL++ QLKAT+KL  + P++
Sbjct  130   DSFPPVAALQHIIDAIHTFTGLNWWVCIALTTFIIRIATVPLLVNQLKATTKLRAINPEM  189

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I+ +M +  M P +V EGQ +MK LF ++ VSP +  +G+ IQGPIF+SFF AISNM 
Sbjct  190   EVIKDQMNS--MDPKSVQEGQAKMKALFKKHGVSPLTPMKGLLIQGPIFMSFFFAISNMV  247

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             EKVPSFK GG  WFTDLTTPDS+YI P+LT LTF  TVE N QEGMEGNP  G +K  SR
Sbjct  248   EKVPSFKGGGTLWFTDLTTPDSLYILPMLTGLTFLATVELNLQEGMEGNPMAGKMKYFSR  307

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
              +A L++PFT +F  AVFCYW +SNIF+L YGLVI+RP V+K   +P +
Sbjct  308   GVAVLTVPFTMNFATAVFCYWTSSNIFTLLYGLVIRRPAVRKWFDLPAL  356



>dbj|BAK02696.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   282 bits (721),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 171/235 (73%), Gaps = 4/235 (2%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ++ID +H  TG NWWA I  TT+LIR  T+PL++ QLK++ KL  ++P++
Sbjct  128   DSFFPVAALQHVIDTIHTFTGLNWWACIALTTVLIRTATIPLLVSQLKSSQKLNAIKPEM  187

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I+  M +    P +  EG+ +M  LF ++ VSPFS  +GI IQGP+F+SFF AI+NM 
Sbjct  188   EAIKDAMDSTD--PKSALEGKYKMTALFQKHGVSPFSPLKGILIQGPMFMSFFFAINNMV  245

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             EKVPS K GG FWFTDLTTPD +YI PVL ALTF  TVE N QEGMEGN   G +K  SR
Sbjct  246   EKVPSMKGGGVFWFTDLTTPDPLYICPVLAALTFLATVELNLQEGMEGNSMAGKMKTFSR  305

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII--PPAP  1175
              MA +++PFT +F K +FCYWITSN+FSL YG+V++RP V+KL  +P +  P AP
Sbjct  306   GMALMTVPFTMNFAKGIFCYWITSNLFSLGYGIVMRRPAVRKLFNLPALEAPSAP  360



>ref|XP_009607376.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Nicotiana 
tomentosiformis]
Length=197

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  549   WASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRM  728
             WASIV T+++IR LTLP+MI QLK+TS+L LLRPK+++I++EMQN+GMAPAAV EGQQRM
Sbjct  5     WASIVATSIIIRLLTLPVMINQLKSTSQLTLLRPKMEEIKEEMQNKGMAPAAVAEGQQRM  64

Query  729   KDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMY  908
              +L  E+ VS F+  +G+ IQGPIFVSFF+AI NMA+ VPS K+GGAFWFTDLTTPDSMY
Sbjct  65    NELMKEHGVSMFTPLKGLLIQGPIFVSFFVAIRNMADNVPSLKQGGAFWFTDLTTPDSMY  124

Query  909   IFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPK  1061
             I PVLTALTFWITVECNAQEG+EGNP+  TIKNVSRA AAL+IPFTA FPK
Sbjct  125   ILPVLTALTFWITVECNAQEGLEGNPAGKTIKNVSRAFAALTIPFTAGFPK  175



>ref|NP_001048756.1| Os03g0116000 [Oryza sativa Japonica Group]
 dbj|BAF10670.1| Os03g0116000 [Oryza sativa Japonica Group]
Length=440

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 175/250 (70%), Gaps = 21/250 (8%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ+LID VH +TG NWWA I  T+LLIR LT+PL++ Q+KAT KL  +RP++
Sbjct  134   DSFAPVAALQHLIDGVHSLTGLNWWACIALTSLLIRTLTVPLLLNQMKATVKLNAMRPEI  193

Query  657   DDIRQEMQ---------------------NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             + I  EM+                     +    P ++ EG++++ +LF  + V+P +  
Sbjct  194   EAINLEMRTISSTRIAGNEKSSTRVTDEGSMSTDPQSMLEGKRKLGELFLRHGVTPLTPL  253

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             +G+FIQ PIF+SFF AISNM EKVPSFK GG +WFTDLTTPD + I P+LT+LTF +TVE
Sbjct  254   KGLFIQAPIFMSFFFAISNMVEKVPSFKGGGIYWFTDLTTPDELLILPMLTSLTFLVTVE  313

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
              N Q+GMEGNP   T+KN SR MA L+IPFT SFPKA+F YW+TSN+FSL YG V+++P 
Sbjct  314   LNMQDGMEGNPMLKTMKNFSRVMAVLTIPFTMSFPKAIFFYWVTSNLFSLGYGFVLRKPA  373

Query  1134  VKKLLGVPII  1163
             V+  L +P I
Sbjct  374   VRSFLDLPPI  383



>gb|EEE58210.1| hypothetical protein OsJ_09169 [Oryza sativa Japonica Group]
Length=407

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 175/250 (70%), Gaps = 21/250 (8%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ+LID VH +TG NWWA I  T+LLIR LT+PL++ Q+KAT KL  +RP++
Sbjct  101   DSFAPVAALQHLIDGVHSLTGLNWWACIALTSLLIRTLTVPLLLNQMKATVKLNAMRPEI  160

Query  657   DDIRQEMQ---------------------NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             + I  EM+                     +    P ++ EG++++ +LF  + V+P +  
Sbjct  161   EAINLEMRTISSTRIAGNEKSSTRVTDEGSMSTDPQSMLEGKRKLGELFLRHGVTPLTPL  220

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             +G+FIQ PIF+SFF AISNM EKVPSFK GG +WFTDLTTPD + I P+LT+LTF +TVE
Sbjct  221   KGLFIQAPIFMSFFFAISNMVEKVPSFKGGGIYWFTDLTTPDELLILPMLTSLTFLVTVE  280

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
              N Q+GMEGNP   T+KN SR MA L+IPFT SFPKA+F YW+TSN+FSL YG V+++P 
Sbjct  281   LNMQDGMEGNPMLKTMKNFSRVMAVLTIPFTMSFPKAIFFYWVTSNLFSLGYGFVLRKPA  340

Query  1134  VKKLLGVPII  1163
             V+  L +P I
Sbjct  341   VRSFLDLPPI  350



>gb|EEC74390.1| hypothetical protein OsI_09733 [Oryza sativa Indica Group]
Length=446

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 176/256 (69%), Gaps = 27/256 (11%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLAL-----  641
             DS+ PVAALQ+LID VH +TG NWWA I  T+LLIR LT+PL++ Q+KAT KL +     
Sbjct  134   DSFAPVAALQHLIDGVHSLTGLNWWACIALTSLLIRTLTVPLLLNQMKATVKLNVKTDSP  193

Query  642   -LRPKLDDIRQEMQ---------------------NRGMAPAAVNEGQQRMKDLFNEYKV  755
              +RP+++ I  EM+                     +    P ++ EG++++ +LF  + V
Sbjct  194   AMRPEIEAINLEMRTISSTRVAGNEKSSTRVTDEGSMSTDPQSMLEGKRKLGELFLRHGV  253

Query  756   SPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALT  935
             +P +  +G+FIQ PIF+SFF AISNM EKVPSFK GG +WFTDLTTPD + I P+LT+LT
Sbjct  254   TPLTPLKGLFIQAPIFMSFFFAISNMVEKVPSFKGGGIYWFTDLTTPDELLILPMLTSLT  313

Query  936   FWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGL  1115
             F +TVE N Q+GMEGNP   T+KN SR MA L+IPFT SFPKA+F YW+TSN+FSL YG 
Sbjct  314   FLVTVELNMQDGMEGNPMLKTMKNFSRVMAVLTIPFTMSFPKAIFFYWVTSNLFSLGYGF  373

Query  1116  VIKRPKVKKLLGVPII  1163
             V+++P V+  L +P I
Sbjct  374   VLRKPAVRSFLDLPPI  389



>gb|ABF93648.1| 60Kd inner membrane protein, expressed [Oryza sativa Japonica 
Group]
Length=436

 Score =   274 bits (701),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 174/250 (70%), Gaps = 25/250 (10%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ+LID VH +TG NWWA I  T+LLIR LT+PL++ Q+KAT+    +RP++
Sbjct  134   DSFAPVAALQHLIDGVHSLTGLNWWACIALTSLLIRTLTVPLLLNQMKATA----MRPEI  189

Query  657   DDIRQEMQ---------------------NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF  773
             + I  EM+                     +    P ++ EG++++ +LF  + V+P +  
Sbjct  190   EAINLEMRTISSTRIAGNEKSSTRVTDEGSMSTDPQSMLEGKRKLGELFLRHGVTPLTPL  249

Query  774   RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVE  953
             +G+FIQ PIF+SFF AISNM EKVPSFK GG +WFTDLTTPD + I P+LT+LTF +TVE
Sbjct  250   KGLFIQAPIFMSFFFAISNMVEKVPSFKGGGIYWFTDLTTPDELLILPMLTSLTFLVTVE  309

Query  954   CNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPK  1133
              N Q+GMEGNP   T+KN SR MA L+IPFT SFPKA+F YW+TSN+FSL YG V+++P 
Sbjct  310   LNMQDGMEGNPMLKTMKNFSRVMAVLTIPFTMSFPKAIFFYWVTSNLFSLGYGFVLRKPA  369

Query  1134  VKKLLGVPII  1163
             V+  L +P I
Sbjct  370   VRSFLDLPPI  379



>ref|XP_002468646.1| hypothetical protein SORBIDRAFT_01g049540 [Sorghum bicolor]
 gb|EER95644.1| hypothetical protein SORBIDRAFT_01g049540 [Sorghum bicolor]
Length=449

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 187/259 (72%), Gaps = 5/259 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVAS----QapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASI  560
             +SE+LSD    A AS     AP   EVA AAA+S+ PVAALQ+L+D V   TG NWWA+I
Sbjct  111   VSELLSDGVASAAASVPLPPAPYPGEVAAAAAESFPPVAALQHLLDAVQSFTGLNWWATI  170

Query  561   VCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLF  740
               TT++IR +T+PL+I Q+K+T KL  +RP+++ I +EM+N    P ++  G+Q++ +LF
Sbjct  171   ALTTVMIRLVTVPLLINQMKSTMKLNEMRPEIEAINEEMRN-STDPRSMEVGKQKLGELF  229

Query  741   NEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPV  920
               + V+P +  +G+FIQGPIF+SFF AISNM EKVPS K GG +WFTDLTTPD+++I PV
Sbjct  230   LRHGVTPLTPLKGLFIQGPIFMSFFFAISNMVEKVPSMKGGGMYWFTDLTTPDNLFILPV  289

Query  921   LTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFS  1100
             LT+LTF  TVE N Q+GMEGNP   T+K VSR    + +PFT  FPKA+F YW+TSN+FS
Sbjct  290   LTSLTFLATVELNMQDGMEGNPMAKTMKKVSRFFGVMFVPFTIGFPKAIFFYWVTSNLFS  349

Query  1101  LSYGLVIKRPKVKKLLGVP  1157
             L YG V++ P V+  L +P
Sbjct  350   LVYGAVLRNPAVRLCLNLP  368



>ref|XP_004985991.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Setaria 
italica]
Length=448

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 190/269 (71%), Gaps = 7/269 (3%)
 Frame = +3

Query  393   ISEVLSDKAVEAVAS----QapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASI  560
             +SE+LSD+   A AS     AP   EVA AAA+S+ PVAALQ+L+D V   TG NWW +I
Sbjct  114   VSELLSDEVASAAASIPVPPAPYAGEVAAAAAESFPPVAALQHLLDAVQSFTGLNWWVTI  173

Query  561   VCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLF  740
               TT+LIR LT+PL+I Q+K+T KL  +RP+++ I +EM+N    P ++  G+Q++ +LF
Sbjct  174   ALTTVLIRSLTVPLLINQMKSTIKLNEMRPEIEAINEEMRN-STDPRSMEVGKQKLGELF  232

Query  741   NEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPV  920
              ++ V+P +  +G+FIQGPIF+SFF AISNM EKVPS K GGA+WFTDLTTPD   I PV
Sbjct  233   LKHDVTPLTPLKGLFIQGPIFMSFFFAISNMVEKVPSLKGGGAYWFTDLTTPDEFIILPV  292

Query  921   LTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFS  1100
             LT+LTF  TVE N Q+GMEGNP   T+K VSR    + +P T  FPKA F YW+TSN+FS
Sbjct  293   LTSLTFLATVELNMQDGMEGNPMAETMKKVSRFFGVMFVPLTLGFPKAFFFYWVTSNMFS  352

Query  1101  LSYGLVIKRPKVKKLLGVPIIP--PAPPR  1181
             L YG+VI+ P V+  L +P +   PAP R
Sbjct  353   LVYGVVIRNPAVRMCLDLPPLESQPAPAR  381



>gb|KHG19923.1| Mitochondrial inner membrane OXA1 -like protein [Gossypium arboreum]
Length=248

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +3

Query  633   LALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSF  812
             + LLRP+L++I++ MQ  GM P AV EGQ  M+ LF EY V+PF+  +G FIQ PIF+SF
Sbjct  1     MTLLRPQLEEIKERMQRTGMDPQAVAEGQNEMQKLFKEYGVTPFTPLKGFFIQMPIFISF  60

Query  813   FLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSY  992
             FL ISNMAEK+PSFK GGA+WF DL+TPDS+ IFPVLTALTFWITVECN  EG EGNPS 
Sbjct  61    FLGISNMAEKMPSFKSGGAYWFIDLSTPDSLCIFPVLTALTFWITVECNMLEGTEGNPSS  120

Query  993   GTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPA  1172
             GT KNV+R  AALS+P T +F KA+FCYWITSN+FSL+YGLV+K P VK  LGVP+IP  
Sbjct  121   GTTKNVARVFAALSVPLTMNFSKAIFCYWITSNVFSLAYGLVLKAPGVKAALGVPLIPKP  180

Query  1173  P  1175
             P
Sbjct  181   P  181



>gb|AGT17416.1| inner membrane protein [Saccharum hybrid cultivar R570]
Length=444

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 182/255 (71%), Gaps = 1/255 (0%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             +SE+LSD         AP   EVA AAA+S+ PVAALQ+L+D V   TG NWWA+I  TT
Sbjct  110   VSELLSDGVASVPLPPAPYPGEVAAAAAESFPPVAALQHLLDAVQSFTGLNWWATIALTT  169

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYK  752
             ++IR +T+PL+I Q+K+T KL  +RP+++ I +EM+N    P ++  G+Q++ +LF  + 
Sbjct  170   VMIRLVTVPLLINQMKSTMKLNDMRPEIEAINEEMRN-STDPRSMEVGKQKLGELFLRHG  228

Query  753   VSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTAL  932
             V+P +  +G+FIQGPIF+SFF AISNM EKVPS K GG +WFTDLTTPD+ +I PVLT+L
Sbjct  229   VTPLTPLKGLFIQGPIFMSFFFAISNMVEKVPSMKGGGLYWFTDLTTPDNFFILPVLTSL  288

Query  933   TFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYG  1112
             TF  TV+ N Q+GMEGNP   T+K VSR    + +PFT  FPKA+F YW+TSN FSL YG
Sbjct  289   TFLATVKLNMQDGMEGNPMAKTMKKVSRFFGVMFVPFTIGFPKAIFFYWVTSNFFSLVYG  348

Query  1113  LVIKRPKVKKLLGVP  1157
              VI+ P V+  L +P
Sbjct  349   AVIRNPAVRLSLNLP  363



>ref|XP_010553841.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Tarenaya hassleriana]
Length=399

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 191/287 (67%), Gaps = 18/287 (6%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEYISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYV  524
             R MS+  G+G +    I  V++D  ++ V SQA  V E +    DS+ PV AL+  I  V
Sbjct  83    RYMSSFHGDGSD----IPLVVTDTTLQTVTSQATGVYEFS----DSFFPVDALRNCIGMV  134

Query  525   HCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAA  704
             H  TG +WW SIV +TL IR +  PL ++Q+KAT+KL L+R +L  I ++M+ +GM P +
Sbjct  135   HSFTGLDWWVSIVLSTLFIRAMLAPLFVKQIKATTKLMLVRSQLPSIGEDMKKKGMDPTS  194

Query  705   VNEGQQRMKDLFNEYKVSPFSAF---RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFW  875
             + EGQQ+M+ L+ ++ + P +      G+FIQGP+F+ FFLA+  M EKVPSF+ GGAFW
Sbjct  195   IAEGQQQMEALYKKHGIGPLAMLAPMMGLFIQGPVFLCFFLAVRGMVEKVPSFQTGGAFW  254

Query  876   FTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASF  1055
             FTDLTTPDS+YI PVLT LT W+ +E N + G         +KN+ R  A L++P T  F
Sbjct  255   FTDLTTPDSLYILPVLTGLTAWMHIEFNVEAG-------KLLKNIGRGYAFLAVPLTMGF  307

Query  1056  PKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSS  1196
             P A+F YWITSN+F+L +G+ +KRP VKK+LG+P +PP  P +D +S
Sbjct  308   PAALFFYWITSNLFTLMFGVAVKRPLVKKVLGIPELPPLEPSSDPTS  354



>ref|XP_010553840.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Tarenaya hassleriana]
Length=420

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 191/287 (67%), Gaps = 18/287 (6%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEYISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYV  524
             R MS+  G+G +    I  V++D  ++ V SQA  V E +    DS+ PV AL+  I  V
Sbjct  104   RYMSSFHGDGSD----IPLVVTDTTLQTVTSQATGVYEFS----DSFFPVDALRNCIGMV  155

Query  525   HCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAA  704
             H  TG +WW SIV +TL IR +  PL ++Q+KAT+KL L+R +L  I ++M+ +GM P +
Sbjct  156   HSFTGLDWWVSIVLSTLFIRAMLAPLFVKQIKATTKLMLVRSQLPSIGEDMKKKGMDPTS  215

Query  705   VNEGQQRMKDLFNEYKVSPFSAF---RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFW  875
             + EGQQ+M+ L+ ++ + P +      G+FIQGP+F+ FFLA+  M EKVPSF+ GGAFW
Sbjct  216   IAEGQQQMEALYKKHGIGPLAMLAPMMGLFIQGPVFLCFFLAVRGMVEKVPSFQTGGAFW  275

Query  876   FTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASF  1055
             FTDLTTPDS+YI PVLT LT W+ +E N + G         +KN+ R  A L++P T  F
Sbjct  276   FTDLTTPDSLYILPVLTGLTAWMHIEFNVEAG-------KLLKNIGRGYAFLAVPLTMGF  328

Query  1056  PKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSS  1196
             P A+F YWITSN+F+L +G+ +KRP VKK+LG+P +PP  P +D +S
Sbjct  329   PAALFFYWITSNLFTLMFGVAVKRPLVKKVLGIPELPPLEPSSDPTS  375



>ref|XP_008650106.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial inner membrane 
protein OXA1-like [Zea mays]
Length=511

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 183/269 (68%), Gaps = 5/269 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvn----evavaaaDSYLPVAALQYLIDYVHCVTGFNWWASI  560
             +SE+LSD    A AS +        EVA AAA+S+ PVAALQ+L+D V   TG NWWA+I
Sbjct  153   VSELLSDGVASAAASVSTPPLPYPGEVAAAAAESFPPVAALQHLLDAVQSFTGLNWWATI  212

Query  561   VCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLF  740
               TTL+IR  T+PL+I Q+K+  KL  +RP+++ I +EM+N    P ++  G+Q++ +LF
Sbjct  213   ALTTLMIRLATVPLLINQMKSMMKLNEMRPEIEAINEEMRN-STDPRSMEVGKQKLGELF  271

Query  741   NEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPV  920
               + V+P +  +G+FIQGPIF+SFF AISNM EKVPS K GG +WFTDLTTPD++ I PV
Sbjct  272   LRHGVTPLTPLKGLFIQGPIFMSFFFAISNMVEKVPSMKGGGVYWFTDLTTPDNLLILPV  331

Query  921   LTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFS  1100
             LT+LTF  TVE N Q+GMEGN     +K  SR    L +PFT  FPKA+F YW+TSN FS
Sbjct  332   LTSLTFLATVELNMQDGMEGNHMLKPMKKFSRFFGVLFVPFTIGFPKAIFFYWVTSNFFS  391

Query  1101  LSYGLVIKRPKVKKLLGVPIIPPAPPRAD  1187
             L YG V++ P V+  L +P +   P  A+
Sbjct  392   LVYGAVLRNPAVRLFLNLPRLESQPTTAE  420



>emb|CDY30690.1| BnaA02g33120D [Brassica napus]
Length=287

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = +3

Query  624   TSKLALL-RPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPI  800
             T+KL++     ++ IR+EMQ++GM    + EGQ++MK+LF EY V+PF+  +G+ IQGP+
Sbjct  88    TTKLSVSDEAAVESIREEMQSKGMDHVTMAEGQKKMKNLFKEYGVTPFTPMKGMLIQGPL  147

Query  801   FVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEG  980
             F+ FFLAI NMAEKVPSF+ GGA WFTDLTTPDS+YI  V+TAL F ITVECNAQEGMEG
Sbjct  148   FIFFFLAIRNMAEKVPSFQTGGALWFTDLTTPDSLYILHVITALAFLITVECNAQEGMEG  207

Query  981   NPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             NP  GT+KNV R  A L++P T SFP+A+FCYWITSN+FSL+YGLVIKRP+VKKLL +P
Sbjct  208   NPMAGTVKNVCRGFALLTVPMTMSFPQAIFCYWITSNLFSLTYGLVIKRPRVKKLLKIP  266



>gb|EMT11597.1| Mitochondrial inner membrane protein OXA1 [Aegilops tauschii]
Length=637

 Score =   263 bits (673),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 181/270 (67%), Gaps = 18/270 (7%)
 Frame = +3

Query  378   NKIEYISEVLSDKAVEAVASQapvv--nevavaaaDSYLPVAALQYLIDYVHCVTGFNWW  551
              +++  + VL D A EAVAS  P     EVA AAADS+ PVAALQYLIDYVH  TG NWW
Sbjct  93    GEVDAAASVLVD-AAEAVASSVPAPFPGEVAAAAADSFFPVAALQYLIDYVHTFTGLNWW  151

Query  552   ASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMK  731
             A I  TT+LIR  T+P++            ++P+++ ++  M +    P    EG+ +M 
Sbjct  152   ACIALTTVLIRTATIPVLA-----------IKPEMEAVKDAMDSTD--PKTALEGKYKMT  198

Query  732   DLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYI  911
              LF ++ VSPFS  +G+ IQGP+F+SFF AI+NM EKVPS K GG FWFTDLTTPD +YI
Sbjct  199   ALFQKHGVSPFSPLKGMLIQGPMFMSFFFAINNMVEKVPSMKGGGVFWFTDLTTPDPLYI  258

Query  912   FPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSN  1091
              PVL ALTF  TVE N QEGMEGN     +K  SR MA +++PFT +F K +FCYW+TSN
Sbjct  259   CPVLAALTFLATVELNLQEGMEGNSMADKMKTFSRGMALMTVPFTMNFAKGIFCYWVTSN  318

Query  1092  IFSLSYGLVIKRPKVKKLLGVPI--IPPAP  1175
             +FSL YG+V++RP V+KL  +P    P AP
Sbjct  319   LFSLVYGIVMRRPAVRKLFNLPAWEAPSAP  348



>ref|XP_006853548.1| hypothetical protein AMTR_s00032p00233900 [Amborella trichopoda]
 gb|ERN15015.1| hypothetical protein AMTR_s00032p00233900 [Amborella trichopoda]
Length=240

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = +3

Query  642   LRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLA  821
             +RP +++I+++MQN  + P    EG+QRMKDLF +Y V+P + F+GI IQGP+F+SF+L 
Sbjct  1     MRPHMEEIKEQMQNT-LDPKVTEEGRQRMKDLFKQYGVTPLTPFKGILIQGPLFISFYLG  59

Query  822   ISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
             I+NM EKVPSFKEGGAFWF DLTTPD++YIFPVLT+L+F  TVE N QEGMEGNP  GT+
Sbjct  60    ITNMVEKVPSFKEGGAFWFVDLTTPDNLYIFPVLTSLSFLATVELNMQEGMEGNPIAGTM  119

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR  1181
             KN SR +A  ++P T SFPKA+FCYW+TSN+FSL YGLVIKRP VKK LG+P +   P  
Sbjct  120   KNFSRFIAFATVPITMSFPKAIFCYWVTSNLFSLVYGLVIKRPPVKKFLGLPDM--VPDA  177

Query  1182  ADQSSGLPFF  1211
             A      PFF
Sbjct  178   AASRINFPFF  187



>ref|XP_002960272.1| hypothetical protein SELMODRAFT_73518 [Selaginella moellendorffii]
 gb|EFJ37811.1| hypothetical protein SELMODRAFT_73518 [Selaginella moellendorffii]
Length=315

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 127/289 (44%), Positives = 183/289 (63%), Gaps = 4/289 (1%)
 Frame = +3

Query  351   MSTSVGEGMNKIEYISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHC  530
             MS S  E +   E +++   +    A  +   +  E+ +A ++S+   AA+QY+I   H 
Sbjct  1     MSESAAESIRFPETLADAAQEIVSGAAGATYDLSKEIVLAVSESFPWTAAVQYVIYATHV  60

Query  531   VTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVN  710
             VTG  WW SI  TT+ +R + LPL+I Q+K+T++ ALLRP L+ I+ +M+     P A+ 
Sbjct  61    VTGLPWWLSIALTTVAVRTMVLPLVIYQVKSTARFALLRPDLEKIKVDMEQANYDPVALA  120

Query  711   EGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLT  890
             E +++M +LF ++K  PF+   G  +QGPIF+ FF  +  MAEK+ SFKEGGAFWFTDLT
Sbjct  121   ENKRKMAELFAKHKTDPFTPLIGALLQGPIFMCFFFGLRTMAEKMDSFKEGGAFWFTDLT  180

Query  891   TPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVF  1070
             TPD +YI P +T  TF ITVE NA +GM+G P+  T+KN+ R M  L +P TA FPKA+F
Sbjct  181   TPDELYILPFITTATFLITVELNAVDGMQGQPNQKTMKNILRGMGVLFLPLTAQFPKALF  240

Query  1071  CYWITSNIFSLSYGLVIKRPKVKKLLGVP----IIPPAPPRADQSSGLP  1205
             CYW+TSN++S+  G +++  K K  L +P    +  PAPP    SS  P
Sbjct  241   CYWVTSNLWSMLQGALLRNKKFKAYLDIPDTSHLGTPAPPPTITSSKPP  289



>gb|KCW71509.1| hypothetical protein EUGRSUZ_E00060 [Eucalyptus grandis]
Length=239

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = +3

Query  549   WASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRM  728
             WASI  TT+LIR  T+PL I Q+++T+KL+L+RP+++++ Q ++    AP A ++  Q  
Sbjct  8     WASIALTTVLIRGATVPLQINQMRSTAKLSLMRPRVEELNQTLRETANAPDAASKYLQSF  67

Query  729   KDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMY  908
               LF EY VSPF+  +G+ ++GPIF+SFF AI NMAEK+PSF+ GG  WF +L TPDS+Y
Sbjct  68    TSLFKEYGVSPFTPLKGLLMRGPIFISFFFAIKNMAEKIPSFQTGGTLWFVNLATPDSLY  127

Query  909   IFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITS  1088
             I P+LTALTFWI VE + +EG++G    GT+K   R    LSIP    FPKA+F YW+TS
Sbjct  128   ILPILTALTFWIAVEFHLEEGLDGTAVVGTLKKFFRVFTILSIPVMMCFPKAMFGYWLTS  187

Query  1089  NIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQ  1190
             N+FSL++GLV+++P VKK L VP IP +P  A Q
Sbjct  188   NMFSLAFGLVVQQPGVKKFLKVPDIPVSPASASQ  221



>gb|KCW71507.1| hypothetical protein EUGRSUZ_E00058 [Eucalyptus grandis]
Length=347

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 209/350 (60%), Gaps = 16/350 (5%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRK---KPESSSENPRV-LTHLRHCY  245
             MA+RRS  TT    L+   +R  PS  HIHRD+ D      P     +P   +  L    
Sbjct  1     MAWRRSLSTT--GTLI--ARRLRPSFFHIHRDNRDEPIICSPGRHYSSPSTSINSLPRAA  56

Query  246   FGNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMN-KIE-YISEVLSDKA  419
              G+R  L      +  Q   F PPP  ++    R MS + G+  + KI+ ++ E   +K 
Sbjct  57    SGSRNLLSP--RSMERQGLLFMPPP-GISSSLCRYMSNASGDDSSFKIDDFVREATPEKV  113

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
             ++ V SQ   ++EVA+AAADS  PVA ++YLI  VH  TG NWWASI  TT+LIR  T+P
Sbjct  114   MDVVTSQPSAMSEVALAAADSSYPVAGIEYLIGAVHSFTGLNWWASIALTTVLIRGATVP  173

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRG  779
             L I Q+++T+KL+L+RP+++++ Q ++     P A ++  Q    LF EY +SPF+  +G
Sbjct  174   LQINQMRSTAKLSLMRPRVEELNQTLRETANDPDAASKYLQSFASLFKEYGISPFTPLKG  233

Query  780   IFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECN  959
             + ++GPIF+SFF AI NMAEK+PSF+ GG  WF +L TPDS+YI P+LTALTFWI VE +
Sbjct  234   LLMRGPIFISFFFAIKNMAEKIPSFQTGGTLWFVNLATPDSLYILPILTALTFWIAVEFH  293

Query  960   AQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAV---FCYWITSNIFS  1100
              +EG+ G    GT+K   R    LSIP    FPK +    C+  +++I S
Sbjct  294   LEEGLNGTAVAGTMKKFFRVFTVLSIPVMMCFPKVLCLRLCFHGSAHINS  343



>ref|XP_002967440.1| hypothetical protein SELMODRAFT_408456 [Selaginella moellendorffii]
 gb|EFJ32039.1| hypothetical protein SELMODRAFT_408456 [Selaginella moellendorffii]
Length=411

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 179/277 (65%), Gaps = 8/277 (3%)
 Frame = +3

Query  399   EVLSDKAVE----AVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVC  566
             E L+D A E    A  +   +  E+ +A ++S+   AA+QY+I   H VTG  WW SI  
Sbjct  109   ETLADAAQEIVSGAAGATYDLSKEIVLAVSESFPWTAAVQYVIYATHVVTGLPWWLSIAL  168

Query  567   TTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNE  746
             TT+ +R + LPL+I Q+K+T++ ALLRP L+ I+ +M+     P A+ E +++M +LF +
Sbjct  169   TTVAVRTMVLPLVIYQVKSTARFALLRPDLEKIKVDMEQANYDPVALAENKRKMAELFAK  228

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLT  926
             +K  PF+   G  +QGPIF+ FF  +  MAEK+ SFKEGGAFWFTDLTTPD ++I P +T
Sbjct  229   HKTDPFTPLIGALLQGPIFMCFFFGLRTMAEKMDSFKEGGAFWFTDLTTPDELFILPFIT  288

Query  927   ALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLS  1106
               TF ITVE NA +GM+G P+  T+KN+ R M  L +P TA FPKA+FCYW+TSN++S+ 
Sbjct  289   TATFLITVELNAVDGMQGQPNQKTMKNILRGMGVLFLPLTAQFPKALFCYWVTSNLWSML  348

Query  1107  YGLVIKRPKVKKLLGVP----IIPPAPPRADQSSGLP  1205
              G +++  K K  L +P    +  PAPP    SS  P
Sbjct  349   QGALLRNKKFKAYLDIPDTSHLGTPAPPPTIASSKPP  385



>ref|XP_001782477.1| predicted protein [Physcomitrella patens]
 gb|EDQ52696.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   248 bits (632),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 172/271 (63%), Gaps = 5/271 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + +V+SD+ + A  S +      A A  D   P AALQ+LID+VH   G  WW SI  TT
Sbjct  136   VDQVVSDQVLSAGTSSSLGEVAAAAA--DCSAPTAALQHLIDFVHTQGGLPWWLSIAATT  193

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYK  752
             + IR + LP+++ Q+KAT++L L+RP+L+ I   ++  G  P      Q+RMK+LF ++ 
Sbjct  194   VGIRVMVLPVLVWQMKATARLTLMRPELERITNTIKESGYDPKVTEVNQKRMKELFAQHN  253

Query  753   VSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTAL  932
              +PF    G F+Q P+F+SFF AI NMAE+VPSFKEGGA WFTDLTT D  +I P+++ L
Sbjct  254   TNPFMPLMGAFVQAPLFISFFFAIRNMAERVPSFKEGGALWFTDLTTADPYFILPIMSGL  313

Query  933   TFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYG  1112
                 T+E  A +GM+G P  G +K   R  A L +P TASFPKA+FCYW+T+N+ SL   
Sbjct  314   FTLATIELGAMDGMQGQPMIGKMKMFFRGFAVLIVPLTASFPKALFCYWLTTNVCSLIQT  373

Query  1113  LVIKRPKVKKLLGVP---IIPPAPPRADQSS  1196
              V+++P VK+ LG+P    + P  P A  SS
Sbjct  374   TVLRQPAVKRTLGIPETAHLAPVTPAAVASS  404



>ref|XP_010274446.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X3 [Nelumbo nucifera]
Length=358

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +3

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLT  926
             Y VSPF+ F+G+FIQGPIF+SFF AISNMAEKVPSFK GGAFWFTDLTTPDS+YIFP+LT
Sbjct  152   YGVSPFTPFKGLFIQGPIFISFFTAISNMAEKVPSFKGGGAFWFTDLTTPDSLYIFPILT  211

Query  927   ALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLS  1106
             +L F ITVECN QEGMEGN   GT+KNVSR +A L+IPFT SFPKA+FCYW+TSN+FSL 
Sbjct  212   SLIFLITVECNMQEGMEGNSVAGTMKNVSRVLAVLTIPFTMSFPKAIFCYWVTSNLFSLM  271

Query  1107  YGLVIKRPKVKKLLGVPIIPPAPPRADQ  1190
             YGLV+KRP VK+ LG+P +P APP A Q
Sbjct  272   YGLVLKRPSVKEFLGLPKLPAAPPSATQ  299


 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 108/192 (56%), Gaps = 16/192 (8%)
 Frame = +3

Query  78   MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
            MA+RRS   + R  LL  +QRF PS S+I  DDD + +P ++      LT     YF   
Sbjct  1    MAFRRS--ISFRVTLL--RQRFHPSFSYILHDDDRKCQPPAADP----LTRPAASYFLEE  52

Query  258  ISLGVGVARIPFQDRKFSPPPW--AMAPIWMRNMSTSVGEGMNKIEYI---SEVLSDKAV  422
             +    +  + FQD++FS       + P   R+MS++VG G +K EYI   ++VL++K V
Sbjct  53   GTYNSNI-NLKFQDKRFSSLYLLPGIGPSLCRHMSSTVGGGSDKFEYINDVADVLTEKGV  111

Query  423  EAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPL  602
            E   +Q P V+EVA+AAADS+ PVAALQYLID VH  TG +W+     T     ++  P+
Sbjct  112  EV--AQVPSVSEVAIAAADSFYPVAALQYLIDGVHSFTGLHWYGVSPFTPFKGLFIQGPI  169

Query  603  MIQQLKATSKLA  638
             I    A S +A
Sbjct  170  FISFFTAISNMA  181



>ref|XP_008644207.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=345

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 142/193 (74%), Gaps = 2/193 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ PVAALQ++ID +H  TG NWW  I  TT +IR  T+PL++ QLKAT+KL  + P++
Sbjct  130   DSFPPVAALQHIIDAIHTFTGLNWWVCIALTTFIIRIATVPLLVNQLKATTKLRAINPEM  189

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             + I+ +M +  M P +V EGQ +MK LF ++ VSP +  +G+ IQGPIF+SFF AISNM 
Sbjct  190   EVIKDQMNS--MDPKSVQEGQAKMKALFKKHGVSPLTPMKGLLIQGPIFMSFFFAISNMV  247

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
             EKVPSFK GG  WFTDLTTPDS+YI P+LT LTF  TVE N QEGMEGNP  G +K  SR
Sbjct  248   EKVPSFKGGGTLWFTDLTTPDSLYILPMLTGLTFLATVELNLQEGMEGNPMAGKMKYFSR  307

Query  1017  AMAALSIPFTASF  1055
              +A L++PFT +F
Sbjct  308   GVAVLTVPFTMNF  320



>ref|XP_007159291.1| hypothetical protein PHAVU_002G225700g [Phaseolus vulgaris]
 gb|ESW31285.1| hypothetical protein PHAVU_002G225700g [Phaseolus vulgaris]
Length=306

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +3

Query  741   NEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPV  920
               Y VSPF+  +G+FIQGPIFVSFFLAISNMAEKVPSFK GGA+WFTDL+TPD++Y+ PV
Sbjct  97    GRYGVSPFTPLKGLFIQGPIFVSFFLAISNMAEKVPSFKHGGAYWFTDLSTPDTLYVLPV  156

Query  921   LTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFS  1100
             LTAL+F ITVECN QEGMEGNP   T+KNVSR +A L++PFT  FPKA+FCYW+TSN+FS
Sbjct  157   LTALSFLITVECNMQEGMEGNPVASTMKNVSRGLAVLTVPFTMGFPKAIFCYWVTSNLFS  216

Query  1101  LSYGLVIKRPKVKKLLGVPIIPPAPPRADQSSGLPFF  1211
             L YGL +K P VKK LG+P IP   P +   S    F
Sbjct  217   LVYGLALKVPGVKKTLGIPEIPVTVPTSGPQSPFSIF  253



>ref|XP_010544832.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Tarenaya hassleriana]
Length=380

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 143/369 (39%), Positives = 212/369 (57%), Gaps = 66/369 (18%)
 Frame = +3

Query  132   QQRFAPSISHI---HRDDDDRKKPESSSENPRVLTHLRHCYFG-NRISLGVGVARIPFQD  299
             Q+RF PS  H+   ++DD D     ++S+N   + H    + G NR+S         F++
Sbjct  15    QRRFYPSCGHLLGNNKDDTD-----TASQNLGTMIHKVLPHNGTNRLS-------SLFRE  62

Query  300   RKFS--PPPWAMAPIWMRNMSTSVGEGMNKIEYI----SEVLSDKAVEAVASQapvvnev  461
             R++     P        R+MS++  E  +K++       E++ D  +EAVAS  PV+NEV
Sbjct  63    RQYRSLAGPVGFGFSSCRHMSSTPEEWSDKVDGFDFAAEEIIPDGTIEAVASSVPVINEV  122

Query  462   avaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLAL  641
             A+AAADS+ PVAALQYL+D VH  TG NWWASIV TTL+IR LT+P  + QLKAT KL +
Sbjct  123   AIAAADSFYPVAALQYLVDGVHSFTGLNWWASIVMTTLIIRGLTVPAHLNQLKATFKLEM  182

Query  642   LRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLA  821
             L+P+L+++R+EM ++ M P  + +G++RM+ LF+EY V+P +  +G+ IQG IFVSFF A
Sbjct  183   LKPRLEELREEMNSKTMDPETMADGKKRMQALFHEYGVTPLTPLKGVLIQGTIFVSFFFA  242

Query  822   ISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
                                                         C+   G EGNP  GT+
Sbjct  243   --------------------------------------------CDMAAGHEGNPMAGTM  258

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR  1181
             K VSR ++ + +P   SF  A+F +W+TSN+FS+ YGLV+KRP+V++LL +PI+  +P +
Sbjct  259   KKVSRILSFVLVPVMMSFETALFGFWLTSNLFSIGYGLVLKRPEVRRLLNIPILGNSPTQ  318

Query  1182  ADQSSGLPF  1208
                 S + F
Sbjct  319   QSPPSPMHF  327



>ref|XP_010553842.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X3 [Tarenaya hassleriana]
Length=244

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 144/203 (71%), Gaps = 10/203 (5%)
 Frame = +3

Query  597   PLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAF-  773
             PL ++Q+KAT+KL L+R +L  I ++M+ +GM P ++ EGQQ+M+ L+ ++ + P +   
Sbjct  4     PLFVKQIKATTKLMLVRSQLPSIGEDMKKKGMDPTSIAEGQQQMEALYKKHGIGPLAMLA  63

Query  774   --RGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWIT  947
                G+FIQGP+F+ FFLA+  M EKVPSF+ GGAFWFTDLTTPDS+YI PVLT LT W+ 
Sbjct  64    PMMGLFIQGPVFLCFFLAVRGMVEKVPSFQTGGAFWFTDLTTPDSLYILPVLTGLTAWMH  123

Query  948   VECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKR  1127
             +E N + G         +KN+ R  A L++P T  FP A+F YWITSN+F+L +G+ +KR
Sbjct  124   IEFNVEAG-------KLLKNIGRGYAFLAVPLTMGFPAALFFYWITSNLFTLMFGVAVKR  176

Query  1128  PKVKKLLGVPIIPPAPPRADQSS  1196
             P VKK+LG+P +PP  P +D +S
Sbjct  177   PLVKKVLGIPELPPLEPSSDPTS  199



>gb|EMS63651.1| Mitochondrial inner membrane protein OXA1 [Triticum urartu]
Length=388

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 129/180 (72%), Gaps = 4/180 (2%)
 Frame = +3

Query  642   LRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLA  821
             ++P+++ I+  M +    P A  EG+ +M  LF ++ VSPFS  +G+ IQGP+F+SFF A
Sbjct  13    IKPEMEAIKDAMDSPD--PKAALEGKYKMTALFQKHGVSPFSPLKGMLIQGPMFMSFFFA  70

Query  822   ISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
             I+NM EKVPS K GG FWFTDLTTPD +YI PVL ALTF +TVE N QEGMEGN     +
Sbjct  71    INNMVEKVPSMKAGGVFWFTDLTTPDPLYICPVLAALTFLVTVELNLQEGMEGNSMADKM  130

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPI--IPPAP  1175
             K  SR MA +++PFT +F K +FCYW+TSN+FSL YG+VI+RP V+KL  +P    P AP
Sbjct  131   KTFSRGMALMTVPFTMNFAKGIFCYWVTSNLFSLVYGIVIRRPAVRKLFNLPAWEAPSAP  190



>tpg|DAA42925.1| TPA: hypothetical protein ZEAMMB73_313766 [Zea mays]
Length=276

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = +3

Query  642   LRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLA  821
             +RP+++ I +EM+N    P ++  G+Q++ +LF  + V+P +  +G+FIQGPIF+SFF A
Sbjct  5     MRPEIEAINEEMRN-STDPRSMEVGKQKLGELFLRHGVTPLTPLKGLFIQGPIFMSFFFA  63

Query  822   ISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
             ISNM EKVPS K GG +WFTDLTTPD++ I PVLT+LTF  TVE N Q+GMEGN     +
Sbjct  64    ISNMVEKVPSMKGGGVYWFTDLTTPDNLLILPVLTSLTFLATVELNMQDGMEGNHMLKPM  123

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR  1181
             K  SR    L +PFT  FPKA+F YW+TSN FSL YG V++ P V+  L +P +   P  
Sbjct  124   KKFSRFFGVLFVPFTIGFPKAIFFYWVTSNFFSLVYGAVLRNPAVRLFLNLPRLESQPTT  183

Query  1182  AD  1187
             A+
Sbjct  184   AE  185



>ref|XP_010550519.1| PREDICTED: mitochondrial inner membrane protein OXA1 isoform 
X1 [Tarenaya hassleriana]
Length=390

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 139/377 (37%), Positives = 196/377 (52%), Gaps = 29/377 (8%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSIS-HIHRDDDDRKKPESSSENPRVL-THLRHCYFG  251
             MA+RRS       + L    R+ PS S  I  DDD  +K    +   R   +  + C+  
Sbjct  1     MAFRRS----LAIRSLLRSHRYRPSHSCAIPLDDDHGRKCFLQAPWQRSYHSSFQRCFCS  56

Query  252   NRISLGVGVARIPFQDRKFSPPPWA--MAPIWMRNMSTSVGEGMNK---IEYISEVLSDK  416
             N +             R +S  P +  +     R MST+ G G ++   +  ++E ++  
Sbjct  57    NSV--------FSRNLRGYSNSPLSSPLGFALYRPMSTAHGAGSDEPDGMNDMAEAITSS  108

Query  417   AVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTL  596
              +E  AS A + NE+A AA+D  +PVAA Q LID VH  TG NWWASIV TTLLIR +T+
Sbjct  109   TLENAASHATLANELAEAASDCTIPVAAAQNLIDMVHSFTGLNWWASIVLTTLLIRGVTI  168

Query  597   PLMIQQLKATS-KLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNE-YKVSPFSA  770
             PLMI  L+  S K+ +   KL D   E++  GM P  V E  +R  D+  + Y +     
Sbjct  169   PLMIGNLRLISYKMIVAIRKLPD--SEIRTMGMDPVTVTENARRANDVLQKLYTLGGVCH  226

Query  771   FRGIFI------QGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTAL  932
              R + I      Q P  ++  LA   MA  + SFK GGA WFTDL T D+  I PVL+ L
Sbjct  227   LRTLLIPIQLLIQYPALIAMSLATYAMAGNISSFKTGGALWFTDLATMDASGILPVLSGL  286

Query  933   TFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYG  1112
             T +I  E  A +G EG P      ++ R +A L    + + PKAV C WITS +FSL   
Sbjct  287   TVFIAAEFGAIKGFEGFPRLCLAGDMGRCLAILVAIGSMTLPKAVHCVWITSALFSLISS  346

Query  1113  LVIKRPKVKKLLGVPII  1163
              V++RP +K+ LG+P++
Sbjct  347   CVLERPGIKRFLGIPVV  363



>ref|XP_010550521.1| PREDICTED: mitochondrial inner membrane protein OXA1 isoform 
X3 [Tarenaya hassleriana]
Length=323

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 153/265 (58%), Gaps = 10/265 (4%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             ++E ++   +E  AS A + NE+A AA+D  +PVAA Q LID VH  TG NWWASIV TT
Sbjct  34    MAEAITSSTLENAASHATLANELAEAASDCTIPVAAAQNLIDMVHSFTGLNWWASIVLTT  93

Query  573   LLIRWLTLPLMIQQLKATS-KLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNE-  746
             LLIR +T+PLMI  L+  S K+ +   KL D   E++  GM P  V E  +R  D+  + 
Sbjct  94    LLIRGVTIPLMIGNLRLISYKMIVAIRKLPD--SEIRTMGMDPVTVTENARRANDVLQKL  151

Query  747   YKVSPFSAFRGIFI------QGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMY  908
             Y +      R + I      Q P  ++  LA   MA  + SFK GGA WFTDL T D+  
Sbjct  152   YTLGGVCHLRTLLIPIQLLIQYPALIAMSLATYAMAGNISSFKTGGALWFTDLATMDASG  211

Query  909   IFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITS  1088
             I PVL+ LT +I  E  A +G EG P      ++ R +A L    + + PKAV C WITS
Sbjct  212   ILPVLSGLTVFIAAEFGAIKGFEGFPRLCLAGDMGRCLAILVAIGSMTLPKAVHCVWITS  271

Query  1089  NIFSLSYGLVIKRPKVKKLLGVPII  1163
              +FSL    V++RP +K+ LG+P++
Sbjct  272   ALFSLISSCVLERPGIKRFLGIPVV  296



>ref|XP_005850884.1| hypothetical protein CHLNCDRAFT_140542 [Chlorella variabilis]
 gb|EFN58782.1| hypothetical protein CHLNCDRAFT_140542 [Chlorella variabilis]
Length=426

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 140/234 (60%), Gaps = 9/234 (4%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+LP   +Q L+  +H   G  WW SI+  T  +R  TLP+MI Q+K T +++L RP++
Sbjct  155   DSWLPTRLIQGLLTGLHGALGLEWWQSIMVATCAMRLATLPIMIMQIKNTYRMSLARPEM  214

Query  657   DDIR---QEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAIS  827
             + +    +E Q +G   AA+ E QQ +  ++ +Y  +PF +  G+ +Q PIF+ FF A+ 
Sbjct  215   EVLMNHVKEEQAKGNMEAAL-EHQQHVMAVWKKYNCNPFKSMAGMLVQAPIFIGFFSALR  273

Query  828   NMA-EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNP--SYGT  998
               A  KVPS  EGGA WFTDLT  D  Y+ P L  L+F +T+E  A +GM+G P      
Sbjct  274   GFAAHKVPSLTEGGALWFTDLTVADPTYMLPALAGLSFLLTIELGAADGMQGQPPEMQKK  333

Query  999   IKNVSRAMAALSIPF-TASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             +KNV R + AL IP  + + P +VF YW  SN+FSL    ++K P VK  LG+P
Sbjct  334   LKNVMR-VVALVIPLASTALPASVFMYWSASNVFSLLQTSLLKVPLVKSTLGIP  386



>ref|XP_001418188.1| Oxa1 family transporter: 60 KD inner membrane protein OxaA-like 
protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96481.1| Oxa1 family transporter: 60 KD inner membrane protein OxaA-like 
protein [Ostreococcus lucimarinus CCE9901]
Length=304

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 137/228 (60%), Gaps = 2/228 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
              S+   AAL Y ++Y H   G  WW +IV  T+ +R +T PL++ Q++ T+K+ L +P+L
Sbjct  34    QSWPTTAALMYAMEYFHVAHGLEWWLAIVGATVFMRTITFPLIVMQMRNTAKMQLCKPEL  93

Query  657   DDIRQEMQ-NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
             + ++ +M+ N    P   N   + M+ ++ +Y V+P  +F  I I  P+F+SFF AIS M
Sbjct  94    EALQAKMKSNPQQDPELANAYYKEMQKVWKKYDVNPVKSFAPILINAPVFISFFFAISKM  153

Query  834   AEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVS  1013
             A+ VPSF+ GG   + DL+  D  Y  P+L++LTF  +VE  A EGM+ + S   +K   
Sbjct  154   AQGVPSFESGGPSMYPDLSMADPTYSLPILSSLTFLASVELGAVEGMQTSQS-AQMKWFL  212

Query  1014  RAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             RA+A   +P TASFP+ VF YWITSNIFS     + +    K  +G+P
Sbjct  213   RALAVAMVPLTASFPQGVFVYWITSNIFSGFQTSITRTKAFKSTMGIP  260



>ref|XP_010550520.1| PREDICTED: mitochondrial inner membrane protein OXA1 isoform 
X2 [Tarenaya hassleriana]
Length=352

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 184/358 (51%), Gaps = 31/358 (9%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSIS-HIHRDDDDRKKPESSSENPRVL-THLRHCYFG  251
             MA+RRS       + L    R+ PS S  I  DDD  +K    +   R   +  + C+  
Sbjct  1     MAFRRS----LAIRSLLRSHRYRPSHSCAIPLDDDHGRKCFLQAPWQRSYHSSFQRCFCS  56

Query  252   NRISLGVGVARIPFQDRKFSPPPWAMAPIWM---RNMSTSVGEGMNK---IEYISEVLSD  413
             N +             R +S  P + +P+     R MST+ G G ++   +  ++E ++ 
Sbjct  57    NSV--------FSRNLRGYSNSPLS-SPLGFALYRPMSTAHGAGSDEPDGMNDMAEAITS  107

Query  414   KAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLT  593
               +E  AS A + NE+A AA+D  +PVAA Q LID VH  TG NWWASIV TTLLIR +T
Sbjct  108   STLENAASHATLANELAEAASDCTIPVAAAQNLIDMVHSFTGLNWWASIVLTTLLIRGVT  167

Query  594   LPLMIQQLKATS-KLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNE-YKVSPFS  767
             +PLMI  L+  S K+ +   KL D   E++  GM P  V E  +R  D+  + Y +    
Sbjct  168   IPLMIGNLRLISYKMIVAIRKLPD--SEIRTMGMDPVTVTENARRANDVLQKLYTLGGVC  225

Query  768   AFRGIFI------QGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTA  929
               R + I      Q P  ++  LA   MA  + SFK GGA WFTDL T D+  I PVL+ 
Sbjct  226   HLRTLLIPIQLLIQYPALIAMSLATYAMAGNISSFKTGGALWFTDLATMDASGILPVLSG  285

Query  930   LTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
             LT +I  E  A +G EG P      ++ R +A L    + + PKAV C WITS +FSL
Sbjct  286   LTVFIAAEFGAIKGFEGFPRLCLAGDMGRCLAILVAIGSMTLPKAVHCVWITSALFSL  343



>ref|XP_005651155.1| hypothetical protein COCSUDRAFT_39658 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26611.1| hypothetical protein COCSUDRAFT_39658 [Coccomyxa subellipsoidea 
C-169]
Length=249

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 136/226 (60%), Gaps = 10/226 (4%)
 Frame = +3

Query  549   WASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPK---LDDIRQEMQNRGMAPAAVNEGQ  719
             W +I+ TT+  R LTLPL+++Q + T+ + + RP+   L D   E   RG  P A  E Q
Sbjct  6     WLTIIYTTIGARLLTLPLVVKQQRNTANMTMARPEMMALKDWYTEETARG-NPKATTEYQ  64

Query  720   QRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM-AEKVPSFKEGGAFWFTDLTTP  896
             QR+ +L+ +Y  +PF +  GI  Q P+F+ FF A+  + A KVPS  EGG  WFTDLT  
Sbjct  65    QRLANLWQKYDCNPFKSMLGILAQAPLFIGFFSALRALSAAKVPSMTEGGVAWFTDLTLA  124

Query  897   DSMYIFPVLTALTFWITVECNAQEGMEGNPS--YGTIKNVSRAMAALSIPFTASFPKAVF  1070
             D  Y  P++++  F +TVE  A +GM+G        +KN+ RA+    +P TASFP+ VF
Sbjct  125   DPYYALPIMSSAVFLLTVELGAADGMQGQDEAMLRRMKNIFRAIGVAMVPLTASFPQGVF  184

Query  1071  CYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSSGLPF  1208
              YW+TSNIFSL   ++ K P V+K L +P +  A  RA  ++GLP 
Sbjct  185   LYWVTSNIFSLGQSVLFKLPAVRKTLKLPDL--AKMRAT-ATGLPI  227



>ref|XP_007512866.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16424.1| predicted protein [Bathycoccus prasinos]
Length=396

 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 135/230 (59%), Gaps = 4/230 (2%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             +S+   A L Y+++Y H V+G  W+ +I   T+++R LTLP  + Q++ T+++ L RP++
Sbjct  89    ESWYTTAGLMYVMEYFHLVSGLEWYQAIAAATVVMRTLTLPFTVMQMRNTARMQLARPEM  148

Query  657   DDIRQEMQNRGMA---PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAIS  827
             + + QE   +  A   P A       +  ++ +Y+  P  +   + +  P+FVSF+ AIS
Sbjct  149   ERL-QERAKQTQAQNDPEAAQRHLSEVTAIWKKYECHPVKSLAPLLVSAPLFVSFYFAIS  207

Query  828   NMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
              MA+ + SFK+GGAFWFTDL+  D   + P+LT+  F  +VE  A EGM  N    T+K 
Sbjct  208   RMADGIGSFKDGGAFWFTDLSAADPTMMMPLLTSALFLASVELGAVEGMNNNQQGLTMKW  267

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
               R +A   +P T +F + VFCYWITSN +SL    + K   +K+L G+P
Sbjct  268   ALRGLALALVPMTWNFTQGVFCYWITSNSYSLFQATLFKSTMMKRLAGIP  317



>emb|CCJ28445.1| unnamed protein product [Pneumocystis jirovecii]
Length=423

 Score =   174 bits (441),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 143/241 (59%), Gaps = 4/241 (2%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  LQ  ++Y+H  TG  WWASI   T++IR+  +PL+I  ++  S L+L+ P++ +  
Sbjct  112   PVGFLQQCLEYIHVFTGLPWWASIAALTIVIRFSMMPLLIGMIRNLSALSLIHPQVQEHM  171

Query  669   QEMQNRGMAPAAVNEGQQ--RMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEK  842
             + ++   +    + + ++   +++LF EY+V+P  +    FIQ P+F+SF+LA S+MA  
Sbjct  172   KALKEAQLEGDMLEQAKRTRSIQELFKEYQVNPLKSLAMPFIQIPVFISFYLACSHMAAL  231

Query  843   -VPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYG-TIKNVSR  1016
              VP  K GG  WF+DLT  DS +I P L +   +I +E  ++ G   + +    +KN  R
Sbjct  232   PVPELKYGGLGWFSDLTVKDSYFILPFLNSSLMFINLELGSEVGSSASANTSRKMKNFFR  291

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSS  1196
             AM  L+  FT +F  A+FCYWITSNIFSL  G+V++ P +++ L +P + P       S 
Sbjct  292   AMILLTPLFTMNFQSAIFCYWITSNIFSLGQGMVLRSPAIRRSLNLPPLRPKVKLEQLSD  351

Query  1197  G  1199
             G
Sbjct  352   G  352



>ref|XP_003079772.1| putative cytochrome oxidase assembly protein (ISS) [Ostreococcus 
tauri]
Length=337

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 135/230 (59%), Gaps = 2/230 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
              S+   AAL Y ++Y H   G  WW +IV  T+ +R +T PL++ Q++ T+++ L +P+L
Sbjct  67    QSWPTTAALMYAMEYFHVAHGLEWWLAIVGATVFMRTVTFPLVVMQMRNTARMQLCKPEL  126

Query  657   DDIRQEMQ-NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
             + ++ +M+ N    P         M+ ++ +Y V+PF +F  + I  P+F+SF+ AIS M
Sbjct  127   EALQAKMKSNPSQDPELATAYYAEMQKVWKKYDVNPFKSFAPVLINAPVFISFYFAISKM  186

Query  834   AEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVS  1013
             A  VPSF+ GG   + DL+  D  Y  P+L++LTF  +VE    EGM+ + S   +K   
Sbjct  187   AAGVPSFETGGPSMYPDLSIADPTYSLPILSSLTFLASVELGTVEGMQTSQS-AQMKWFL  245

Query  1014  RAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
             RA+A   +P TASFP+ VF YWITSN+FS     + +    K  +G+P +
Sbjct  246   RALAVAMVPLTASFPQGVFVYWITSNMFSGVQTSITRTKGFKAAMGIPDV  295



>ref|XP_003383807.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Amphimedon 
queenslandica]
Length=425

 Score =   173 bits (438),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 138/241 (57%), Gaps = 6/241 (2%)
 Frame = +3

Query  483   YLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDD  662
             Y PV  +Q  +D++H  TG  WWASIV  T+++R L LPL+I+     ++L  +RP+ D 
Sbjct  119   YTPVGLVQNCLDWIHLNTGLPWWASIVVGTVILRSLMLPLVIKLQVNAARLNQIRPETDV  178

Query  663   IR---QEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
             I    +E Q  G    A  E   R+  L+ ++  +P       F+Q P+F+SFF+A+  M
Sbjct  179   IMARMKEYQQMGNTILAAQE-NARLLMLYRKHNCNPVKMMIMPFLQFPVFISFFIALRRM  237

Query  834   AEK-VPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A+  + S K+GG FWFTDLT PD  YI P+ ++L F   +E   + G+  NP    +K  
Sbjct  238   AQAPIESMKDGGLFWFTDLTLPDPYYILPITSSLLFMANIELGGEAGVT-NPQMEKMKLF  296

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQ  1190
              R MA   +P TA+FP A+F YWIT++ +S+   LV+K P V+  LG+P I   P   D 
Sbjct  297   FRVMAVALVPLTATFPTALFMYWITASFYSMGQILVLKVPAVRTRLGIPTIVNDPSATDN  356

Query  1191  S  1193
             S
Sbjct  357   S  357



>emb|CEF98290.1| Membrane insertase OXA1/ALB3/YidC [Ostreococcus tauri]
Length=424

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 135/230 (59%), Gaps = 2/230 (1%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
              S+   AAL Y ++Y H   G  WW +IV  T+ +R +T PL++ Q++ T+++ L +P+L
Sbjct  154   QSWPTTAALMYAMEYFHVAHGLEWWLAIVGATVFMRTVTFPLVVMQMRNTARMQLCKPEL  213

Query  657   DDIRQEMQ-NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
             + ++ +M+ N    P         M+ ++ +Y V+PF +F  + I  P+F+SF+ AIS M
Sbjct  214   EALQAKMKSNPSQDPELATAYYAEMQKVWKKYDVNPFKSFAPVLINAPVFISFYFAISKM  273

Query  834   AEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVS  1013
             A  VPSF+ GG   + DL+  D  Y  P+L++LTF  +VE    EGM+ + S   +K   
Sbjct  274   AAGVPSFETGGPSMYPDLSIADPTYSLPILSSLTFLASVELGTVEGMQTSQS-AQMKWFL  332

Query  1014  RAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
             RA+A   +P TASFP+ VF YWITSN+FS     + +    K  +G+P +
Sbjct  333   RALAVAMVPLTASFPQGVFVYWITSNMFSGVQTSITRTKGFKAAMGIPDV  382



>gb|EMT11598.1| Mitochondrial inner membrane protein OXA1 [Aegilops tauschii]
Length=338

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/230 (39%), Positives = 120/230 (52%), Gaps = 55/230 (24%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS+ P AALQ+LID +H  TG NWWASI  T +LIR   +P  +   K+  K+  ++P++
Sbjct  125   DSFFPFAALQHLIDTIHTFTGLNWWASIALTAVLIRTAVIPFTVSHQKSGEKIHAMKPEV  184

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             D I+  +                                                I+NM 
Sbjct  185   DAIKHAVD-----------------------------------------------INNMV  197

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGT-IKNVS  1013
             EKVPS K GG FWFTDLTTPD +YI PVLT+LTF  TVE        GNP   + +K + 
Sbjct  198   EKVPSLKGGGIFWFTDLTTPDPLYILPVLTSLTFLATVEL-------GNPYIASKMKMLH  250

Query  1014  RAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
             R M  + +PFT +F K  F YWIT+N+F+L Y +V++RP V+KL   P +
Sbjct  251   RGMGVMIVPFTMNFAKGFFFYWITANLFTLVYVIVMRRPTVRKLFNFPAL  300



>ref|XP_003383873.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Amphimedon 
queenslandica]
Length=425

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 138/241 (57%), Gaps = 6/241 (2%)
 Frame = +3

Query  483   YLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDD  662
             Y PV  +Q  +D++H  TG  WWASIV  T+++R L LPL+I+     ++L  +RP+ D 
Sbjct  119   YTPVGLVQNCLDWIHLNTGLPWWASIVVGTVILRSLMLPLVIKLQVNAARLNQIRPETDV  178

Query  663   IR---QEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
             I    +E Q  G    A  E   R+  L+ ++  +P       F+Q P+F+SFF+A+  M
Sbjct  179   IMARMKEYQQMGNTILAAQE-NARLLMLYRKHNCNPVKMMIMPFLQFPVFISFFIALRRM  237

Query  834   AEK-VPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A+  + S K+GG FWFTDLT PD  YI P+ ++L F   +E   + G+  NP    +K  
Sbjct  238   AQAPIESMKDGGLFWFTDLTLPDPYYILPITSSLLFMANIELGGEAGVT-NPQMEKMKLF  296

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQ  1190
              R M+   +P TA+FP A+F YWIT++ +S+   LV+K P V+  LG+P I   P   D 
Sbjct  297   FRIMSVALVPLTATFPTALFMYWITASFYSMGQILVLKVPAVRTRLGIPNIVNDPFATDN  356

Query  1191  S  1193
             S
Sbjct  357   S  357



>ref|XP_005823454.1| hypothetical protein GUITHDRAFT_117364 [Guillardia theta CCMP2712]
 gb|EKX36474.1| hypothetical protein GUITHDRAFT_117364 [Guillardia theta CCMP2712]
Length=287

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/231 (37%), Positives = 130/231 (56%), Gaps = 5/231 (2%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             P A  +  I  +H   G  WW SI   TL +R L  P+++ Q+K  ++L L++P+++ I 
Sbjct  29    PPALAEAAIVAIHGYFGLEWWMSIGAITLSLRLLLFPVVVYQMKNIARLNLVKPEMEVIT  88

Query  669   QEMQNRG---MAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAE  839
                +  G     P A +  Q+++K+LF ++  +P+ +F G+ +QGPIFVSFF A+ +MA 
Sbjct  89    NNWRKLGGYSAPPRATDVYQKQLKELFAKHHCNPWKSFIGLAVQGPIFVSFFFALRHMAT  148

Query  840   KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRA  1019
               PSFK+GG  WF DL+  D  Y+ PV+ +L+   T+E   + G        T+K   R 
Sbjct  149   TYPSFKDGGTMWFQDLSIVDPTYMLPVIASLSMLATIELGGETGQAMKDQQSTMKFAMRG  208

Query  1020  MAALSIPFT--ASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIP  1166
              A   +P    +  P  VF YWI SN+FSL   L++K P +K LLG P +P
Sbjct  209   FAVAMVPLVIMSGIPNGVFLYWIPSNVFSLLQVLLLKVPFMKSLLGFPKMP  259



>ref|XP_010544810.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Tarenaya hassleriana]
Length=388

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 156/276 (57%), Gaps = 16/276 (6%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEYIS----EVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYL  512
             R+MS+  GE  +KI+Y+S    E++ ++++EAV  Q   V EVA+AAADS LPVAA+Q+ 
Sbjct  79    RHMSSKPGECSDKIDYLSTVVEELVPEESLEAVIPQVSSVKEVAIAAADSSLPVAAIQHF  138

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGFNW ASIV +T L+  L +P  +   K         P + +I Q ++    
Sbjct  139   IDSVHAFTGFNWCASIVISTFLVGGLYIPTRVILWKNI-------PHIVNICQRVRKMAE  191

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 V  G++  + +F E++    S       +G I+VS FLAI NMA+K+PSF+ GG  
Sbjct  192   TDGLVT-GEKEWEAIFEEFEPFLSSLLIASLAEGFIYVSTFLAIHNMAQKMPSFQSGGIL  250

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPD  YI PV+T LTFW T         + NP  GT   +     +++     S
Sbjct  251   WFTDLTTPDRFYILPVVTGLTFWFT---GRPLSRQHNPVGGTRILLWVIFTSVAFQAIFS  307

Query  1053  FPKAVFCYWITSNIFSLSYGLVIKR-PKVKKLLGVP  1157
             F  A++C+ I S +F     L I R P  +KLLG+P
Sbjct  308   FESALYCFMIPSRVFLYGASLAILRSPNARKLLGLP  343



>ref|XP_010544820.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
 ref|XP_010544821.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
 ref|XP_010544822.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
Length=376

 Score =   164 bits (414),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 165/276 (60%), Gaps = 15/276 (5%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIE----YISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYL  512
             R+MS+  GE  NKI+     + E++ + ++EAV +    VNEVA AAADS+L VAA+Q+ 
Sbjct  78    RHMSSKPGECSNKIDCNPAVVEELVPEGSLEAVITHVSSVNEVANAAADSFLHVAAIQHF  137

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGFNW+ASIV +T L+  L +P  ++ LK       + P L DI Q ++ + +
Sbjct  138   IDSVHAFTGFNWFASIVLSTFLVGGLYIPTRVKVLK-------MGPHLADIYQHLR-KML  189

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 +  G++  + +F  +     S       +G I++S FLAI NMA+K+PSF+ GG  
Sbjct  190   KRYGLETGEKEWEAIFKGFNPLLASILIAKLAEGFIYISTFLAIRNMAQKMPSFESGGIL  249

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPDS YI PV+T LTF  T    +++  + + +  T++ +    A+++   T S
Sbjct  250   WFTDLTTPDSFYILPVVTGLTFCFTPTPFSRQ--QNSAARRTMRLLCWISASVAFQATFS  307

Query  1053  FPKAVFCYWITSNIFSLSYGL-VIKRPKVKKLLGVP  1157
                AV+C+ I+S +      L ++K PKV++LLG+P
Sbjct  308   IESAVYCFMISSRVAMHGIELAMVKSPKVRELLGLP  343



>ref|XP_010545161.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
Length=369

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 159/276 (58%), Gaps = 27/276 (10%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIE----YISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYL  512
             R+MS+   E  NKI+     + E++ ++++EAV +Q   VNE A+AAADS LPVAA+Q+ 
Sbjct  78    RHMSSKPEECSNKIDCNPAVVEELVPEESLEAVITQVSSVNEAALAAADSSLPVAAIQHF  137

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGFNW ASIV +T L+  L +P+                   DI Q +  + +
Sbjct  138   IDSVHAFTGFNWCASIVISTFLVGGLYIPIC------------------DINQHL-GKTL  178

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 +  G++  + +F ++K    S       +G I++S FLA+ NMA+K+PSF+ GG  
Sbjct  179   KRYGLETGEKEWEAIFEKFKPLLPSYLIARLAEGFIYISTFLAVHNMAQKMPSFQSGGIL  238

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPDS YI PV+TALTF  T+  N QE      S   +  +S   A+++   T S
Sbjct  239   WFTDLTTPDSFYILPVVTALTFCFTMPLNRQENSAAIRSMRLLCWIS---ASVAFQATFS  295

Query  1053  FPKAVFCYWITSNIFSLSYGL-VIKRPKVKKLLGVP  1157
                AV+C+ I+S +      L ++K PKV++LLG+P
Sbjct  296   IESAVYCFMISSRVAMHGIDLAMVKSPKVRELLGLP  331



>ref|XP_003059469.1| cytochrome oxidase biogenesis family, partial [Micromonas pusilla 
CCMP1545]
 gb|EEH56601.1| cytochrome oxidase biogenesis family, partial [Micromonas pusilla 
CCMP1545]
Length=240

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 129/234 (55%), Gaps = 5/234 (2%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DS++  A L Y+I+Y H   G  W+A+I   T ++R    PL I Q K+  K+ L +P++
Sbjct  8     DSWITTAGLMYVIEYFHLAHGMEWYAAIAAATCVMRVCAFPLTIMQQKSAGKMHLAKPEM  67

Query  657   DDIRQ---EMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAIS  827
               +++   E +  G    A   G  R+  +++++ V P      +  Q P+F+SF+ AIS
Sbjct  68    TALQESINEARRAGEHERAARLG--RVFAIWSKHDVHPAKMLAPLLFQAPVFISFYFAIS  125

Query  828   NMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
              MAE +PS ++GG  WF DL+  D  +  P++++LTF   VE   Q     +      K 
Sbjct  126   RMAEGLPSMRDGGFAWFQDLSIADPTFALPIISSLTFLAAVEFAPQNPAVKSSQREMTKW  185

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPP  1169
               RA+    +P TASFP  VF YWITSN+FS +  ++++ P  K+ +G+P  PP
Sbjct  186   GLRALGVAMVPLTASFPSGVFVYWITSNVFSFAQTVLLRVPFAKRAMGIPEDPP  239



>ref|XP_007873481.1| hypothetical protein PNEG_01536 [Pneumocystis murina B123]
 gb|EMR10272.1| hypothetical protein PNEG_01536 [Pneumocystis murina B123]
Length=458

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 135/231 (58%), Gaps = 4/231 (2%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  LQ  ++Y++  TG  WWASI   T++IR+  +P +I  ++  S LAL+ P++ +  
Sbjct  129   PVGFLQQSLEYIYVFTGLPWWASIATLTVIIRFSMIPFLIGMIRNLSTLALIHPQVQNHM  188

Query  669   QEMQNRGMAPAAVNEGQ--QRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-  839
             + ++   +    + + +  Q ++ LF EY+V+P  +    FIQ P+FVSF+LA S MA  
Sbjct  189   KALKEAQLEGDMIEQAKRTQSIQKLFKEYQVNPLKSLAMPFIQMPVFVSFYLACSRMASL  248

Query  840   KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYG-TIKNVSR  1016
              VP  K GG  WFTDL+  D  +I P L +   +I +E  ++ G   + +    ++N  R
Sbjct  249   PVPGLKHGGLGWFTDLSASDPYFILPFLNSSLMFINLELGSEVGSSASTNVNMKMRNFFR  308

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPP  1169
              +  L+  FT +F  A+FCYWITSNIFSL  G ++++  V+ LL +P + P
Sbjct  309   IIILLTPLFTINFQSAIFCYWITSNIFSLGQGFMLRQSSVRHLLNLPPLKP  359



>ref|XP_002111548.1| hypothetical protein TRIADDRAFT_23561 [Trichoplax adhaerens]
 gb|EDV25515.1| hypothetical protein TRIADDRAFT_23561 [Trichoplax adhaerens]
Length=305

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/279 (32%), Positives = 148/279 (53%), Gaps = 15/279 (5%)
 Frame = +3

Query  396   SEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTL  575
             S++LSD A     +   V   +A      Y P+  LQ+ ID +H   G  WW SI+  T 
Sbjct  8     SDLLSDAAFHV--NDTHVGQTLADLGLGGYTPIGLLQHAIDSLHSYVGLPWWGSIMVATA  65

Query  576   LIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEG--QQRMKDLFNEY  749
             ++R LTLPL+++  + ++++  + P +  +  +M+    AP         Q ++ LF ++
Sbjct  66    ILRALTLPLVVRSYRNSARMNNISPTVSRLMNKMRA---APTQQEAALYSQELRLLFQKH  122

Query  750   KVSPFSAFRGIFIQGPIFVSFFLAISNMAEK-VPSFKEGGAFWFTDLTTPDSMYIFPVLT  926
               +PF +     +Q P+F+SFFL +  M    + S K+GG +WFTDLT  D  Y+ PVL+
Sbjct  123   NCNPFKSLISPLLQVPVFISFFLGLRRMCTAPLESMKDGGMYWFTDLTAADPYYVLPVLS  182

Query  927   ALTFWITVECNAQ-----EGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSN  1091
              +T  +T+E   +      GM+   +   +K V R +A   +P TA FP A+FCYW+TSN
Sbjct  183   CVTMLLTLELGTEVGARNSGMQQQATMKVMKIVFRFLAIGMLPVTAQFPTAIFCYWLTSN  242

Query  1092  IFSLSYGLVIKRPKVKKLLGVP--IIPPAPPRADQSSGL  1202
               S+   +++  P+++K  G+P  I    PP   +  G+
Sbjct  243   SCSMLQMVILNTPRIRKSFGIPELIKVEPPPEESKDKGI  281



>ref|XP_007219768.1| hypothetical protein PRUPE_ppa025587mg, partial [Prunus persica]
 gb|EMJ20967.1| hypothetical protein PRUPE_ppa025587mg, partial [Prunus persica]
Length=227

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  822   ISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
             I NMAEKVPSF+ GGA WFTDLTTPDS+ I PVLT+LTF ITVECN QEG+EGNP   T+
Sbjct  65    IRNMAEKVPSFQSGGALWFTDLTTPDSLLILPVLTSLTFLITVECNMQEGLEGNPIAQTM  124

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGL  1115
             KN SR +AA+S+P   SFPKA+FCYW+TSN+FSL+YGL
Sbjct  125   KNYSRILAAISVPVMMSFPKALFCYWLTSNLFSLTYGL  162



>ref|XP_008868290.1| hypothetical protein H310_05370 [Aphanomyces invadans]
 gb|ETW02906.1| hypothetical protein H310_05370 [Aphanomyces invadans]
Length=366

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 134/225 (60%), Gaps = 7/225 (3%)
 Frame = +3

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             +D VH ++G  WWA+I+ TT+++R    P+ I  +K ++++ +L+PKL+ ++ E++N   
Sbjct  99    MDVVHAMSGLPWWATIIATTVIVRSAFFPISIMSMKNSARMGILQPKLEKLQNEIKNSPD  158

Query  693   A--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGG  866
             A  PA + E + R + LF E+KV PF +F     Q PIF+ FF  + ++++ +P +   G
Sbjct  159   AYDPAKMTEFRARAQALFKEHKVRPFMSFLMPISQLPIFLGFFWGLQDISKYIPGYATDG  218

Query  867   AFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSY-GTIKNVSRAMAALSIPF  1043
             AFWF +L  PD  Y  PV+++     ++E    EGM   P Y    K   RA+A + IP 
Sbjct  219   AFWFENLAAPDPTYALPVISSALMVASLEAGG-EGMP--PEYIDKAKMGMRAVALIMIPV  275

Query  1044  TASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPP  1178
               +F   +  YW+TSNIF+L+  LV+K P +K  LG+P  P APP
Sbjct  276   AINFESGILLYWVTSNIFTLTQTLVLKIPGLKAALGIP-SPVAPP  319



>gb|KFH72250.1| hypothetical protein MVEG_02541 [Mortierella verticillata NRRL 
6337]
Length=434

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 144/260 (55%), Gaps = 6/260 (2%)
 Frame = +3

Query  387   EYISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVC  566
             E I+EV +  A + +AS      ++       + PV AL+ +++ VH  TG  WWA+I  
Sbjct  119   EAITEVAAQNA-DTIASVGMKYGDLKAMGLVHFSPVGALETVLEAVHISTGLPWWATIAA  177

Query  567   TTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQ--NRGMAPAAVNEGQQRMKDLF  740
             TT+ IR L +P +++    T++L  ++P+L+ + + M+        AA+     + ++LF
Sbjct  178   TTVAIRTLLVPFIVKLQGNTARLHNVKPQLERLTENMKLAKESNDTAALARFSAQTQELF  237

Query  741   NEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFP  917
              +   +P  +     IQ P+ +SF+LA+ +MA   VP F++GG  WFTDLT  D  Y+ P
Sbjct  238   AKNDCNPIKSLILPLIQAPVMISFYLALRDMANLPVPQFQDGGLAWFTDLTIADPTYVLP  297

Query  918   VLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIF  1097
             V ++L F   +E  ++ G    P   T+KNV R MA   +P T +FP A+F YW+TSN F
Sbjct  298   VASSLGFLAIMELGSEAGGVAQPK--TMKNVMRVMAVAMVPLTMNFPSAIFVYWLTSNAF  355

Query  1098  SLSYGLVIKRPKVKKLLGVP  1157
             + S  +  K P V++   +P
Sbjct  356   TASQIMFFKAPAVRRFFNIP  375



>ref|XP_007159295.1| hypothetical protein PHAVU_002G225900g [Phaseolus vulgaris]
 gb|ESW31289.1| hypothetical protein PHAVU_002G225900g [Phaseolus vulgaris]
Length=220

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 147/229 (64%), Gaps = 15/229 (7%)
 Frame = +3

Query  78   MAYRRSSITTTRAKLLYDQQRFAPSISHI-HRDDDDRKKPESSSENPRVLTHLRHCYFGN  254
            MAYRR  +   R  L+   +R  PS S++ H D+  ++K E  S +  V    +   FG+
Sbjct  1    MAYRRCLLI--RGNLV--DRRCHPSFSYVLHNDEGRQEKSEEKSSSAGVSNFAQIRSFGS  56

Query  255  RISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEY-----ISEVLSDKA  419
             ++  +G +  P +DR FSP        + R MST V +G +KI+      +++VL+D  
Sbjct  57   SLNGPLGFS-APSRDRFFSP---CTGYGFCRYMST-VNQGSDKIDSDIITDVADVLTDTT  111

Query  420  VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
            ++ +ASQAP++NEVA+AAADS+L V  LQY+ID VH  TG NWWA+IV TTLLIR  T+P
Sbjct  112  IDTIASQAPIINEVAIAAADSFLLVKGLQYVIDAVHSYTGLNWWAAIVLTTLLIRSATVP  171

Query  600  LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNE  746
            L+I QLKATSKL L+RP L++I+Q+M    M P AV +GQQ+MK LF E
Sbjct  172  LLINQLKATSKLTLMRPHLEEIKQQMDGMAMDPVAVAKGQQQMKKLFKE  220



>ref|XP_010550518.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Tarenaya hassleriana]
Length=380

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 135/378 (36%), Positives = 185/378 (49%), Gaps = 41/378 (11%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MA+RRS       + L    R+ PS S     D D  + +   + P  L    H YF   
Sbjct  1     MAFRRS----LSIRSLLRSHRYRPSHSCAIPLDHDHAR-KCFLQAP--LQRSYHSYFHQS  53

Query  258   ISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNK---IEYISEVLSDKAVEA  428
                    + +  +    SPP   +     R MST+ G G ++   ++ + E +++ A+E 
Sbjct  54    FRSNSAFS-LNLRGYSNSPPCPPLGFALYRPMSTAHGAGSDEPDSMDDMVEAITNSALEN  112

Query  429   VASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMI  608
              ASQA + NE+A AA+D  +PVAA Q LID VH  TG NWWASIV TTLLI+ + +PL++
Sbjct  113   AASQATLANELAKAASDCTIPVAAAQNLIDMVHSFTGLNWWASIVLTTLLIQGVAVPLVV  172

Query  609   QQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNE----GQQRMKDLFNEYKVSPFSAFR  776
               L                R  +   GM PA V E        ++ L+    V   S   
Sbjct  173   GSL----------------RIILHKMGMDPAPVAESAGSANGVLQRLYTPGGVCRLSTLF  216

Query  777   GIFIQGPIFVSFFLAIS----NMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWI  944
              I I  PI  +   A+S    +MA  + SFK GGA WFTDLTT D+  IFPVL  LT  I
Sbjct  217   -IPIVVPIEYTALAAMSKATYDMAGNISSFKTGGALWFTDLTTMDASGIFPVLLGLTLLI  275

Query  945   TVE--CNAQEGMEGNPSYGTIK---NVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSY  1109
              VE     Q  M+G   +   +   NV R +A L    + S  KA  C+WIT  +FSL  
Sbjct  276   DVERVMKGQRAMKGFEQFLPFRQGPNVVRCLAILMAICSISAAKATHCFWITWALFSLIS  335

Query  1110  GLVIKRPKVKKLLGVPII  1163
               V+KRP +KK LG+P++
Sbjct  336   SHVLKRPGIKKFLGIPVV  353



>ref|XP_003724188.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like isoform 
1 [Strongylocentrotus purpuratus]
 ref|XP_790253.3| PREDICTED: mitochondrial inner membrane protein OXA1L-like isoform 
2 [Strongylocentrotus purpuratus]
Length=452

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 126/229 (55%), Gaps = 4/229 (2%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
              Y P+  LQ  ++ +H   G  WWASIV  TL++R    PLM++ +K T +L    P   
Sbjct  143   GYTPIGFLQSGLEMLHVSAGLPWWASIVVGTLIVRACVFPLMLKNMKYTIRLNNCMPIFQ  202

Query  660   DIRQEMQNRGMAPAAVNEGQQRM--KDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
              I +EM +           ++ M  +    +  V+P  +F GI +Q PIF+SFF+ +  M
Sbjct  203   KISKEMNDAKACGDQFEMTRKSMELQQFMKKNDVNPLKSFAGILLQAPIFISFFIGLRRM  262

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A   V S + GG +WFTDLTT D  Y  PV+ +L+ ++ +E   + G+  N     ++NV
Sbjct  263   ATLPVESMQTGGLWWFTDLTTSDPYYALPVIASLSMFLVMELGGEAGVS-NAQAQKMRNV  321

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              R M  + +PF AS PKAVFCYW+TSN FS+    ++K P V+    +P
Sbjct  322   LRVMPFVVLPFIASLPKAVFCYWLTSNFFSVFQVGLLKIPAVRTAFNIP  370



>ref|XP_010550517.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X1 [Tarenaya hassleriana]
Length=383

 Score =   158 bits (400),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 135/381 (35%), Positives = 185/381 (49%), Gaps = 44/381 (12%)
 Frame = +3

Query  78    MAYRRSSITTTRAKLLYDQQRFAPSISHIHRDDDDRKKPESSSENPRVLTHLRHCYFGNR  257
             MA+RRS       + L    R+ PS S     D D  + +   + P  L    H YF   
Sbjct  1     MAFRRS----LSIRSLLRSHRYRPSHSCAIPLDHDHAR-KCFLQAP--LQRSYHSYFHQS  53

Query  258   ISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNK---IEYISEVLSDKAVEA  428
                    + +  +    SPP   +     R MST+ G G ++   ++ + E +++ A+E 
Sbjct  54    FRSNSAFS-LNLRGYSNSPPCPPLGFALYRPMSTAHGAGSDEPDSMDDMVEAITNSALEN  112

Query  429   VASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMI  608
              ASQA + NE+A AA+D  +PVAA Q LID VH  TG NWWASIV TTLLI+ + +PL++
Sbjct  113   AASQATLANELAKAASDCTIPVAAAQNLIDMVHSFTGLNWWASIVLTTLLIQGVAVPLVV  172

Query  609   QQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNE----GQQRMKDLFNEYKVSPFSAFR  776
               L                R  +   GM PA V E        ++ L+    V   S   
Sbjct  173   GSL----------------RIILHKMGMDPAPVAESAGSANGVLQRLYTPGGVCRLSTLF  216

Query  777   GIFIQGPIFVSFFLAIS----NMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWI  944
              I I  PI  +   A+S    +MA  + SFK GGA WFTDLTT D+  IFPVL  LT  I
Sbjct  217   -IPIVVPIEYTALAAMSKATYDMAGNISSFKTGGALWFTDLTTMDASGIFPVLLGLTLLI  275

Query  945   TVEC-----NAQEGMEGNPSYGTIK---NVSRAMAALSIPFTASFPKAVFCYWITSNIFS  1100
              VE        Q  M+G   +   +   NV R +A L    + S  KA  C+WIT  +FS
Sbjct  276   DVESFQRVMKGQRAMKGFEQFLPFRQGPNVVRCLAILMAICSISAAKATHCFWITWALFS  335

Query  1101  LSYGLVIKRPKVKKLLGVPII  1163
             L    V+KRP +KK LG+P++
Sbjct  336   LISSHVLKRPGIKKFLGIPVV  356



>gb|EIE80290.1| hypothetical protein RO3G_04995 [Rhizopus delemar RA 99-880]
Length=341

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 128/242 (53%), Gaps = 10/242 (4%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV AL+ + +Y+H  +G  WW +I   TL +R   LPLMI+  +  +KL  + P   D+ 
Sbjct  63    PVGALESMFEYIHVYSGLPWWGTIAVATLAVRIALLPLMIKIQRNNAKLMNINP---DVT  119

Query  669   QEMQNRGMAPA-----AVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
             + M N   A +     +V++  Q ++ LF + +  P  +     +Q P+ +SFF+AI +M
Sbjct  120   RIMNNLKTAQSQGDVLSVDKYSQEIQTLFKKNECHPMKSLGLPLVQMPVMISFFMAIRSM  179

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             AE  VP     G  WFTDL   D  YI P ++A      +E   + G   NP    +KNV
Sbjct  180   AEVPVPGLSNEGTLWFTDLAAKDPYYILPAISAAGMMAVLEAGTETG-AANPQSKGMKNV  238

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQ  1190
              R ++   +PFTA  P  VF YWITSN FS+   L +K P ++K L +P++   P    Q
Sbjct  239   FRVLSLAVVPFTAWMPSGVFVYWITSNFFSIGQILALKSPSLRKALNIPLLVKKPQELQQ  298

Query  1191  SS  1196
             ++
Sbjct  299   NT  300



>ref|XP_009842842.1| hypothetical protein H257_16184, partial [Aphanomyces astaci]
 gb|ETV67721.1| hypothetical protein H257_16184, partial [Aphanomyces astaci]
Length=366

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 131/228 (57%), Gaps = 8/228 (4%)
 Frame = +3

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             +D VH  +G  WWA+I+ TT+++R    P+ I  ++ ++++ +L+PKL  ++ E+++   
Sbjct  102   LDVVHATSGLPWWATIIATTIVVRSAFFPISIMSMRNSARMGILQPKLQKLQDEIKSSPD  161

Query  693   A--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGG  866
             A  PA + E + R + LF E+KV PF +F     Q PIF+ FF  + ++A+ +P +   G
Sbjct  162   AYDPAKMTEFRARAQALFKEHKVRPFMSFLMPISQLPIFLGFFWGLQDIAKYIPGYAADG  221

Query  867   AFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPS--YGTIKNVSRAMAALSIP  1040
             AFWF +L  PD  Y  PVL++     ++E     G EG P+      K   R +A + IP
Sbjct  222   AFWFENLAAPDPTYALPVLSSALMVASLEA----GGEGMPAEYIDKAKMGMRIVALIMIP  277

Query  1041  FTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRA  1184
                +F   +  YW++SNIF+L+  LV+K P VKKLL +P     PP A
Sbjct  278   VAVNFESGILLYWVSSNIFTLTQTLVLKIPGVKKLLDIPTPVTPPPLA  325



>ref|XP_002169136.2| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Hydra 
vulgaris]
Length=459

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 128/232 (55%), Gaps = 4/232 (2%)
 Frame = +3

Query  483   YLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDD  662
             Y PV  +  + D++H   G  WW +I+ TT+  R L  PLMI+    T++LA ++P+L+ 
Sbjct  155   YTPVGFVHNIFDFIHLSVGLPWWGTIIATTVAFRALVFPLMIKGQANTARLAAVKPELEK  214

Query  663   IRQEMQNRG--MAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA  836
             ++++++       P    +    ++D F ++  +P  +     +Q P+F+SFF+AI  M 
Sbjct  215   LQEKLREAANYHNPNIRAQASIELQDFFKKHNCNPLKSIISPLVQLPLFISFFIAIRKMC  274

Query  837   E-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVS  1013
                V S + GG  WF+DL+  D   IFP+  A T  +T+E  A+  +  N     +KNV 
Sbjct  275   NLPVESLQTGGILWFSDLSAADPYMIFPIACAFTMLLTIEFGAEASVS-NSQMVVMKNVF  333

Query  1014  RAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPP  1169
             R M+ L +P T +FP A+F YW+TSN+ SL   +V+K P V     +P + P
Sbjct  334   RGMSVLMVPLTYNFPVAIFLYWMTSNVLSLVQVMVLKVPGVMTFFNIPKVVP  385



>ref|XP_005314501.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Chrysemys 
picta bellii]
Length=375

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 127/230 (55%), Gaps = 4/230 (2%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             DSY PV  +Q +++++H   G  WW +IV  T++ R L  PL+++  +   KL    P++
Sbjct  64    DSYTPVGLIQNMLEFLHADLGLPWWGAIVAGTVVARCLVFPLIVKGQREAVKLNNHLPEI  123

Query  657   DDIRQEMQN--RGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
               + Q MQ+  R       ++    +      + V+P   F    +Q PIF+SFF+A+  
Sbjct  124   TRLTQCMQDAKRSGNQFEYSKSYSELNLYQKAHDVNPMRGFLVPLVQAPIFISFFIALRE  183

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WF DLT  D +YI PV+   T W+ +E   + G++ NP+   +K 
Sbjct  184   MATLPVPSMQSGGLAWFVDLTAADPLYILPVVVTSTMWLILELGVESGVD-NPNLKVMKT  242

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             V R M  + +P T SFP AVF YW+TSN+FSL    +++ P V+  L +P
Sbjct  243   VFRVMPLVILPLTISFPTAVFTYWLTSNLFSLVQVGLLRIPAVRTRLRIP  292



>ref|XP_010544818.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
 ref|XP_010544819.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Tarenaya 
hassleriana]
Length=404

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 150/282 (53%), Gaps = 14/282 (5%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEY----ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYL  512
             R+MS+   E  NKI++    + E++ ++++EAV SQ   V EVA+AAADS LPVAA+Q+ 
Sbjct  78    RHMSSKPEECSNKIDWNSTVVEELVPEESLEAVISQVSSVKEVAIAAADSSLPVAAIQHF  137

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGFNW  SIV +T L+  L +P  +++L A        P   +  Q      M
Sbjct  138   IDSVHAFTGFNWCLSIVLSTFLVGGLYIPAHVKRLNAG-------PDFANTFQHAVK--M  188

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 + + ++    +F++ K    S          I++S FLAI NMA+K+PSF+ GG  
Sbjct  189   IQTDLVKFKREWLLIFDDLK-PGLSLLIATAADWFIYISTFLAIRNMAQKMPSFESGGIL  247

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPDS Y+ P +  +TFW T   +     +  P +     +      ++     S
Sbjct  248   WFTDLTTPDSFYVLPAVLGVTFWFTTMSDDSYQRQQKPGFEAFSLLCWIFTTVAFQAIFS  307

Query  1053  FPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPP  1178
                AVFC+ I+SNI      +  K PKV+KLL +  +P   P
Sbjct  308   IESAVFCFMISSNIIGYGLDMATKSPKVRKLLKIRNLPDGSP  349



>ref|XP_010544811.1| PREDICTED: mitochondrial inner membrane protein OXA1-like isoform 
X2 [Tarenaya hassleriana]
Length=373

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/255 (40%), Positives = 145/255 (57%), Gaps = 15/255 (6%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEYIS----EVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYL  512
             R+MS+  GE  +KI+Y+S    E++ ++++EAV  Q   V EVA+AAADS LPVAA+Q+ 
Sbjct  79    RHMSSKPGECSDKIDYLSTVVEELVPEESLEAVIPQVSSVKEVAIAAADSSLPVAAIQHF  138

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             ID VH  TGFNW ASIV +T L+  L +P  +   K         P + +I Q ++    
Sbjct  139   IDSVHAFTGFNWCASIVISTFLVGGLYIPTRVILWKNI-------PHIVNICQRVRKMAE  191

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAF  872
                 V  G++  + +F E++    S       +G I+VS FLAI NMA+K+PSF+ GG  
Sbjct  192   TDGLVT-GEKEWEAIFEEFEPFLSSLLIASLAEGFIYVSTFLAIHNMAQKMPSFQSGGIL  250

Query  873   WFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTAS  1052
             WFTDLTTPD  YI PV+T LTFW T         + NP  GT   +     +++     S
Sbjct  251   WFTDLTTPDRFYILPVVTGLTFWFT---GRPLSRQHNPVGGTRILLWVIFTSVAFQAIFS  307

Query  1053  FPKAVFCYWITSNIF  1097
             F  A++C+ I S +F
Sbjct  308   FESALYCFMIPSRVF  322



>ref|XP_002174771.1| inner membrane translocase Oxa102 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB08478.1| inner membrane translocase Oxa102 [Schizosaccharomyces japonicus 
yFS275]
Length=368

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 138/267 (52%), Gaps = 4/267 (1%)
 Frame = +3

Query  402   VLSDKAVEAV-ASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLL  578
             + +D AVEAV A       +       ++ P   LQ +++ +H  +G  WWASI  T + 
Sbjct  60    ISTDTAVEAVNAVHKIGDLKAMGLGTHTWWPYPYLQSILEVIHVYSGMPWWASIAATAIG  119

Query  579   IRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYK  752
             +R L  PLM+  ++ +S++A + P++      +    +A    A+ +    ++ L+ E  
Sbjct  120   MRVLMFPLMLGMIRTSSRMAAIGPQVAGHMATLHGARLAGDSLAMQKATLEVQRLYKENG  179

Query  753   VSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTA  929
             ++P    R  FIQG +FVSFF A+  MA+  VP  + GG  W  DLT PD M+  P+   
Sbjct  180   INPMRLLRAPFIQGILFVSFFYALKTMADFPVPGLEHGGFGWVMDLTKPDPMHAIPIANG  239

Query  930   LTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSY  1109
             L  W  +E  ++ G   +P   ++K   R M   S  FT +FP A+F YW+ SN+FS+  
Sbjct  240   LLMWANIELGSENGTNKSPVAPSMKRFFRLMCLASPLFTMNFPMAIFMYWLPSNLFSIFQ  299

Query  1110  GLVIKRPKVKKLLGVPIIPPAPPRADQ  1190
             G  ++  ++++ L +P I   P +  Q
Sbjct  300   GFFLRSKRIRRYLDIPEIEVTPTKFPQ  326



>ref|XP_010790930.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial inner membrane 
protein OXA1L-like [Notothenia coriiceps]
Length=468

 Score =   155 bits (391),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 135/245 (55%), Gaps = 7/245 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRP---  650
             S  PV  +Q L++Y+H   G  WW +IV  T++ R    P++++  +  +KL  +     
Sbjct  161   SRTPVGMVQSLLEYIHIDLGIPWWGAIVVGTVIARVAVFPVIVKGQREAAKLHNVMAVFG  220

Query  651   KLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
             +L++   E QN G       +   ++    N++ VSP   F    IQ P+F+SFF+A+  
Sbjct  221   RLNNQMSEAQNSGNK-LEFAKAYFQLSLFKNKHNVSPLRGFIVPLIQAPVFISFFIALRK  279

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             M+E  VPS + GG  WF DLT  D  YI PV+   T +  +E  A+ G+E NP    +K 
Sbjct  280   MSELPVPSIQSGGLLWFPDLTAADPFYILPVVVTGTMFFILEFGAESGVE-NPQLRHLKT  338

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRAD  1187
             V R M  + +PFT SFP AVF YW+TSN FSL    +++ P V++ L +P + P P  A+
Sbjct  339   VFRIMPFVVLPFTISFPTAVFTYWLTSNCFSLGQVALLRHPLVRERLKIPAMIPHPIPAN  398

Query  1188  QSSGL  1202
              S GL
Sbjct  399   -SDGL  402



>emb|CDH51810.1| mitochondrial inner membrane protein oxa1l-like [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=386

 Score =   153 bits (386),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 126/244 (52%), Gaps = 5/244 (2%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV  L+ +++ VH  TG  WW +I   T+L+R   LPLMI+  +  +K+  L P++ 
Sbjct  105   NFTPVGGLEAMLEAVHVYTGMPWWGTIATATVLVRLALLPLMIKIQRNNAKMMNLNPEVS  164

Query  660   DIRQEMQNRGMAPAAVNEGQ--QRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
              +   ++       +V  G+    M+ LF ++   P  +     IQ P+ VSFFLA+  M
Sbjct  165   RLMSNLKTAQQDGDSVAVGKYTNEMQSLFKKHGCHPMKSLGLPIIQMPVMVSFFLALRAM  224

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             AE  VP    GG  WFTDLT  D  YI P ++A      +E   + G   NP    +KN 
Sbjct  225   AELPVPGMTTGGLGWFTDLTAQDPYYILPAVSAAGVMAVLEAGTEVG-AANPQSRGMKNF  283

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP-IIPPAPPRAD  1187
              R MA   +PFT   P +VF YWITSN  S++  L +K P V+K L +P ++ PA     
Sbjct  284   FRVMAVAMVPFTYWMPSSVFVYWITSNAVSIAQILTLKNPAVRKALDIPKLVKPAAELQK  343

Query  1188  QSSG  1199
                G
Sbjct  344   NQKG  347



>ref|XP_010793094.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like, partial 
[Notothenia coriiceps]
Length=482

 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 130/235 (55%), Gaps = 16/235 (7%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             SY PV  +Q L+++ H   G  WW +IV  T+  R    P++++  +  +KL+ + P+L 
Sbjct  165   SYTPVGLVQNLLEFAHMDVGLPWWGAIVVGTVFARLAVFPVIVKGQREAAKLSNVLPELT  224

Query  660   DIRQEMQNRGMAPAAVNEGQQ-------RMKDLFNE-YKVSPFSAFRGIFIQGPIFVSFF  815
              +   M        A N G +          +LF + + V+P   F    IQ P+F+SFF
Sbjct  225   KLNTRMSE------AKNSGNKFDFAKAYSDLNLFQKKHDVNPLRGFLVPLIQAPVFISFF  278

Query  816   LAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSY  992
             +A+  MAE  VPS + GG  WF DLT  D  YI PV+   T +  +E  A+ G++ NP+ 
Sbjct  279   IALRKMAELPVPSMQSGGLLWFPDLTAADPFYILPVVVTGTMFFILEFGAESGVD-NPNL  337

Query  993   GTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              T+K V R M  + +PFT +FP AVF YW+TSN FSL   ++++ P V++ L +P
Sbjct  338   RTMKTVFRIMPFVILPFTINFPTAVFTYWLTSNCFSLCQVVLLRHPLVREKLMIP  392



>emb|CDP21743.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   144 bits (363),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +3

Query  345  RNMSTSVGEGM-NKIEYISEV---LSDKAVEAVASQapvvnevavaaa-DSYLPVAALQY  509
            RNMSTS+GE    KI+YI++V   L+D  VEAV +QA  V      AA DS+LPVAALQY
Sbjct  9    RNMSTSIGEAAAEKIDYITDVADVLTDHTVEAVVTQAAPVVNEVAVAAADSFLPVAALQY  68

Query  510  LIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNR  686
            LIDYVH  TGFNWWASIV TT+LIRW+T+PLMI QLKATSK  LLRP+L++I++EM++R
Sbjct  69   LIDYVHTFTGFNWWASIVVTTILIRWVTVPLMINQLKATSKFTLLRPRLEEIKEEMESR  127



>ref|XP_001639327.1| predicted protein [Nematostella vectensis]
 gb|EDO47264.1| predicted protein [Nematostella vectensis]
Length=308

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 127/226 (56%), Gaps = 4/226 (2%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             P+  +Q+ ++ +H   G  W  SIV  T+  R L  PL+++     ++L  ++P+L++++
Sbjct  22    PIGLVQHALEMLHATVGLPWVWSIVAATIAFRTLMFPLIVKSQANAARLNNVKPELEEVQ  81

Query  669   QEMQNRGMAPAAVNEG--QQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-  839
              ++++   +  A+ +     R++ L+ +    P  +     +Q P+F+SFF+ +  MA  
Sbjct  82    AQLRDLMNSNNAIGKAAASARLQQLYKDNDCHPIKSIIAPLVQVPLFISFFVGLRRMANL  141

Query  840   KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRA  1019
              V SFKEGG FWFTDLT  D  ++ P++ +LT   ++E   + G+  NP    +K   R 
Sbjct  142   PVESFKEGGLFWFTDLTAYDPYFVLPIVCSLTMLASIELGGEAGVS-NPQMQHMKTFFRV  200

Query  1020  MAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             M    IP TA FP A+F YW+TSN+FSL    ++K   V++  G+P
Sbjct  201   MCVAMIPLTAQFPAAIFTYWVTSNLFSLGQVSLLKVKAVREYFGIP  246



>emb|CDS03152.1| hypothetical protein LRAMOSA00554 [Absidia idahoensis var. thermophila]
Length=391

 Score =   151 bits (381),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 126/244 (52%), Gaps = 5/244 (2%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV  L+ +++ +H  TG  WW +I   T+L+R   LPLMI+  +  +K+  L P++ 
Sbjct  110   NFTPVGGLEAMLEALHVYTGMPWWGTIATATVLVRLALLPLMIKIQRNNAKMMNLNPEVS  169

Query  660   DIRQEMQNRGMAPAAVNEGQ--QRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
              +   ++       +V  G+    M+ LF ++   P  +     IQ P+ +SFFLA+  M
Sbjct  170   RLMNNLKTAQQDGDSVAVGKYTNEMQSLFKKHGCHPMKSLGLPIIQMPVMISFFLALRAM  229

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             AE  VP    GG  WFTDLT  D  YI P ++A      +E   + G   NP    +KN 
Sbjct  230   AELPVPGMTTGGLGWFTDLTAQDPYYILPAVSAAGVMAVLEAGTEVG-AANPQSRGMKNF  288

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP-IIPPAPPRAD  1187
              R MA   +PFT   P +VF YWITSN  S++  L +K P V+K L +P ++ PA     
Sbjct  289   FRVMAVAMVPFTYWMPSSVFVYWITSNAVSIAQILTLKNPAVRKALDIPKLVKPAAELQK  348

Query  1188  QSSG  1199
                G
Sbjct  349   NQKG  352



>ref|XP_001742405.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ92643.1| predicted protein [Monosiga brevicollis MX1]
Length=235

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 129/231 (56%), Gaps = 16/231 (7%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  +Q L+++   +    W   I  TT+L+R L LPL+   ++  + L  ++P+L    
Sbjct  8     PVGLIQNLVEFNTVMLDAPWAVGICATTILMRTLMLPLVFGSMRNNTILMNIQPQLQLHS  67

Query  669   Q---EMQNR----GMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAIS  827
             Q   E Q R    G A AA N     +  LF E+ V P      +F+Q P+F+SFF+A+ 
Sbjct  68    QRIRECQTRNDHDGAAQAAAN-----LNGLFKEHGVHPLKGLLPLFVQAPVFISFFMALR  122

Query  828   NMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIK  1004
              MA   + S K GG  WFTDLT  D  Y+ PV+ + T   T+E  + EG++ N     +K
Sbjct  123   QMANLPIESMKTGGLLWFTDLTAADPYYVLPVIASATMLATIEFGS-EGVKQNNVM--MK  179

Query  1005  NVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             NV R ++ + +P T + P A+F YW T+N+FSLS  L++K P +KK LG+P
Sbjct  180   NVFRGLSIVLLPVTINLPTAIFVYWCTANMFSLSQMLMLKIPGLKKSLGIP  230



>ref|XP_002500884.1| cytochrome oxidase biogenesis family, partial [Micromonas sp. 
RCC299]
 gb|ACO62142.1| cytochrome oxidase biogenesis family, partial [Micromonas sp. 
RCC299]
Length=223

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 120/227 (53%), Gaps = 17/227 (7%)
 Frame = +3

Query  525   HCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAA  704
             H      WWA+I+ TT ++R   +P M+ Q +  +++ + +P+++ +   ++  G     
Sbjct  1     HLAHDMEWWAAIMATTAIMRVFVMPFMVMQQRVAARMHIAKPEIEALNARIKGMGGDQQV  60

Query  705   VNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFW---  875
             + E Q+ +  ++ ++  +P      I +Q P+F+SF+ AIS MA+ VPSF  GG  W   
Sbjct  61    MAEAQKEIFAIWKKHNCNPAYMMLPIAVQAPLFISFYFAISEMAKGVPSFASGGPDWPLG  120

Query  876   ---FTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVS-------RAMA  1025
                  DLT  D  YI PVL++ TF  TVE     G  GNP        +       RA++
Sbjct  121   PISMHDLTAADPTYIMPVLSSATFLATVEL----GGAGNPETSGAAQQTMMTKWGLRALS  176

Query  1026  ALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIP  1166
                IP TA F K VF YWIT+N+FSL   L  K P +KK++ +P IP
Sbjct  177   VALIPMTAGFSKGVFVYWITTNMFSLGQTLAFKVPLIKKIVAIPEIP  223



>gb|EPB90412.1| hypothetical protein HMPREF1544_02778 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=404

 Score =   150 bits (378),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 10/245 (4%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV  L+ + +Y+H  +G  WW +I   T+ +R   LPLMI+  +  ++L  + P   
Sbjct  123   NFTPVGGLEAMFEYIHVYSGLPWWGTIAVATVAVRVALLPLMIKIQRNNARLMNINP---  179

Query  660   DIRQEMQNRGMAPA-----AVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAI  824
             D+ + M+N   A A     A  +  Q ++ LF + +  P  +     IQ P+ +SFF+AI
Sbjct  180   DVNRIMENLKAAQAEGDSLATGKYTQEIQTLFKKNECHPMKSMGLPLIQMPVMISFFMAI  239

Query  825   SNMAEK-VPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
               MAE  VP  ++ G FWFTDL   D  Y+ PV++A      +E   + G   NP    +
Sbjct  240   RAMAEMPVPGLQDQGLFWFTDLAAKDPYYVLPVVSAAGVMAVLEAGTEAG-AANPQSKGM  298

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR  1181
             KNV RA+  + +PFTA  P  VF YWITSN FS+   L +K P V+  L +P +   P  
Sbjct  299   KNVFRALTLVMVPFTAWMPSGVFVYWITSNFFSIGQILALKNPAVRNALSIPKLKKKPEE  358

Query  1182  ADQSS  1196
               +++
Sbjct  359   LQKNT  363



>ref|XP_007436445.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like isoform 
X2 [Python bivittatus]
Length=402

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 123/234 (53%), Gaps = 12/234 (5%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             +SY PV  +   ++  H   G  WW +IV  T+L+R L  PLM++  + +  L+   P++
Sbjct  99    ESYSPVGLVLKTLESFHLDLGLPWWGAIVAGTVLVRCLVFPLMVKNQQDSIALSNHMPQM  158

Query  657   DDIRQEMQNRGMAPAAVNEGQQRMKDLFN------EYKVSPFSAFRGIFIQGPIFVSFFL  818
               +  ++             QQ MK + +       + V+P   F   F+Q PIF+SFF 
Sbjct  159   TVLSTKVSEA----RKTGNHQQFMKAVADLEHYQKTHNVNPLRGFITPFVQAPIFLSFFF  214

Query  819   AISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYG  995
             A+  MAE  VPS + GG +WF +LT PD  Y+ P+   +T WI +E   Q     NP+  
Sbjct  215   ALRKMAEFPVPSLETGGLWWFMNLTAPDPYYVLPLTVTVTMWIILETGMQTAAP-NPNLD  273

Query  996   TIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              +K V R M  L +PF  SFP A+F YW+TSN+FS+   L+ + P V+    +P
Sbjct  274   LMKKVFRVMPVLFLPFIISFPTAIFTYWLTSNMFSIMQVLLFRLPAVRTFFHIP  327



>ref|XP_007662256.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Ornithorhynchus 
anatinus]
Length=412

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 121/230 (53%), Gaps = 6/230 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             SY PV  +Q L++Y+H   G  WW +IV  T+  R L  PL+++  +   K+    P++ 
Sbjct  101   SYTPVGMVQNLLEYIHIDMGLPWWGAIVTCTVAARCLIFPLIVKGQREAVKINNHMPEIQ  160

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              +   M    M+     E  +   DL     ++ VSP   F     Q PIF+SFF+A+  
Sbjct  161   KLSARMNEAKMSGDKF-EFSRAYSDLQLYQKKHDVSPLRGFIVPLAQAPIFISFFIALRE  219

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WF DLT  D  Y  P+L   + W  +E  A+ G+  N +   +K 
Sbjct  220   MAYLPVPSMQSGGLLWFPDLTVADPFYALPLLVTASMWAVLELGAETGVN-NANLRVMKT  278

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             V R M  + +PFT  FP AVF YW++SN+FSL+    ++ P V+  LG+P
Sbjct  279   VIRVMPLVVLPFTIHFPTAVFTYWLSSNLFSLAQVAFLRVPAVRTRLGIP  328



>ref|XP_003227547.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Anolis 
carolinensis]
Length=421

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 122/230 (53%), Gaps = 6/230 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV  +Q L++ +H   G  WW +IV  T++ R L  PL+++  +   KL    P++ 
Sbjct  111   AHTPVGLIQNLLECLHVDVGLPWWGAIVAGTVVARCLVFPLIVKGQREAVKLNNHLPQIT  170

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              +   M N         E  +   DL      + V+P   F    +Q PIF+SFF+A+  
Sbjct  171   QLTTRM-NEAKQSGNKFEFAKAYSDLALYQKTHNVNPLRGFLVPLVQAPIFISFFIALRK  229

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MAE  VPS + GG +WF DLT  D  YI P+   +T W  +E  A+ G+  NP+   +K 
Sbjct  230   MAELPVPSMQTGGLWWFADLTAADPYYILPLAVTVTMWAILELGAESGVS-NPNLRVMKT  288

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             V R M    +P T SFP A+F YW+TSN+FSL    V++ P V+  L +P
Sbjct  289   VFRVMPIAILPLTISFPTAIFTYWMTSNLFSLVQVGVLRLPAVRTRLRIP  338



>ref|XP_005807304.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Xiphophorus 
maculatus]
Length=483

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 125/230 (54%), Gaps = 6/230 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
              Y PV  +Q L+++ H   G  WW +IV  T+L R    P++++  +  +KL  + P++ 
Sbjct  173   GYTPVGLIQNLLEFFHMDLGLPWWGAIVVGTVLARLAVFPVIVKGQREAAKLNNVLPEMT  232

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              + ++M N         E  +   DL     ++ V+P   F    IQ P+F+SFF+A+  
Sbjct  233   KLTEKM-NEAKQSGNKYEFAKAYSDLNLFQKKHDVNPLRGFLVPLIQAPVFISFFIALRK  291

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WFTDL+  D  YI P +   T +  +E  A+ G++ NP+  T+K 
Sbjct  292   MAYLPVPSLQTGGVLWFTDLSAADPFYILPFVVTGTMFFILELGAESGID-NPNLRTMKT  350

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             V R M  + +P T +FP AVF YW+TSN FSL    +++ P V++   +P
Sbjct  351   VFRIMPLIILPLTINFPTAVFTYWLTSNCFSLGQVALLRHPAVRRRFNIP  400



>gb|AAI34231.1| Zgc:163091 protein [Danio rerio]
Length=469

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 128/227 (56%), Gaps = 6/227 (3%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  +Q L++++H   G  WW +IV  T++ R    P++++  +  +KL  + P++  + 
Sbjct  156   PVGLIQNLLEFMHVSIGLPWWGAIVAGTIVARCAVFPVIVKGQREAAKLNNVMPEMTKLT  215

Query  669   QEMQNRGMAPAAVNEGQQRMKDL--FNEYK-VSPFSAFRGIFIQGPIFVSFFLAISNMAE  839
               M N         E  +   DL  F + K V+PF  F    +Q PIF+SFF+A+  M+E
Sbjct  216   NRM-NEAKQSGNKFEFSKAYTDLMMFQKKKDVNPFRGFLVPLVQAPIFLSFFIALRKMSE  274

Query  840   -KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
               VPS + GG +WFTDLT  D  YI P+    T    +E  A+ G++ NP+   +K V R
Sbjct  275   LPVPSLQTGGLWWFTDLTAADPFYILPIAVTGTMVAILELGAESGVD-NPNLRAMKTVFR  333

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              M  + +P T +FP AVF YW+TSN+FSL+   V++ P V++ L +P
Sbjct  334   IMPFVILPLTINFPTAVFTYWMTSNLFSLAQVAVLRHPAVRQKLRIP  380



>ref|NP_001106402.1| oxidase (cytochrome c) assembly 1-like [Xenopus (Silurana) tropicalis]
 gb|AAI52066.1| LOC100127562 protein [Xenopus (Silurana) tropicalis]
Length=425

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 124/227 (55%), Gaps = 6/227 (3%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  +Q  +++++   G  WW +IV  T+L R L  PL+++  +  +KL    P++  + 
Sbjct  117   PVGLIQNFLEFLNVDVGLPWWGAIVTGTVLARILVFPLIVKGQREAAKLNNHMPQISSMT  176

Query  669   QEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAE  839
               M N         E  +   DL     ++ V+P   F    +Q PIF+SFF+A+  M+ 
Sbjct  177   NRM-NEAKQSGNKFEFSKAYSDLTLYQKKHDVNPLRGFLVPLVQAPIFISFFVALRQMSY  235

Query  840   -KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
               VPS + GG +WFTDLT  D  YI P+    T W  +E  A+ G++ NP+   +K V R
Sbjct  236   LPVPSMQSGGLWWFTDLTAADPFYILPLTVTCTMWGVLELGAESGVD-NPNLKIMKTVFR  294

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              M  + +P T +FP AVF YW+TSN+FSL+    ++ P V+K L +P
Sbjct  295   VMPLIILPLTINFPTAVFTYWVTSNVFSLAQVSFLRIPAVRKKLKIP  341



>gb|AAI52010.1| Oxa1l protein [Danio rerio]
Length=469

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 128/227 (56%), Gaps = 6/227 (3%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  +Q L++++H   G  WW +IV  T++ R    P++++  +  +KL  + P++  + 
Sbjct  156   PVGLIQNLLEFMHVSIGLPWWGAIVAGTIVARCAVFPVIVKGQREAAKLNNVMPEMTKLT  215

Query  669   QEMQNRGMAPAAVNEGQQRMKDL--FNEYK-VSPFSAFRGIFIQGPIFVSFFLAISNMAE  839
               M N         E  +   DL  F + K V+PF  F    +Q PIF+SFF+A+  M+E
Sbjct  216   NRM-NEAKQSGNKFEFSKAYTDLMMFQKKKDVNPFRGFLVPLVQAPIFLSFFIALRKMSE  274

Query  840   -KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
               VPS + GG +WFTDLT  D  YI P+    T    +E  A+ G++ NP+   +K V R
Sbjct  275   LPVPSLQTGGLWWFTDLTAADPFYILPIAVTGTMVAILELGAESGVD-NPNLRAMKTVFR  333

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              M  + +P T +FP AVF YW+TSN+FSL+   V++ P V++ L +P
Sbjct  334   IMPFVILPLTINFPTAVFTYWMTSNLFSLAQVAVLRHPAVRQKLRIP  380



>ref|NP_001098600.2| oxidase (cytochrome c) assembly 1-like [Danio rerio]
Length=469

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 128/227 (56%), Gaps = 6/227 (3%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  +Q L++++H   G  WW +IV  T++ R    P++++  +  +KL  + P++  + 
Sbjct  156   PVGLIQNLLEFMHVSIGLPWWGAIVAGTIVARCAVFPVIVKGQREAAKLNNVMPEMTKLT  215

Query  669   QEMQNRGMAPAAVNEGQQRMKDL--FNEYK-VSPFSAFRGIFIQGPIFVSFFLAISNMAE  839
               M N         E  +   DL  F + K V+PF  F    +Q PIF+SFF+A+  M+E
Sbjct  216   NRM-NEAKQSGNKFEFSKAYTDLMMFQKKKDVNPFRGFLVPLVQAPIFLSFFIALRKMSE  274

Query  840   -KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
               VPS + GG +WFTDLT  D  YI P+    T    +E  A+ G++ NP+   +K V R
Sbjct  275   LPVPSLQTGGLWWFTDLTAADPFYILPIAVTGTMVAILELGAESGVD-NPNLRAMKTVFR  333

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              M  + +P T +FP AVF YW+TSN+FSL+   V++ P V++ L +P
Sbjct  334   IMPFVILPLTINFPTAVFTYWMTSNLFSLAQVAVLRHPAVRQKLRIP  380



>gb|EPX74122.1| inner membrane translocase Oxa102 [Schizosaccharomyces octosporus 
yFS286]
Length=397

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 123/236 (52%), Gaps = 13/236 (6%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPK-----  653
             P   LQ L+  +H  +G  WWASI  T + +R   LPLMI+ ++ +SKLA++ P+     
Sbjct  97    PHNLLQSLVQSIHVWSGMPWWASIAATAIGMRLTMLPLMIKMMRTSSKLAVINPQVSQHM  156

Query  654   --LDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAIS  827
               L   + E  + GM+     E   R+++L+    V+P S      +QG +F+SFF A+ 
Sbjct  157   VALQKAKAENNSTGMS-----EATTRIQELYRSNNVNPLSLLTAPVVQGIVFISFFYALK  211

Query  828   NMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIK  1004
              MA   V  F EGG  W  DLT  D   +FP+L  L     +E  ++ G         +K
Sbjct  212   CMAGVPVEGFLEGGFLWVQDLTKADPYAVFPILNGLLMLFNIEAGSETGTNKAAMAPGMK  271

Query  1005  NVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPA  1172
                R + A S  FT SFP A+F YW+ SN+FS+  GL++K   ++  L +P +P A
Sbjct  272   RFFRLLCAASPVFTMSFPMAIFMYWVPSNVFSVFQGLLLKNQSLRNKLDLPEVPAA  327



>ref|XP_008426239.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Poecilia 
reticulata]
Length=485

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 126/230 (55%), Gaps = 6/230 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV  +Q L+++ H   G  WW +IV  T+L R    P++++  +  +KL  + P++ 
Sbjct  175   AHTPVGLIQSLLEFFHMDLGLPWWGAIVVGTVLARLAVFPVIVKGQREAAKLNNVLPEMT  234

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              + ++M N         E  +   DL     ++ V+P   F    +Q P+F+SFF+A+  
Sbjct  235   KLTEKM-NEAKQSGNKYEFSKAYSDLNLFQKKHDVNPLRGFLIPLVQAPVFISFFIALRK  293

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WFTDL+  D  YI P +   T +  +E  A+ G++ NP+  T+K 
Sbjct  294   MAYLPVPSLQTGGVLWFTDLSAADPFYILPFVVTGTMFFILELGAESGID-NPNLRTMKT  352

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             V R M  + +P T +FP AVF YW+TSN FSL    +++ P V++   +P
Sbjct  353   VFRIMPLIILPLTINFPTAVFTYWLTSNCFSLGQVALLRHPAVRRRFNIP  402



>ref|XP_007248080.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Astyanax 
mexicanus]
Length=502

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 127/239 (53%), Gaps = 6/239 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             +Y PV  +Q L++++H   G  WW +IV  T++ R    P +++  +   KL  + P++ 
Sbjct  173   NYTPVGLIQNLLEFMHVNIGLPWWCAIVAGTIIARCAVFPAIVKGQREAVKLNNVLPEMT  232

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDL---FNEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              I   M N         E  +   +L   + ++ V+P   F    +Q P+F+SFF+A+  
Sbjct  233   KISNRM-NEAKHSGNKFEFSKAYSELMMFYKKHDVNPVRGFLVPLVQAPVFISFFIALRQ  291

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WFTDLT  D  +I P     T +  VE  A+ G++ NP+   +K 
Sbjct  292   MAYLPVPSLQTGGLGWFTDLTAADPYFILPFAVTGTMFAIVELGAESGLD-NPNLRAMKT  350

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRA  1184
             V R M  + +P T +FP AVF YW+TSN+FSL    +++ P V+K L +P     PP A
Sbjct  351   VFRIMPLVILPMTINFPTAVFVYWLTSNVFSLGQVALLRHPAVRKKLRIPERKTHPPSA  409



>ref|XP_007436446.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like isoform 
X3 [Python bivittatus]
Length=412

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 128/234 (55%), Gaps = 14/234 (6%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             SY PV  +  +++  H   G  WW +IV  T+L R L  PL+++  +    L    P+++
Sbjct  102   SYSPVGLIMKILESFHLDLGLPWWGAIVAGTVLARCLVFPLIVKSQREAVLLNNHFPQMN  161

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLFNE-------YKVSPFSAFRGIFIQGPIFVSFFL  818
             ++     N  +A A  +   +     + E       + ++P   F    +Q PIF+SFF 
Sbjct  162   EM-----NTRIADARKSGNHKEFVKAYTELNQYQKAHNINPKRGFIAPLVQTPIFISFFF  216

Query  819   AISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYG  995
             A+  MAE  VPS + GG +WFTDLT+ DS Y+ P++T +T W  +E  A+ G+  NP++ 
Sbjct  217   ALRKMAEFPVPSMETGGLWWFTDLTSADSYYVLPLMTTVTMWAVLEFGAETGVS-NPNFH  275

Query  996   TIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              +K V R +  L +P T +FP A+F YW+TSN+FS+    +++ P ++    +P
Sbjct  276   VMKTVLRVIPVLLLPITINFPTAIFTYWLTSNLFSMVQVSLLRLPALRTFFRIP  329



>ref|XP_007436444.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like isoform 
X1 [Python bivittatus]
Length=412

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 128/234 (55%), Gaps = 14/234 (6%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             SY PV  +  +++  H   G  WW +IV  T+L R L  PL+++  +    L    P+++
Sbjct  102   SYSPVGLIMKILESFHLDLGLPWWGAIVAGTVLARCLVFPLIVKSQREAVLLNNHFPQMN  161

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLFNE-------YKVSPFSAFRGIFIQGPIFVSFFL  818
             ++     N  +A A  +   +     + E       + ++P   F    +Q PIF+SFF 
Sbjct  162   EM-----NTRIADARKSGNHKEFVKAYTELNQYQKAHNINPKRGFIAPLVQTPIFISFFF  216

Query  819   AISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYG  995
             A+  MAE  VPS + GG +WFTDLT+ DS Y+ P++T +T W  +E  A+ G+  NP++ 
Sbjct  217   ALRKMAEFPVPSMETGGLWWFTDLTSADSYYVLPLMTTVTMWAVLEFGAETGVS-NPNFH  275

Query  996   TIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              +K V R +  L +P T +FP A+F YW+TSN+FS+    +++ P ++    +P
Sbjct  276   VMKTVLRVIPVLLLPITINFPTAIFTYWLTSNLFSMVQVSLLRLPALRTFFRIP  329



>ref|XP_007551475.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Poecilia 
formosa]
Length=465

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 131/246 (53%), Gaps = 7/246 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV  +Q L++++H   G  WW +IV  T+L R    P++++  +  +KL  + P++ 
Sbjct  175   AHTPVGLIQSLLEFIHMDLGLPWWGAIVVGTVLARVAVFPVIVKGQREAAKLNNVLPEMT  234

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              +  +M N         E  +   DL     ++ V+P   F    +Q P+F+SFF+A+  
Sbjct  235   KLTDKM-NEAKQSGNKYEFAKAYSDLNLFQKKHDVNPLRGFLVPLVQAPVFISFFIALRK  293

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WFTDL+  D  YI P     T +  +E  A+ G++ NP+  T+K 
Sbjct  294   MAYLPVPSLQTGGVLWFTDLSAADPFYILPFAVTGTMFFILELGAESGID-NPNLRTMKT  352

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRA-  1184
             V R M  + +P T +FP AVF YW+TSN FSL    +++ P V++   +P     P  A 
Sbjct  353   VFRIMPLIILPLTINFPTAVFTYWLTSNCFSLGQVALLRHPAVRRRFNIPERVKHPTAAL  412

Query  1185  DQSSGL  1202
              QS GL
Sbjct  413   PQSDGL  418



>ref|XP_008618881.1| hypothetical protein SDRG_14524 [Saprolegnia diclina VS20]
 gb|EQC27686.1| hypothetical protein SDRG_14524 [Saprolegnia diclina VS20]
Length=355

 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 124/222 (56%), Gaps = 8/222 (4%)
 Frame = +3

Query  510   LIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRG  689
             ++D  H  TG  WWA+I+ TT+ +R +  P+ +  ++ ++++ +++PKL+ ++ E+++  
Sbjct  95    VLDVAHVTTGLPWWATIIATTVAVRSVFFPISVMSMRNSARMNIMKPKLEKLQDEIKSSQ  154

Query  690   MA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEG  863
              A  P  + E + R K+LF E++V PF +F     Q PIF+ FF  +  ++  +P +   
Sbjct  155   EAYDPKKMAEFRARAKNLFKEHEVRPFMSFLMPLSQLPIFLGFFWGLQEISTHIPEYASE  214

Query  864   GAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPS--YGTIKNVSRAMAALSI  1037
             G  WF DL +PD +Y  PVL++     ++E     G +G P       K   R +A + +
Sbjct  215   GTLWFQDLASPDPLYALPVLSSALMIASMEA----GGDGLPKEYLSQAKMGMRMVALIMV  270

Query  1038  PFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
             P   +F   +  YW+TSN F+L+  +V+K P V+   G+P +
Sbjct  271   PVATTFQSGILVYWVTSNCFTLAQTMVLKVPAVRSAFGIPSV  312



>emb|CEG66499.1| hypothetical protein RMATCC62417_03066 [Rhizopus microsporus]
Length=331

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 131/245 (53%), Gaps = 10/245 (4%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV AL+ + +Y+H  +G  WWA+I   T+ +R   LPLMI+  +  +KL  + P   
Sbjct  50    NFTPVGALEAMFEYIHIYSGLPWWAAIAAATVAVRVALLPLMIKIQRNNAKLMNINP---  106

Query  660   DIRQEMQNRGMAPA-----AVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAI  824
             D+ + M N   A A     +V++  + ++ LF      P  +     IQ P+ +SFF+AI
Sbjct  107   DVTRIMDNLKKAQAEGDTLSVDKYSREIQTLFKNNDCHPMKSLGLPMIQMPVMISFFMAI  166

Query  825   SNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
              +MAE  VP     G  WFTDL+  D  YI P ++A      +E   + G   NP    +
Sbjct  167   RSMAEVPVPGLTNEGLLWFTDLSAKDPYYILPAISAAGMMAILEAGTETG-AANPQSKGM  225

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR  1181
             KNV R ++   +PFTA  P  VF YWITSN+FS+   L +K P V+K L +P++   P  
Sbjct  226   KNVFRVLSLAVVPFTAWMPSGVFVYWITSNLFSIGQILTLKAPSVRKALNIPLLKRKPEE  285

Query  1182  ADQSS  1196
               +++
Sbjct  286   LQKNT  290



>ref|XP_315429.4| AGAP005421-PA [Anopheles gambiae str. PEST]
 gb|EAA11925.4| AGAP005421-PA [Anopheles gambiae str. PEST]
Length=419

 Score =   145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/308 (30%), Positives = 141/308 (46%), Gaps = 6/308 (2%)
 Frame = +3

Query  249   GNRISLGVGVARIPFQDRKFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISE---VLSDKA  419
             G    +  G A     + +FSP     A + MRN+ST+ G+    +E I E   +    A
Sbjct  34    GRDYHIASGHATATLLNARFSPVKPITATVLMRNLSTADGDKSALLETIPEPPAIPQAGA  93

Query  420   VEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLP  599
              E     A      +      + PV  +Q  ++++H      WW  I   T+ +R L  P
Sbjct  94    PEIADIVAGAEPAFSTLGLGGWTPVGIVQNCMEFLHIGLDLPWWGCIAIGTVCVRTLLFP  153

Query  600   LMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQ--QRMKDLFNEYKVSPFSAF  773
             L+I   +  +K+    P+L  ++ +M     A  A++  +  Q M     E  ++P    
Sbjct  154   LVIASQRNAAKMNNYMPQLQVLQMKMTEARQAGNAIDSARYGQEMVLFMKEKNLNPLKNM  213

Query  774   RGIFIQGPIFVSFFLAISNMAEK-VPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITV  950
                  Q PIF+SFF+ +  MA   V S ++GG FWFTDLT  D  Y  P++T+LT + T+
Sbjct  214   LVPLAQAPIFISFFMGLREMANTPVESMRDGGLFWFTDLTICDQFYALPIITSLTLFATI  273

Query  951   ECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRP  1130
             E           +  T K + RA+     PFT +FP A+ CYW  SN FSL     ++ P
Sbjct  274   ELGTDSARMSAANMQTAKYILRALPLFIFPFTINFPGAILCYWACSNFFSLVQVGFLRIP  333

Query  1131  KVKKLLGV  1154
             KV+    +
Sbjct  334   KVRDFFKI  341



>gb|KDO25568.1| hypothetical protein SPRG_20688 [Saprolegnia parasitica CBS 223.65]
Length=355

 Score =   144 bits (362),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 125/222 (56%), Gaps = 8/222 (4%)
 Frame = +3

Query  510   LIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRG  689
             ++D  H  TG  WWA+I+ TT+ +R +  P+ +  ++ ++++ +++PKL+ +++E+++  
Sbjct  95    VLDVAHVTTGLPWWATIIATTVAVRSVFFPISVMSMRNSARMNIMKPKLEKLQEEIKSSQ  154

Query  690   MA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEG  863
              A  P  + E + R K+LF E++V PF +F     Q PIF+ FF  +  ++  +P +   
Sbjct  155   EAYDPKKMAEFRARAKNLFKEHEVRPFMSFLMPLSQLPIFLGFFWGLQEISTHIPEYAGE  214

Query  864   GAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPS--YGTIKNVSRAMAALSI  1037
             G  WF DL  PD +Y  PV+++     ++E     G +G P       K   R +A + +
Sbjct  215   GTLWFQDLAAPDPLYALPVISSALMIASMEA----GGDGLPKEYLSQAKMGMRMVALIMV  270

Query  1038  PFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPII  1163
             P   +F   +  YW+TSN F+L+  +++K P V+  LG+P +
Sbjct  271   PVATTFQSGILVYWVTSNCFTLTQTMLLKVPAVRSALGIPSV  312



>gb|KFB48215.1| AGAP005421-PA-like protein [Anopheles sinensis]
Length=425

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 89/289 (31%), Positives = 136/289 (47%), Gaps = 5/289 (2%)
 Frame = +3

Query  303   KFSPPPWAMAPIWMRNMSTSVGEGMNKIEYISE--VLSDKAVEAVASQapvvnevavaaa  476
             KFS      A + +RN+ST  G+    ++ I E   +   A E     A      A    
Sbjct  59    KFSSLKPITAAVLVRNLSTGDGDKAALLDVIPEPPTIPQGAPEIAELVAGAEPAFASLGL  118

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
               + PV  +Q  ++++H      WW  I   T+++R L  PL+I   +  +K+    P+L
Sbjct  119   GGWTPVGIVQNCMEFLHIGLDLPWWGCIAIGTVVVRTLLFPLVIASQRNAAKMNNHMPQL  178

Query  657   DDIRQEMQNRGMAPAAVNEGQ--QRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
               ++ +M     A  A+   +  Q M     E K++P         Q PIF+SFF+ +  
Sbjct  179   QVLQMKMTEARQAGNAIESARYGQEMVLFMKEKKLNPLKNMLVPLAQAPIFISFFMGLRE  238

Query  831   MAEK-VPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   V S +EGG FWFTDLT  D  Y  P++T+LT ++T+E           +  T+K 
Sbjct  239   MANTPVESMREGGLFWFTDLTICDQFYALPIITSLTLFLTIELGTDSARMSAANMQTVKY  298

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGV  1154
             + RAM     PFT +FP A+ CYW  SN FSL     ++ P V+    +
Sbjct  299   ILRAMPIFIFPFTINFPGAILCYWACSNFFSLVQVGFLRIPTVRDFFKI  347



>ref|XP_010740031.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Larimichthys 
crocea]
Length=495

 Score =   146 bits (368),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 134/254 (53%), Gaps = 4/254 (2%)
 Frame = +3

Query  405   LSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIR  584
             ++D A  AV         +A     +Y PV  +Q +++++H   G  WW +IV  T+L R
Sbjct  154   VADAAPTAVEVLTATETSLAELGLGAYTPVGLIQNMLEFMHVDLGLPWWGAIVVGTVLAR  213

Query  585   WLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMK-DLFNE-YKVS  758
                 P++++  +  +KL  + P++  +   M     +    +  +     +LF + + V+
Sbjct  214   LAVFPVIVKGQREAAKLNNVLPEMTKLTTRMNEAKQSGNKFDFAKAYSDLNLFQKKHDVN  273

Query  759   PFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALT  935
             P   F    +Q P+FVSFF+A+  MA   VPS + GG  WFTDLT  D  YI P+    T
Sbjct  274   PLRGFLVPMVQAPVFVSFFIALRKMAYLPVPSLQTGGVLWFTDLTAADPFYILPLAVTGT  333

Query  936   FWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGL  1115
              +  +E  A+ G++ NP+   +K V R M  + +P T +FP AVF YW+TSN FSL+   
Sbjct  334   MFFILELGAESGVD-NPNLRAMKTVFRIMPLIILPLTINFPTAVFTYWMTSNCFSLAQVA  392

Query  1116  VIKRPKVKKLLGVP  1157
             +++ P ++  L +P
Sbjct  393   LLRHPYIRDRLKIP  406



>ref|XP_002875952.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52211.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 103/277 (37%), Positives = 136/277 (49%), Gaps = 41/277 (15%)
 Frame = +3

Query  345   RNMSTSVGEGMNKIEYISEVLS---DKAVEAVASQapvvnevavaaaDSYLPVAALQYLI  515
             R+MSTS   G +    +SEV     D  +E VASQ             SY     ++ LI
Sbjct  76    RSMSTSHVPGSDDSCNVSEVAGTPIDSVMENVASQDWSY---------SY-NFDIVKALI  125

Query  516   DYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA  695
             + +H  TG NWWASIV  TLLIR +T+PLMI   +  S++ +L      I          
Sbjct  126   ETLHSYTGLNWWASIVLATLLIRGVTIPLMIDNERWRSRIMML-----GIHSTASMETKD  180

Query  696   PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFW  875
             PAA+ E +     L         S F+               ISNM E+V SFK GG  W
Sbjct  181   PAALAEHRIEFDKLLKNN-----SCFQ---------------ISNMTEEVASFKTGGVLW  220

Query  876   FTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASF  1055
             FTDLTT D+  IFP+LT LTFWI +E +A  G+EG       K ++R M           
Sbjct  221   FTDLTTHDTSLIFPLLTWLTFWIMIEYDATVGLEGAM---IPKKLTRIMVIPMFVVAIMV  277

Query  1056  PKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIP  1166
              K V CY ++  +FS++Y LVI+RP V K  G+P +P
Sbjct  278   SKGVHCYLMSCMMFSIAYMLVIRRPAVMKHYGIPEVP  314



>ref|XP_002612458.1| hypothetical protein BRAFLDRAFT_214259 [Branchiostoma floridae]
 gb|EEN68467.1| hypothetical protein BRAFLDRAFT_214259 [Branchiostoma floridae]
Length=383

 Score =   144 bits (362),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 127/235 (54%), Gaps = 13/235 (6%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             P+  LQ  ID  H      WWASIVC TLL R L  PL+++  K    L  + P++  + 
Sbjct  70    PICLLQSSIDMFHSTLHLPWWASIVCCTLLARSLMFPLIVKGQKNAINLNNVMPQIQKMN  129

Query  669   QEM-QNRGMAPA-AVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-  839
             +++ + R M     V      ++    ++ V+P   F    +Q P+F+SFF+ +  MA  
Sbjct  130   EKINEARTMGNKFEVAHQTAELQAFMKKHGVNPLKNFLVPLVQMPVFISFFVGLRRMATL  189

Query  840   KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRA  1019
              + S   GG FWFTDLT  D  +I PV+T++T    +E  ++ G+E NP    +KNV R 
Sbjct  190   PIMSMATGGIFWFTDLTASDPYFILPVMTSITMLTIIELGSELGVE-NPQMKMMKNVMRV  248

Query  1020  MAALSIPFTASFPK---------AVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             ++ + +P TASFP          A+F YW+TSN F+++   ++K P V++ L +P
Sbjct  249   VSLMILPLTASFPTHSFPKVYCIAIFTYWMTSNTFTIAQISLLKVPAVRQWLKMP  303



>emb|CEJ03963.1| hypothetical protein RMCBS344292_17934 [Rhizopus microsporus]
Length=397

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 131/245 (53%), Gaps = 10/245 (4%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV AL+ + +Y+H  +G  WWA+I   T+ +R   LPLMI+  +  +KL  + P   
Sbjct  116   NFTPVGALEAMFEYIHVYSGLPWWAAIAAATVAVRVALLPLMIKIQRNNAKLMNINP---  172

Query  660   DIRQEMQNRGMAPA-----AVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAI  824
             D+ + M N   A A     +V++  + ++ LF      P  +     IQ P+ +SFF+AI
Sbjct  173   DVTRIMDNLKKAQAEGDTLSVDKYSREIQTLFKNNDCHPMKSLGLPMIQMPVMISFFMAI  232

Query  825   SNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
              +MAE  VP     G  WFTDL+  D  YI P ++A      +E   + G   NP    +
Sbjct  233   RSMAEVPVPGLTNEGLLWFTDLSAKDPYYILPAISAAGMMAILEAGTETG-AANPQSKGM  291

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR  1181
             KNV R ++   +PFTA  P  VF YWITSN+FS+   L +K P V+K L +P++   P  
Sbjct  292   KNVFRVLSLAVVPFTAWMPSGVFVYWITSNLFSIGQILTLKAPSVRKALNIPLLKRKPEE  351

Query  1182  ADQSS  1196
               +++
Sbjct  352   LQKNT  356



>ref|XP_009107740.1| PREDICTED: mitochondrial inner membrane protein OXA1-like [Brassica 
rapa]
Length=174

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +3

Query  744   EYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
              + V+ F+  +G+ IQGPIF+SFF AI NMAEKVPSFK GG  WFTDLTT D+ YI P+L
Sbjct  59    RHGVTSFTPLKGLIIQGPIFISFFFAIRNMAEKVPSFKTGGTLWFTDLTTADTTYILPLL  118

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKA  1064
             TA+TF I VE N QEGMEGNP  GT+K  SR +A LSIP      K 
Sbjct  119   TAITFIIMVESNMQEGMEGNPVAGTMKKFSRIIAFLSIPILMGIEKV  165



>emb|CEG66498.1| hypothetical protein RMATCC62417_03066 [Rhizopus microsporus]
Length=397

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 131/245 (53%), Gaps = 10/245 (4%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             ++ PV AL+ + +Y+H  +G  WWA+I   T+ +R   LPLMI+  +  +KL  + P   
Sbjct  116   NFTPVGALEAMFEYIHIYSGLPWWAAIAAATVAVRVALLPLMIKIQRNNAKLMNINP---  172

Query  660   DIRQEMQNRGMAPA-----AVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAI  824
             D+ + M N   A A     +V++  + ++ LF      P  +     IQ P+ +SFF+AI
Sbjct  173   DVTRIMDNLKKAQAEGDTLSVDKYSREIQTLFKNNDCHPMKSLGLPMIQMPVMISFFMAI  232

Query  825   SNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
              +MAE  VP     G  WFTDL+  D  YI P ++A      +E   + G   NP    +
Sbjct  233   RSMAEVPVPGLTNEGLLWFTDLSAKDPYYILPAISAAGMMAILEAGTETG-AANPQSKGM  291

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPR  1181
             KNV R ++   +PFTA  P  VF YWITSN+FS+   L +K P V+K L +P++   P  
Sbjct  292   KNVFRVLSLAVVPFTAWMPSGVFVYWITSNLFSIGQILTLKAPSVRKALNIPLLKRKPEE  351

Query  1182  ADQSS  1196
               +++
Sbjct  352   LQKNT  356



>ref|XP_003449430.2| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Oreochromis 
niloticus]
Length=494

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 129/246 (52%), Gaps = 7/246 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
              + PV  +Q +++++H   G  WW +IV  T+L R    P++++  +  +KL  + P++ 
Sbjct  178   GHTPVGLVQNMLEFIHMDLGLPWWGAIVVATVLARLAVFPVIVKGQREAAKLNNVLPEMT  237

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              +   M N         E  +   DL     ++ V+P   F    +Q P+F+SFF+A+  
Sbjct  238   KLTNRM-NEAKQSGNKFEFSKAYSDLNLFQKKHDVNPLRGFLIPLVQTPVFISFFIALRK  296

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GGA WF DLT  D  YI P+    T +  +E  A+ G++ NP+   +K 
Sbjct  297   MAYLPVPSMQTGGALWFADLTASDPFYILPLAVTGTMFFILELGAESGID-NPNLRAMKT  355

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRA-  1184
             V R M  +  P T +FP AVF YW+TSN FSL    +++ P ++K L +P     P  A 
Sbjct  356   VFRIMPLVIFPLTINFPTAVFTYWLTSNCFSLCQVALLRHPLIRKKLKIPERIKHPASAL  415

Query  1185  DQSSGL  1202
              QS GL
Sbjct  416   PQSDGL  421



>dbj|BAC36908.1| unnamed protein product [Mus musculus]
Length=433

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 129/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S  A + V  Q             SY PV  +Q L++Y+H   G  WW +I   T
Sbjct  86    VPEVASGGAADVV--QCATEPSFTELGLGSYTPVGLIQNLLEYIHVDLGLPWWGAIATCT  143

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  144   VLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKK  203

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +           Q P+F+SFF+A+  MA   VPS + GG +WF DLT  D +Y+ P++
Sbjct  204   HDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLV  263

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E +A+ G++ N     ++N+ R M  + +P T  FP AVF YW++SN+FSL
Sbjct  264   VTATMWCVLELDAETGVQSN-DLQFMRNIIRVMPLVVLPVTIHFPSAVFMYWLSSNVFSL  322

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  323   CQVACLRIPAVRTVLKIP  340



>dbj|BAE24033.1| unnamed protein product [Mus musculus]
Length=433

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 128/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S  A + V  Q             SY PV  +Q L++Y+H   G  WW +I   T
Sbjct  86    VPEVASGGAADVV--QCATEPSFTELGLGSYTPVGLIQNLLEYIHVDLGLPWWGAIATCT  143

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  144   VLARCLVFPLIVKGQREAAKIHHHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKK  203

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +           Q P+F+SFF+A+  MA   VPS + GG +WF DLT  D +Y+ P++
Sbjct  204   HDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLV  263

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ N     ++N+ R M  + +P T  FP AVF YW++SN+FSL
Sbjct  264   VTATMWCVLELGAETGVQSN-DLQFMRNIIRVMPLVVLPVTIHFPSAVFMYWLSSNVFSL  322

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  323   CQVACLRIPAVRTVLKIP  340



>dbj|BAE32503.1| unnamed protein product [Mus musculus]
 dbj|BAE32657.1| unnamed protein product [Mus musculus]
Length=433

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 128/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S  A + V  Q             SY PV  +Q L++Y+H   G  WW +I   T
Sbjct  86    VPEVASGGAADVV--QCATELSFTELGLGSYTPVGLIQNLLEYIHVDLGLPWWGAIATCT  143

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  144   VLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKK  203

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +           Q P+F+SFF+A+  MA   VPS + GG +WF DLT  D +Y+ P++
Sbjct  204   HDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLV  263

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ N     ++N+ R M  + +P T  FP AVF YW++SN+FSL
Sbjct  264   VTATMWCVLELGAETGVQSN-DLQFMRNIIRVMPLVVLPVTIHFPSAVFMYWLSSNVFSL  322

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  323   CQVACLRIPAVRTVLKIP  340



>ref|XP_006817147.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Saccoglossus 
kowalevskii]
Length=436

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 126/234 (54%), Gaps = 14/234 (6%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRP---  650
             ++ PV A+Q  ++++H      WW++IV  T++ R+L  P++I+  +   KL  + P   
Sbjct  125   NFTPVGAIQNCLEFLHINLHLPWWSAIVVGTVIARFLIFPVVIRGQRNAVKLNNVMPTVQ  184

Query  651   ----KLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFL  818
                 K+++IR       +A  A NE Q  MK    ++ V+P        +Q PIF+SFF+
Sbjct  185   RLTNKMNEIRSSGSQLEIA-RATNELQMFMK----KHGVNPMKNMLVPLVQAPIFISFFI  239

Query  819   AISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYG  995
              +  MA   V S + GG +WFTDLT  D  YI P +  L+    +E   + G++ NP   
Sbjct  240   GLRKMAALPVESMQTGGLYWFTDLTIADPYYIMPAIATLSMLCIIELGGETGVQ-NPQMQ  298

Query  996   TIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              +K V R +  + +PFTAS P +VFCYW+TSN  SL    ++K P V+    +P
Sbjct  299   NMKTVMRILPFVILPFTASMPASVFCYWLTSNFISLGQVALLKNPNVRAYFNIP  352



>ref|XP_009019457.1| hypothetical protein HELRODRAFT_121655, partial [Helobdella robusta]
 gb|ESO02049.1| hypothetical protein HELRODRAFT_121655, partial [Helobdella robusta]
Length=288

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 121/244 (50%), Gaps = 11/244 (5%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             P   ++  ++++HC     WW++IV  T+ +R    PL+I   +  + L    P +  ++
Sbjct  14    PKGLVENGLEFLHCTLDIPWWSAIVIGTVCLRLAIFPLVILAQRNAANLNNNMPTVQRLQ  73

Query  669   QEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFI---QGPIFVSFFLAISNMAE  839
             Q M    M+   V +  +  K L    KV+  +  + + +   Q PIF+S F AI  M  
Sbjct  74    QRMTQARMS-GNVQQAMESSKQLMEFMKVNNVNPLKNLLVPLAQIPIFLSVFTAIREMTN  132

Query  840   -KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
               V S+K GG  WFTDLT PD  YI PV+TA T + T+E              TIK V R
Sbjct  133   LPVASWKSGGILWFTDLTVPDPFYILPVVTAATLFATIELGVDGIKADQVGSSTIKFVLR  192

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRADQSS  1196
             +M  ++ P    FP A+ CYW TSN FSL   L++K PKVK L  +      PP  D ++
Sbjct  193   SMPFITFPIMIQFPSAMLCYWFTSNTFSLLQVLILKIPKVKSLCKI------PPLIDHTT  246

Query  1197  GLPF  1208
               P 
Sbjct  247   AYPL  250



>gb|EDL36360.1| oxidase assembly 1-like, isoform CRA_d [Mus musculus]
Length=433

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 128/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S  A + V  Q             SY PV  +Q L++Y+H   G  WW +I   T
Sbjct  86    VPEVASGGAADVV--QCATELSFTELGLGSYTPVGLIQNLLEYIHVDLGLPWWGAIATCT  143

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  144   VLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKK  203

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +           Q P+F+SFF+A+  MA   VPS + GG +WF DLT  D +Y+ P++
Sbjct  204   HDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLV  263

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ N     ++N+ R M  + +P T  FP AVF YW++SN+FSL
Sbjct  264   VTATMWCVLELGAETGVQSN-DLQFMRNIIRVMPLVVLPVTIHFPSAVFMYWLSSNVFSL  322

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  323   CQVACLRIPAVRTVLKIP  340



>ref|NP_081212.1| mitochondrial inner membrane protein OXA1L [Mus musculus]
 sp|Q8BGA9.1|OXA1L_MOUSE RecName: Full=Mitochondrial inner membrane protein OXA1L; AltName: 
Full=Oxidase assembly 1-like protein; Short=OXA1-like 
protein; Flags: Precursor [Mus musculus]
 dbj|BAC32104.1| unnamed protein product [Mus musculus]
 dbj|BAC34985.1| unnamed protein product [Mus musculus]
Length=433

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 128/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S  A + V  Q             SY PV  +Q L++Y+H   G  WW +I   T
Sbjct  86    VPEVASGGAADVV--QCATEPSFTELGLGSYTPVGLIQNLLEYIHVDLGLPWWGAIATCT  143

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  144   VLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKK  203

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +           Q P+F+SFF+A+  MA   VPS + GG +WF DLT  D +Y+ P++
Sbjct  204   HDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLV  263

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ N     ++N+ R M  + +P T  FP AVF YW++SN+FSL
Sbjct  264   VTATMWCVLELGAETGVQSN-DLQFMRNIIRVMPLVVLPVTIHFPSAVFMYWLSSNVFSL  322

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  323   CQVACLRIPAVRTVLKIP  340



>gb|ACO09357.1| Inner membrane protein OXA1L, mitochondrial precursor [Osmerus 
mordax]
Length=421

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 133/247 (54%), Gaps = 11/247 (4%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  +Q ++++ H   G  WW +IV  T+L R L  P++++  +  +KL  + P++  + 
Sbjct  103   PVGLVQNMLEFFHVDLGVPWWGAIVIGTVLARMLVFPVIVKGQREAAKLNNVMPEMTKLT  162

Query  669   QEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISNMA-  836
              +M N         +  +   DL     ++ V+P   F     Q P+F+SFF+A+  M+ 
Sbjct  163   SKM-NEAKQSGNKFDFAKAYADLTMFQKKHDVNPLRGFLVPLAQTPVFISFFIALRKMSY  221

Query  837   EKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
               VPS + GG FWFTDLT  D  +I P+    T +  +E  A+ G++ NP+   +K V R
Sbjct  222   HPVPSMQTGGLFWFTDLTAADPYFILPLAVTGTMFFILELGAESGID-NPNMRAMKTVFR  280

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP---IIPPA--PPR  1181
              M  + +P T +FP AVF YW+TSN FSL    ++K P V++ L +P   I PP+  PP+
Sbjct  281   IMPFIILPLTINFPTAVFTYWLTSNCFSLGQVALLKHPLVRQKLRIPEKIIHPPSSMPPQ  340

Query  1182  ADQSSGL  1202
                  G+
Sbjct  341   DGLFDGI  347



>ref|XP_003924390.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Saimiri 
boliviensis boliviensis]
Length=441

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 129/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S +  + V  QA            SY PV  +Q L+++VH   G  WW +I   T
Sbjct  90    VPEVASGETADTV--QAAAETSFTELGLGSYTPVGLIQNLLEFVHVELGLPWWGAIATCT  147

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  P++++  +   K     P++      ++   +A   A        M     +
Sbjct  148   ILARCLIFPVILKGQREAVKNQNHAPEIQKFTTRIKEARLAGDHAEFYRASAEMSIYQKK  207

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +S F        Q PIF+SFFLA+  MA   VPS + GG +WF DLT  D +++ PVL
Sbjct  208   HDISFFKPLILPLTQAPIFISFFLALREMAHLPVPSLQTGGLWWFQDLTVSDPIFVLPVL  267

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W+ +E  A+ G++ N     ++NV R M   + P T  FP AVF YW++SN+FSL
Sbjct  268   VTATMWVVLELGAETGVQ-NSDLKWMRNVIRLMPLAAFPVTVHFPTAVFMYWLSSNLFSL  326

Query  1104  SYGLVIKRPKVKKLLGVP  1157
             +    ++ P V+ +L +P
Sbjct  327   AQVSCLRIPAVRTVLKIP  344



>gb|EPY53819.1| inner membrane translocase Oxa102 [Schizosaccharomyces cryophilus 
OY26]
Length=396

 Score =   142 bits (358),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 119/234 (51%), Gaps = 13/234 (6%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPK-----  653
             P   LQ L++ +H  +G  WWASI    + +R   LPLM+  ++ +SKLA++ P+     
Sbjct  97    PHNLLQGLVNSIHVWSGMPWWASIATMAIGMRITVLPLMLNMIRTSSKLAVINPQVSQHM  156

Query  654   --LDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAIS  827
               L   + E  + GM+     E   +++DL+    V+P S      +QG IF+SFF A+ 
Sbjct  157   VTLQRAKAENNSTGMS-----EATSKIQDLYRSNNVNPLSLLSAPMVQGVIFISFFYALK  211

Query  828   NMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIK  1004
              MA   V    EGG  W  DLT  D   +FP+L        +E  ++ G         +K
Sbjct  212   CMAGVPVDGLTEGGFLWVQDLTKADPYAVFPILNGFLMLFNIEAGSETGTNKAAMAPGMK  271

Query  1005  NVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIP  1166
                R + A S  FT SFP A+F YW+ SNIFS+  GL++K   V+  L +P +P
Sbjct  272   RFFRLLCAASPIFTMSFPMAIFMYWVPSNIFSVFQGLLLKNQSVRNKLDLPEVP  325



>ref|XP_004562716.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Maylandia 
zebra]
Length=463

 Score =   143 bits (360),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 128/246 (52%), Gaps = 7/246 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
              + PV  +Q +++++H   G  WW +IV  T+L R    P++++  +  +KL  + P++ 
Sbjct  146   GHTPVGLVQNMLEFIHMDLGLPWWGAIVVATVLARLAVFPVIVKGQREAAKLNNVLPEMT  205

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              +   M N         E  +   DL     ++ V+P   F    +Q P+F+SFF+A+  
Sbjct  206   KLTNRM-NEAKQSGNKFEFSKAYSDLNLFQKKHDVNPLRGFLIPLVQTPVFISFFIALRK  264

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WF DLT  D  YI P+    T +  +E  A+ G++ NP+   +K 
Sbjct  265   MAYLPVPSMQTGGMLWFADLTASDPFYILPLAVTGTMFFILELGAESGID-NPNLRAMKT  323

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRA-  1184
             V R M  +  P T +FP AVF YW+TSN FSL    +++ P ++K L +P     P  A 
Sbjct  324   VFRIMPLVIFPLTINFPTAVFTYWLTSNCFSLCQVALLRHPLIRKKLKIPERIKHPASAL  383

Query  1185  DQSSGL  1202
              QS GL
Sbjct  384   PQSDGL  389



>ref|XP_004079879.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Oryzias 
latipes]
Length=492

 Score =   143 bits (361),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 121/227 (53%), Gaps = 6/227 (3%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  +Q L+++ H   G  WW +IV  T+L R    P++++  +  +KL  + P++  + 
Sbjct  179   PVGLIQNLLEFFHMDLGLPWWGAIVVGTVLARLAVFPVIVKGQREAAKLNNVLPEITKLT  238

Query  669   QEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAE  839
               M N         E  +   DL     +  V+P   F    +Q P+F+SFF+A+  MA 
Sbjct  239   NRM-NEAKQSGNKFEFAKAYSDLNLFQKKNDVNPLRGFLVPLVQAPVFISFFIALRKMAY  297

Query  840   -KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSR  1016
               VPS + GG  WFTDLT  D  YI P+    T +  +E  A+ G++ NP+   +K V R
Sbjct  298   LPVPSLQTGGMLWFTDLTAADPFYILPIAVTGTMFFILELGAESGID-NPNLRAMKTVFR  356

Query  1017  AMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              M  + +P T +FP AVF YW++SN+FSL    +++ P V+K   +P
Sbjct  357   IMPLVILPLTINFPTAVFTYWLSSNLFSLGQVALLRHPAVRKKFKIP  403



>ref|XP_005925924.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Haplochromis 
burtoni]
Length=438

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 127/246 (52%), Gaps = 7/246 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
              + PV  +Q +++++H   G  WW +IV  T+L R    P++++  +  +KL  + P++ 
Sbjct  121   GHTPVGLVQNMLEFIHMDLGLPWWGAIVVATVLARLAVFPVIVKGQREAAKLNNVLPEMT  180

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              +   M N         E  +   DL      + V+P   F    +Q P+F+SFF+A+  
Sbjct  181   KLTNRM-NEAKQSGNKFEFSKAYSDLNLFQKNHDVNPLRGFLIPLVQTPVFISFFIALRK  239

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WF DLT  D  YI P+    T +  +E  A+ G++ NP+   +K 
Sbjct  240   MAYLPVPSMQTGGMLWFADLTASDPFYILPLAVTGTMFFILELGAESGID-NPNLRAMKT  298

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRA-  1184
             V R M  +  P T +FP AVF YW+TSN FSL    +++ P ++K L +P     P  A 
Sbjct  299   VFRIMPLVIFPLTINFPTAVFTYWLTSNCFSLCQVALLRHPLIRKKLKIPERIKHPASAL  358

Query  1185  DQSSGL  1202
              QS GL
Sbjct  359   PQSDGL  364



>ref|XP_006801756.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Neolamprologus 
brichardi]
Length=494

 Score =   143 bits (360),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 128/246 (52%), Gaps = 7/246 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
              + PV  +Q +++++H   G  WW +IV  T+L R    P++++  +  +KL  + P++ 
Sbjct  178   GHTPVGLVQNMLEFIHMDLGLPWWGAIVVATVLARLAVFPVIVKGQREAAKLNNVLPEMT  237

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              +   M N         E  +   DL     ++ V+P   F    +Q P+F+SFF+A+  
Sbjct  238   KLTNRM-NEAKQSGNKFEFSKAYSDLNLFQKKHDVNPLRGFLIPLVQTPVFISFFIALRK  296

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             MA   VPS + GG  WF DLT  D  YI P+    T +  +E  A+ G++ NP+   +K 
Sbjct  297   MAYLPVPSMQTGGMLWFADLTASDPFYILPLAVTGTMFFILELGAESGID-NPNLRAMKT  355

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIPPAPPRA-  1184
             V R M  +  P T +FP AVF YW+TSN FSL    +++ P ++K L +P     P  A 
Sbjct  356   VFRIMPLVIFPLTINFPTAVFTYWLTSNCFSLCQVALLRHPLIRKKLKIPERIKHPASAL  415

Query  1185  DQSSGL  1202
              QS GL
Sbjct  416   PQSDGL  421



>ref|XP_004992614.1| hypothetical protein PTSG_07193 [Salpingoeca rosetta]
 gb|EGD74969.1| hypothetical protein PTSG_07193 [Salpingoeca rosetta]
Length=370

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 134/248 (54%), Gaps = 21/248 (8%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL----  656
             P   +Q L+++V    G +W+  IV +T+ IR L LP+ +  ++    +  LRP++    
Sbjct  55    PSGVVQNLLEFVAAQPGMSWFGGIVLSTIAIRTLMLPITVAMMRNNVTMMNLRPEMQLHA  114

Query  657   DDIRQEMQNRGMAPAAVNEGQ----QRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAI  824
             D I+Q       A     EG+    QR+++L  +  VSP  +  G F Q P+F+SFF A+
Sbjct  115   DRIKQ------CAAQGDEEGKIAASQRLQELMKKNGVSPLKSLYG-FAQIPVFLSFFFAL  167

Query  825   SNM-AEKVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTI  1001
              ++   +V S K GG  +FTDLT  D  Y+ PV+TA T  ++ E +++ G   +P   T+
Sbjct  168   RSITGGEVASIKTGGYSFFTDLTAADPTYVLPVVTATTMLLSFELSSRMGTAMSP---TM  224

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP--IIPPAP  1175
             K V R +A ++   TA+ P  +  YWITSNIF+L    V+  P VK+L  +P  +  P P
Sbjct  225   KKVFRGLALVTGAVTATLPMGIHAYWITSNIFTLGQVAVLNTPPVKRLFKIPDMVKHPDP  284

Query  1176  PRADQSSG  1199
             P+     G
Sbjct  285   PKQQSGKG  292



>gb|KDD75294.1| inner membrane protein [Helicosporidium sp. ATCC 50920]
Length=302

 Score =   139 bits (351),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 125/235 (53%), Gaps = 5/235 (2%)
 Frame = +3

Query  477   DSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKL  656
             + +LP   +Q+LI  V    G  WWA+++ TT+ +R +TLP+ I Q +  S++   +P +
Sbjct  38    ECWLPTQGMQHLILAVKDSLGVPWWAALIATTVGLRLVTLPVNIIQTRRGSRMQEAKPHM  97

Query  657   DDIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
             + +  + +    A  P A+ E Q+R+  ++ +Y + P      +  Q PIF+  F A+  
Sbjct  98    ESVVAQFKASYAAGDPNAMAEHQRRISAIWKKYDIHPGKMLLPMVFQMPIFLGMFGALRA  157

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPS--YGTI  1001
              A  KVPS   GGA W TDL++ D  Y+ P+LT  +F   +E  A +GME          
Sbjct  158   FAAAKVPSLVVGGALWCTDLSSADPTYLLPILTCASFMAMLELGASDGMEAQTEDQRKKF  217

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIP  1166
             K   R +    +PFTAS P A+  YW  SN+   +  +++K   V++ L +PI+P
Sbjct  218   KLFMRFIGLAILPFTASMPAALHIYWTASNVIGTAQSVILKTAPVRRALNLPILP  272



>ref|XP_010899007.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Esox lucius]
Length=471

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 125/230 (54%), Gaps = 6/230 (3%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             S  PV  +Q +++++H   G  WW +IV  T+L R +  P++++  +  +KL  + P++ 
Sbjct  145   SATPVGLVQNMLEFMHVDMGMPWWGAIVAGTILARIMVFPVIVKGQREAAKLNNVMPEMT  204

Query  660   DIRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISN  830
              +  +M N         +  +   DL     +  V+P   F    +Q P+F+SFF+A+  
Sbjct  205   KLTNKM-NEAKQSGNKFDFAKAYSDLTMFQKKNDVNPLRGFLVPLVQTPVFISFFIALRK  263

Query  831   MAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKN  1007
             M+   VPS + GG  WF DLT  D  YI P+    T +  +E  A+ G++ NP+   +K 
Sbjct  264   MSYLPVPSMQTGGCLWFLDLTAADPFYILPIAVTATMFAILELGAESGVD-NPNLKAMKT  322

Query  1008  VSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             V R M  + +P T +FP AVF YW+TSN FSL+   ++K P V+K L +P
Sbjct  323   VFRIMPFVILPLTINFPTAVFTYWMTSNCFSLAQVGLLKHPLVRKKLRIP  372



>ref|XP_003741477.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Metaseiulus 
occidentalis]
Length=411

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 123/229 (54%), Gaps = 7/229 (3%)
 Frame = +3

Query  483   YLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDD  662
             Y P   LQ  +D +H   G  WWA+I  TT++++ L +PL ++  +  + +    P+L  
Sbjct  118   YTPPGLLQNALDLLHSA-GLPWWAAIALTTVVMKTLMIPLAVKAQRNATVMNNYMPELQR  176

Query  663   IR---QEMQNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
              +   +E +  G    A   G +  K    E  V+P S+   + IQGP+F+SFF+A+  M
Sbjct  177   HQLKLREARESGDILEASKAGNELAK-FTKEKNVNPLSSLVPVLIQGPVFISFFIALRKM  235

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A   + S K GG +WF+DLT PD  Y+ P++T  T  +  E  A +G     +   +K V
Sbjct  236   ANLPMESMKTGGLYWFSDLTVPDPYYVLPLVTCTTVLVMFETGA-DGATRADNMRNMKYV  294

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              RA+  L  PFT  FP AV  YW TSN F+L+   +++RP V+ +  +P
Sbjct  295   LRAVPFLMFPFTMGFPAAVLTYWTTSNFFALAQTTILRRPGVRAMFNIP  343



>dbj|BAB25113.1| unnamed protein product [Mus musculus]
Length=433

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 127/258 (49%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S  A + V  Q             SY PV  +Q L++Y+H   G  WW +I   T
Sbjct  86    VPEVASGGAADVV--QCATEPSFTELGLGSYTPVGLIQNLLEYIHVDLGLPWWGAIATCT  143

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  144   VLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKK  203

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +             P+F+SFF+A+  MA   VPS + GG +WF DLT  D +Y+ P++
Sbjct  204   HDIKLLRPLILPLTHAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLV  263

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ N     ++N+ R M  + +P T  FP AVF YW++SN+FSL
Sbjct  264   VTATMWCVLELGAETGVQSN-DLQFMRNIIRVMPLVVLPVTIHFPSAVFMYWLSSNVFSL  322

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  323   CQVACLRIPAVRTVLKIP  340



>ref|NP_001162055.1| oxidase assembly 1-like [Rattus norvegicus]
 gb|EDM14152.1| rCG23545, isoform CRA_c [Rattus norvegicus]
Length=433

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 119/229 (52%), Gaps = 4/229 (2%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             SY PV  +Q L++Y+H   G  WW +I   T+L R L  PL+++  +  +K+    P++ 
Sbjct  113   SYTPVGLIQNLLEYIHVDLGLPWWGAIATCTVLARCLVFPLIVKGQREAAKIHNHMPEMQ  172

Query  660   DIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
                  ++   ++   A   +    M     ++ +  F        Q PIF+SFF+A+  M
Sbjct  173   KFSARIREAKLSGDQAEFYKATIEMTHYQKKHDIKFFRPLILPLTQAPIFISFFIALREM  232

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A   VPS + GG +WF DLT  D +Y+ P++   T W  +E  A+ GM+ +     ++NV
Sbjct  233   ANLPVPSLQTGGLWWFQDLTVSDPIYVLPLVVTATMWGVLELGAETGMQSS-DLQLMRNV  291

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              R M    +P T  FP AVF YW++SN+FSL     ++ P V+  L +P
Sbjct  292   IRVMPLAVLPVTIHFPSAVFMYWLSSNVFSLCQVACLRFPAVRTALKIP  340



>ref|XP_005623266.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Canis 
lupus familiaris]
Length=435

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 129/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             ++EV S +  + V  QA      A     SY PV  +Q L++++H   G  WW +I   T
Sbjct  90    VTEVASGETADVV--QAAAEQSFAELGLGSYTPVGLIQNLLEFMHVNLGLPWWGAIAACT  147

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  148   VLARCLVFPLIVKGQREAAKIHNHLPEIQKFSTRIREAKLAGDQAEFYKASSEMTFYQKK  207

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + V  F        Q PIF+SFF+A+  MA   VPS + GG  WF DLT  D  YI P++
Sbjct  208   HDVKLFRPLILPLTQAPIFISFFIALREMANLPVPSLQTGGLLWFQDLTLSDPTYILPLV  267

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ GM+ +     ++N+ R M    +P T  FP AVF YW++SN+FSL
Sbjct  268   VTATMWGVLELGAETGMQSS-DLQWMRNLIRVMPLAVLPITIHFPTAVFMYWLSSNMFSL  326

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  327   GQVACLRIPAVRTILKIP  344



>dbj|BAE42101.1| unnamed protein product [Mus musculus]
Length=433

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 127/258 (49%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S  A + V  Q             SY PV  +Q L++Y+H      WW +I   T
Sbjct  86    VPEVASGGAADVV--QCATELSFTELGLGSYTPVGLIQNLLEYIHVDLSLPWWGAIATCT  143

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  144   VLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKATIEMTRYQKK  203

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +           Q P+F+SFF+A+  MA   VPS + GG +WF DLT  D +Y+ P++
Sbjct  204   HDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYVLPLV  263

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ N     ++N+ R M  + +P T  FP AVF YW++SN+FSL
Sbjct  264   VTATMWCVLELGAETGVQSN-DLQFMRNIIRVMPLVVLPVTIHFPSAVFMYWLSSNVFSL  322

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  323   CQVACLRIPAVRTVLKIP  340



>ref|XP_004879917.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Heterocephalus 
glaber]
 ref|XP_004864259.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like isoform 
X2 [Heterocephalus glaber]
Length=436

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 128/256 (50%), Gaps = 6/256 (2%)
 Frame = +3

Query  399   EVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLL  578
             EV S +  + V  QA            SY PV  +Q L++++H   G  WW +I   T+L
Sbjct  93    EVASGETTDVV--QAAAELSFTELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAGCTVL  150

Query  579   IRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYK  752
              R L LPL+++  +  +K+    P++      ++   +A   A        M     ++ 
Sbjct  151   ARCLVLPLIVKGQREAAKIHNHVPEIQKFSARIREAKLAGDSAEFYRASMEMTAYQKKHG  210

Query  753   VSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTA  929
             +  F        Q PIF+SFF+A+  MA   VPS + GG +WF DLT  D M+I PV   
Sbjct  211   IKFFKPLILPLTQAPIFISFFIALREMANLPVPSMQTGGLWWFQDLTVSDPMFILPVAVT  270

Query  930   LTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSY  1109
              T W  +E  A+ GM+ +     ++NV R M  + +P T  FP  VF YW++SN+FSL+ 
Sbjct  271   ATMWGVLELGAETGMQSS-DLQWMRNVFRVMPLVVLPVTIHFPTGVFVYWLSSNLFSLAQ  329

Query  1110  GLVIKRPKVKKLLGVP  1157
                ++ P V+ +L +P
Sbjct  330   VSCLRIPAVRTVLKIP  345



>ref|XP_003967001.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Takifugu 
rubripes]
Length=664

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 122/229 (53%), Gaps = 6/229 (3%)
 Frame = +3

Query  483   YLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDD  662
             Y PV  +Q L++++H   G  WW +IV  T+L R    P++++  +  +KL  + P++  
Sbjct  349   YTPVGLIQNLLEFMHVDLGLPWWGAIVVGTVLARLAVFPVIVKGQREAAKLNNVLPEMTK  408

Query  663   IRQEMQNRGMAPAAVNEGQQRMKDLF---NEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
             +   M N         E  +   DL     ++ V+P   F    +Q PIF+SFF+A+  M
Sbjct  409   LTNRM-NEAKQSGNKFEFGKAYSDLTLFQKKHDVNPLRGFLVPLVQAPIFISFFIALRKM  467

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A   VPS + GG  WF DLT  D  YI P +   T +  +E  A+ G++ NP+   +K V
Sbjct  468   AYLPVPSLQTGGTLWFLDLTAADPFYILPFVVTGTMFFILELGAESGVD-NPNLRAMKTV  526

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              R M  + +P T +FP AVF YW+TSN FSL    +++ P V++   +P
Sbjct  527   FRIMPFIILPMTINFPTAVFTYWLTSNCFSLGQVALLRLPVVREKFNIP  575



>ref|XP_004421315.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Ceratotherium 
simum simum]
Length=436

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 129/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             ++EV S +  + V  QA      A     SY PV  +Q L++++H   G  WW +I   T
Sbjct  91    VTEVASGETADVV--QAAAEQSFAELGLGSYTPVGLIQNLLEFMHVNLGLPWWGAIAACT  148

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAP--AAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A        M     +
Sbjct  149   VLARCLVFPLIVKGQREAAKIHNHLPEIQKFSTRIREAKLAGDHAEFYRASSEMTLYQKK  208

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + V  F        Q PIF+SFF+A+  MA   VPS + GG FWF DLT  D  Y+ P++
Sbjct  209   HDVKLFRPLILPLTQAPIFISFFIALREMANLPVPSLQTGGLFWFQDLTLSDPTYMLPLV  268

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ GM+ +     ++N+ R M    +P T  FP AVF YW++SN+FSL
Sbjct  269   VTATMWGVLELGAETGMQSS-DVQWMRNLIRLMPLAVLPITIHFPSAVFMYWLSSNMFSL  327

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  328   GQVACLRIPAVRTVLKIP  345



>ref|XP_005711735.1| unnamed protein product [Chondrus crispus]
 emb|CDF32070.1| unnamed protein product [Chondrus crispus]
Length=409

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 115/221 (52%), Gaps = 12/221 (5%)
 Frame = +3

Query  510   LIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQ---EMQ  680
             L+  VH VTG  WW +I  +T+ IR L LP  +  ++ ++++  L+P +++ R    E  
Sbjct  122   LLHTVHDVTGLPWWLAIGVSTIAIRSLLLPATLMTMRNSARMTALKPDIEERRNVVMEAV  181

Query  681   NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFKE  860
               G  P A    Q+ M+D       +P     G  +Q P+F+SFF+ +  +++  P+F  
Sbjct  182   RSGDRPLAAKR-QKEMQDFMRNAGATPLKVLAGPLVQFPVFISFFVGLKRLSQSDPTFAT  240

Query  861   GGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEG---MEGNPSYGTIKNVSRAMAAL  1031
              GA WF DL++ D M++ PV+   +     E     G   M      G      R +AAL
Sbjct  241   EGAMWFIDLSSKDPMFVLPVVCGASLLAMTELGGDTGSTQMSKEMRLGM-----RCIAAL  295

Query  1032  SIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGV  1154
             S+P T  FP AVFCYWI +N+FS+  G  ++    +++LG+
Sbjct  296   SVPMTYWFPTAVFCYWIPNNVFSIMLGAALRTKPTRQMLGL  336



>ref|XP_005603270.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial inner membrane 
protein OXA1L-like [Equus caballus]
 ref|XP_008527180.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial inner membrane 
protein OXA1L [Equus przewalskii]
Length=483

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 130/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             ++EV S +  + V  QA      A     SY PV  +Q L++++H   G  WW +I   T
Sbjct  138   VTEVASGETADVV--QAAAEQSFAELGLGSYTPVGLIQNLLEFMHVNLGLPWWGAIAACT  195

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAP--AAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  196   VLARCLVFPLIVKGQREAAKIHNHLPEIQKFSTRIREAKLAGDHAEFYKASSEMTLYQKK  255

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + V  F        Q PIF+SFF+A+  MA   VPS + GG +WF DLT  D  Y+ P++
Sbjct  256   HDVKLFRPLILPLTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTLSDPTYVLPLV  315

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ GM+ +     ++NV R M    +P T  FP AVF YW++SN+FSL
Sbjct  316   VTATMWGVLELGAETGMQSS-DVQWMRNVIRLMPLAVLPITIHFPSAVFMYWLSSNMFSL  374

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  375   GQVACLRIPAVRTVLKIP  392



>ref|XP_005706414.1| preprotein translocase, Oxa1 family [Galdieria sulphuraria]
 gb|EME29894.1| preprotein translocase, Oxa1 family [Galdieria sulphuraria]
Length=413

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 121/220 (55%), Gaps = 6/220 (3%)
 Frame = +3

Query  507   YLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEM---  677
             YLI  +H  TG+ W+A +   T  IR + LPL +  L+ ++ L  L+P+L DI+ ++   
Sbjct  123   YLIHRLHEATGWPWFALLAGMTWSIRLMMLPLTLGSLRTSALLNSLQPQLKDIQDKISRA  182

Query  678   QNRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAEKVPSFK  857
             + RG +   V E  ++  ++    K +P  A      Q P+F++FF ++  +++  P+F 
Sbjct  183   KERGNS-EKVEEYNKKYMEILRVNKANPMKALFAPLAQTPVFIAFFFSLRKLSQIEPTFS  241

Query  858   EGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSI  1037
              GG  WFTDL+ PD  YI PV  +     T++   +       +  T  N+ R MA   I
Sbjct  242   SGGTLWFTDLSAPDPYYILPVACSSILLTTLQFGGETA--STATSRTAFNMMRLMALSII  299

Query  1038  PFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             PFT   P A+FCYW+ +N+FSL+  L+ K P V+K+L +P
Sbjct  300   PFTYQMPSALFCYWVPNNLFSLAQTLLFKVPTVRKVLKLP  339



>ref|XP_008285617.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Stegastes 
partitus]
Length=500

 Score =   141 bits (355),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 123/226 (54%), Gaps = 4/226 (2%)
 Frame = +3

Query  489   PVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIR  668
             PV  +Q L++Y+H   G  WW +IV  T+L R    P++++  +  +KL  + P++  + 
Sbjct  187   PVGLIQNLLEYMHMDLGLPWWGAIVAGTVLARLAVFPVIVKGQREAAKLNNVLPEMTKLT  246

Query  669   QEMQNRGMAPAAVNEGQQRMK-DLFNE-YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-  839
              +M     +       +   + +LF + + V+P   F    +Q P+F+SFF+A+  MA  
Sbjct  247   TKMTEAKQSGNKYEFAKAYSELNLFQKKHDVNPLRGFLVPLVQAPVFISFFIALRKMAYL  306

Query  840   KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRA  1019
              VP  + GG  WFTDLT  D  YI P     T +  +E  A+ G++ NP+   +K V R 
Sbjct  307   PVPGLQTGGLLWFTDLTAADPFYILPFAVTGTMFFILELGAESGID-NPNLRAMKTVFRI  365

Query  1020  MAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             M  + +P T +FP AVF YW+TSN FSL+   +++ P V++   +P
Sbjct  366   MPFIILPLTINFPTAVFTYWLTSNCFSLAQVALLRHPLVRQRFKIP  411



>emb|CCA19898.1| mitochondrial inner membrane protein OXA1 putative [Albugo laibachii 
Nc14]
Length=362

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 121/218 (56%), Gaps = 7/218 (3%)
 Frame = +3

Query  513   IDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGM  692
             + Y+H  TG  WWA+I  +T+++R + +   I+ ++  +KL +++PKL+ +++EM+    
Sbjct  97    LAYIHSTTGLPWWATIAVSTVIVRSVMIYPSIKGIRNAAKLKIIQPKLEKLKEEMEVGPR  156

Query  693   APAAVNEGQQRMKDLFNEYKVSPFSAFRGIFI---QGPIFVSFFLAISNMAEKVPSFKEG  863
              P  V + Q++ K L +   VS    FRG+++   Q P+F+ FF  +  + +   S KEG
Sbjct  157   TPEKVIDFQRKYKALMSANDVS---IFRGLYVPLFQIPMFLGFFWGLRELPKYYESCKEG  213

Query  864   GAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPF  1043
             GA WFTDL   D  YI PVL A    + VE  ++ G+  N     +K   R M+ L IPF
Sbjct  214   GALWFTDLGAADPTYILPVLNAALMLVAVETGSEGGLN-NDMRDKMKIGMRCMSVLMIPF  272

Query  1044  TASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             T  F   +F +WI SN  SL+   +++ P +   L +P
Sbjct  273   TMHFETGLFVFWIASNTCSLAQSAMLRIPSIMNALDIP  310



>gb|ETE62324.1| Mitochondrial inner membrane protein OXA1L, partial [Ophiophagus 
hannah]
Length=572

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/277 (32%), Positives = 144/277 (52%), Gaps = 19/277 (7%)
 Frame = +3

Query  342   MRNMSTSVGEGMNKIEYISEVLSDKAVEAV-----ASQapvvnevavaaaDSYLPVAALQ  506
             +R+ STS   G      + +  ++  VE +      SQ    + +A     S+ PV  + 
Sbjct  304   IRHQSTSAVAGTQ----VVQAAANAPVETILPLEEISQIAEESTLAELGLGSFSPVGLIM  359

Query  507   YLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNR  686
              +++ +H   G  WW +IV  TLL R L  P++++  +    L    P++ ++   + + 
Sbjct  360   KILESLHLDLGLPWWGAIVGGTLLARCLVFPIIVKCQQQAVNLNNHYPQMSEMNSRISD-  418

Query  687   GMAPAAVNEGQ-QRMKDLFNEYK----VSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVP  848
               A  + N+ +  R     N+Y+    ++P   F    +Q PIF+SFF A+  MAE  VP
Sbjct  419   --ARKSGNQKEFMRAYTELNQYQKVHNLNPKVGFLAPLVQMPIFISFFFALRKMAECPVP  476

Query  849   SFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAA  1028
             S + GG  WFTDLTT D  Y  P++T  +    +E  A+ G+  NPSY  +K V R +  
Sbjct  477   SMQTGGLLWFTDLTTSDPYYALPLITTASMLAVLELGAETGV-SNPSYHMMKTVFRVLPI  535

Query  1029  LSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVK  1139
             L +P T +FP A+F YW+TSN++SL   L+++ P V+
Sbjct  536   LLLPITINFPTAIFTYWLTSNLYSLGQVLLLRLPSVR  572


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 86/197 (44%), Gaps = 51/197 (26%)
 Frame = +3

Query  570   TLLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVNEGQQRMKDLFNEY  749
             T+ IR L  PL+++  +   +L    P++ ++           A +NE     K   N  
Sbjct  37    TVFIRCLVFPLIVKNQRDAIELNNHVPQITELT----------AKINEA----KKTGNRP  82

Query  750   KVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLT  926
             + S    F   + Q PIF+SFF A+  MAE  VPS + GG +WFTDLT  D  YI PV+ 
Sbjct  83    QYSRLDFFFPPWSQAPIFISFFFALRKMAECPVPSMQTGGLWWFTDLTAADPYYILPVMA  142

Query  927   ALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLS  1106
             ++T WI  E                                    A+F YW+TSN+FS+ 
Sbjct  143   SVTMWIVTE------------------------------------AIFTYWLTSNLFSIM  166

Query  1107  YGLVIKRPKVKKLLGVP  1157
               L+ + P  +    +P
Sbjct  167   QILLFRLPAARAFFHIP  183



>ref|XP_004389992.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Trichechus 
manatus latirostris]
Length=435

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 119/229 (52%), Gaps = 4/229 (2%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             SY PV  +Q L++++H   G  WW +I  +T+L R L  PL+I+  K  +K+    P++ 
Sbjct  118   SYTPVGLIQNLLEFMHVDLGLPWWGAIAASTVLARCLVFPLIIKGQKEAAKIHNHLPEIQ  177

Query  660   DIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
                  ++   +A   A        M     ++ V  F        Q PIF+SFF+A+  M
Sbjct  178   KFSTRIREAKLAGDQAEFYRACSEMTLYQKKHDVKLFRPLILPLTQAPIFLSFFIALREM  237

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A   VPS + GG +WF DLT  D  Y+ P++   T W  +E  A+ G++ +     ++NV
Sbjct  238   ANLPVPSLQTGGLWWFQDLTVSDPTYVLPLVVTATMWAVLELGAETGVQSS-DLQWMRNV  296

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              R M    +P T  FP AVF YW++SN+FSL     ++ P V+ +L +P
Sbjct  297   IRVMPLAVLPITIHFPSAVFMYWLSSNMFSLGQVACLRIPAVRTVLKIP  345



>ref|XP_002926062.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial inner membrane 
protein OXA1L-like [Ailuropoda melanoleuca]
Length=637

 Score =   142 bits (357),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 128/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S +  + V  QA            SY PV  +Q L++++H   G  WW +I   T
Sbjct  294   VPEVASGETADVV--QAAAEQSFTELGLGSYTPVGLIQNLLEFMHVNLGLPWWGAIAACT  351

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAP--AAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      M+   +A   A   +    M     +
Sbjct  352   ILARCLVFPLIVKGQREAAKIHNHLPEIQKFSTRMREAKLAGDHAEFYKASSEMTFYQKK  411

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             Y +  F        Q PIF+SFF+A+  MA   VPS + GG  WF DLT  D +Y+ P++
Sbjct  412   YDIKLFRPLILPLTQAPIFISFFIALREMANLPVPSLQTGGLLWFQDLTLSDPIYVLPLV  471

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ +     ++NV R M    +P T  FP AVF YW++SN+FSL
Sbjct  472   VTATMWGVLELGAETGVQSS-DLQWMRNVIRVMPLAVLPITIHFPTAVFMYWLSSNMFSL  530

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  531   VQVACLRVPAVRTILKIP  548



>ref|XP_009025059.1| hypothetical protein HELRODRAFT_114451 [Helobdella robusta]
 gb|ESN96932.1| hypothetical protein HELRODRAFT_114451 [Helobdella robusta]
Length=369

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 124/233 (53%), Gaps = 12/233 (5%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             S+ P   +QY ++ +H   G  WW++IV  T  +R +T PL++   +  + +    P   
Sbjct  77    SWYPNGLVQYGLESLHVGLGVPWWSAIVIGTFFLRLVTFPLVVLGQRNAANMHNYMP---  133

Query  660   DIRQEMQNRGMAPAAVNEGQQRMK---DLFN---EYKVSPFSAFRGIFIQGPIFVSFFLA  821
              I Q++QN+     +V    +  K    L+N   E  V+P       FIQ PIFVS F+ 
Sbjct  134   -IMQKLQNKFSKAKSVGNSLETAKAGAQLYNFMKENNVNPLKNMLVPFIQLPIFVSVFVG  192

Query  822   ISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGT  998
             I  MA   V S   GG  WFTDLT+PD  +I P++T LTF+ TVE    +G+  +    T
Sbjct  193   IRQMANLPVESMGSGGIAWFTDLTSPDPFFILPIMTTLTFYATVELGV-DGVRASTMTRT  251

Query  999   IKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             +K   R +  L +PFT +FP  +  YW+TSNIFSL   L +K   VK+ L +P
Sbjct  252   MKVFMRVLPFLIMPFTVNFPAGLLLYWLTSNIFSLIQVLFMKIDGVKRALKIP  304



>ref|XP_003755910.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Sarcophilus 
harrisii]
Length=441

 Score =   139 bits (351),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/265 (31%), Positives = 133/265 (50%), Gaps = 7/265 (3%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             ++EV+   A + V  QA     ++      Y PV  +Q  +++VH   G  WW +IV  T
Sbjct  95    VTEVVPAGAADVV--QAATEQSLSDLGLGGYTPVGLVQNFLEFVHVDLGLPWWGAIVTCT  152

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAPAAVN--EGQQRMKDLFNE  746
             ++ R L  PL+++  + T KL    PK+  +   M    ++   +        ++    +
Sbjct  153   VVARCLIFPLIVRGQRETIKLNNHLPKMQKLSTRMNEAKLSGDRMEFFRVASELQLYQKK  212

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + ++P   F     Q P+F+SFF+ +  M+   VPS + GG  WF DLT  D  Y  P++
Sbjct  213   HNINPLKGFIVPLAQAPVFLSFFIGLREMSSLPVPSMQNGGLLWFQDLTVADPTYALPLI  272

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                + W  +E  A+ G+  N S   +KN  R +  + +PFT +FP AVF YW +SN+FSL
Sbjct  273   VTASMWAILELGAETGVN-NASLRMMKNFFRVLPLVVLPFTINFPTAVFTYWFSSNLFSL  331

Query  1104  SYGLVIKRPKVKKLLGVPI-IPPAP  1175
                  ++ P V+  L +P  IPP P
Sbjct  332   VQVAFLQIPAVRIWLRIPKRIPPEP  356



>ref|XP_003420979.1| PREDICTED: mitochondrial inner membrane protein OXA1L [Loxodonta 
africana]
Length=437

 Score =   139 bits (351),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 116/229 (51%), Gaps = 4/229 (2%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             SY PV  +Q L+++ H   G  WW +I   T+L R L  PL+I+  +A +K+    P++ 
Sbjct  119   SYTPVGLIQNLLEFTHVNLGLPWWGAIAACTVLARCLVFPLIIKGQRAAAKIHNHLPEIQ  178

Query  660   DIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
                  +    +A   A        M     ++ V  F        Q P+F+SFF+A+  M
Sbjct  179   KFSTRISEAKLAGDQAEFYRASSEMTLYQKKHDVKLFRPLILPLTQAPVFISFFIALREM  238

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A   VPS + GG +WF DLT  D  Y+ P++   T W  +E  A  G++ +     ++NV
Sbjct  239   ANLPVPSLQTGGLWWFQDLTVSDPTYVLPLVVTATMWAVLELGADTGVQSS-DLRWMRNV  297

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              R M    +P T  FP AVF YW++SN+FSL     ++ P V+ +L +P
Sbjct  298   IRVMPLAVLPITIHFPSAVFMYWLSSNLFSLGQVACLRIPAVRTVLKIP  346



>ref|XP_008838134.1| PREDICTED: mitochondrial inner membrane protein OXA1L isoform 
X1 [Nannospalax galili]
Length=432

 Score =   139 bits (351),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 140/299 (47%), Gaps = 16/299 (5%)
 Frame = +3

Query  300   RKFSPPPW---AMAPIWMRNMSTSVGEGMNKIE-------YISEVLSDKAVEAVASQapv  449
             R    P W   A++P ++   S S  E   +          I EV S +  + V  QA  
Sbjct  44    RGCGRPHWVRTALSPRYLSTSSISFAEAQAQAPSVVPAAPAIPEVPSAETTDVV--QAAA  101

Query  450   vnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATS  629
                 +     SY PV  +Q L++++H   G  WW +I   T++ R L  PL+++  +  +
Sbjct  102   EQSFSELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIATCTVIARCLVFPLIVKGQREAA  161

Query  630   KLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIF  803
             K+    P++      ++   +A   A        M     ++ +  F        Q P+F
Sbjct  162   KIHNHLPEIQKFSTRIREAKLAGDHAEFYRASSEMTLYQKKHDIKLFRPLILPLTQAPVF  221

Query  804   VSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEG  980
             +SFF+A+  MA   VPS + GG  WF DLT  D +YI P++   T W  +E  A+ G++ 
Sbjct  222   ISFFIALREMANLPVPSLQTGGLLWFQDLTVSDPIYILPLVVTATMWAVLELGAETGVQS  281

Query  981   NPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             +     ++NV R M    +P T  FP AVF YW++SN+FSL     ++ P V+  L +P
Sbjct  282   S-DLQMMRNVIRVMPLAVLPVTIHFPSAVFMYWLSSNVFSLCQVACLRIPAVRTALKIP  339



>ref|XP_008838135.1| PREDICTED: mitochondrial inner membrane protein OXA1L isoform 
X2 [Nannospalax galili]
Length=430

 Score =   139 bits (351),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 140/299 (47%), Gaps = 16/299 (5%)
 Frame = +3

Query  300   RKFSPPPW---AMAPIWMRNMSTSVGEGMNKIE-------YISEVLSDKAVEAVASQapv  449
             R    P W   A++P ++   S S  E   +          I EV S +  + V  QA  
Sbjct  42    RGCGRPHWVRTALSPRYLSTSSISFAEAQAQAPSVVPAAPAIPEVPSAETTDVV--QAAA  99

Query  450   vnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATS  629
                 +     SY PV  +Q L++++H   G  WW +I   T++ R L  PL+++  +  +
Sbjct  100   EQSFSELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIATCTVIARCLVFPLIVKGQREAA  159

Query  630   KLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIF  803
             K+    P++      ++   +A   A        M     ++ +  F        Q P+F
Sbjct  160   KIHNHLPEIQKFSTRIREAKLAGDHAEFYRASSEMTLYQKKHDIKLFRPLILPLTQAPVF  219

Query  804   VSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEG  980
             +SFF+A+  MA   VPS + GG  WF DLT  D +YI P++   T W  +E  A+ G++ 
Sbjct  220   ISFFIALREMANLPVPSLQTGGLLWFQDLTVSDPIYILPLVVTATMWAVLELGAETGVQS  279

Query  981   NPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
             +     ++NV R M    +P T  FP AVF YW++SN+FSL     ++ P V+  L +P
Sbjct  280   S-DLQMMRNVIRVMPLAVLPVTIHFPSAVFMYWLSSNVFSLCQVACLRIPAVRTALKIP  337



>emb|CCG83137.1| Inner membrane protein oxa1-2 [Taphrina deformans PYCC 5710]
Length=676

 Score =   141 bits (356),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 131/235 (56%), Gaps = 10/235 (4%)
 Frame = +3

Query  483   YLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLDD  662
             Y P   LQ L+++VH  TGF W ASI   T++IR    PLM++ ++ TSKLA + P + +
Sbjct  122   YTPPGILQQLLEFVHISTGFAWIASIAVATVMIRVTLFPLMLKSIRNTSKLANINPMVKE  181

Query  663   IRQEMQ--NRGMAPAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM-  833
                ++   N+     A  + Q  ++ +F +  V+P  +   IFIQ P+F+ F+ A++ M 
Sbjct  182   HMAKLTQANKEGDKVAAAQAQLAVQKMFKDNGVNPLMSIVPIFIQMPVFIFFYYALNAMV  241

Query  834   AEKVPSFKEGGAFWFTDLTTPDSMYIFPV----LTALTFWITVECNAQEGMEGNPSYGTI  1001
             A  VP  + GG  WFTDLT  D  +I P+    +T + F I  E  A +G   NP+   +
Sbjct  242   ALPVPGMEVGGLLWFTDLTAADPRHILPLATSAMTLVNFEIGAEVGASQGTTMNPA---V  298

Query  1002  KNVSRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVPIIP  1166
             K V R +  L   FT +FP A+F YW TS++FSL  G + + P ++  L +P +P
Sbjct  299   KMVFRGVMLLMPFFTWNFPVAIFGYWFTSSLFSLVQGFMFRNPTIRARLDLPPMP  353



>ref|XP_006835521.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like [Chrysochloris 
asiatica]
Length=435

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 116/229 (51%), Gaps = 4/229 (2%)
 Frame = +3

Query  480   SYLPVAALQYLIDYVHCVTGFNWWASIVCTTLLIRWLTLPLMIQQLKATSKLALLRPKLD  659
             SY PV  +Q  +++ H   G  WW +I   T+L R L  P++++  +  +K+    P + 
Sbjct  118   SYTPVGLIQNFLEFAHVDLGLPWWGAIAACTVLARCLVFPIIVKGQREAAKIHNHLPAIQ  177

Query  660   DIRQEMQNRGMA--PAAVNEGQQRMKDLFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNM  833
                  ++   +A   A        M     ++ V  F        Q PIF+SFF+A+  M
Sbjct  178   KFSTRIREAKLAGDSAEFYRASSEMTLYQKKHDVKLFRPLILPLTQAPIFISFFIALREM  237

Query  834   AE-KVPSFKEGGAFWFTDLTTPDSMYIFPVLTALTFWITVECNAQEGMEGNPSYGTIKNV  1010
             A   VPS + GG  WF DLT  D +Y+ P++   T W  +E  A+ GM+ +     ++NV
Sbjct  238   ANLPVPSLQTGGLLWFQDLTVSDPIYVLPLIVTATMWGVLELGAETGMQSS-DLQWMRNV  296

Query  1011  SRAMAALSIPFTASFPKAVFCYWITSNIFSLSYGLVIKRPKVKKLLGVP  1157
              R M  + +P T  FP AVF YW++SN+FSL     ++ P V+ +L +P
Sbjct  297   IRVMPLVVLPITIHFPTAVFMYWLSSNLFSLGQVACLRIPAVRTVLKIP  345



>ref|XP_008708786.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial inner membrane 
protein OXA1L, partial [Ursus maritimus]
Length=508

 Score =   139 bits (351),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 127/258 (49%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S +  + +  QA            SY PV  +Q L++++H   G  WW +I   T
Sbjct  165   VPEVASGETTDVI--QAAAEQSFTELGLGSYTPVGLIQNLLEFMHVNLGLPWWGAIAACT  222

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  223   VLARCLVFPLIVKGQREAAKIHNHLPEIQKFSTRIREAKLAGDHAEFYKASSEMTVYQKK  282

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             Y +  F        Q PIF+SFF+A+  MA   VPS + GG  WF DLT  D  Y+ P++
Sbjct  283   YDIKLFRPLILPLTQAPIFISFFIALREMANLPVPSLQTGGLLWFQDLTLSDPTYVLPLI  342

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ +     ++NV R M    +P T  FP AVF YW++SN+FSL
Sbjct  343   VTATMWGVLELGAETGVQSS-DLQWMRNVIRVMPLAVLPITIHFPTAVFMYWLSSNMFSL  401

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  402   VQVACLRVPAVRTVLKIP  419



>gb|KFO27516.1| Mitochondrial inner membrane protein OXA1L [Fukomys damarensis]
Length=382

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 127/258 (49%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             + EV S +  + V  QA            SY PV  +Q L++++H   G  WW +I   T
Sbjct  37    VPEVASGETTDVV--QAAAEPSFTELGLGSYTPVGLIQNLLEFMHIDLGLPWWGAIAGCT  94

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMAP--AAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A   +    M     +
Sbjct  95    VLARCLVFPLIVKGQREAAKIHNHMPEIQKFSTRIREAKLAGDNAEFYKASIEMTAYQKK  154

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +  F        Q PIF+SFF+A+  MA   VPS + GG +WF DLT  D M+I PV 
Sbjct  155   HDIKFFRPLILPLTQAPIFISFFIALREMANLPVPSMQTGGLWWFQDLTVSDPMFILPVA  214

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ GM+ +  +  ++ V R M  +  P T  FP  VF YW+TSN+FSL
Sbjct  215   VTATMWGVLELGAETGMQSS-DFQWMRTVLRMMPLVVFPITIYFPTGVFVYWLTSNLFSL  273

Query  1104  SYGLVIKRPKVKKLLGVP  1157
             +    ++ P V+  L +P
Sbjct  274   TQVSCLRIPAVRTALKIP  291



>ref|XP_006776876.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like, partial 
[Myotis davidii]
Length=368

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 129/258 (50%), Gaps = 6/258 (2%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             ++EV S +  + V  QA      A     SY PV  +Q L++Y+H   G  WW +I   T
Sbjct  63    VTEVASGETADVV--QAAAEQSFAELGLGSYTPVGLIQNLMEYMHVDLGLPWWGAIALCT  120

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA--PAAVNEGQQRMKDLFNE  746
             +L R L  PL+++  +  +K+    P++      ++   +A   A        M     +
Sbjct  121   VLARCLVFPLIVKGQREAAKIHNHMPEIQKFSTRIREAKLAGDHAEFYRASSEMTLYQKK  180

Query  747   YKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYIFPVL  923
             + +  F        Q PIF+SFF+++  MA   VPS + GG +WF DLT  D  YI P++
Sbjct  181   HDIKLFKPLILPLTQAPIFISFFISLREMANLPVPSLQTGGLWWFQDLTLSDPTYILPMV  240

Query  924   TALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSNIFSL  1103
                T W  +E  A+ G++ +  +  ++NV R +    +P T  FP AVF YW +SN+FSL
Sbjct  241   VTATMWGVLELGAETGVQSSDLHW-MRNVMRVIPLAVLPITVHFPSAVFVYWFSSNMFSL  299

Query  1104  SYGLVIKRPKVKKLLGVP  1157
                  ++ P V+ +L +P
Sbjct  300   VQVSCLRIPGVRTMLKIP  317



>ref|XP_007479856.1| PREDICTED: mitochondrial inner membrane protein OXA1L-like isoform 
X2 [Monodelphis domestica]
Length=439

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/262 (32%), Positives = 135/262 (52%), Gaps = 14/262 (5%)
 Frame = +3

Query  393   ISEVLSDKAVEAVASQapvvnevavaaaDSYLPVAALQYLIDYVHCVTGFNWWASIVCTT  572
             ++EV+   A +AV  QA     ++      + PV  +Q L+++VH   G  WW +IV  T
Sbjct  95    VTEVVPGGAADAV--QAATEQSLSDLGLGGFTPVGLVQNLLEFVHVDLGLPWWGAIVTCT  152

Query  573   LLIRWLTLPLMIQQLKATSKLALLRPKLDDIRQEMQNRGMA------PAAVNEGQQRMKD  734
             ++ R +  PL+++  +   K+    P++      M    ++        A +E Q   K 
Sbjct  153   VVARIMIFPLIVKGQREAVKINNHMPEIQKFSTRMNEAKLSGDKFEFSRAFSELQLYQK-  211

Query  735   LFNEYKVSPFSAFRGIFIQGPIFVSFFLAISNMAE-KVPSFKEGGAFWFTDLTTPDSMYI  911
                ++ VSP   F     Q P+F+SFF+A+  MA   VPS + GG +WF DLT  D +Y 
Sbjct  212   ---KHDVSPLRGFIVPLAQAPVFISFFIALREMAYLPVPSMQNGGLWWFQDLTAADPLYA  268

Query  912   FPVLTALTFWITVECNAQEGMEGNPSYGTIKNVSRAMAALSIPFTASFPKAVFCYWITSN  1091
              P+L   + W  +E  A+ G+  N +   +K V R +  + +PFT +FP AVF YW +SN
Sbjct  269   LPLLVTASMWAILELGAETGVN-NANLRMMKTVFRVLPLIVLPFTINFPTAVFTYWFSSN  327

Query  1092  IFSLSYGLVIKRPKVKKLLGVP  1157
             +FSL+    ++ P V+  L +P
Sbjct  328   LFSLAQVSFLQIPAVRIWLRIP  349



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3804414986880