BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16210_g1_i2 len=1511 path=[1782:0-683 2466:684-754 140:755-1510]

Length=1511
                                                                      Score     E

ref|XP_009628224.1|  PREDICTED: transmembrane protein 106C              227   4e-67   
ref|XP_009786428.1|  PREDICTED: transmembrane protein 106C              214   3e-62   
emb|CDO98059.1|  unnamed protein product                                206   8e-59   
ref|XP_004235710.1|  PREDICTED: uncharacterized protein LOC101250488    203   5e-58   
ref|XP_006341680.1|  PREDICTED: uncharacterized protein LOC102589613    202   1e-57   
gb|EYU24694.1|  hypothetical protein MIMGU_mgv1a013752mg                185   2e-51   
ref|XP_011080841.1|  PREDICTED: uncharacterized protein LOC105164000    181   7e-50   
ref|XP_002279706.1|  PREDICTED: uncharacterized protein LOC100258307    177   3e-48   Vitis vinifera
gb|EPS63390.1|  hypothetical protein M569_11397                         173   6e-47   
ref|XP_011016017.1|  PREDICTED: uncharacterized protein LOC105119566    172   9e-47   
ref|XP_007024133.1|  Late embryogenesis abundant hydroxyproline-r...    167   1e-44   
ref|XP_007024135.1|  Late embryogenesis abundant hydroxyproline-r...    167   1e-44   
ref|XP_006381711.1|  hypothetical protein POPTR_0006s16220g             166   2e-44   
ref|XP_007024134.1|  Late embryogenesis abundant hydroxyproline-r...    167   2e-44   
gb|EYU21543.1|  hypothetical protein MIMGU_mgv1a013195mg                166   3e-44   
gb|KFK36217.1|  hypothetical protein AALP_AA4G093100                    165   6e-44   
emb|CDY42881.1|  BnaC08g46850D                                          164   2e-43   
ref|XP_006465533.1|  PREDICTED: uncharacterized protein LOC102615257    163   4e-43   
gb|EPS74475.1|  hypothetical protein M569_00286                         162   6e-43   
ref|XP_002863251.1|  hypothetical protein ARALYDRAFT_497058             162   9e-43   
ref|XP_010532848.1|  PREDICTED: uncharacterized protein LOC104808...    161   1e-42   
ref|XP_010532846.1|  PREDICTED: uncharacterized protein LOC104808...    162   1e-42   
ref|XP_006427015.1|  hypothetical protein CICLE_v10026444mg             161   2e-42   
emb|CBI28084.3|  unnamed protein product                                161   2e-42   
ref|XP_002284574.1|  PREDICTED: uncharacterized protein LOC100254347    160   2e-42   Vitis vinifera
ref|XP_009107688.1|  PREDICTED: uncharacterized protein LOC103833354    160   3e-42   
gb|KDP33657.1|  hypothetical protein JCGZ_07228                         160   3e-42   
ref|XP_007013199.1|  Late embryogenesis abundant (LEA) hydroxypro...    160   3e-42   
gb|KHG15162.1|  hth-type transcriptional regulator yid                  158   3e-41   
ref|NP_193063.2|  late embryogenesis abundant hydroxyproline-rich...    157   3e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CDY61168.1|  BnaA08g29800D                                          158   4e-41   
ref|XP_011072340.1|  PREDICTED: uncharacterized protein LOC105157619    154   4e-41   
ref|XP_004287097.1|  PREDICTED: uncharacterized protein LOC101303354    157   6e-41   
dbj|BAE99725.1|  hypothetical protein                                   155   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336930.1|  PREDICTED: uncharacterized protein LOC103929447    154   8e-40   
ref|XP_010527200.1|  PREDICTED: uncharacterized protein LOC104804584    153   2e-39   
ref|XP_006451136.1|  hypothetical protein CICLE_v10009328mg             152   2e-39   
ref|XP_008242614.1|  PREDICTED: transmembrane protein 106B              152   3e-39   
ref|XP_006451135.1|  hypothetical protein CICLE_v10009328mg             152   5e-39   
ref|XP_010254139.1|  PREDICTED: uncharacterized protein LOC104595218    152   5e-39   
ref|XP_006284513.1|  hypothetical protein CARUB_v10005713mg             151   8e-39   
ref|XP_004305294.1|  PREDICTED: uncharacterized protein LOC101294785    152   9e-39   
ref|XP_008463384.1|  PREDICTED: uncharacterized protein LOC103501551    151   9e-39   
ref|XP_007202533.1|  hypothetical protein PRUPE_ppa011027mg             151   1e-38   
ref|XP_004148717.1|  PREDICTED: uncharacterized protein LOC101219269    150   2e-38   
ref|XP_010062457.1|  PREDICTED: uncharacterized protein LOC104449866    150   2e-38   
ref|XP_010249767.1|  PREDICTED: uncharacterized protein LOC104592233    151   2e-38   
ref|XP_006414934.1|  hypothetical protein EUTSA_v10026222mg             149   3e-38   
ref|XP_007024140.1|  Late embryogenesis abundant hydroxyproline-r...    148   3e-38   
ref|XP_008386536.1|  PREDICTED: uncharacterized protein LOC103449036    149   5e-38   
ref|XP_010435290.1|  PREDICTED: uncharacterized protein LOC104719134    149   6e-38   
ref|XP_010450318.1|  PREDICTED: uncharacterized protein LOC104732466    149   6e-38   
ref|XP_008367874.1|  PREDICTED: uncharacterized protein LOC103431496    148   8e-38   
ref|XP_010440608.1|  PREDICTED: uncharacterized protein LOC104723875    147   1e-37   
ref|XP_010088829.1|  hypothetical protein L484_020812                   149   2e-37   
ref|XP_008779021.1|  PREDICTED: uncharacterized protein LOC103698755    147   2e-37   
gb|KHG14734.1|  Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase...    147   2e-37   
ref|XP_008801697.1|  PREDICTED: uncharacterized protein LOC103715738    147   3e-37   
ref|XP_002304190.2|  hypothetical protein POPTR_0003s05380g             143   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011001617.1|  PREDICTED: uncharacterized protein LOC105108...    144   3e-36   
ref|XP_011001618.1|  PREDICTED: uncharacterized protein LOC105108...    144   3e-36   
ref|XP_011001616.1|  PREDICTED: uncharacterized protein LOC105108...    145   4e-36   
emb|CDX87901.1|  BnaC06g09630D                                          142   9e-36   
ref|XP_009347170.1|  PREDICTED: uncharacterized protein LOC103938851    142   1e-35   
emb|CAN72107.1|  hypothetical protein VITISV_044045                     142   2e-35   Vitis vinifera
ref|XP_010907059.1|  PREDICTED: uncharacterized protein LOC105033825    142   2e-35   
ref|XP_010937299.1|  PREDICTED: uncharacterized protein LOC105056...    142   3e-35   
ref|XP_010937311.1|  PREDICTED: uncharacterized protein LOC105056...    141   4e-35   
ref|XP_009374010.1|  PREDICTED: uncharacterized protein LOC103962955    141   4e-35   
ref|XP_002299644.2|  hypothetical protein POPTR_0001s18090g             140   5e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010937290.1|  PREDICTED: uncharacterized protein LOC105056...    141   5e-35   
ref|XP_009144850.1|  PREDICTED: uncharacterized protein LOC103868509    139   9e-35   
ref|XP_003534194.1|  PREDICTED: uncharacterized protein LOC100793858    140   2e-34   
ref|XP_007216392.1|  hypothetical protein PRUPE_ppa021471mg             138   6e-34   
ref|XP_008342697.1|  PREDICTED: uncharacterized protein LOC103405...    137   7e-34   
ref|XP_002466626.1|  hypothetical protein SORBIDRAFT_01g011230          137   7e-34   Sorghum bicolor [broomcorn]
ref|XP_008342696.1|  PREDICTED: uncharacterized protein LOC103405...    137   7e-34   
ref|XP_011032795.1|  PREDICTED: uncharacterized protein LOC105131...    137   9e-34   
ref|XP_002514321.1|  conserved hypothetical protein                     140   9e-34   Ricinus communis
ref|XP_011032794.1|  PREDICTED: uncharacterized protein LOC105131...    137   1e-33   
ref|XP_010098050.1|  hypothetical protein L484_026181                   135   1e-33   
ref|XP_002891688.1|  hypothetical protein ARALYDRAFT_474353             136   2e-33   
ref|XP_008228515.1|  PREDICTED: uncharacterized protein LOC103327919    135   2e-33   
gb|KDO51223.1|  hypothetical protein CISIN_1g027729mg                   135   3e-33   
ref|XP_009413332.1|  PREDICTED: uncharacterized protein LOC103994657    135   6e-33   
ref|NP_175643.1|  late embryogenesis abundant hydroxyproline-rich...    134   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KHF99951.1|  Transmembrane protein                                   133   1e-32   
ref|XP_010033883.1|  PREDICTED: uncharacterized protein LOC104423118    134   1e-32   
gb|KCW53735.1|  hypothetical protein EUGRSUZ_J02990                     134   1e-32   
ref|XP_006305590.1|  hypothetical protein CARUB_v10010254mg             134   1e-32   
ref|XP_007013200.1|  Late embryogenesis abundant hydroxyproline-r...    134   2e-32   
ref|XP_010500832.1|  PREDICTED: uncharacterized protein LOC104778155    132   3e-32   
emb|CAB40762.1|  hypothetical protein                                   131   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007152822.1|  hypothetical protein PHAVU_004G162700g             133   5e-32   
ref|XP_004486731.1|  PREDICTED: uncharacterized protein LOC101505...    130   1e-31   
ref|XP_004486730.1|  PREDICTED: uncharacterized protein LOC101505...    130   1e-31   
ref|XP_006392931.1|  hypothetical protein EUTSA_v10011771mg             131   1e-31   
ref|XP_010462071.1|  PREDICTED: uncharacterized protein LOC104742737    131   1e-31   
gb|AII99859.1|  late embryogenesis abundant protein                     130   1e-31   
ref|XP_004486729.1|  PREDICTED: uncharacterized protein LOC101505...    130   2e-31   
ref|XP_010479741.1|  PREDICTED: uncharacterized protein LOC104758554    129   4e-31   
gb|KDP37212.1|  hypothetical protein JCGZ_06268                         129   6e-31   
ref|NP_001050978.1|  Os03g0696000                                       129   8e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006595136.1|  PREDICTED: uncharacterized protein LOC100792375    128   1e-30   
ref|XP_009418806.1|  PREDICTED: uncharacterized protein LOC103998921    129   1e-30   
ref|XP_010688185.1|  PREDICTED: uncharacterized protein LOC104902184    127   1e-30   
gb|ACG33974.1|  hypothetical protein                                    128   2e-30   Zea mays [maize]
ref|XP_003560997.1|  PREDICTED: uncharacterized protein LOC100825061    127   2e-30   
ref|XP_008665007.1|  PREDICTED: hypothetical protein isoform X1         127   2e-30   
ref|XP_010545724.1|  PREDICTED: uncharacterized protein LOC104817997    127   3e-30   
ref|XP_008644593.1|  PREDICTED: uncharacterized protein LOC100273513    126   7e-30   
ref|XP_010049704.1|  PREDICTED: uncharacterized protein LOC104438290    126   9e-30   
ref|XP_009417167.1|  PREDICTED: uncharacterized protein LOC103997...    125   3e-29   
ref|XP_009417166.1|  PREDICTED: uncharacterized protein LOC103997...    125   3e-29   
ref|XP_003597772.1|  hypothetical protein MTR_2g102080                  122   5e-29   
ref|XP_002516077.1|  conserved hypothetical protein                     123   7e-29   Ricinus communis
gb|KCW69598.1|  hypothetical protein EUGRSUZ_F03017                     122   7e-29   
gb|AES68023.2|  late embryogenesis abundant protein                     122   8e-29   
gb|KEH27093.1|  late embryogenesis abundant protein                     124   1e-28   
ref|XP_003529998.2|  PREDICTED: uncharacterized protein LOC100775891    122   2e-28   
ref|XP_010937278.1|  PREDICTED: uncharacterized protein LOC105056680    122   2e-28   
dbj|BAJ98808.1|  predicted protein                                      122   3e-28   
ref|XP_010497631.1|  PREDICTED: uncharacterized protein LOC104774984    119   5e-28   
ref|XP_007024137.1|  Late embryogenesis abundant hydroxyproline-r...    117   2e-27   
ref|XP_007150661.1|  hypothetical protein PHAVU_005G171000g             118   3e-27   
ref|XP_004512968.1|  PREDICTED: uncharacterized protein LOC101515080    119   3e-27   
ref|XP_010694099.1|  PREDICTED: uncharacterized protein LOC104906954    118   4e-27   
ref|XP_007024139.1|  Late embryogenesis abundant hydroxyproline-r...    116   5e-27   
ref|XP_004982101.1|  PREDICTED: uncharacterized protein LOC101764044    117   7e-27   
ref|XP_008777264.1|  PREDICTED: uncharacterized protein LOC103697223    117   8e-27   
gb|ABK22511.1|  unknown                                                 115   4e-26   Picea sitchensis
ref|XP_006859125.1|  hypothetical protein AMTR_s00070p00082830          115   3e-25   
gb|KFK35787.1|  hypothetical protein AALP_AA4G036600                    110   3e-25   
ref|NP_001077704.1|  late embryogenesis abundant hydroxyproline-r...    111   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004506853.1|  PREDICTED: uncharacterized protein LOC101490...    109   3e-24   
gb|ABK23452.1|  unknown                                                 108   3e-23   Picea sitchensis
ref|XP_007135691.1|  hypothetical protein PHAVU_010G150300g             103   4e-22   
gb|AAO19373.1|  hypothetical protein                                    104   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665013.1|  PREDICTED: hypothetical protein isoform X2         102   3e-21   
ref|NP_001136584.1|  hypothetical protein                               101   4e-21   Zea mays [maize]
gb|KHG13960.1|  tRNA modification GTPase MnmE                         99.8    6e-21   
ref|XP_006585593.1|  PREDICTED: uncharacterized protein LOC100815...  99.4    2e-20   
gb|ABK21986.1|  unknown                                               92.8    2e-18   Picea sitchensis
ref|XP_003604446.1|  hypothetical protein MTR_4g012450                93.2    4e-18   
gb|KHN32607.1|  hypothetical protein glysoja_022289                   90.5    7e-18   
ref|XP_004506854.1|  PREDICTED: uncharacterized protein LOC101490...  91.3    1e-17   
ref|XP_003531681.1|  PREDICTED: uncharacterized protein LOC100815...  90.1    3e-17   
gb|EEC75999.1|  hypothetical protein OsI_13134                        88.6    5e-17   Oryza sativa Indica Group [Indian rice]
gb|EEE59744.1|  hypothetical protein OsJ_12210                        86.3    5e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651720.1|  PREDICTED: uncharacterized protein LOC102705061  83.2    1e-15   
dbj|BAJ86713.1|  predicted protein                                    84.0    1e-14   
ref|XP_010228236.1|  PREDICTED: uncharacterized protein LOC100842709  82.0    5e-14   
gb|AII99863.1|  late embryogenesis abundant protein                   77.8    2e-13   
ref|XP_001778135.1|  predicted protein                                75.5    5e-12   
ref|XP_002983453.1|  hypothetical protein SELMODRAFT_422757           72.4    5e-11   
gb|EMT09918.1|  hypothetical protein F775_19204                       71.6    1e-10   
ref|XP_002974039.1|  hypothetical protein SELMODRAFT_414233           71.2    1e-10   
ref|XP_004955793.1|  PREDICTED: uncharacterized protein LOC101756814  70.9    2e-10   
ref|XP_010322682.1|  PREDICTED: uncharacterized protein LOC104648055  67.8    3e-10   
dbj|BAJ94476.1|  predicted protein                                    70.5    3e-10   
ref|XP_006356160.1|  PREDICTED: uncharacterized protein LOC102579994  63.9    5e-09   
ref|NP_001059155.1|  Os07g0206800                                     65.9    8e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009786429.1|  PREDICTED: uncharacterized protein LOC104234552  63.5    9e-09   
ref|XP_002461671.1|  hypothetical protein SORBIDRAFT_02g006180        65.5    1e-08   Sorghum bicolor [broomcorn]
gb|EEC81715.1|  hypothetical protein OsI_25326                        65.5    2e-08   Oryza sativa Indica Group [Indian rice]
gb|EAZ39074.1|  hypothetical protein OsJ_23504                        65.9    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001136794.1|  hypothetical protein                             63.2    7e-08   Zea mays [maize]
ref|NP_001144261.1|  uncharacterized protein LOC100277135             63.2    9e-08   Zea mays [maize]
gb|ACG40692.1|  hypothetical protein                                  61.6    2e-07   Zea mays [maize]
ref|XP_007013201.1|  Uncharacterized protein TCM_037899               59.7    2e-07   
ref|XP_009628211.1|  PREDICTED: uncharacterized protein LOC104118631  59.3    3e-07   
ref|XP_001758636.1|  predicted protein                                60.1    5e-07   
ref|XP_003629642.1|  hypothetical protein MTR_8g083460                57.8    8e-07   
ref|XP_006664899.1|  PREDICTED: uncharacterized protein LOC102714338  58.2    1e-06   
ref|XP_006381709.1|  hypothetical protein POPTR_0006s16210g           55.5    5e-06   
gb|ABK25772.1|  unknown                                               55.5    6e-06   Picea sitchensis
ref|XP_002324414.1|  hypothetical protein POPTR_0018s05880g           55.1    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007140030.1|  hypothetical protein PHAVU_008G078400g           55.8    1e-05   
ref|XP_006465532.1|  PREDICTED: uncharacterized protein LOC102614963  53.9    2e-05   
gb|ADP02176.1|  hypothetical protein 1E5.1                            56.6    3e-05   
ref|XP_010923414.1|  PREDICTED: uncharacterized protein LOC105046513  52.8    4e-05   
gb|KDP33658.1|  hypothetical protein JCGZ_07229                       52.4    5e-05   
ref|XP_002514322.1|  conserved hypothetical protein                   52.4    6e-05   Ricinus communis
tpg|DAA48645.1|  TPA: hypothetical protein ZEAMMB73_005874            53.1    7e-05   
ref|XP_009347169.1|  PREDICTED: uncharacterized protein LOC103938850  52.0    1e-04   
gb|EPS66146.1|  hypothetical protein M569_08632                       52.8    1e-04   
ref|XP_010249769.1|  PREDICTED: uncharacterized protein LOC104592234  51.6    1e-04   
ref|XP_004503417.1|  PREDICTED: uncharacterized protein LOC101489104  51.2    1e-04   
ref|XP_006846191.1|  hypothetical protein AMTR_s00012p00214100        51.6    1e-04   
ref|XP_009395975.1|  PREDICTED: uncharacterized protein LOC103981098  52.4    2e-04   
ref|XP_003574930.1|  PREDICTED: uncharacterized protein LOC100825530  52.0    2e-04   
gb|ABR17408.1|  unknown                                               51.6    2e-04   Picea sitchensis
ref|XP_006451138.1|  hypothetical protein CICLE_v10010038mg           50.8    2e-04   
gb|KGN45357.1|  hypothetical protein Csa_7G446750                     50.4    2e-04   
ref|XP_008386523.1|  PREDICTED: uncharacterized protein LOC103449029  50.8    3e-04   
gb|KGN65356.1|  hypothetical protein Csa_1G369510                     50.4    3e-04   
ref|XP_001778238.1|  predicted protein                                51.6    3e-04   
ref|XP_009394853.1|  PREDICTED: uncharacterized protein LOC103980249  51.6    4e-04   
ref|XP_002445681.1|  hypothetical protein SORBIDRAFT_07g024160        51.2    4e-04   Sorghum bicolor [broomcorn]
ref|XP_007152821.1|  hypothetical protein PHAVU_004G162600g           49.3    5e-04   
ref|XP_008788146.1|  PREDICTED: uncharacterized protein LOC103705995  51.2    6e-04   
gb|EYU24693.1|  hypothetical protein MIMGU_mgv1a018247mg              49.3    7e-04   
gb|KHN20688.1|  hypothetical protein glysoja_019005                   48.9    7e-04   
gb|KCW79696.1|  hypothetical protein EUGRSUZ_C01049                   48.9    8e-04   



>ref|XP_009628224.1| PREDICTED: transmembrane protein 106C [Nicotiana tomentosiformis]
Length=220

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 176/227 (78%), Gaps = 12/227 (5%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPA---EPQTPQYIIVLPNYYRSHSYISRTCRRRLIY  262
            MTSS+ SDP PP+       + PLP     PQ PQYIIVLP+YYRS   + R   RR IY
Sbjct  1    MTSSKFSDP-PPTL------YDPLPTYPLPPQQPQYIIVLPHYYRSPRQLLRVACRRYIY  53

Query  263  SAGllllavav-flIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSV  436
            SA +L+L  A  F +WPSDP VS+ARL LR  ++H FP  +LD+ LD+ V+++N+DFYSV
Sbjct  54   SAAVLILLAAAVFFLWPSDPDVSIARLHLRHLKIHTFPKIALDVTLDVTVRIRNKDFYSV  113

Query  437  DYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGS  616
            ++ ++ V+I YR K+LGYVTS+ G ++ARASSYINATL+L  + I +D++PLIED+ARGS
Sbjct  114  NFRSVAVAIGYRGKQLGYVTSDYGKIRARASSYINATLELNDISIFSDIIPLIEDLARGS  173

Query  617  VTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            +TFDTVT+I G+LGLFL D+P++GKVSCEIVV+T+NETISHQNCYPE
Sbjct  174  ITFDTVTQIGGELGLFLFDIPIKGKVSCEIVVDTRNETISHQNCYPE  220



>ref|XP_009786428.1| PREDICTED: transmembrane protein 106C [Nicotiana sylvestris]
Length=220

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 175/227 (77%), Gaps = 12/227 (5%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPA---EPQTPQYIIVLPNYYRSHSYISRTCRRRLIY  262
            MTSS+ SDP P         + PLP     PQ PQYIIVLP+YYRS   + R   RR IY
Sbjct  1    MTSSKFSDPSPTP-------YDPLPTYPQPPQQPQYIIVLPHYYRSPRQLLRVACRRYIY  53

Query  263  SAGllllavav-flIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSV  436
            SA +L+L  A  F +WPSDP VS+ARL+LR  ++H FP  +LD+ LD+ V+++N+DFYSV
Sbjct  54   SAAVLILLAAAVFFLWPSDPDVSIARLRLRHLKIHTFPKIALDVTLDVTVRIRNKDFYSV  113

Query  437  DYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGS  616
            ++ ++ V+I YR K+LGYVTS+ G ++ARASSYINATL+L  + I +D++PLIED+ARGS
Sbjct  114  NFRSVAVAIGYRGKQLGYVTSDYGKIRARASSYINATLELNDISIFSDIIPLIEDLARGS  173

Query  617  VTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            +TFDTVT+I G+LGLFL D+P++GKVSCEIVV+T++ETISHQNCYPE
Sbjct  174  ITFDTVTQIGGELGLFLFDIPIKGKVSCEIVVDTRSETISHQNCYPE  220



>emb|CDO98059.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 166/230 (72%), Gaps = 8/230 (3%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQ----YIIVLPNYY---RSHSYISRTCRR  250
            MTSS+ SD  P S    + Y+  LP++P        YII+LP YY   R   ++SRT RR
Sbjct  1    MTSSKRSDDAPLSPRFPQSYYQQLPSDPHQQPQQPQYIILLPRYYNNRRPRLHLSRTWRR  60

Query  251  RLIYSAGllllavavflIWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDF  427
             LI    L+LL +AVFL+WPSDP VS+ RL+L    +H FP PS+DI LD+ VK++NRDF
Sbjct  61   CLICLLTLVLLGLAVFLLWPSDPEVSIVRLRLDHLGIHLFPIPSVDITLDVTVKIRNRDF  120

Query  428  YSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVA  607
            +S+DY +L+V+I YR K+LGY TS+ G++KAR SSY+NAT+ L GV I++D+L LIED+A
Sbjct  121  FSIDYKSLIVAIGYRGKQLGYATSDHGNIKARGSSYVNATVHLSGVNILSDMLLLIEDLA  180

Query  608  RGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
             G +TFDT T+I GQLGL   ++PLQGKVSCEI VN  N+TI HQNCYPE
Sbjct  181  TGEITFDTDTKIGGQLGLAFFEIPLQGKVSCEINVNIHNQTIEHQNCYPE  230



>ref|XP_004235710.1| PREDICTED: uncharacterized protein LOC101250488 [Solanum lycopersicum]
Length=221

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 154/192 (80%), Gaps = 2/192 (1%)
 Frame = +2

Query  188  YIIVLPNYYRS-HSYISRTCRRRLIYSAGllllavavflIWPSDPGVSVARLKLRGFRVH  364
            YIIVLP YYR+   ++ R  RR +  +A  +LL+ A+FLIWPSDP +S+ARLKLR  +VH
Sbjct  30   YIIVLPQYYRTPRQFLRRPTRRYVCCAAVFILLSAALFLIWPSDPELSIARLKLRHLKVH  89

Query  365  PFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYIN  541
             FP  ++D+ LD+  K++N+DFYSV +  +V+SI YR K+LG+V S+ G +KARASSY+N
Sbjct  90   SFPKIAIDVTLDVTAKIRNKDFYSVGFRYVVISIGYRGKQLGHVISDYGRIKARASSYVN  149

Query  542  ATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTK  721
            ATL+L  V I +D++PLIED+ARGS+TFDTVT+I G+LGL L D+P++GKV CEIVV+T+
Sbjct  150  ATLELTDVSIFSDLIPLIEDLARGSITFDTVTQIGGELGLVLFDIPIKGKVVCEIVVDTR  209

Query  722  NETISHQNCYPE  757
            NETISHQNCYPE
Sbjct  210  NETISHQNCYPE  221



>ref|XP_006341680.1| PREDICTED: uncharacterized protein LOC102589613 [Solanum tuberosum]
Length=221

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 154/192 (80%), Gaps = 2/192 (1%)
 Frame = +2

Query  188  YIIVLPNYYRS-HSYISRTCRRRLIYSAGllllavavflIWPSDPGVSVARLKLRGFRVH  364
            YIIVLP YYR+   ++ R  RR +  +A  +LL+ A+F +WPSDP +S+ARLKLR  +VH
Sbjct  30   YIIVLPQYYRTPRQFLRRPTRRYVYCAAVFILLSAALFFLWPSDPELSIARLKLRHLKVH  89

Query  365  PFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYIN  541
             FP  ++D+ LD+  K++N+DFYSV++  +V+SI YR K+LG+V S+ G +KARASSY+N
Sbjct  90   SFPKIAIDVTLDVTAKIRNKDFYSVNFRYVVISIGYRGKQLGHVISDYGRIKARASSYVN  149

Query  542  ATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTK  721
            ATL+L  + I +D++PLIED+ARGS+TFDTVT+I G+LGL L D+P++GKV CEIVV+T+
Sbjct  150  ATLELTDISIFSDLIPLIEDLARGSITFDTVTQIGGELGLVLFDIPIKGKVVCEIVVDTR  209

Query  722  NETISHQNCYPE  757
            NETISHQNCYPE
Sbjct  210  NETISHQNCYPE  221



>gb|EYU24694.1| hypothetical protein MIMGU_mgv1a013752mg [Erythranthe guttata]
Length=211

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = +2

Query  176  QTPQYIIVLPNY---YRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSVARLKL  346
            QTPQY++VLP Y   YR         RR + +SA  L L  AV+L+WPSDP +SV R+ L
Sbjct  13   QTPQYVVVLPAYLPPYRQRLLRKLHRRRLICFSAVFLFLISAVYLVWPSDPELSVVRMSL  72

Query  347  RGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKAR  523
                 H  P  SLD+ LDL +KV+NRD YS+DY++L+V++ YR + LG +TSE GH++AR
Sbjct  73   NRLHFHTRPKISLDVTLDLRLKVRNRDVYSMDYDSLLVAVGYRGESLGNITSEGGHIRAR  132

Query  524  ASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCE  703
             SSY+NATL + GVE+++DV+ L+ED+A GS+TFDTV+EI G+LGLF  +LPL+ K+SCE
Sbjct  133  GSSYVNATLDVDGVEMLSDVILLLEDLAAGSITFDTVSEIGGKLGLFFFELPLKAKISCE  192

Query  704  IVVNTKNETISHQNCYPE  757
            ++VNT+N TI+ QNCYPE
Sbjct  193  VIVNTRNSTITRQNCYPE  210



>ref|XP_011080841.1| PREDICTED: uncharacterized protein LOC105164000 [Sesamum indicum]
Length=222

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 154/230 (67%), Gaps = 17/230 (7%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQT-----PQYIIVLPNYYRSHSYISRT--CRR  250
            MT+ +H D           Y  PL +EPQ      PQY+IVLP Y   +    R   C  
Sbjct  1    MTAVKHPD--------TASYGQPLLSEPQASYSQPPQYVIVLPPYLPPYRRRVRREPCWG  52

Query  251  RLIYSAGllllavavf-lIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRD  424
            RLI  A +LL+ VA   L+WPSDP +SV RL L        P  SLD+ LD  +KV+N+D
Sbjct  53   RLICCAAVLLILVAAGYLLWPSDPELSVVRLNLDRLHFDTRPQISLDLTLDTTIKVRNKD  112

Query  425  FYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDV  604
            FYS+DY++L+V I YR +RLG +TS+ GH++AR SSY+N+TLQL  VE+++D + L+ED+
Sbjct  113  FYSLDYDSLIVGIGYRGRRLGLMTSDGGHIRARGSSYLNSTLQLDAVEMLSDAILLLEDL  172

Query  605  ARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYP  754
            ARGS+TFDTV+E SG+L +F   +PL+ K+ CE+VVNT+N+TI+H +C+P
Sbjct  173  ARGSITFDTVSETSGKLRIFFFHVPLKAKIMCEVVVNTRNQTITHHSCHP  222



>ref|XP_002279706.1| PREDICTED: uncharacterized protein LOC100258307 [Vitis vinifera]
Length=237

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 146/208 (70%), Gaps = 5/208 (2%)
 Frame = +2

Query  140  QERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRR-RLIYSAGllllavavflIWPSD  316
            Q  Y+ P+P+ P + +  +VLP Y      + R C R RL+ +A +LLL  + F++WPSD
Sbjct  33   QLPYYTPVPSHPASERNYVVLPLYI---PLLHRRCNRFRLLTAASVLLLVASTFVLWPSD  89

Query  317  PGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYV  493
            P VS+ RL+LR   VH FP  SLD+ + L+VKV+N D YS++Y +L V+I YR K LG V
Sbjct  90   PDVSIVRLRLRRIAVHTFPRLSLDVSMSLMVKVRNVDLYSMNYRSLHVAIEYRGKELGNV  149

Query  494  TSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflld  673
            TSEEGH++AR SS ++A+L+L GV +++DV+ ++ED+A+G++  DTVTE+ G +G     
Sbjct  150  TSEEGHVRARGSSLVDASLELNGVAVLSDVIFVLEDLAKGTIPIDTVTEVRGSMGFLFFQ  209

Query  674  lplqgKVSCEIVVNTKNETISHQNCYPE  757
            LPL+ KVSC++ VNT  + + HQNCYPE
Sbjct  210  LPLRTKVSCQVYVNTNTQKVLHQNCYPE  237



>gb|EPS63390.1| hypothetical protein M569_11397, partial [Genlisea aurea]
Length=201

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 136/197 (69%), Gaps = 5/197 (3%)
 Frame = +2

Query  182  PQYIIVLPNYY-RSHSYISRTCRRRLIYSAGllllavavfl---IWPSDPGVSVARLKLR  349
            PQY++VLP Y      +   + RRRL + A ++L   A       WPSDP + ++ LKL 
Sbjct  4    PQYVVVLPPYRPAGRRFFRASTRRRLCWFACVVLFLAAASAAYVFWPSDPELLISDLKLD  63

Query  350  GFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARA  526
                H  P  SLD+ LDL ++V+NRDFYS++Y++LVV+I YR +RLG+ TS  G ++AR 
Sbjct  64   RLGFHTKPVISLDVTLDLTIQVRNRDFYSIEYDSLVVAIEYRGRRLGFATSGGGRIRARG  123

Query  527  SSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEI  706
            SSY+NATL L  VE++TD + L+ED ARG++ FDTV+EI G++ LF L LP++ KVSCE 
Sbjct  124  SSYVNATLDLDAVEMLTDAVSLLEDFARGAIEFDTVSEIHGKIALFALQLPVKAKVSCEA  183

Query  707  VVNTKNETISHQNCYPE  757
             VNTK++ ++ QNCYPE
Sbjct  184  TVNTKSQIVTSQNCYPE  200



>ref|XP_011016017.1| PREDICTED: uncharacterized protein LOC105119566 [Populus euphratica]
Length=210

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +2

Query  161  LPAEPQT-PQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSVAR  337
            LP+ P + PQ +IVL  YYR  ++I R C   L+++  +L L+ A +L++PSDP + ++R
Sbjct  13   LPSHPDSYPQNVIVLSYYYRPPNHILRRC---LLFTTAILFLSAAAYLLYPSDPAIQLSR  69

Query  338  LKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHL  514
            +KL   RV+  P  +LD+   L +KV+NRDF+S+DY++LVVS+ YR + LG+V S+ G +
Sbjct  70   IKLNHIRVNSSPELTLDVSFSLTIKVENRDFFSLDYDSLVVSVGYRGRELGFVNSKGGKI  129

Query  515  KARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKV  694
            +AR SSY++A L L G+E+I DV  LI+D+ARG + FDT T++ G LGL L  +P+ G+V
Sbjct  130  RARRSSYVDARLDLNGLEVIKDVFYLIQDLARGVIIFDTNTQVEGDLGLLLFKIPINGRV  189

Query  695  SCEIVVNTKNETISHQNCYPE  757
            SC++ VNT N+T+ HQ+CYP+
Sbjct  190  SCQVFVNTNNQTVEHQDCYPQ  210



>ref|XP_007024133.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY26755.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 1 [Theobroma cacao]
Length=220

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 143/203 (70%), Gaps = 6/203 (3%)
 Frame = +2

Query  149  YFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVS  328
            YF  LP++P    Y+ VLP YYR      R C  R++ +A L+LLA +V++ WPSDP V 
Sbjct  21   YFTALPSQPPDQNYL-VLP-YYRP---TLRWCGCRILCTASLVLLATSVYIFWPSDPEVK  75

Query  329  VARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEE  505
            + R+ +   ++H  P  +LDI L + +KV+N D YSVD+ +L V++ YR K LG+VTSE 
Sbjct  76   IVRMHVDRMQLHTIPIIALDISLLVTLKVRNSDVYSVDFTSLDVAVGYRGKMLGHVTSEH  135

Query  506  GHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplq  685
            GH++A  SSY+ A L+L GVE+++DV+ ++ED+ARG+V FDTVTE++G LGL L   PL+
Sbjct  136  GHVRAWGSSYVQAELELNGVEVLSDVVYMLEDLARGTVPFDTVTEVAGWLGLSLFKFPLK  195

Query  686  gKVSCEIVVNTKNETISHQNCYP  754
             +VSCEIVVN  N+TI  QNCYP
Sbjct  196  ARVSCEIVVNRTNQTIIRQNCYP  218



>ref|XP_007024135.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 3 [Theobroma cacao]
 gb|EOY26757.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 3 [Theobroma cacao]
Length=222

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 143/203 (70%), Gaps = 6/203 (3%)
 Frame = +2

Query  149  YFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVS  328
            YF  LP++P    Y+ VLP YYR      R C  R++ +A L+LLA +V++ WPSDP V 
Sbjct  21   YFTALPSQPPDQNYL-VLP-YYRP---TLRWCGCRILCTASLVLLATSVYIFWPSDPEVK  75

Query  329  VARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEE  505
            + R+ +   ++H  P  +LDI L + +KV+N D YSVD+ +L V++ YR K LG+VTSE 
Sbjct  76   IVRMHVDRMQLHTIPIIALDISLLVTLKVRNSDVYSVDFTSLDVAVGYRGKMLGHVTSEH  135

Query  506  GHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplq  685
            GH++A  SSY+ A L+L GVE+++DV+ ++ED+ARG+V FDTVTE++G LGL L   PL+
Sbjct  136  GHVRAWGSSYVQAELELNGVEVLSDVVYMLEDLARGTVPFDTVTEVAGWLGLSLFKFPLK  195

Query  686  gKVSCEIVVNTKNETISHQNCYP  754
             +VSCEIVVN  N+TI  QNCYP
Sbjct  196  ARVSCEIVVNRTNQTIIRQNCYP  218



>ref|XP_006381711.1| hypothetical protein POPTR_0006s16220g [Populus trichocarpa]
 gb|ERP59508.1| hypothetical protein POPTR_0006s16220g [Populus trichocarpa]
Length=210

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 146/201 (73%), Gaps = 5/201 (2%)
 Frame = +2

Query  161  LPAEPQT-PQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSVAR  337
            LP+ P + PQ +IVL  Y+R  ++I R C   L+++  +LLL+ A +L++PSDP + ++R
Sbjct  13   LPSHPDSYPQNVIVLSYYHRPPNHILRRC---LLFTTAILLLSAAAYLLYPSDPAIQLSR  69

Query  338  LKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHL  514
            +KL   RV+  P  +LD+   L +KV+NRDF+S+DY++LVVS+ YR + LG+V S+ G +
Sbjct  70   IKLNHIRVNSSPELTLDVSFSLTIKVENRDFFSLDYDSLVVSVGYRGRELGFVNSKGGKI  129

Query  515  KARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKV  694
            +AR SSY++A L L G+E+I DV  LI+D+ARG + FDT T++ G LGL L  +P+ G+V
Sbjct  130  RARRSSYVDARLDLNGLEVIKDVFYLIQDLARGVIIFDTDTQVKGDLGLLLFKIPINGRV  189

Query  695  SCEIVVNTKNETISHQNCYPE  757
            SC++ VNT N+T+ HQ+CYP+
Sbjct  190  SCQVFVNTNNQTVEHQDCYPQ  210



>ref|XP_007024134.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY26756.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 2 [Theobroma cacao]
Length=249

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 143/203 (70%), Gaps = 6/203 (3%)
 Frame = +2

Query  149  YFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVS  328
            YF  LP++P    Y+ VLP YYR      R C  R++ +A L+LLA +V++ WPSDP V 
Sbjct  21   YFTALPSQPPDQNYL-VLP-YYRP---TLRWCGCRILCTASLVLLATSVYIFWPSDPEVK  75

Query  329  VARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEE  505
            + R+ +   ++H  P  +LDI L + +KV+N D YSVD+ +L V++ YR K LG+VTSE 
Sbjct  76   IVRMHVDRMQLHTIPIIALDISLLVTLKVRNSDVYSVDFTSLDVAVGYRGKMLGHVTSEH  135

Query  506  GHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplq  685
            GH++A  SSY+ A L+L GVE+++DV+ ++ED+ARG+V FDTVTE++G LGL L   PL+
Sbjct  136  GHVRAWGSSYVQAELELNGVEVLSDVVYMLEDLARGTVPFDTVTEVAGWLGLSLFKFPLK  195

Query  686  gKVSCEIVVNTKNETISHQNCYP  754
             +VSCEIVVN  N+TI  QNCYP
Sbjct  196  ARVSCEIVVNRTNQTIIRQNCYP  218



>gb|EYU21543.1| hypothetical protein MIMGU_mgv1a013195mg [Erythranthe guttata]
Length=228

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 157/229 (69%), Gaps = 13/229 (6%)
 Frame = +2

Query  92   MTSSRHSD--PLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHS--YISRTCRRRLI  259
            MT ++HSD  PL P     +++ H     P   QY+IVLP+Y   H      ++C+R L 
Sbjct  1    MTVAKHSDKSPLLP-----DQHQHT-QPPPPPAQYVIVLPHYPPPHHHFLFRKSCQRCLF  54

Query  260  YSAGllllavavf-lIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYS  433
              A LL+  +A   L+WP+ P +S+ RL+L   + H  P  S+D+ +DL VKV+N DFY+
Sbjct  55   CLATLLIFLIAAGYLLWPAKPQLSIIRLRLDRLQFHTIPKMSVDVTMDLTVKVRNEDFYA  114

Query  434  VDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARG  613
            + Y++L+V+I YR KRLGYVT++ G + AR SSY+NATLQL  VEI++DV+ LIED+A+G
Sbjct  115  MYYDSLLVAIGYRGKRLGYVTADGGRIGARGSSYVNATLQLDRVEIMSDVVSLIEDLAKG  174

Query  614  SVTFDTVTEISgqlglflldlp-lqgKVSCEIVVNTKNETISHQNCYPE  757
            +VTFD  +EISG+L +F      L+ ++ CE+VV+++N+TISHQ+CYPE
Sbjct  175  AVTFDAESEISGKLEVFYFFNLPLKTEIECEVVVSSRNQTISHQSCYPE  223



>gb|KFK36217.1| hypothetical protein AALP_AA4G093100 [Arabis alpina]
Length=213

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 146/204 (72%), Gaps = 5/204 (2%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSH--SYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            + PLP+ PQ  Q +I+L  Y R    S++    R  LI++A +LLL+ +V+ ++PSDP +
Sbjct  11   YSPLPS-PQPSQTVILLTPYLRHRRPSFLHH-LRCTLIFTAVILLLSASVYFLYPSDPDI  68

Query  326  SVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
            SV+R++L   RV     P+LD+   L +KV+NRDF+S+DY++LVVSI YR + LG V S+
Sbjct  69   SVSRIQLNHIRVLDSLKPALDLSFSLTIKVRNRDFFSLDYDSLVVSIGYRGRELGLVKSK  128

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GHL+AR SSY+NATL+L G+E++ DV+ LI D+A+G + FDT+ ++ G LG  L  +P+
Sbjct  129  GGHLRARDSSYVNATLELDGLEVVHDVIYLIGDLAKGVIGFDTIAQVKGDLGALLFQIPI  188

Query  683  qgKVSCEIVVNTKNETISHQNCYP  754
            +GKVSCE+ VN  ++ ISHQ+C+P
Sbjct  189  EGKVSCEVFVNVNSQKISHQDCHP  212



>emb|CDY42881.1| BnaC08g46850D [Brassica napus]
Length=232

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 147/204 (72%), Gaps = 7/204 (3%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSH---SYISRTCRRRLIYSAGllllavavflIWPSDPG  322
            + PLP+   +   I++ P  YR H   S++ R+ R  ++++A +LLL+ AV+ ++PSDP 
Sbjct  13   YTPLPSSQPSQTVIVLTP--YRRHPRPSFL-RSLRCSILFTAAILLLSAAVYFLYPSDPE  69

Query  323  VSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTS  499
            ++V+R++L   RV   F P+LD+   L +KV+NRDF+S+DY++LVVSI YR + LG V S
Sbjct  70   INVSRIQLNHIRVLDSFKPTLDLSFSLTIKVRNRDFFSLDYDSLVVSIGYRGRELGLVKS  129

Query  500  EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlp  679
              GHL+AR SSYINATL+L G+E++ DV+ LI D+A+G + FDT+ ++ G LG+ L  +P
Sbjct  130  RGGHLRARDSSYINATLELDGLEVVHDVIYLIGDLAKGVIPFDTIAQVKGDLGVLLFQIP  189

Query  680  lqgKVSCEIVVNTKNETISHQNCY  751
            +QGKVSCE+ VN  N+ ISHQ+C+
Sbjct  190  IQGKVSCEVFVNINNQKISHQDCH  213



>ref|XP_006465533.1| PREDICTED: uncharacterized protein LOC102615257 [Citrus sinensis]
 gb|KDO51222.1| hypothetical protein CISIN_1g027729mg [Citrus sinensis]
Length=219

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 149/226 (66%), Gaps = 12/226 (5%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAG  271
            M  S+ + PLPP+  +Q  Y+  LP +PQ   Y I LP YY  +        RR  Y+  
Sbjct  1    MAPSKTTSPLPPATPSQPHYYTVLPPQPQDENYTI-LPYYYLENP-------RRNWYATI  52

Query  272  llllavavf---lIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVD  439
             + L +      + WPS+P + + RL L  F V   P   +DI L++ +KV NRD YSV+
Sbjct  53   AISLILLAALLYVFWPSEPELKIERLHLAHFHVRMKPAICIDISLNVTLKVHNRDVYSVN  112

Query  440  YNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSV  619
            Y +L VS+ YR ++LG+V S  G +KA ASS+I+A LQLK V++++DV+ L+ED+ARG+V
Sbjct  113  YKSLDVSVGYRGRKLGHVKSNHGRVKALASSFIDAELQLKCVKVLSDVVYLLEDLARGTV  172

Query  620  TFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
             FDT+T+++G LGLF L+ PL+ +VSCE+++NT ++TI+ QNCYP+
Sbjct  173  PFDTITKVTGHLGLFFLEFPLEARVSCEVLINTTSQTIARQNCYPK  218



>gb|EPS74475.1| hypothetical protein M569_00286, partial [Genlisea aurea]
Length=211

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 148/208 (71%), Gaps = 5/208 (2%)
 Frame = +2

Query  149  YFHPLPAEPQ---TPQYIIVLPNYYRSHSYISRTCRRRLIY-SAGllllavavflIWPSD  316
            +  PL  EP    + +Y++V+P   R H  ++R  RR L+  +  LL LA A +L WP D
Sbjct  2    FQQPLLPEPHILPSSEYLVVIPPPPRRHRLLTRRGRRCLVGCATTLLFLAAAAYLFWPYD  61

Query  317  PGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYV  493
            P +SV RL L   R H  P  S+D+ LD+ ++V N DFYS+ Y++LVV + YR +RLG+V
Sbjct  62   PSISVVRLHLDRLRFHRLPKFSVDLTLDVTLRVWNGDFYSLSYDSLVVGVGYRGRRLGFV  121

Query  494  TSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflld  673
            TS  G + ARA+SY+NAT++L  V+I++DV+ LIED+A+G+V  DT +EI+G+LGLFL D
Sbjct  122  TSSNGSVAARATSYLNATVELDHVQILSDVILLIEDLAKGAVALDTESEITGKLGLFLFD  181

Query  674  lplqgKVSCEIVVNTKNETISHQNCYPE  757
            LP++ +V CE+VVNT+N++I+ Q+CYPE
Sbjct  182  LPIKTRVECEVVVNTRNQSITKQSCYPE  209



>ref|XP_002863251.1| hypothetical protein ARALYDRAFT_497058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39510.1| hypothetical protein ARALYDRAFT_497058 [Arabidopsis lyrata subsp. 
lyrata]
Length=224

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 151/222 (68%), Gaps = 11/222 (5%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRS-HSYISRTCRRRLIYSA  268
            M SS+H D   P        + PLP+  Q  Q +I+L  Y R+ +  I R  R  L+++A
Sbjct  1    MASSKHEDYGVP--------YTPLPSS-QPSQTVILLTPYRRNRYPSIFRNLRCSLLFTA  51

Query  269  GllllavavflIWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYN  445
             +LLL+ AV+L++PSDP ++V+R+ L    V      +LD+   L +KV+NRDF+S+DY+
Sbjct  52   AILLLSAAVYLLYPSDPDITVSRINLNHISVVDSHKIALDLSFSLTIKVRNRDFFSLDYD  111

Query  446  ALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTF  625
            +LVVSI YR + LG V S+ GHLKAR SSYINATL+L G+E++ DV+ LI D+A+G + F
Sbjct  112  SLVVSIGYRGRELGLVKSKGGHLKARDSSYINATLELDGLEVVHDVIYLIGDLAKGVIPF  171

Query  626  DTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            DT+ ++ G LG+ L  +P+QGKVSCE+ VN  N+ ISHQ+C+
Sbjct  172  DTIAQVKGDLGVLLFQIPIQGKVSCEVYVNVNNQKISHQDCH  213



>ref|XP_010532848.1| PREDICTED: uncharacterized protein LOC104808757 isoform X2 [Tarenaya 
hassleriana]
Length=215

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSH--SYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            + PLP  P T Q ++VL  Y+R    S++ R  R   ++SA +LLL+ AVF ++PSDP +
Sbjct  13   YAPLPPSPTT-QTVVVLTPYFRHRRPSFL-RHLRCCFLFSAAILLLSAAVFFLFPSDPDI  70

Query  326  SVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
            S++R++L   RV   P  + D+   L +KV+NRDF+S+DY++LVVS+ YR + LG V S 
Sbjct  71   SLSRIRLNHIRVRDSPKVAFDLSFSLTIKVRNRDFFSLDYDSLVVSVGYRDRELGLVKSR  130

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GHL+AR SSYI+ATL L G+E++ DV+ LI D+A+G + FDT+  I G LGL    +P+
Sbjct  131  GGHLRARDSSYIDATLDLDGLEVVHDVIYLIRDLAKGVIPFDTIAWIKGDLGLLFFRVPI  190

Query  683  qgKVSCEIVVNTKNETISHQNCYPE  757
            QGKVSCE+ VN  ++TISHQ+C PE
Sbjct  191  QGKVSCEVYVNVNSQTISHQDCRPE  215



>ref|XP_010532846.1| PREDICTED: uncharacterized protein LOC104808757 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532847.1| PREDICTED: uncharacterized protein LOC104808757 isoform X1 [Tarenaya 
hassleriana]
Length=224

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSH--SYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            + PLP  P T Q ++VL  Y+R    S++ R  R   ++SA +LLL+ AVF ++PSDP +
Sbjct  13   YAPLPPSPTT-QTVVVLTPYFRHRRPSFL-RHLRCCFLFSAAILLLSAAVFFLFPSDPDI  70

Query  326  SVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
            S++R++L   RV   P  + D+   L +KV+NRDF+S+DY++LVVS+ YR + LG V S 
Sbjct  71   SLSRIRLNHIRVRDSPKVAFDLSFSLTIKVRNRDFFSLDYDSLVVSVGYRDRELGLVKSR  130

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GHL+AR SSYI+ATL L G+E++ DV+ LI D+A+G + FDT+  I G LGL    +P+
Sbjct  131  GGHLRARDSSYIDATLDLDGLEVVHDVIYLIRDLAKGVIPFDTIAWIKGDLGLLFFRVPI  190

Query  683  qgKVSCEIVVNTKNETISHQNCYPE  757
            QGKVSCE+ VN  ++TISHQ+C PE
Sbjct  191  QGKVSCEVYVNVNSQTISHQDCRPE  215



>ref|XP_006427015.1| hypothetical protein CICLE_v10026444mg [Citrus clementina]
 gb|ESR40255.1| hypothetical protein CICLE_v10026444mg [Citrus clementina]
Length=219

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 151/225 (67%), Gaps = 10/225 (4%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAG  271
            M  S+ + PLP + S+Q  Y+  LP +PQ   Y I LP YY ++       RR    +  
Sbjct  1    MAPSKTTSPLPLATSSQPHYYTVLPPQPQDENYTI-LPYYYLANP------RRNWCATIA  53

Query  272  llllavavf--lIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDY  442
            + L+ +A    + WPS+P + + +L L  F V   P   +DI L++ +KV NRD YSV+Y
Sbjct  54   ISLILLAALLYVFWPSEPELKIEKLHLAHFHVRMKPAICIDISLNVTLKVHNRDVYSVNY  113

Query  443  NALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVT  622
             +L VS+ YR ++LG+V S  G +KA ASSYI+A LQLK V++++DV+ L+ED+ARG+V 
Sbjct  114  KSLDVSVGYRGRKLGHVKSNHGRVKALASSYIDAELQLKCVKVLSDVVYLLEDLARGTVP  173

Query  623  FDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            FDT+T+++G LGLF L+ PL+ +VSCE+++NT ++TI+ QNCYP+
Sbjct  174  FDTITKVTGHLGLFFLEFPLEARVSCEVLINTTSQTIARQNCYPK  218



>emb|CBI28084.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 136/202 (67%), Gaps = 1/202 (0%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSV  331
            + P+  +P     +++LP YY     +        +  A  L ++ AV+L++PSDP V V
Sbjct  10   YAPIGGDPNYQNVVVLLPVYYPRRRRLLYRLCNAFLACAVFLSISAAVYLLYPSDPTVQV  69

Query  332  ARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEG  508
              L L   +VH  P  SLD+ LDL ++V+NRDF+S  Y +L  S+ YR +RLG+V S  G
Sbjct  70   VGLHLNSVQVHTSPVISLDLSLDLTIRVRNRDFFSFSYTSLTASVGYRGRRLGFVNSSGG  129

Query  509  HLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqg  688
            +L+AR SSYINATL L G+E++ DV  L+ED+ARGS+ FDTV+E+ G+LGLF  ++PL+ 
Sbjct  130  YLRARGSSYINATLDLDGIEVLHDVFYLLEDLARGSIPFDTVSEVRGKLGLFFFEIPLKA  189

Query  689  KVSCEIVVNTKNETISHQNCYP  754
            +VSCE+ VNT N+TI HQ+CYP
Sbjct  190  RVSCEVYVNTSNQTIIHQDCYP  211



>ref|XP_002284574.1| PREDICTED: uncharacterized protein LOC100254347 [Vitis vinifera]
Length=212

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 136/202 (67%), Gaps = 1/202 (0%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSV  331
            + P+  +P     +++LP YY     +        +  A  L ++ AV+L++PSDP V V
Sbjct  10   YAPIGGDPNYQNVVVLLPVYYPRRRRLLYRLCNAFLACAVFLSISAAVYLLYPSDPTVQV  69

Query  332  ARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEG  508
              L L   +VH  P  SLD+ LDL ++V+NRDF+S  Y +L  S+ YR +RLG+V S  G
Sbjct  70   VGLHLNSVQVHTSPVISLDLSLDLTIRVRNRDFFSFSYTSLTASVGYRGRRLGFVNSSGG  129

Query  509  HLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqg  688
            +L+AR SSYINATL L G+E++ DV  L+ED+ARGS+ FDTV+E+ G+LGLF  ++PL+ 
Sbjct  130  YLRARGSSYINATLDLDGIEVLHDVFYLLEDLARGSIPFDTVSEVRGKLGLFFFEIPLKA  189

Query  689  KVSCEIVVNTKNETISHQNCYP  754
            +VSCE+ VNT N+TI HQ+CYP
Sbjct  190  RVSCEVYVNTSNQTIIHQDCYP  211



>ref|XP_009107688.1| PREDICTED: uncharacterized protein LOC103833354 [Brassica rapa]
Length=215

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 147/203 (72%), Gaps = 5/203 (2%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNY--YRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            + PLP+  Q  Q +IVL  Y  +R  S++ R+ R  ++++A +LLL+ A + ++PSDP +
Sbjct  13   YTPLPSS-QPSQTVIVLTPYRRHRRPSFL-RSLRCSILFTAAILLLSAAAYFLYPSDPEI  70

Query  326  SVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
            +V+R++L   RV   F P+LD+   L +KV+NRDF+S+DY++LVVSI YR + LG V S 
Sbjct  71   NVSRIQLNHIRVLDSFRPTLDLSFSLTIKVRNRDFFSLDYDSLVVSIGYRGRELGLVKSR  130

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GHL+AR SSYINATL+L G+E++ DV+ LI D+A+G + FDT+ ++ G LGL L  +P+
Sbjct  131  GGHLRARDSSYINATLELDGLEVVHDVIYLIGDLAKGVIPFDTIAQVKGDLGLLLFQIPI  190

Query  683  qgKVSCEIVVNTKNETISHQNCY  751
            QGKVSCE+ VN  N+ ISHQ+C+
Sbjct  191  QGKVSCEVFVNINNQKISHQDCH  213



>gb|KDP33657.1| hypothetical protein JCGZ_07228 [Jatropha curcas]
Length=212

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 140/200 (70%), Gaps = 2/200 (1%)
 Frame = +2

Query  161  LPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSVARL  340
            LP+ P  P  +IVLP Y    +      RR L++++ +LLL+  VF ++PSDP + V R+
Sbjct  13   LPSHP-IPHNVIVLPYYQPPPNPSLIFLRRCLLFTSVILLLSAVVFFLYPSDPALQVDRI  71

Query  341  KLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLK  517
            +L   RV+  P  +LDI L L+++V+NRDF+S+DY++L VS+ YR + LG V S+ G L+
Sbjct  72   RLNHIRVNSSPKLTLDISLSLLMRVRNRDFFSLDYDSLDVSVGYRGRELGLVRSQGGKLR  131

Query  518  ARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVS  697
            AR SSY+NATL L G++II DV  LIED+ARG + FDT T I G+LGL    +P++ +VS
Sbjct  132  ARGSSYVNATLDLNGLQIIHDVFYLIEDLARGVIPFDTDTMIEGELGLLFFKIPIKARVS  191

Query  698  CEIVVNTKNETISHQNCYPE  757
            CE+ VNT N+T++ Q+CYPE
Sbjct  192  CEVYVNTNNQTVARQDCYPE  211



>ref|XP_007013199.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family isoform 1 [Theobroma cacao]
 gb|EOY30818.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family isoform 1 [Theobroma cacao]
Length=214

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 139/203 (68%), Gaps = 2/203 (1%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSV  331
            +  LP+ P   Q +IVLP YY   +   R  RR LI++  ++LL+ AVF ++PSDP + +
Sbjct  13   YAALPSNPNQ-QNVIVLPVYYSRPNQNYRCLRRCLIFTGIVVLLSAAVFFLYPSDPTLQL  71

Query  332  ARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEG  508
             RL+L   RV+  P  +LD+   L ++V+NRDF+S+DY+ LVVS+ YR + LG V+SE G
Sbjct  72   VRLQLNHVRVNSSPALTLDLSFSLTIRVRNRDFFSLDYDKLVVSVGYRGRELGVVSSEGG  131

Query  509  HLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqg  688
             ++AR SSY+NATL L G E++ DV+ LI D A+G + FDT T++ G LGLFL   P++ 
Sbjct  132  RVRARGSSYVNATLDLNGFEVVHDVIYLIADWAKGVIPFDTNTKVDGDLGLFLFKAPIKA  191

Query  689  KVSCEIVVNTKNETISHQNCYPE  757
            +VSCE+ VNT N+TI  Q+CY E
Sbjct  192  EVSCEVYVNTNNQTIVRQDCYAE  214



>gb|KHG15162.1| hth-type transcriptional regulator yid [Gossypium arboreum]
Length=236

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 135/203 (67%), Gaps = 4/203 (2%)
 Frame = +2

Query  149  YFHPLPAEPQTP-QYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            ++H     P+ P Q  +VLP Y+  H    R   RR++Y+A  LLLA  +F+ WPSDP V
Sbjct  22   HYHAAVLPPELPIQNCVVLPYYH--HLSRLRWRDRRVLYTASFLLLAALLFIFWPSDPEV  79

Query  326  SVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
             +ARL +   +VH  P  ++DI L + +KV+N D YS+D     V++ YR K LG+VTSE
Sbjct  80   KIARLHVNHMQVHTAPIVAVDISLAMTLKVRNWDVYSMDITRFEVAVGYRGKTLGHVTSE  139

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GH++AR SSY+ A L+L GVE+ +DV+ ++ED+ARG+V FDTVT++ G LG   +  PL
Sbjct  140  HGHVRARGSSYVEAVLELNGVEVFSDVVYMLEDLARGTVPFDTVTQVVGWLGFSFVKFPL  199

Query  683  qgKVSCEIVVNTKNETISHQNCY  751
            + K+SCEIV+N  N+ I  QNCY
Sbjct  200  KAKISCEIVINRANQAIIRQNCY  222



>ref|NP_193063.2| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAY17421.1| At4g13270 [Arabidopsis thaliana]
 gb|AAY57315.1| At4g13270 [Arabidopsis thaliana]
 gb|AEE83257.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=215

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 150/223 (67%), Gaps = 13/223 (6%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHS--YISRTCRRRLIYS  265
            M SS+H D   P        + PLP+   +   I++ P  YR H    + R  R  L+++
Sbjct  1    MASSKHEDYGIP--------YTPLPSSQPSQSVILLTP--YRRHRRPSLLRNLRCSLLFT  50

Query  266  AGllllavavflIWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDY  442
            A +LLL+ AV+L++PSDP ++V+R+ L    V      +LD+   L +KV+NRDF+S+DY
Sbjct  51   AVILLLSAAVYLLYPSDPDITVSRINLNHISVVDSHKIALDLSFSLTIKVRNRDFFSLDY  110

Query  443  NALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVT  622
            ++LVVSI YR + LG V S+ GHLKAR SSYI+ATL+L G+E++ DV+ LI D+A+G + 
Sbjct  111  DSLVVSIGYRGRELGLVKSKGGHLKARDSSYIDATLELDGLEVVHDVIYLIGDLAKGVIP  170

Query  623  FDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            FDT+ ++ G LG+ L ++P+QGKVSCE+ VN  N+ ISHQ+C+
Sbjct  171  FDTIAQVQGDLGVLLFNIPIQGKVSCEVYVNVNNQKISHQDCH  213



>emb|CDY61168.1| BnaA08g29800D [Brassica napus]
Length=232

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 146/203 (72%), Gaps = 5/203 (2%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNY--YRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            + PLP+  Q  Q +IVL  Y  +R  S++ R+ R  ++++A +LLL+ A + ++PSDP +
Sbjct  13   YTPLPSS-QPSQTVIVLTPYRRHRRPSFL-RSLRCSILFTAAILLLSAAAYFLYPSDPEI  70

Query  326  SVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
            +V+R++L   RV   F P+LD+   L +KV+NRD +S+DY++LVVSI YR + LG V S 
Sbjct  71   NVSRIQLNHIRVLDSFKPTLDLSFSLTIKVRNRDVFSLDYDSLVVSIGYRGRELGLVKSR  130

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GHL+AR SSYINATL+L G+E++ DV+ LI D+A+G + FDT+ ++ G LGL L  +P+
Sbjct  131  GGHLRARDSSYINATLELDGLEVVHDVIYLIGDLAKGVIPFDTIAQVKGDLGLLLFQIPI  190

Query  683  qgKVSCEIVVNTKNETISHQNCY  751
            QGKVSCE+ VN  N+ ISHQ+C+
Sbjct  191  QGKVSCEVFVNINNQKISHQDCH  213



>ref|XP_011072340.1| PREDICTED: uncharacterized protein LOC105157619 [Sesamum indicum]
Length=129

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  392  LDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEI  571
            +DL V+V+N+DFY +DY++L+V+I YR KRLGYVTS+ GH+KAR SSY+NATLQL  VEI
Sbjct  1    MDLTVRVRNQDFYELDYDSLLVAIGYRGKRLGYVTSDGGHIKARGSSYVNATLQLDRVEI  60

Query  572  ITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            ++DV+ LIE++A+G+VTFDT +EISG+LG+ + DLPL+ KV CE++VNTKN+T+S Q+CY
Sbjct  61   LSDVVLLIEELAKGAVTFDTESEISGKLGVVVFDLPLKTKVKCEVIVNTKNQTVSRQSCY  120

Query  752  PE  757
            PE
Sbjct  121  PE  122



>ref|XP_004287097.1| PREDICTED: uncharacterized protein LOC101303354 [Fragaria vesca 
subsp. vesca]
Length=218

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 144/216 (67%), Gaps = 6/216 (3%)
 Frame = +2

Query  128  SCSTQERYFHPLPAEP---QTPQYIIVLPNY--YRSHSYISRTCRRRLIYSAGllllava  292
            S   +  ++ P+PA P   Q  Q+++VL +Y  YR      R  R  +  +A  L ++ A
Sbjct  3    SSKGESAFYAPIPANPDSGQPQQHVVVLTHYRPYRDDYLERRRFRLCVSTTAAFLFISAA  62

Query  293  vflIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAY  469
            VF ++PSDP +S+AR++L    VH  P  +LD    L +KV+NRDF+S++Y++LVV I Y
Sbjct  63   VFFLFPSDPALSLARIQLNHVGVHSSPKLTLDASFSLTIKVRNRDFFSLEYDSLVVKIGY  122

Query  470  RRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISg  649
            R + LG+V+S+ G ++AR SSY+NATL + G+E+I DV  L+ED+ARG + FDT + + G
Sbjct  123  RGRELGFVSSDGGRVRARGSSYVNATLVVDGLEVIHDVFYLLEDLARGEIPFDTDSVVDG  182

Query  650  qlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
             +GLF   +P++G+ SCE+ VNT ++T+  Q+CYPE
Sbjct  183  TVGLFFFRIPIKGRASCEVYVNTNDQTVVRQDCYPE  218



>dbj|BAE99725.1| hypothetical protein [Arabidopsis thaliana]
Length=213

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 149/221 (67%), Gaps = 13/221 (6%)
 Frame = +2

Query  98   SSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHS--YISRTCRRRLIYSAG  271
            SS+H D   P        + PLP+   +   I++ P  YR H    + R  R  L+++A 
Sbjct  1    SSKHEDYGIP--------YTPLPSSQPSQSVILLTP--YRRHRRPSLLRNLRCSLLFTAV  50

Query  272  llllavavflIWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNA  448
            +LLL+ AV+L++PSDP ++V+R+ L    V      +LD+   L +KV+NRDF+S+DY++
Sbjct  51   ILLLSAAVYLLYPSDPDITVSRINLNHISVVDSHKIALDLSFSLTIKVRNRDFFSLDYDS  110

Query  449  LVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFD  628
            LVVSI YR + LG V S+ GHLKAR SSYI+ATL+L G+E++ DV+ LI D+A+G + FD
Sbjct  111  LVVSIGYRGRELGLVKSKGGHLKARDSSYIDATLELDGLEVVHDVIYLIGDLAKGVIPFD  170

Query  629  TVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            T+ ++ G LG+ L ++P+QGKVSCE+ VN  N+ ISHQ+C+
Sbjct  171  TIAQVQGDLGVLLFNIPIQGKVSCEVYVNVNNQKISHQDCH  211



>ref|XP_009336930.1| PREDICTED: uncharacterized protein LOC103929447 [Pyrus x bretschneideri]
Length=217

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 146/215 (68%), Gaps = 5/215 (2%)
 Frame = +2

Query  128  SCSTQERYFHPLPAEPQTPQ---YIIVLPNYYRS-HSYISRTCRRRLIYSAGllllavav  295
            S  ++  ++ P+P+ P  PQ    +IVL +Y  + H Y  R+ R  +  +A +LLL+ AV
Sbjct  3    SSKSEYAFYSPIPSGPNNPQSQQNVIVLTHYRPTPHYYCGRSLRLCISITASILLLSAAV  62

Query  296  flIWPSDPGVSVARLKLRGFRVH-PFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYR  472
            F ++PSDP + +AR+KL   RV+    P+LD+   L ++V+NRDFYS++Y++L V++ YR
Sbjct  63   FFLYPSDPTLHLARIKLNHVRVNTSLKPTLDLSFSLTIRVRNRDFYSLNYDSLKVTVGYR  122

Query  473  RKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgq  652
             + LG+V S+ GH++ARASSY+NATL + G+E++ DV  L+ED+A+  + FDT T + G 
Sbjct  123  ARELGFVISDGGHVRARASSYVNATLVVDGLEVLHDVFYLLEDLAKRVIPFDTDTAVDGT  182

Query  653  lglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LG+    +P++ + SCE+ V+T N+T+  ++CY E
Sbjct  183  LGVLFFKIPIKARASCEVYVDTNNQTVLREDCYSE  217



>ref|XP_010527200.1| PREDICTED: uncharacterized protein LOC104804584 [Tarenaya hassleriana]
 ref|XP_010527201.1| PREDICTED: uncharacterized protein LOC104804584 [Tarenaya hassleriana]
Length=214

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 132/190 (69%), Gaps = 2/190 (1%)
 Frame = +2

Query  191  IIVLPNYYRSH-SYISRTCRRRLIYSAGllllavavflIWPSDPGVSVARLKLRGFRVHP  367
            IIVL  YYR   S   R  R   ++SA +LLL+ AVF ++PSDP + + R++L   RV  
Sbjct  25   IIVLTPYYRHRRSSFLRHLRCCFLFSAAILLLSAAVFFLYPSDPDIRLTRIQLNHVRVLD  84

Query  368  FP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINA  544
             P P++D+   L +KV+NRDF+S+DY++LVVS+ YR + LG V S  GHL+AR SSYI+A
Sbjct  85   SPKPAIDLSFSLTIKVRNRDFFSLDYDSLVVSVGYRDRELGIVKSRGGHLRARDSSYIDA  144

Query  545  TLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKN  724
            TL L G+E++ DV+ LI D+A+G + FDT+  + G LG F   +P+QGKV CE+ VN  +
Sbjct  145  TLDLDGLEVVHDVIHLIGDLAKGVIPFDTIAWVKGDLGFFFFRIPIQGKVKCEVYVNVND  204

Query  725  ETISHQNCYP  754
            +TISHQ+C P
Sbjct  205  QTISHQDCRP  214



>ref|XP_006451136.1| hypothetical protein CICLE_v10009328mg [Citrus clementina]
 ref|XP_006475609.1| PREDICTED: uncharacterized protein LOC102611769 [Citrus sinensis]
 gb|ESR64376.1| hypothetical protein CICLE_v10009328mg [Citrus clementina]
 gb|KDO50877.1| hypothetical protein CISIN_1g028106mg [Citrus sinensis]
Length=213

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 135/207 (65%), Gaps = 10/207 (5%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYR---SHSYISRTCRRRLIYSAGllllavavflI-WPSDP  319
            + PLP E      +IVLP YY+         R   R L  +A +  L   +  I +PSDP
Sbjct  12   YAPLPTEN-----VIVLPVYYQPDLRRWRRRRNLSRCLCTAAAIASLLAVLVFIFYPSDP  66

Query  320  GVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVT  496
             + +AR+ L   RV+  P P+LD+   L+VKV NRDF+S++Y++L VSI YR + LG V 
Sbjct  67   YLQLARIHLNHIRVNSSPQPTLDLSFSLVVKVHNRDFFSLNYDSLDVSIGYRGRELGSVR  126

Query  497  SEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldl  676
            S  G ++AR SSY+NA+L+L G+E+I DV+ LIED+ +G + FDTVT + G+LG+   ++
Sbjct  127  SHGGRVRARGSSYVNASLKLNGLEVIHDVIYLIEDLIKGVIPFDTVTMVKGELGVLFFEI  186

Query  677  plqgKVSCEIVVNTKNETISHQNCYPE  757
            PL+ KVSCE+ VNT N+TI  Q+CYPE
Sbjct  187  PLKAKVSCEVYVNTSNQTIVRQDCYPE  213



>ref|XP_008242614.1| PREDICTED: transmembrane protein 106B [Prunus mume]
Length=216

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 143/208 (69%), Gaps = 5/208 (2%)
 Frame = +2

Query  149  YFHPLPAEP---QTPQYIIVLPNYYRSHSYISRTCRRR-LIYSAGllllavavflIWPSD  316
            Y+ P+P++P   Q+ Q ++VL  Y  + +Y  R   R  L  +A LLLL+ A+F ++PSD
Sbjct  9    YYAPIPSDPTHTQSQQTVVVLAPYRPNPNYQRRRRLRLCLSITASLLLLSTAIFFLFPSD  68

Query  317  PGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYV  493
            P + + RLKL   RV+  P P+LD+   L ++V+NRD +S++Y++L V++ YR + LG+V
Sbjct  69   PTLQLVRLKLNHVRVNSSPRPTLDLSFSLTIRVRNRDSFSLNYDSLRVTVGYRARELGFV  128

Query  494  TSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflld  673
            +S+ G ++AR SSY+NATL L G+E+I DV  L+ED+ARG + FDT TE+   LGLF   
Sbjct  129  SSDGGRVRARGSSYVNATLVLDGLEVIHDVFYLLEDLARGVIPFDTDTEVERTLGLFFFK  188

Query  674  lplqgKVSCEIVVNTKNETISHQNCYPE  757
            +P++ K SCE+ VNT N+TI  Q+C PE
Sbjct  189  IPIKAKASCEVYVNTNNQTIVRQDCSPE  216



>ref|XP_006451135.1| hypothetical protein CICLE_v10009328mg [Citrus clementina]
 gb|ESR64375.1| hypothetical protein CICLE_v10009328mg [Citrus clementina]
Length=240

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 135/207 (65%), Gaps = 10/207 (5%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYR---SHSYISRTCRRRLIYSAGllllavavflI-WPSDP  319
            + PLP E      +IVLP YY+         R   R L  +A +  L   +  I +PSDP
Sbjct  12   YAPLPTEN-----VIVLPVYYQPDLRRWRRRRNLSRCLCTAAAIASLLAVLVFIFYPSDP  66

Query  320  GVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVT  496
             + +AR+ L   RV+  P P+LD+   L+VKV NRDF+S++Y++L VSI YR + LG V 
Sbjct  67   YLQLARIHLNHIRVNSSPQPTLDLSFSLVVKVHNRDFFSLNYDSLDVSIGYRGRELGSVR  126

Query  497  SEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldl  676
            S  G ++AR SSY+NA+L+L G+E+I DV+ LIED+ +G + FDTVT + G+LG+   ++
Sbjct  127  SHGGRVRARGSSYVNASLKLNGLEVIHDVIYLIEDLIKGVIPFDTVTMVKGELGVLFFEI  186

Query  677  plqgKVSCEIVVNTKNETISHQNCYPE  757
            PL+ KVSCE+ VNT N+TI  Q+CYPE
Sbjct  187  PLKAKVSCEVYVNTSNQTIVRQDCYPE  213



>ref|XP_010254139.1| PREDICTED: uncharacterized protein LOC104595218 [Nelumbo nucifera]
Length=221

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = +2

Query  194  IVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSVARLKLRGFRVHPFP  373
            I+LP Y     +  R  RR L+  A LLL A  ++LIWPS P V+V RL L   +VH  P
Sbjct  33   IILPLYCPPCQF--RVLRRHLLGVAALLLFAGGLYLIWPSGPEVNVVRLGLGHVQVHTSP  90

Query  374  -PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATL  550
              S+D+ + L VK +NRDF+S +Y+++V+SI YR K+ G+VTS  GH++AR SSY+NATL
Sbjct  91   RVSIDVSVALTVKARNRDFFSFNYSSIVISIGYRGKQFGFVTSNGGHVRARGSSYVNATL  150

Query  551  QLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlp-lqgKVSCEIVVNTKNE  727
               GVEI+ DV  L++D+A+GS+  DTV+E+ GQL         L+ K+SCE+  NT  +
Sbjct  151  NFDGVEILDDVFLLLKDLAKGSIPLDTVSEVQGQLQFLFFFNFPLKAKISCEVHANTVKQ  210

Query  728  TISHQNCYPE  757
            T++ Q+CYP+
Sbjct  211  TVTSQDCYPD  220



>ref|XP_006284513.1| hypothetical protein CARUB_v10005713mg [Capsella rubella]
 gb|EOA17411.1| hypothetical protein CARUB_v10005713mg [Capsella rubella]
Length=215

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 145/215 (67%), Gaps = 10/215 (5%)
 Frame = +2

Query  128  SCSTQERY---FHPLPAEPQTPQYIIVLPNYYRSH---SYISRTCRRRLIYSAGllllav  289
            + + Q+ Y   + PLP+   +   I++ P  YR H   S++ R  R  L+++A +LLL+ 
Sbjct  2    ASTKQQDYGVPYTPLPSSQPSQTVILLTP--YRRHRRPSFL-RNLRCSLLFTAAILLLSA  58

Query  290  avflIWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIA  466
            AV+ ++PSDP ++V R+ L    V      +LD+   L +KV+NRDF+S+DY++L VSI 
Sbjct  59   AVYFLYPSDPDITVTRIDLNHISVLDSHKIALDLSFSLTIKVENRDFFSLDYDSLDVSIG  118

Query  467  YRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
            YR + LG V S+ GHL+AR SSYI+ATL+L G+E++ DV+ LI D+A+G V FDT+  + 
Sbjct  119  YRGRELGVVKSKGGHLRARDSSYIDATLELDGLEVVHDVIYLISDLAKGVVPFDTIATVK  178

Query  647  gqlglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            G LG+ L  +P+QGKVSCE+ VN  N+ ISHQ+C+
Sbjct  179  GDLGVLLFQIPIQGKVSCEVYVNVSNQKISHQDCH  213



>ref|XP_004305294.1| PREDICTED: uncharacterized protein LOC101294785 [Fragaria vesca 
subsp. vesca]
Length=248

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 144/221 (65%), Gaps = 14/221 (6%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAG  271
            M SS+ ++P PP    Q  +++PLP +    Q   VLP+ Y SH       RR  I    
Sbjct  1    MASSK-TEPPPP----QHHHYNPLPHD----QNDNVLPSSYSSH----LPQRRTTILLTV  47

Query  272  llllavavflIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNA  448
            LLLL  +++L WPSDP V + RLKL+   VH  P  ++D+ + + +KV+N D YS+DY+A
Sbjct  48   LLLLFSSLYLFWPSDPSVKIVRLKLKKVHVHTRPRVTIDVSMAVRIKVRNGDVYSMDYDA  107

Query  449  LVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFD  628
            L V + YR KRLG V  ++GH++A  SSY++A ++  GV + +DV+ L+ED+A+G+V FD
Sbjct  108  LEVGVGYRGKRLGQVRFQQGHVRAFGSSYVDAEVEFNGVGVFSDVVLLLEDLAKGTVPFD  167

Query  629  TVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            TVTE+ G+LG+ +   PL+ +VSCEI+VN  N+TI   NCY
Sbjct  168  TVTEVRGKLGVLVFHFPLRARVSCEILVNMMNQTIFRHNCY  208



>ref|XP_008463384.1| PREDICTED: uncharacterized protein LOC103501551 [Cucumis melo]
Length=215

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 141/223 (63%), Gaps = 9/223 (4%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAG  271
            MT+S   D +P          + L +     Q ++VL  Y  +     R  R    YSA 
Sbjct  1    MTTSSGDDSVPVP--------YTLLSSNAAQQNVVVLSLYRPTPCRHRRLLRLFAFYSAA  52

Query  272  llllavavflIWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNA  448
             LLL    FL++PSDP + + RLKL   +VH  P  SLD+   + ++V+N++F+S++YN 
Sbjct  53   FLLLFAVAFLLFPSDPSLQLVRLKLNRVKVHLVPFVSLDLSFSVSLRVRNKNFFSLNYNF  112

Query  449  LVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFD  628
            L VS+ YR +RLGYV+S  G + AR SSY+NATL L G+E++ DVL L+ D+ +G + FD
Sbjct  113  LGVSVGYRGRRLGYVSSGGGRVSARGSSYVNATLDLNGLEVVHDVLYLLADLGKGIIPFD  172

Query  629  TVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            T TE+ G +GLF + +P++ +VSCE++VNT N+TI HQ+CYPE
Sbjct  173  TETEVEGSMGLFFIKIPIKARVSCEVLVNTNNQTIEHQDCYPE  215



>ref|XP_007202533.1| hypothetical protein PRUPE_ppa011027mg [Prunus persica]
 gb|EMJ03732.1| hypothetical protein PRUPE_ppa011027mg [Prunus persica]
Length=226

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 142/208 (68%), Gaps = 5/208 (2%)
 Frame = +2

Query  149  YFHPLPAEP---QTPQYIIVL-PNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSD  316
            Y+ P+P++P   Q+ Q ++VL P     +    R  R     +A LLLL+ A+FL++PSD
Sbjct  9    YYAPIPSDPTHTQSQQTVVVLAPYRPNPNYRRRRRLRLCFSITASLLLLSTAIFLLFPSD  68

Query  317  PGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYV  493
            P + + RLKL   RV+  P P+LD+   L ++V+NRD +S++Y++L V++ YR + LG+V
Sbjct  69   PTLQLVRLKLNHVRVNSSPRPTLDLSFSLTIRVRNRDLFSLNYDSLRVTVGYRARELGFV  128

Query  494  TSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflld  673
            +S+ G ++AR SSY+NATL L G+E+I DV  L+ED+ARG + FDT TE+ G LGLF   
Sbjct  129  SSDGGRVRARGSSYVNATLVLDGLEVIHDVFYLLEDLARGVIPFDTDTEVEGTLGLFFFK  188

Query  674  lplqgKVSCEIVVNTKNETISHQNCYPE  757
            +P++ K SCE+ VNT N+TI  Q+C PE
Sbjct  189  IPIKAKASCEVYVNTNNQTIVRQDCSPE  216



>ref|XP_004148717.1| PREDICTED: uncharacterized protein LOC101219269 [Cucumis sativus]
 ref|XP_004161330.1| PREDICTED: uncharacterized protein LOC101225993 [Cucumis sativus]
 gb|KGN65355.1| hypothetical protein Csa_1G369500 [Cucumis sativus]
Length=215

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 113/151 (75%), Gaps = 1/151 (1%)
 Frame = +2

Query  308  PSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRL  484
            PSDP + + RLKL   +VH  P  SLD+   + ++V+N++F+S++YN L VS+ YR +RL
Sbjct  65   PSDPSLQLVRLKLNRVKVHLVPVVSLDLSFSVSLRVRNKNFFSLNYNFLGVSVGYRGRRL  124

Query  485  GYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglf  664
            GYV+SE G + AR SSY+NATL L G+E++ DVL L+ D+ +G + FDT T++ G +GLF
Sbjct  125  GYVSSEGGRVSARGSSYVNATLDLNGLEVVHDVLYLLADLGKGIIPFDTETDVEGSMGLF  184

Query  665  lldlplqgKVSCEIVVNTKNETISHQNCYPE  757
             + +P++ +VSCE++VNT N+TI HQ+CYPE
Sbjct  185  FIKIPIKARVSCEVLVNTNNQTIEHQDCYPE  215



>ref|XP_010062457.1| PREDICTED: uncharacterized protein LOC104449866 [Eucalyptus grandis]
 gb|KCW69597.1| hypothetical protein EUGRSUZ_F03017 [Eucalyptus grandis]
Length=215

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 141/223 (63%), Gaps = 9/223 (4%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAG  271
            M SS+ ++P PP   T   Y+ PLP +P  P YI+ LP +   H   +   R   I +  
Sbjct  1    MDSSK-ANPPPP---TLPIYYTPLPPQPDAPNYIL-LPLH---HPATASPRRLHTICAVS  52

Query  272  llllavavflIWPSDPGVSVARLKLRGFRVHPFPPSL-DIYLDLIVKVQNRDFYSVDYNA  448
            L+LLA   ++++PS+P + V RL+L   + H  P  L DI L L +KV N D YS+DY+ 
Sbjct  53   LILLASVAYILYPSEPDIDVVRLRLNRVQFHTQPHVLVDISLFLTIKVCNADVYSMDYST  112

Query  449  LVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFD  628
            L V++ YR K LG+V S+ GH+ A  SSY++A L+  GVE+ +DV+ L+ED+A+G+V  D
Sbjct  113  LDVAVGYRGKMLGHVKSDHGHVMALGSSYVDAELEFDGVEVFSDVVFLLEDLAKGTVPLD  172

Query  629  TVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            TVT I G++GL     PL+ KVSCE+ VNT N+TI  QNC+ E
Sbjct  173  TVTTIDGRVGLLFFGFPLKAKVSCEVSVNTHNQTIVRQNCFAE  215



>ref|XP_010249767.1| PREDICTED: uncharacterized protein LOC104592233 [Nelumbo nucifera]
Length=251

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            IWPSDP + + R+ L  F V   P    DI + L +KV+N+D + ++Y+++VVSI YR K
Sbjct  98   IWPSDPDLKIVRVGLSHFHVRTSPTVCFDISMALTIKVRNKDLFFLNYSSIVVSIGYRGK  157

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            +LG+VTS+ G ++AR SSY+NATL L G+E+  D+LPL+ED+ARGS+ FDT+TE+ GQLG
Sbjct  158  QLGFVTSDGGLVRARGSSYVNATLLLDGIEVFHDMLPLLEDLARGSIAFDTITEVQGQLG  217

Query  659  lflldlp-lqgKVSCEIVVNTKNETISHQNCYPE  757
                    L+GK+SCE+ VNT  +TI  Q+CYPE
Sbjct  218  FLFFFDIPLKGKISCEMHVNTVKKTIMRQDCYPE  251



>ref|XP_006414934.1| hypothetical protein EUTSA_v10026222mg [Eutrema salsugineum]
 gb|ESQ56387.1| hypothetical protein EUTSA_v10026222mg [Eutrema salsugineum]
Length=213

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 150/211 (71%), Gaps = 8/211 (4%)
 Frame = +2

Query  137  TQERY---FHPLPAEPQTPQYIIVLPNYYRSH--SYISRTCRRRLIYSAGllllavavfl  301
            ++E Y   + PLP+  Q  Q +IVL  Y R+   S++ R  R  L+++A +LLL+ AV+ 
Sbjct  3    SKEEYGIPYTPLPSS-QPSQTVIVLTPYRRNRRPSFL-RNLRCSLLFAAAILLLSAAVYF  60

Query  302  IWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            ++PSDP ++++R++L   RV     P+LD+   L +KV+NRDF+S DY++LVVSI YR +
Sbjct  61   LYPSDPDINLSRIQLNHIRVLDSLKPALDLSFSLTIKVRNRDFFSFDYDSLVVSIGYRGR  120

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG V S  GHL+AR SSY+NATL+L G+E++ DV+ LI D+A+G + FDT+ +++G LG
Sbjct  121  ELGLVKSRGGHLRARDSSYVNATLELDGLEVVHDVIYLIGDLAKGVIPFDTIAQVTGDLG  180

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCY  751
            + L  +P++G+VSCE+ VN  ++ ISHQ+C+
Sbjct  181  VLLFQIPVEGEVSCEVFVNVNSQKISHQDCH  211



>ref|XP_007024140.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 4 [Theobroma cacao]
 gb|EOY26762.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 4 [Theobroma cacao]
Length=167

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 110/151 (73%), Gaps = 1/151 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WPS P V + R+ ++  ++H  P  +LDI L + +KV+N D YS+D+ +L +++ YR K 
Sbjct  15   WPSQPEVKIVRMHVKRMQMHTVPIIALDISLLVTLKVRNSDVYSMDFTSLDMAVGYRGKM  74

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG+V SE  HL+A  SSY+ A L+L GVE+++DV+ ++ED+ARG+V FDT+TE++G LGL
Sbjct  75   LGHVKSEHDHLRAWGSSYLQAELELNGVEVLSDVVYMLEDLARGTVPFDTITEVAGWLGL  134

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYP  754
             L   PL+ K+SCEIVVN  N+ I HQNCYP
Sbjct  135  SLFKFPLKVKISCEIVVNRTNQIIIHQNCYP  165



>ref|XP_008386536.1| PREDICTED: uncharacterized protein LOC103449036 [Malus domestica]
Length=217

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 145/215 (67%), Gaps = 5/215 (2%)
 Frame = +2

Query  128  SCSTQERYFHPLPA---EPQTPQYIIVLPNYYRS-HSYISRTCRRRLIYSAGllllavav  295
            S  ++  ++ P+P+    PQ  Q ++VL +Y  + H    R+ R  +  +A +LLL+ AV
Sbjct  3    SSKSEYAFYSPIPSGLNNPQPQQNVVVLTHYRPTPHYCCGRSLRLCISITATILLLSAAV  62

Query  296  flIWPSDPGVSVARLKLRGFRVH-PFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYR  472
            F ++PSDP + +AR+KL   RV+    P+LD+   L ++V+NRDF+S++Y++L V++ YR
Sbjct  63   FFLYPSDPTLHLARIKLNHVRVNXSXKPTLDLSFSLTIRVRNRDFFSLNYDSLKVTVGYR  122

Query  473  RKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgq  652
               LG+V S+ GH++ARASSY+NATL + G+E++ DV  L+ED+A+G + FDT T + G 
Sbjct  123  AXELGFVISDGGHVRARASSYVNATLVVDGLEVLHDVFYLLEDLAKGVIPFDTDTAVDGT  182

Query  653  lglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LG+    +P++ + SCE+ V+T N+T+  ++CY E
Sbjct  183  LGVLFFKIPIKARASCEVYVDTNNQTVVREDCYSE  217



>ref|XP_010435290.1| PREDICTED: uncharacterized protein LOC104719134 [Camelina sativa]
Length=215

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 151/225 (67%), Gaps = 13/225 (6%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSH--SYISRTCRRRLIYS  265
            M SS+H D   P        + PLP+  Q  Q +I+L  Y R    S++ R  R  L+++
Sbjct  1    MASSKHQDYGIP--------YTPLPSS-QPSQTVILLTPYLRHRRPSFL-RNLRCSLLFA  50

Query  266  AGllllavavflIWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDY  442
            A +LLL+ AV+ ++PSDP ++V+R+ L    V      +LD+   L +KV+NRDF+S+DY
Sbjct  51   AAILLLSAAVYFLYPSDPDITVSRINLNHISVLDSHKIALDLSFSLTIKVRNRDFFSLDY  110

Query  443  NALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVT  622
            ++LVVSI YR + LG V S+ GHL+AR SSYI+ATL+L G+E++ DV+ LI D+A+G V 
Sbjct  111  DSLVVSIGYRGRELGVVKSKGGHLRARDSSYIDATLELDGLEVVHDVIYLIGDLAKGVVP  170

Query  623  FDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            FDTV ++ G LG+ L  +P+QGKVSCE+ VN  N+ ISHQ+C+ +
Sbjct  171  FDTVAQVKGDLGVLLFQIPIQGKVSCEVYVNVNNQKISHQDCHSK  215



>ref|XP_010450318.1| PREDICTED: uncharacterized protein LOC104732466 [Camelina sativa]
Length=215

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 149/225 (66%), Gaps = 13/225 (6%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYIS--RTCRRRLIYS  265
            M SS+H D   P        + PLP+   +   I++ P  YR H   S  R  R  L+++
Sbjct  1    MASSKHQDYGIP--------YTPLPSSQPSQTVILLTP--YRRHRRPSFLRNLRCSLLFA  50

Query  266  AGllllavavflIWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDY  442
            A +LLL+ AV+ ++PSDP ++V+R+ L    V      +LD+   L +KV+NRDF+S+DY
Sbjct  51   AAILLLSAAVYFLYPSDPDITVSRINLNHISVLDSHKIALDLSFSLTIKVRNRDFFSLDY  110

Query  443  NALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVT  622
            ++LVVSI YR + LG V S+ GHL+AR SSYI+ATL+L G+E++ DV+ LI D+A+G V 
Sbjct  111  DSLVVSIGYRGRELGVVKSKGGHLRARDSSYIDATLELDGLEVVHDVIYLIGDLAKGVVP  170

Query  623  FDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            FDTV ++ G LG+ L  +P+QGKVSCE+ VN  N+ ISHQ+C+ +
Sbjct  171  FDTVAQVKGDLGVLLFQIPIQGKVSCEVYVNVNNQKISHQDCHSK  215



>ref|XP_008367874.1| PREDICTED: uncharacterized protein LOC103431496 [Malus domestica]
Length=217

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 144/216 (67%), Gaps = 11/216 (5%)
 Frame = +2

Query  128  SCSTQERYFHPLPAEPQTPQ---YIIVLPNYYRSHSYISRTCRRRL-IY---SAGlllla  286
            S  ++  ++ P+P+ P  PQ    ++VL +Y  +  Y    CRR L +Y   +  LLLL+
Sbjct  3    SSKSEYVFYAPIPSGPYNPQPQQNVVVLTHYRPTPDY---CCRRSLRLYISITTSLLLLS  59

Query  287  vavflIWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSI  463
             A F ++PSDP V +AR+ L   R++  P P+LD+   L ++V+NRDF+S++Y++L V++
Sbjct  60   AAAFFLYPSDPTVQLARISLNHVRINAAPKPTLDLSFSLTIRVRNRDFFSLNYDSLKVTV  119

Query  464  AYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             YR + LG+V+S+ G ++ARASSY+NATL + G+E++ DV  L+ED A+G + FDT TE+
Sbjct  120  GYRARELGFVSSDGGRVRARASSYVNATLVIDGLEVLHDVFYLLEDFAKGVIPFDTDTEV  179

Query  644  SgqlglflldlplqgKVSCEIVVNTKNETISHQNCY  751
             G LGL    +P++ + SCE+ V T N+T+  ++CY
Sbjct  180  DGSLGLLFFKIPIKARASCEVYVGTTNQTVVREDCY  215



>ref|XP_010440608.1| PREDICTED: uncharacterized protein LOC104723875 [Camelina sativa]
Length=216

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 150/216 (69%), Gaps = 8/216 (4%)
 Frame = +2

Query  128  SCSTQERY---FHPLPAEPQTPQYIIVLPNY--YRSHSYISRTCRRRLIYSAGllllava  292
            S   QE Y   + PLP+  Q  Q +I+L  Y  +R  S++ R  R  L+++A +LLL+ A
Sbjct  3    STKHQEDYGIPYTPLPSS-QPSQTVILLTPYLRHRRTSFL-RNLRCSLLFAAAILLLSAA  60

Query  293  vflIWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAY  469
            V+L++PSDP ++V+R+ L    V      +LD+   L +KV+NRDF+S+DY++LVVSI Y
Sbjct  61   VYLLYPSDPDITVSRINLNHISVLDSHKIALDLSFSLTIKVRNRDFFSLDYDSLVVSIGY  120

Query  470  RRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISg  649
            R + LG V S+ GHL+AR SSYI+ATL+L G+E++ DV+ LI D+A+G V FDTV ++ G
Sbjct  121  RGRELGVVKSKGGHLRARDSSYIDATLELDGLEVVHDVIYLIGDLAKGVVPFDTVAQVKG  180

Query  650  qlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
             LG+ L  +P+QGKVSCE+ VN  N+ ISHQ+C+ +
Sbjct  181  DLGVLLFQIPIQGKVSCEVYVNVNNQKISHQDCHSK  216



>ref|XP_010088829.1| hypothetical protein L484_020812 [Morus notabilis]
 gb|EXB37026.1| hypothetical protein L484_020812 [Morus notabilis]
Length=250

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 134/207 (65%), Gaps = 5/207 (2%)
 Frame = +2

Query  152  FHPLPAEPQTPQY---IIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflI-WPSDP  319
            + PLP  P    Y   ++VLP Y  S S        R + ++  +LL +A   I +PSDP
Sbjct  10   YSPLPPNPTATAYHQNVVVLPYYRPSPSKRRSRRLCRCLLASAAVLLLIAAVFILYPSDP  69

Query  320  GVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVT  496
             + + R+ L   RV+  P  +LD+   L VKV NRDF+S+DY++L VS+ YR + LG+V 
Sbjct  70   SLQLVRVHLNRVRVNSSPDLTLDLSFFLTVKVFNRDFFSLDYDSLAVSVGYRGRELGFVN  129

Query  497  SEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldl  676
            S+ G ++AR SSY++ATL L G  II DV  L+ED+ARG + FDTVT++ G LGLFL  +
Sbjct  130  SDGGKIRARGSSYVDATLDLNGFAIIQDVFYLLEDLARGVIPFDTVTKVEGNLGLFLFKI  189

Query  677  plqgKVSCEIVVNTKNETISHQNCYPE  757
            PL+  VSCE+ VNT N+TI+ Q+CYPE
Sbjct  190  PLKASVSCEVYVNTNNQTIARQDCYPE  216



>ref|XP_008779021.1| PREDICTED: uncharacterized protein LOC103698755 [Phoenix dactylifera]
Length=234

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            IWPSDP + VARL+L   RV P P  ++D+ L L ++V+N+DF+++DY +L VSI YR +
Sbjct  82   IWPSDPDIQVARLRLDRLRVSPPPRAAIDVSLGLRIRVRNQDFFALDYRSLAVSIGYRGR  141

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG  TS+ GH++AR  SY++A LQL G+E++ D   LIED+ARG +  D +TE+ G+L 
Sbjct  142  RLGNATSDGGHVRARGVSYVDAELQLDGIEVLNDAFYLIEDIARGFLPLDAITEVQGKLR  201

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF  + P+QGK+SC + VN + + I  Q+CYPE
Sbjct  202  LFFFEFPVQGKISCSLNVNPETQKIIRQDCYPE  234



>gb|KHG14734.1| Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B [Gossypium 
arboreum]
Length=214

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 143/213 (67%), Gaps = 5/213 (2%)
 Frame = +2

Query  134  STQERYFHPLPAEPQTP----QYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavfl  301
            S Q+   + +P    +P    Q ++VLP YY  H+   R  R  L +++ +LLL+ A+FL
Sbjct  2    SKQDLRHYSVPYSRLSPNPNHQNVVVLPVYYPRHNDNYRCLRHCLAFTSVILLLSAALFL  61

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            ++PSDP + +ARL+L    V+  P  +LD+   L ++V+NRDF+S+DY+ LVVS+ YR +
Sbjct  62   LYPSDPTLELARLQLNHVGVNTSPKLTLDLSFSLTIRVRNRDFFSLDYDKLVVSVGYRGR  121

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG V+SE G ++AR SSY+NATL L G E++ DV+ L+ D A+G + FDT T++ G LG
Sbjct  122  ELGLVSSEGGRVRARGSSYVNATLDLDGFEVVHDVIYLLSDWAKGVIPFDTTTKVDGDLG  181

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LFL  +PL+ KVSCE+ ++  N++I  Q+CY E
Sbjct  182  LFLFKIPLKAKVSCEVYMDRNNQSIVRQDCYAE  214



>ref|XP_008801697.1| PREDICTED: uncharacterized protein LOC103715738 [Phoenix dactylifera]
Length=232

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WPSDP V V RL+L    V   P  SL + + L V+VQN+DF+S+DY+++VVSI YR +R
Sbjct  79   WPSDPDVRVVRLRLDRVHVSTSPAVSLAVSMGLEVRVQNKDFFSLDYDSIVVSIGYRGRR  138

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG VTS+ GH++AR  SY++A L + G+E+I D L LIED  RGS+ FDT+T++ G+L  
Sbjct  139  LGSVTSKGGHVRARGVSYVDAELHIDGIEVINDALYLIEDFVRGSIPFDTITKVGGKLHF  198

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            F  D+P+QG++SC + V+ +NET+  Q+CYPE
Sbjct  199  FFFDIPIQGRISCSVHVSAQNETVVRQDCYPE  230



>ref|XP_002304190.2| hypothetical protein POPTR_0003s05380g, partial [Populus trichocarpa]
 gb|EEE79169.2| hypothetical protein POPTR_0003s05380g, partial [Populus trichocarpa]
Length=171

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WPSDP + V  L+L   R+H  P  ++D+ L + ++V+N D YS+D+ +L V++ Y+ KR
Sbjct  20   WPSDPMIKVVGLRLDKIRIHTLPIINIDLSLYVTLRVRNVDVYSMDFRSLDVAVRYKGKR  79

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG+V S+ GH++A  SSY++A + L+G+ +++ V+ L+ED+ RG+V FDTVTE+SG+LGL
Sbjct  80   LGHVRSDHGHVRALGSSYVDAEIDLRGISVLSGVVSLLEDLGRGTVPFDTVTEVSGKLGL  139

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
                 PL+ +VSCE++VNT N+TI  Q CYPE
Sbjct  140  LFFGFPLKARVSCEVLVNTHNQTIVRQTCYPE  171



>ref|XP_011001617.1| PREDICTED: uncharacterized protein LOC105108847 isoform X2 [Populus 
euphratica]
Length=219

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + V  L+L   RVH  P  ++D+ L + ++V+N D YS+D+++L V++ Y+ K
Sbjct  65   FWPSDPMIKVVGLRLDKIRVHTLPIINIDLSLYVTLRVRNVDVYSMDFSSLDVAVKYKGK  124

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG+V S  GH++A  SSY++A + L+G+  ++DV+ L+ED+ RG+V FDTVTE+SG+LG
Sbjct  125  RLGHVRSGHGHVRALGSSYVDAEIDLRGISALSDVVSLLEDLGRGTVPFDTVTEVSGKLG  184

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            L     PL+ K+SCE++VNT N+TI  Q CYPE
Sbjct  185  LLFFGFPLKAKLSCEVLVNTHNQTIVRQTCYPE  217



>ref|XP_011001618.1| PREDICTED: uncharacterized protein LOC105108847 isoform X3 [Populus 
euphratica]
Length=218

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + V  L+L   RVH  P  ++D+ L + ++V+N D YS+D+++L V++ Y+ K
Sbjct  65   FWPSDPMIKVVGLRLDKIRVHTLPIINIDLSLYVTLRVRNVDVYSMDFSSLDVAVKYKGK  124

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG+V S  GH++A  SSY++A + L+G+  ++DV+ L+ED+ RG+V FDTVTE+SG+LG
Sbjct  125  RLGHVRSGHGHVRALGSSYVDAEIDLRGISALSDVVSLLEDLGRGTVPFDTVTEVSGKLG  184

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            L     PL+ K+SCE++VNT N+TI  Q CYPE
Sbjct  185  LLFFGFPLKAKLSCEVLVNTHNQTIVRQTCYPE  217



>ref|XP_011001616.1| PREDICTED: uncharacterized protein LOC105108847 isoform X1 [Populus 
euphratica]
Length=255

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + V  L+L   RVH  P  ++D+ L + ++V+N D YS+D+++L V++ Y+ K
Sbjct  65   FWPSDPMIKVVGLRLDKIRVHTLPIINIDLSLYVTLRVRNVDVYSMDFSSLDVAVKYKGK  124

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG+V S  GH++A  SSY++A + L+G+  ++DV+ L+ED+ RG+V FDTVTE+SG+LG
Sbjct  125  RLGHVRSGHGHVRALGSSYVDAEIDLRGISALSDVVSLLEDLGRGTVPFDTVTEVSGKLG  184

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            L     PL+ K+SCE++VNT N+TI  Q CYPE
Sbjct  185  LLFFGFPLKAKLSCEVLVNTHNQTIVRQTCYPE  217



>emb|CDX87901.1| BnaC06g09630D [Brassica napus]
Length=212

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 118/179 (66%), Gaps = 2/179 (1%)
 Frame = +2

Query  224  SYISRTCRRRLIYSAGllllavavflI-WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLD  397
            S+ S   RRR I S  L+  A  +  I WPSDP + + R+K+    VH  P PS+D+ + 
Sbjct  33   SHPSSISRRRFIISLFLISFASILIYIFWPSDPRIKIERVKVSHVHVHRRPVPSIDMTML  92

Query  398  LIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIIT  577
            + +KV N D YS D+ AL V+I YR K LG+V+S+ GH+KA  SSY+ A  QL GV +  
Sbjct  93   VTLKVSNADVYSFDFTALDVAIGYRGKTLGHVSSDGGHVKAMGSSYLEAETQLDGVTVFA  152

Query  578  DVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYP  754
            DV+ LI D+A+GS+ FDTVTE +G+LG+     PL+ KV+C I++NT N+TIS Q+C P
Sbjct  153  DVINLIHDLAKGSIEFDTVTETNGKLGVLFFRFPLKAKVACGILINTVNQTISRQSCRP  211



>ref|XP_009347170.1| PREDICTED: uncharacterized protein LOC103938851 [Pyrus x bretschneideri]
Length=217

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 141/213 (66%), Gaps = 5/213 (2%)
 Frame = +2

Query  128  SCSTQERYFHPLPAEPQTPQ---YIIVLPNYYRSHSYISRTCRRRLI-YSAGllllavav  295
            S  ++  ++ P+P+ P  PQ    ++VL +Y  +  Y  R   R  I  +  LLLL+ AV
Sbjct  3    SSKSEYVFYAPIPSGPYNPQPQQNVVVLTHYRPTPDYCCRRSLRLCISITTSLLLLSAAV  62

Query  296  flIWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYR  472
            F ++PSDP + + R+ L   R++  P P+LD+   L ++++NRDF+S++Y++L V++ YR
Sbjct  63   FFLYPSDPTLQLVRINLNHVRINAAPKPTLDLSFSLTIRIRNRDFFSLNYDSLKVTVGYR  122

Query  473  RKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgq  652
             + LG V+S+ G ++ARASSY+NATL + G++++ DV  L+ED+A+G + FDT TE+ G 
Sbjct  123  ARELGVVSSDGGRVRARASSYVNATLVIDGLQVLHDVFYLLEDLAKGVIPFDTDTEVDGS  182

Query  653  lglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            LGL    +P++ + SCE+ V T N+T+  ++CY
Sbjct  183  LGLLFFKIPIKARASCEVYVGTTNQTVVREDCY  215



>emb|CAN72107.1| hypothetical protein VITISV_044045 [Vitis vinifera]
Length=224

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 122/170 (72%), Gaps = 5/170 (3%)
 Frame = +2

Query  140  QERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRR-RLIYSAGllllavavflIWPSD  316
            Q  Y+ P+P++P + +  +VLP Y      + R C R RL+ +A +LLL  + F++WPSD
Sbjct  27   QLPYYTPVPSQPASERNYVVLPLYI---PLLHRRCNRFRLLTAAAVLLLVASTFVLWPSD  83

Query  317  PGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYV  493
            P VS+ RL+LR   VH FP  SLD+ + L+VKV+N D YS++Y +L V+I YR K LG V
Sbjct  84   PDVSIVRLRLRRIAVHTFPRLSLDVSMSLMVKVRNVDLYSMNYRSLHVAIEYRGKELGNV  143

Query  494  TSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
            TSEEGH++AR SS ++A+L+L GV +++DV+ ++ED+A+G++  DTVTE+
Sbjct  144  TSEEGHVRARGSSLVDASLELNGVAVLSDVIFVLEDLAKGTIPIDTVTEV  193



>ref|XP_010907059.1| PREDICTED: uncharacterized protein LOC105033825 [Elaeis guineensis]
Length=230

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 139/234 (59%), Gaps = 23/234 (10%)
 Frame = +2

Query  101  SRHSDPL---PPSCSTQERYFHPLPAEPQTPQYIIVLPNY-----------YRSHSYISR  238
               SDPL   PPS   Q     P P     P Y++ LP +               S +S 
Sbjct  5    GEQSDPLLHPPPSYLAQ-----PSPYYSDPPAYVL-LPAFPGRRLRLRRPCRCCDSLVSS  58

Query  239  TCRRRLIYSAGllllavavflIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQ  415
            +    L+++A LL  A+    +WPSDP V + RL+L    V   P  SL + + L V+V 
Sbjct  59   STLLTLVFAAALLTSALFF--LWPSDPEVRIVRLRLDRVHVSTSPAVSLAVSMGLEVRVW  116

Query  416  NRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLI  595
            N+DF+S+DY+++VV I YR +RLG VTS+ GH++AR  SY++A L + G+E+I D   LI
Sbjct  117  NKDFFSLDYDSIVVCIEYRGRRLGSVTSQGGHVRARGVSYVDAELHIDGIEVINDAFYLI  176

Query  596  EDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            ED  RGS+ FDT+T++ G+L LF  D+P+QGK+SC + VN  N+T+  Q+CYP+
Sbjct  177  EDFVRGSIPFDTITKVEGKLHLFFFDIPIQGKISCSMHVNALNQTVVRQDCYPD  230



>ref|XP_010937299.1| PREDICTED: uncharacterized protein LOC105056689 isoform X2 [Elaeis 
guineensis]
Length=236

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPSDP + VARL+L   RV P P  ++D+ L L ++V+N+DF+++DY +L VSI YR +
Sbjct  80   LWPSDPDIQVARLRLDRLRVSPPPHAAIDVSLGLQIRVRNQDFFALDYRSLAVSIGYRGR  139

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG VTS+ GHL+AR  SY++A L+L G++++ D   LIED+ARG +  D VT++ G+L 
Sbjct  140  PLGNVTSDGGHLRARGVSYVDAELELDGIQVLNDAFYLIEDLARGVLPLDAVTKVQGKLR  199

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF L++P+QG++SC + VN + + I  Q+CYPE
Sbjct  200  LFFLEIPVQGRISCSVNVNPETQIIIRQDCYPE  232



>ref|XP_010937311.1| PREDICTED: uncharacterized protein LOC105056689 isoform X3 [Elaeis 
guineensis]
Length=232

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPSDP + VARL+L   RV P P  ++D+ L L ++V+N+DF+++DY +L VSI YR +
Sbjct  80   LWPSDPDIQVARLRLDRLRVSPPPHAAIDVSLGLQIRVRNQDFFALDYRSLAVSIGYRGR  139

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG VTS+ GHL+AR  SY++A L+L G++++ D   LIED+ARG +  D VT++ G+L 
Sbjct  140  PLGNVTSDGGHLRARGVSYVDAELELDGIQVLNDAFYLIEDLARGVLPLDAVTKVQGKLR  199

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF L++P+QG++SC + VN + + I  Q+CYPE
Sbjct  200  LFFLEIPVQGRISCSVNVNPETQIIIRQDCYPE  232



>ref|XP_009374010.1| PREDICTED: uncharacterized protein LOC103962955 [Pyrus x bretschneideri]
Length=217

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 142/213 (67%), Gaps = 5/213 (2%)
 Frame = +2

Query  128  SCSTQERYFHPLPAEPQTPQ---YIIVLPNYYRSHSYI-SRTCRRRLIYSAGllllavav  295
            S  ++  ++ P+P+ P  PQ    ++VL +Y  +  Y   R+ R  +  +  LLLL+ AV
Sbjct  3    SSKSEYVFYAPIPSGPYNPQPQQNVVVLTHYRPTPDYCCQRSLRLCISITTSLLLLSAAV  62

Query  296  flIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYR  472
            F ++PSDP + +AR+ L   R++  P  +LD+   L ++V+NRDF+S++Y++L V++ YR
Sbjct  63   FFLYPSDPTLQLARINLNHVRINAAPKLTLDLSFSLTIRVRNRDFFSLNYDSLKVTVGYR  122

Query  473  RKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgq  652
             + LG V+S+ G ++ARASSY+NATL + G++++ DV  L+ED+A+G + FDT TE+ G 
Sbjct  123  ARELGVVSSDGGRVRARASSYVNATLVIDGLQVLHDVFYLLEDLAKGVIPFDTDTEVDGS  182

Query  653  lglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            LGL    +P++ + SCE+ V T N+T+  ++CY
Sbjct  183  LGLLFFKIPIKARASCEVYVGTTNQTVVREDCY  215



>ref|XP_002299644.2| hypothetical protein POPTR_0001s18090g [Populus trichocarpa]
 gb|EEE84449.2| hypothetical protein POPTR_0001s18090g [Populus trichocarpa]
Length=220

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP V V RL+L    +H  P  ++DI L + +KV+N D YS+D+ +L V++ YR K
Sbjct  67   FWPSDPTVKVVRLRLNKIHIHTLPIINIDISLYVSLKVRNVDVYSMDFRSLDVAVKYRGK  126

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG+V S+ GH++A  SSY++A +   G+ +++DV+ L++D+ARG+V FDTVTE+SG+LG
Sbjct  127  RLGHVRSDHGHVRALGSSYVHAGVDFSGISVLSDVVSLLDDLARGTVPFDTVTEVSGRLG  186

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            L     P++ K+ C ++VN  N+TI  Q CYPE
Sbjct  187  LLFFGFPMKAKLFCAVLVNINNQTIVRQTCYPE  219



>ref|XP_010937290.1| PREDICTED: uncharacterized protein LOC105056689 isoform X1 [Elaeis 
guineensis]
Length=241

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPSDP + VARL+L   RV P P  ++D+ L L ++V+N+DF+++DY +L VSI YR +
Sbjct  80   LWPSDPDIQVARLRLDRLRVSPPPHAAIDVSLGLQIRVRNQDFFALDYRSLAVSIGYRGR  139

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG VTS+ GHL+AR  SY++A L+L G++++ D   LIED+ARG +  D VT++ G+L 
Sbjct  140  PLGNVTSDGGHLRARGVSYVDAELELDGIQVLNDAFYLIEDLARGVLPLDAVTKVQGKLR  199

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF L++P+QG++SC + VN + + I  Q+CYPE
Sbjct  200  LFFLEIPVQGRISCSVNVNPETQIIIRQDCYPE  232



>ref|XP_009144850.1| PREDICTED: uncharacterized protein LOC103868509 [Brassica rapa]
 ref|XP_009144851.1| PREDICTED: uncharacterized protein LOC103868509 [Brassica rapa]
 ref|XP_009144852.1| PREDICTED: uncharacterized protein LOC103868509 [Brassica rapa]
 emb|CDY49899.1| BnaA05g14940D [Brassica napus]
Length=212

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 128/202 (63%), Gaps = 9/202 (4%)
 Frame = +2

Query  167  AEPQTPQYIIVLPNYYRSH------SYISRTCRRRLIYSAGllllavavflI-WPSDPGV  325
            A P +P+Y   LP+  R        S+ S   RRR I S  L+  A  +  I WPSDP +
Sbjct  9    ATPSSPEYK-PLPSSSRDLDGAVLISHPSSIRRRRFIISLFLISFASILSYIFWPSDPRI  67

Query  326  SVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
             + R+K+    VH  P PS+D+ + + +KV N D YS D+ AL V+I YR K LG+V+S+
Sbjct  68   KIERVKVSHVHVHRRPVPSIDMTMLVTLKVSNADVYSFDFTALDVAIGYRGKTLGHVSSD  127

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GH++A  SSY+ A  QL GV +  DV+ LI D+A+GS+ FDTVTE +G+LG+F    PL
Sbjct  128  GGHVRAMGSSYLEAETQLDGVSVFADVINLIHDLAKGSIEFDTVTETNGKLGVFFFRFPL  187

Query  683  qgKVSCEIVVNTKNETISHQNC  748
            + KV+C I++NT N+TIS Q+C
Sbjct  188  KAKVACGILINTVNQTISRQSC  209



>ref|XP_003534194.1| PREDICTED: uncharacterized protein LOC100793858 [Glycine max]
Length=257

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 134/201 (67%), Gaps = 10/201 (5%)
 Frame = +2

Query  182  PQYIIVLPNYYRSH-SYISRTCRRRLIYSAGl---lllavavflIWPSDPGVSVARLKLR  349
            PQ ++VL   YR H     R C   +IYSA L   LL+A A FL++PSDP + +AR++L 
Sbjct  47   PQNVVVLLPSYRPHFQRRRRRC---IIYSAALFLFLLVAGAAFLLYPSDPEIRLARIRLD  103

Query  350  --GFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKAR  523
              G R +P  P LD+   L VKV+NRDF+S+ Y++L VS+ YR ++LG+VT+  G ++AR
Sbjct  104  RIGIRTNP-RPILDLSFSLTVKVRNRDFFSLSYDSLTVSVGYRGRQLGFVTAGGGSIRAR  162

Query  524  ASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCE  703
             SSY++ATL + G E+I D   L+ED+A+G + FDT T + G+LGLF   +PL+  VSCE
Sbjct  163  GSSYVDATLTIDGFEVIYDAFYLLEDIAKGVIPFDTDTRVEGKLGLFFFTVPLKATVSCE  222

Query  704  IVVNTKNETISHQNCYPE*YG  766
            + VN   +TI  Q+CYP+  G
Sbjct  223  VDVNINQQTIVRQDCYPKSLG  243



>ref|XP_007216392.1| hypothetical protein PRUPE_ppa021471mg [Prunus persica]
 gb|EMJ17591.1| hypothetical protein PRUPE_ppa021471mg [Prunus persica]
Length=232

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + + RL+L   +VH  P  ++D+ + + +KV+N D Y +DY+AL V++ YR +
Sbjct  62   FWPSDPSLKIVRLRLNRVQVHTRPHVAIDVSMLVTIKVRNGDVYRMDYDALEVAVGYRGR  121

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG+VT + GH++A  SSY+ A ++  GV + +DV+ L+ED+A+G V FDTVTE+ G+LG
Sbjct  122  SLGHVTFQRGHVRAFGSSYMEAEVEFNGVGVFSDVVLLLEDLAKGKVPFDTVTEVHGRLG  181

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
                + PLQ +VSCE++VNT N+TI   NCY E
Sbjct  182  FLFFEFPLQARVSCEVMVNTVNQTILRHNCYEE  214



>ref|XP_008342697.1| PREDICTED: uncharacterized protein LOC103405471 isoform X2 [Malus 
domestica]
 ref|XP_008342708.1| PREDICTED: uncharacterized protein LOC103405480 [Malus domestica]
Length=213

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPS+P + + RL+L   +VH  P  ++D+ + + +KVQN D Y++DY AL V++ YR +
Sbjct  62   LWPSEPSLKIVRLRLNKVQVHTRPRVTIDVSMSVTIKVQNVDVYAMDYEALEVAVGYRGR  121

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG+ T ++G+++A  SSY++A ++   V + +DV+ L+ED+A+G+V FDTVTE+ G+LG
Sbjct  122  RLGHATFQQGYVRALGSSYLDAEVEFNEVGVFSDVVLLLEDLAKGTVPFDTVTEVQGRLG  181

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCY  751
                  PLQ +VSCE++VNT N+TI   NCY
Sbjct  182  FLFFQFPLQARVSCEVMVNTVNQTIFRHNCY  212



>ref|XP_002466626.1| hypothetical protein SORBIDRAFT_01g011230 [Sorghum bicolor]
 gb|EER93624.1| hypothetical protein SORBIDRAFT_01g011230 [Sorghum bicolor]
Length=231

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 107/152 (70%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WP+DP VS+ARL+L    V   P  ++ I   L V+V+N DF+++DYN L V+IAYR   
Sbjct  80   WPADPDVSLARLRLAHVSVVARPAVAVTISAALKVRVRNPDFFALDYNRLDVAIAYRGAP  139

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG VTS  G ++ARA SY++A LQL G+ ++ D + L+ED+ARGSV FDT+ E+ G L  
Sbjct  140  LGRVTSGGGRVRARAVSYVDADLQLDGIRVVEDAIYLVEDLARGSVPFDTIVEVEGHLHF  199

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            F L +P++G++SC + VN  NETI HQ+CYPE
Sbjct  200  FFLSIPVKGRISCVVHVNPHNETIVHQDCYPE  231



>ref|XP_008342696.1| PREDICTED: uncharacterized protein LOC103405471 isoform X1 [Malus 
domestica]
Length=219

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPS+P + + RL+L   +VH  P  ++D+ + + +KVQN D Y++DY AL V++ YR +
Sbjct  62   LWPSEPSLKIVRLRLNKVQVHTRPRVTIDVSMSVTIKVQNVDVYAMDYEALEVAVGYRGR  121

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG+ T ++G+++A  SSY++A ++   V + +DV+ L+ED+A+G+V FDTVTE+ G+LG
Sbjct  122  RLGHATFQQGYVRALGSSYLDAEVEFNEVGVFSDVVLLLEDLAKGTVPFDTVTEVQGRLG  181

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCY  751
                  PLQ +VSCE++VNT N+TI   NCY
Sbjct  182  FLFFQFPLQARVSCEVMVNTVNQTIFRHNCY  212



>ref|XP_011032795.1| PREDICTED: uncharacterized protein LOC105131491 isoform X2 [Populus 
euphratica]
Length=220

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP V V RL+L    +H  P  ++DI L + +KV+N D YS+ + +L V++ YR K
Sbjct  67   FWPSDPTVKVVRLRLNKIHIHTLPIINIDISLYVTLKVRNVDVYSMYFRSLDVAVKYRGK  126

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG+V S+ G+++A  SSY++A +   G+ +++DV+ L++D+ARG+V FDTVTE+SG+LG
Sbjct  127  RLGHVRSDHGYVRALGSSYVDAEVDFSGISVLSDVVSLLDDLARGTVPFDTVTEVSGRLG  186

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            L     PL+ K+ C ++VNT N+TI  Q CYPE
Sbjct  187  LLFFGFPLKAKLFCAVLVNTNNQTIVRQTCYPE  219



>ref|XP_002514321.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48275.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score =   140 bits (353),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            ++PSDP + +AR++L    V+  P  +LD+   L+++V+NRDF+S+DY+ L VS+ YR K
Sbjct  83   LYPSDPSLQLARIQLNHIHVNSSPKFTLDLSFSLLIRVKNRDFFSLDYDTLDVSVGYRGK  142

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG V+S+ G+++ R SSYI+A L L G+EI+ DV  LIED+ARG + FDT T ++G+LG
Sbjct  143  ELGVVSSKGGNVRPRGSSYISAALDLNGLEIVHDVFYLIEDLARGVIPFDTDTMVNGELG  202

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
             F   +P++ KVSCE+ VNT N+TI  ++C+P+
Sbjct  203  FFFFKIPIKAKVSCEVYVNTVNQTIVREDCHPQ  235



>ref|XP_011032794.1| PREDICTED: uncharacterized protein LOC105131491 isoform X1 [Populus 
euphratica]
Length=232

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP V V RL+L    +H  P  ++DI L + +KV+N D YS+ + +L V++ YR K
Sbjct  67   FWPSDPTVKVVRLRLNKIHIHTLPIINIDISLYVTLKVRNVDVYSMYFRSLDVAVKYRGK  126

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG+V S+ G+++A  SSY++A +   G+ +++DV+ L++D+ARG+V FDTVTE+SG+LG
Sbjct  127  RLGHVRSDHGYVRALGSSYVDAEVDFSGISVLSDVVSLLDDLARGTVPFDTVTEVSGRLG  186

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            L     PL+ K+ C ++VNT N+TI  Q CYPE
Sbjct  187  LLFFGFPLKAKLFCAVLVNTNNQTIVRQTCYPE  219



>ref|XP_010098050.1| hypothetical protein L484_026181 [Morus notabilis]
 gb|EXB74487.1| hypothetical protein L484_026181 [Morus notabilis]
Length=188

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 116/178 (65%), Gaps = 8/178 (4%)
 Frame = +2

Query  116  PLPPSCSTQERYFHPLPAEPQTP-QYIIVLPNYYRSHSYISRTCRRRLIYSAGllllava  292
            P+P + S++ +   PL   P  P Q  +VLP Y+  H       RR  I + G+ LL  A
Sbjct  2    PIPMASSSKSKT-EPLNHTPLPPDQNYVVLPLYFPRHR-----LRRCAISAVGVALLITA  55

Query  293  vflIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAY  469
             +  WPSDP + V R++L+  RVH  P  ++D+ + L V+V+N D YS+DY+AL V++ Y
Sbjct  56   AYAFWPSDPDIKVVRMRLKSVRVHRTPHVAVDVSVSLTVRVRNDDVYSMDYSALDVAVGY  115

Query  470  RRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
            R K +G+V S+ GH++AR SSY++A L L G+EI +DV+ L+ED+A+G+V FDTVT +
Sbjct  116  RGKWMGHVRSDGGHVRARGSSYVDAELDLDGIEIFSDVVFLLEDLAKGTVRFDTVTAV  173



>ref|XP_002891688.1| hypothetical protein ARALYDRAFT_474353 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67947.1| hypothetical protein ARALYDRAFT_474353 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 126/203 (62%), Gaps = 8/203 (4%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflI-WPSDPGVS  328
            + PLP+        +++     SHS  S T RRR I S  L+  A  +  I WPSDP + 
Sbjct  17   YKPLPSSSHDQNDAVLI----SSHS--SFTSRRRFIISIFLISFASILIYIFWPSDPRIK  70

Query  329  VARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEE  505
            + R+K+    VH  P PS+D+ L + +KV N D YS D+  L V+I YR K LG+V+S+ 
Sbjct  71   IVRVKISHVHVHRRPVPSIDMTLLVTLKVSNADVYSFDFTDLDVTIDYRGKTLGHVSSDG  130

Query  506  GHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplq  685
            GH+ A  SSY++A  +L GV +  DV+ LI D+A+GSV FDTVTE +G LG++    PL+
Sbjct  131  GHVTAFGSSYLDAEAELDGVTVFPDVIHLIHDLAKGSVEFDTVTETNGNLGVWFFRFPLK  190

Query  686  gKVSCEIVVNTKNETISHQNCYP  754
             KV+C I+V T N+TIS Q+C P
Sbjct  191  AKVACGILVITVNQTISRQSCSP  213



>ref|XP_008228515.1| PREDICTED: uncharacterized protein LOC103327919 [Prunus mume]
Length=213

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + + RL+L   +VH  P  ++D+ + + +KV+N D Y +DY AL V++ YR +
Sbjct  62   FWPSDPSLKIVRLRLNRVQVHTRPHVAIDVSMLVTIKVRNGDVYRMDYEALEVAVGYRGR  121

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG+VT + GH++A  SSY+ A ++  GV + +DV+ L+ED+A+G V FDTVTE+ G+LG
Sbjct  122  SLGHVTFQRGHVRAFGSSYMEAEVEFNGVGVFSDVVLLLEDLAKGKVPFDTVTEVHGRLG  181

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCY  751
                + PLQ +VSCE++VNT N+TI   NCY
Sbjct  182  FLFFEFPLQARVSCEVMVNTVNQTILRHNCY  212



>gb|KDO51223.1| hypothetical protein CISIN_1g027729mg [Citrus sinensis]
Length=203

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 118/189 (62%), Gaps = 12/189 (6%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAG  271
            M  S+ + PLPP+  +Q  Y+  LP +PQ   Y I LP YY  +        RR  Y+  
Sbjct  1    MAPSKTTSPLPPATPSQPHYYTVLPPQPQDENYTI-LPYYYLENP-------RRNWYATI  52

Query  272  llllavavf---lIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVD  439
             + L +      + WPS+P + + RL L  F V   P   +DI L++ +KV NRD YSV+
Sbjct  53   AISLILLAALLYVFWPSEPELKIERLHLAHFHVRMKPAICIDISLNVTLKVHNRDVYSVN  112

Query  440  YNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSV  619
            Y +L VS+ YR ++LG+V S  G +KA ASS+I+A LQLK V++++DV+ L+ED+ARG+V
Sbjct  113  YKSLDVSVGYRGRKLGHVKSNHGRVKALASSFIDAELQLKCVKVLSDVVYLLEDLARGTV  172

Query  620  TFDTVTEIS  646
             FDT+T+++
Sbjct  173  PFDTITKVT  181



>ref|XP_009413332.1| PREDICTED: uncharacterized protein LOC103994657 [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPSDP ++VARL+L    + P P  + DI L + ++V+N DF+++DY ++VV+I YR +
Sbjct  94   LWPSDPELTVARLRLDDIHITPPPEAAFDISLGVDLRVRNPDFFALDYRSIVVTIGYRGR  153

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG VT+E GH++AR  SY+ A L+L G+ ++ D + LIED+ARGS+  +TVTE+ G++ 
Sbjct  154  PLGSVTAEGGHIRARGVSYVRAKLKLDGIRVLNDAISLIEDLARGSLPLNTVTEVDGRMR  213

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF +D+P+QGK+SC + VN   + +  Q+CYP+
Sbjct  214  LFFIDVPVQGKISCAVTVNPNTQEVISQDCYPK  246



>ref|NP_175643.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAG51539.1|AC037424_4 hypothetical protein; 44111-43310 [Arabidopsis thaliana]
 gb|AAZ52706.1| expressed protein [Arabidopsis thaliana]
 gb|AEE32787.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=214

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 117/179 (65%), Gaps = 2/179 (1%)
 Frame = +2

Query  224  SYISRTCRRRLIYSAGllllavavflI-WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLD  397
            S+ S   RRR I S  L+  A  +  I WPSDP + + R+K+    VH  P PS+D+ L 
Sbjct  35   SHPSPPSRRRFIISIFLISFASILIYIFWPSDPRIKIIRVKISHVHVHRRPVPSIDMTLL  94

Query  398  LIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIIT  577
            + +KV N D YS D+  L V+I YR K LG+V+S+ GH+ A  SSY++A  +L GV +  
Sbjct  95   VTLKVSNADVYSFDFTDLDVTIDYRGKTLGHVSSDGGHVTAFGSSYLDAEAELDGVMVFP  154

Query  578  DVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYP  754
            DV+ LI D+A+GSV FDTVTE +G+LG+     PL+ KV+C I+V+T N+TIS Q+C P
Sbjct  155  DVIHLIHDLAKGSVEFDTVTETNGKLGVLFFRFPLKAKVACGILVDTVNQTISRQSCSP  213



>gb|KHF99951.1| Transmembrane protein [Gossypium arboreum]
Length=200

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 117/180 (65%), Gaps = 12/180 (7%)
 Frame = +2

Query  116  PLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYS--AGllllav  289
            P P  C T       LP +P    Y+ VLP YY     + R C  R++Y+  A   LLA 
Sbjct  16   PSPSHCYTA------LPTQPPDENYV-VLP-YYSPEGRL-RWCGCRMLYTGTASFFLLAT  66

Query  290  avflIWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIA  466
             V++ WPSDP V + R+ +   ++H  P  +LD+ L + +KV+N D YS+D+ +L V++ 
Sbjct  67   LVYIFWPSDPDVKIVRMHVNRMKIHTVPIIALDMSLLITLKVRNSDVYSMDFTSLDVAVG  126

Query  467  YRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
            YR K LG+VTSE+GH+KA  SSY+ A L++ GVE+++DV+ L+ED+A+G+V FDTVTE++
Sbjct  127  YRGKMLGHVTSEQGHVKALGSSYVEAVLEVNGVEVLSDVVYLLEDLAKGTVPFDTVTEVA  186



>ref|XP_010033883.1| PREDICTED: uncharacterized protein LOC104423118 [Eucalyptus grandis]
 gb|KCW53734.1| hypothetical protein EUGRSUZ_J02990 [Eucalyptus grandis]
Length=236

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WPSDP + + RL     R+   P  ++DI +   ++V+N D Y +DY +L V++ YR K 
Sbjct  74   WPSDPRLKIERLWPTRVRIRTLPVLAVDISMLATIRVRNADAYWMDYRSLDVAVGYRGKM  133

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG VTS  G ++A  SSY++A L+L GVE++ +   L+ED+A+GSV FDT+TE+ GQLGL
Sbjct  134  LGRVTSGGGRVRAFGSSYVDAALELNGVEVLAEAAFLLEDLAKGSVPFDTLTEVEGQLGL  193

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE*YG  766
            +    PL+ KVSCE++VNTKN+TI  Q+CYPE  G
Sbjct  194  WFFRFPLKAKVSCEVLVNTKNQTIVRQSCYPERLG  228



>gb|KCW53735.1| hypothetical protein EUGRSUZ_J02990 [Eucalyptus grandis]
Length=236

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WPSDP + + RL     R+   P  ++DI +   ++V+N D Y +DY +L V++ YR K 
Sbjct  74   WPSDPRLKIERLWPTRVRIRTLPVLAVDISMLATIRVRNADAYWMDYRSLDVAVGYRGKM  133

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG VTS  G ++A  SSY++A L+L GVE++ +   L+ED+A+GSV FDT+TE+ GQLGL
Sbjct  134  LGRVTSGGGRVRAFGSSYVDAALELNGVEVLAEAAFLLEDLAKGSVPFDTLTEVEGQLGL  193

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            +    PL+ KVSCE++VNTKN+TI  Q+CYPE
Sbjct  194  WFFRFPLKAKVSCEVLVNTKNQTIVRQSCYPE  225



>ref|XP_006305590.1| hypothetical protein CARUB_v10010254mg [Capsella rubella]
 gb|EOA38488.1| hypothetical protein CARUB_v10010254mg [Capsella rubella]
Length=219

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + + R+K+    VH  P PS+D+ + + +KV N D YS D+  L V++ YR K
Sbjct  67   FWPSDPRIKIVRVKISHVHVHRRPVPSIDMTVLVTLKVSNADVYSFDFTDLDVAVDYRGK  126

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG+V+S+ GH+ A  SSY++A  +L GV++  DV+ LI D+A+GSV FDTVTE +G+LG
Sbjct  127  TLGHVSSDGGHVTAFGSSYLDAEAELDGVDVFPDVVHLIHDLAKGSVEFDTVTETNGKLG  186

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYP  754
            +     PL+ KV+C I+VNT N+TIS Q+C P
Sbjct  187  VMFFRFPLKAKVACGILVNTVNQTISRQSCSP  218



>ref|XP_007013200.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative isoform 2, partial [Theobroma cacao]
 gb|EOY30819.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative isoform 2, partial [Theobroma cacao]
Length=243

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 112/165 (68%), Gaps = 2/165 (1%)
 Frame = +2

Query  152  FHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSV  331
            +  LP+ P   Q +IVLP YY   +   R  RR LI++  ++LL+ AVF ++PSDP + +
Sbjct  57   YAALPSNPNQ-QNVIVLPVYYSRPNQNYRCLRRCLIFTGIVVLLSAAVFFLYPSDPTLQL  115

Query  332  ARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEG  508
             RL+L   RV+  P  +LD+   L ++V+NRDF+S+DY+ LVVS+ YR + LG V+SE G
Sbjct  116  VRLQLNHVRVNSSPALTLDLSFSLTIRVRNRDFFSLDYDKLVVSVGYRGRELGVVSSEGG  175

Query  509  HLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             ++AR SSY+NATL L G E++ DV+ LI D A+G + FDT T++
Sbjct  176  RVRARGSSYVNATLDLNGFEVVHDVIYLIADWAKGVIPFDTNTKV  220



>ref|XP_010500832.1| PREDICTED: uncharacterized protein LOC104778155 [Camelina sativa]
Length=216

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + + R+K+   RVH  P PS+D+ + + +KV N D YS D+  L V++ YR K
Sbjct  64   FWPSDPRIKIERVKISHVRVHRRPVPSIDMTVLVTLKVSNADVYSFDFTDLDVAVDYRGK  123

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG+V+S+ GH+ A  +SY++A  +L+GV +  DV+ LI D+A+GSV FDTVTE +G+LG
Sbjct  124  TLGHVSSDGGHVTAFGTSYLDAEAELEGVTVFPDVIHLIHDLAKGSVEFDTVTETNGKLG  183

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYP  754
            +     PL+ KV+C I VNT N+TIS Q+C P
Sbjct  184  VLFFRFPLKAKVACGIEVNTVNQTISRQSCSP  215



>emb|CAB40762.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78369.1| hypothetical protein [Arabidopsis thaliana]
Length=192

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 122/187 (65%), Gaps = 13/187 (7%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHS--YISRTCRRRLIYS  265
            M SS+H D   P        + PLP+   +   I++ P  YR H    + R  R  L+++
Sbjct  1    MASSKHEDYGIP--------YTPLPSSQPSQSVILLTP--YRRHRRPSLLRNLRCSLLFT  50

Query  266  AGllllavavflIWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDY  442
            A +LLL+ AV+L++PSDP ++V+R+ L    V      +LD+   L +KV+NRDF+S+DY
Sbjct  51   AVILLLSAAVYLLYPSDPDITVSRINLNHISVVDSHKIALDLSFSLTIKVRNRDFFSLDY  110

Query  443  NALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVT  622
            ++LVVSI YR + LG V S+ GHLKAR SSYI+ATL+L G+E++ DV+ LI D+A+G + 
Sbjct  111  DSLVVSIGYRGRELGLVKSKGGHLKARDSSYIDATLELDGLEVVHDVIYLIGDLAKGVIP  170

Query  623  FDTVTEI  643
            FDT+ ++
Sbjct  171  FDTIAQV  177



>ref|XP_007152822.1| hypothetical protein PHAVU_004G162700g [Phaseolus vulgaris]
 gb|ESW24816.1| hypothetical protein PHAVU_004G162700g [Phaseolus vulgaris]
Length=258

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 142/224 (63%), Gaps = 15/224 (7%)
 Frame = +2

Query  116  PLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGl---llla  286
            PLP + +     +H     PQ    +++LP Y        R C   ++YS+ L   LL+A
Sbjct  29   PLPSNPNPNSYAYH----YPQNQNVVVLLPTYRPRLHRRRRRC---ILYSSALFLFLLIA  81

Query  287  vavflIWPSDPGVSVARLKLR--GFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVS  460
             A FL++PSDP V +AR++L   G R +P  P LD+   L VKV+NR+F+S+ Y++L VS
Sbjct  82   GAAFLLFPSDPEVHLARIRLNRIGIRANP-RPILDLSFSLTVKVRNRNFFSLSYDSLAVS  140

Query  461  IAYRRKRLGYVTS--EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTV  634
            + YR +++G V++    G ++ARASSY++ATL + G E++ DV  L+EDVA+G + FDT 
Sbjct  141  VGYRGRQIGLVSAPGAGGRIRARASSYVDATLTVDGFEVLYDVFYLLEDVAKGVIPFDTD  200

Query  635  TEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE*YG  766
            + + G+LGLF L +PL+  VSCE+ VN   +TI  Q+CYP+  G
Sbjct  201  SRVEGKLGLFFLTIPLKATVSCEVYVNINQQTIVRQDCYPKSLG  244



>ref|XP_004486731.1| PREDICTED: uncharacterized protein LOC101505811 isoform X3 [Cicer 
arietinum]
Length=203

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 130/205 (63%), Gaps = 14/205 (7%)
 Frame = +2

Query  149  YFHPL-PAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            Y H L P +P+  Q  IV    ++    ++ T    L++++  +         WPSDP +
Sbjct  11   YTHLLWPCQPRNDQNHIVFSKRFQ----VTCTVSLLLLFTSAYI--------FWPSDPYL  58

Query  326  SVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
             + RLKL+  +VH  P  ++DI + L + VQN D YS+D+ A+ V+++YR K LG+V SE
Sbjct  59   KIVRLKLKRIKVHRVPHITVDISMLLTLSVQNADVYSMDFGAVDVAVSYRGKPLGHVRSE  118

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GH++A  SS+++A  +  G+ ++ +++ L+ED+A+G+V FDTV+++ GQ+G+     P+
Sbjct  119  NGHVRAMGSSFVDADAEFAGIGVLPEIVFLLEDLAKGTVPFDTVSQVRGQMGILFFHFPI  178

Query  683  qgKVSCEIVVNTKNETISHQNCYPE  757
            + K+SCE++V+T N+TI  Q+C  E
Sbjct  179  KAKLSCEVLVSTINQTIVRQHCLHE  203



>ref|XP_004486730.1| PREDICTED: uncharacterized protein LOC101505811 isoform X2 [Cicer 
arietinum]
Length=207

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 130/205 (63%), Gaps = 14/205 (7%)
 Frame = +2

Query  149  YFHPL-PAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            Y H L P +P+  Q  IV    ++    ++ T    L++++  +         WPSDP +
Sbjct  11   YTHLLWPCQPRNDQNHIVFSKRFQ----VTCTVSLLLLFTSAYI--------FWPSDPYL  58

Query  326  SVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
             + RLKL+  +VH  P  ++DI + L + VQN D YS+D+ A+ V+++YR K LG+V SE
Sbjct  59   KIVRLKLKRIKVHRVPHITVDISMLLTLSVQNADVYSMDFGAVDVAVSYRGKPLGHVRSE  118

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GH++A  SS+++A  +  G+ ++ +++ L+ED+A+G+V FDTV+++ GQ+G+     P+
Sbjct  119  NGHVRAMGSSFVDADAEFAGIGVLPEIVFLLEDLAKGTVPFDTVSQVRGQMGILFFHFPI  178

Query  683  qgKVSCEIVVNTKNETISHQNCYPE  757
            + K+SCE++V+T N+TI  Q+C  E
Sbjct  179  KAKLSCEVLVSTINQTIVRQHCLHE  203



>ref|XP_006392931.1| hypothetical protein EUTSA_v10011771mg [Eutrema salsugineum]
 gb|ESQ30217.1| hypothetical protein EUTSA_v10011771mg [Eutrema salsugineum]
Length=214

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WPSDP + + R+++    VH  P PS+D+ + + +K+ N D YS D+ AL V I YR K 
Sbjct  63   WPSDPRIKIERVRISHVSVHRRPVPSIDMTMLVTLKISNADVYSFDFTALDVEIDYRGKT  122

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG+V+S+ GH++A  SSY+ A  +L GV +  DV+ LI D+A GSV FDTVTE +G+LG+
Sbjct  123  LGHVSSDGGHVRAMGSSYLEAETELDGVTVFADVIHLIHDLAMGSVEFDTVTETNGKLGI  182

Query  662  flldlplqgKVSCEIVVNTKNETISHQNC  748
                 PL+ KV+C I VNT N+TIS Q+C
Sbjct  183  LFFRFPLKAKVACGIQVNTVNQTISRQSC  211



>ref|XP_010462071.1| PREDICTED: uncharacterized protein LOC104742737 [Camelina sativa]
Length=217

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + + R+K+   RVH  P PS+D+ + + +KV N D YS D+  L V++ YR K
Sbjct  65   FWPSDPRIKIERVKISHVRVHRRPVPSIDMTVLVTLKVSNADVYSFDFTDLDVAVDYRGK  124

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG+V+S+ GH+ A  +SY++A  +L+GV +  DV+ LI D+A+GSV FDTVT+ +G+LG
Sbjct  125  TLGHVSSDGGHVTAFGTSYLDAEAELEGVTVFPDVIHLIHDLAKGSVEFDTVTDTNGKLG  184

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYP  754
            ++    PL+ KV+C I VNT N+TIS Q+C P
Sbjct  185  VWFFRFPLKAKVACGIEVNTVNQTISRQSCSP  216



>gb|AII99859.1| late embryogenesis abundant protein [Cicer arietinum]
Length=212

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 131/208 (63%), Gaps = 14/208 (7%)
 Frame = +2

Query  149  YFHPL-PAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            Y H L P +P+  Q  IV    ++    ++ T    L++++  +         WPSDP +
Sbjct  11   YTHLLWPCQPRNDQNHIVFSKRFQ----VTCTVSLLLLFTSAYI--------FWPSDPYL  58

Query  326  SVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
             + RLKL+  +VH  P  ++DI + L + VQN D YS+D+ A+ V+++YR K LG+V SE
Sbjct  59   KIVRLKLKRIKVHRVPHITVDISMLLTLSVQNADVYSMDFGAVDVAVSYRGKPLGHVRSE  118

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GH++A  SS+++A  +  G+ ++ +++ L+ED+A+G+V FDTV+++ GQ+G+     P+
Sbjct  119  NGHVRAMGSSFVDADAEFAGIGVLPEIVFLLEDLAKGTVPFDTVSQVRGQMGILFFHFPI  178

Query  683  qgKVSCEIVVNTKNETISHQNCYPE*YG  766
            + K+SCE++V+T N+TI  Q+C  E  G
Sbjct  179  KAKLSCEVLVSTINQTIVRQHCLHELCG  206



>ref|XP_004486729.1| PREDICTED: uncharacterized protein LOC101505811 isoform X1 [Cicer 
arietinum]
Length=219

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 130/205 (63%), Gaps = 14/205 (7%)
 Frame = +2

Query  149  YFHPL-PAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGV  325
            Y H L P +P+  Q  IV    ++    ++ T    L++++  +         WPSDP +
Sbjct  11   YTHLLWPCQPRNDQNHIVFSKRFQ----VTCTVSLLLLFTSAYI--------FWPSDPYL  58

Query  326  SVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
             + RLKL+  +VH  P  ++DI + L + VQN D YS+D+ A+ V+++YR K LG+V SE
Sbjct  59   KIVRLKLKRIKVHRVPHITVDISMLLTLSVQNADVYSMDFGAVDVAVSYRGKPLGHVRSE  118

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlpl  682
             GH++A  SS+++A  +  G+ ++ +++ L+ED+A+G+V FDTV+++ GQ+G+     P+
Sbjct  119  NGHVRAMGSSFVDADAEFAGIGVLPEIVFLLEDLAKGTVPFDTVSQVRGQMGILFFHFPI  178

Query  683  qgKVSCEIVVNTKNETISHQNCYPE  757
            + K+SCE++V+T N+TI  Q+C  E
Sbjct  179  KAKLSCEVLVSTINQTIVRQHCLHE  203



>ref|XP_010479741.1| PREDICTED: uncharacterized protein LOC104758554 [Camelina sativa]
Length=215

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 104/152 (68%), Gaps = 1/152 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPSDP + + R+K+   RVH  P PS+D+ + + +KV N D YS D+  L V++ YR K
Sbjct  63   FWPSDPRIKIERVKISHVRVHRRPVPSIDMTVLVTLKVSNADVYSFDFTDLDVAVDYRGK  122

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG+V+S+ GH+ A  +SY++A  +L GV +  DV+ LI D+A+G V FDTVTE +G+LG
Sbjct  123  TLGHVSSDGGHVTAFGTSYLDAEAELDGVTVFPDVIHLIHDLAKGFVEFDTVTETNGKLG  182

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYP  754
            ++    PL+ KV+C I VNT N+TIS Q+C P
Sbjct  183  VWFFRFPLKAKVACGIEVNTVNQTISRQSCSP  214



>gb|KDP37212.1| hypothetical protein JCGZ_06268 [Jatropha curcas]
Length=224

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 130/207 (63%), Gaps = 8/207 (4%)
 Frame = +2

Query  149  YFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSA-GllllavavflIWPSDPGV  325
            Y+ P+P   Q  Q  IVLP  +  H    R   + +I +   LL +   V+L+WPSDP +
Sbjct  20   YYTPIPC--QHDQNYIVLP--FHHHPTTFRGPSKPMIITIICLLFIPALVYLLWPSDPNL  75

Query  326  SVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
             + RL L    +H  P  ++D+ L + +KV+N D YS+D   L V++AYR KRLG+V  +
Sbjct  76   RIVRLSLNKIHIHTLPIINIDVSLYVTIKVRNVDVYSMDLRRLDVALAYRGKRLGHVKVK  135

Query  503  -EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldl-  676
             +GH+ A  SSY++  L+  GV I++DV+ L+ED+A+G V FDTV ++SG+LG   L+  
Sbjct  136  GKGHVSALGSSYVDTELEFSGVRILSDVVFLLEDLAKGRVPFDTVIKVSGELGFLGLEFP  195

Query  677  plqgKVSCEIVVNTKNETISHQNCYPE  757
              Q K+SCE++VNT N+TI  QNCY +
Sbjct  196  FKQAKMSCEVLVNTNNQTIVRQNCYSD  222



>ref|NP_001050978.1| Os03g0696000 [Oryza sativa Japonica Group]
 gb|ABF98347.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12892.1| Os03g0696000 [Oryza sativa Japonica Group]
 dbj|BAG98840.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WP+DP VSVARL+L    V   P   + I   L V+V+N D +++DY  L V I YR  
Sbjct  74   LWPADPDVSVARLRLAHVSVSARPTVRVTISAALKVRVRNPDLFALDYGRLDVDIGYRGA  133

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG VTS  G ++ARA SYI+A L L G+ ++ D + L+ED+ARGSV FDTV E+ G + 
Sbjct  134  PLGRVTSGGGRVRARAVSYIDANLSLDGISVVEDAIYLLEDLARGSVPFDTVAEVEGHVH  193

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF L +P++G++SC + +N  N+TI HQ+CYP+
Sbjct  194  LFFLSIPVKGRISCVVHINPHNQTIVHQDCYPD  226



>ref|XP_006595136.1| PREDICTED: uncharacterized protein LOC100792375 [Glycine max]
Length=201

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 125/186 (67%), Gaps = 1/186 (1%)
 Frame = +2

Query  203  PNYYRSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSVARLKLRGFRVHPFPP-S  379
            P+ +   +Y+  + RR +  + G+L+L  A+++ WPS P + +  LKLR  +VHP PP +
Sbjct  16   PHNHHHQNYVVLSRRRVVTLAVGVLILLSALYIFWPSGPDLKIVGLKLRRIKVHPVPPIT  75

Query  380  LDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLK  559
            +DI + L ++V N D Y +D+ A+ V++AYR K LG+VTS   H++AR SSY++A ++  
Sbjct  76   IDISMLLTLRVHNVDVYFMDFGAVNVAVAYRGKMLGHVTSRRMHVRARGSSYVDADVEFA  135

Query  560  GVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISH  739
            G+ ++ +++ L+EDVARG V FDT++   GQLGL     P++ K+SCE+VV+  N+TI  
Sbjct  136  GISVLPELVLLLEDVARGIVPFDTISHAKGQLGLLFFHFPIKAKLSCEVVVSIINQTIVR  195

Query  740  QNCYPE  757
            Q+C  E
Sbjct  196  QHCLHE  201



>ref|XP_009418806.1| PREDICTED: uncharacterized protein LOC103998921 [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPSDP ++VARL+    RV P P  ++D+ L + + V+N DF+S+DY ++VVSI YR +
Sbjct  89   LWPSDPQLTVARLRFDDLRVTPPPFATIDVVLSVDLMVRNPDFFSLDYRSIVVSIGYRGR  148

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG VT++ GH++AR  S+++  L L G+ ++ D + LIED+ RGS+  DTVTE+ G++ 
Sbjct  149  PLGSVTADGGHVRARGVSHVHTKLDLDGILVLNDAIYLIEDLFRGSLPLDTVTEVQGRMR  208

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF  D+P+QG +SC + VN +N+ +  Q+CY E
Sbjct  209  LFFFDVPVQGNISCALNVNLENQEVIRQDCYSE  241



>ref|XP_010688185.1| PREDICTED: uncharacterized protein LOC104902184 [Beta vulgaris 
subsp. vulgaris]
Length=206

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 126/203 (62%), Gaps = 11/203 (5%)
 Frame = +2

Query  158  PLPAEPQTPQYIIVLPNYY--RSHSYISRTCRRRLIYSAGllllavavflIWPSDPGVSV  331
            PLP EP      +VL  Y+    H Y+ RT     +       +   VFL++PSDP + +
Sbjct  12   PLPPEPTY----VVLQFYHPPNHHPYLRRTLISISLLLL----IFTIVFLLFPSDPHLQL  63

Query  332  ARLKLRGFRVHPFPPSLDIYLDLI-VKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEG  508
             R+KL   RV+  P         + VKV N D +S+++++L V+IAYR + LG+V S  G
Sbjct  64   VRVKLNHVRVNSSPHLSLDLSLSLLVKVFNPDLFSLNFDSLAVTIAYRGRELGFVESNGG  123

Query  509  HLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqg  688
             +KAR SSY+NAT+ + G E++ D   L+EDVA G V FDTV+ I G++GLF + +P+Q 
Sbjct  124  RVKARGSSYVNATVVVDGFEVLHDFFYLVEDVAAGKVPFDTVSLIRGEIGLFFVKIPIQA  183

Query  689  KVSCEIVVNTKNETISHQNCYPE  757
            KVSCE+ VN K++TI HQNCYPE
Sbjct  184  KVSCEVDVNPKDQTIVHQNCYPE  206



>gb|ACG33974.1| hypothetical protein [Zea mays]
Length=227

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WP+DP +S+ARL L    V   P  ++ I   L V+V+N D +++DY  L V+I YR   
Sbjct  76   WPADPDISLARLHLAHVSVVARPAVAVTISATLKVRVRNPDLFALDYTRLDVAIGYRGAG  135

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG VTS  G ++ARA SY++A LQL G+ ++ D + L+ED+A+GSV FDT+ E+ G L  
Sbjct  136  LGRVTSGGGRVRARAVSYVDANLQLDGIRVVEDAMYLLEDLAQGSVPFDTIAEVEGHLHF  195

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
              L +P++G++SC + +N  N+TI HQ+CYPE
Sbjct  196  LFLSIPVKGRISCVMHINPHNQTIVHQDCYPE  227



>ref|XP_003560997.1| PREDICTED: uncharacterized protein LOC100825061 [Brachypodium 
distachyon]
Length=225

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WP+DP VSVARL+L    V   P  +L+I   L V+V+N D +++DY+ L ++I YR   
Sbjct  74   WPADPDVSVARLRLAHISVVARPAVALNISAALKVRVRNPDLFALDYSRLDIAIGYRGAP  133

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG VTS  G ++ARA SYI+A L L G+ ++ D + L+ED+ARGS+ FDTV E+ G L  
Sbjct  134  LGTVTSGGGRVRARAVSYIDADLHLNGIRVVEDAIYLLEDLARGSIPFDTVVEVEGHLHF  193

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            F + +P++G+++C + VN  ++TI HQ+CYP+
Sbjct  194  FFISIPVKGRIACVVHVNPHDQTIVHQDCYPK  225



>ref|XP_008665007.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN35534.1| unknown [Zea mays]
 tpg|DAA50803.1| TPA: hypothetical protein ZEAMMB73_010184, partial [Zea mays]
Length=227

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WP+DP +S+ARL L    V   P  ++ I   L V+V+N D +++DY  L V+I YR   
Sbjct  76   WPADPDISLARLHLAHVSVVARPAVAVTISATLKVRVRNPDLFALDYTRLDVAIGYRGAG  135

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG VTS  G ++ARA SY++A LQL G+ ++ D + L+ED+A+GSV FDT+ E+ G L  
Sbjct  136  LGRVTSGGGRVRARAVSYVDANLQLDGIRVVEDAMYLLEDLAQGSVPFDTIAEVEGHLHF  195

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
              L +P++G++SC + +N  N+TI HQ+CYPE
Sbjct  196  LFLSIPVKGRISCVMHINPHNQTIVHQDCYPE  227



>ref|XP_010545724.1| PREDICTED: uncharacterized protein LOC104817997 [Tarenaya hassleriana]
Length=211

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 134/221 (61%), Gaps = 14/221 (6%)
 Frame = +2

Query  98   SSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGll  277
            S + S+P PP+ + +   +  LP+  +       +P+Y  + S      RRR+I +  LL
Sbjct  2    SGKDSEPDPPAPTPE---YQRLPSLDENDD----VPSYLEASSK-----RRRIIITVFLL  49

Query  278  llavavflI-WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNAL  451
             LA AV  I WPSDP + + RL++   R+   P  S+D+ L + +KV N D YS  +  L
Sbjct  50   SLASAVVYIFWPSDPRIHIERLRISHVRIRRRPVLSVDMSLLVTLKVTNADVYSFGFTTL  109

Query  452  VVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDT  631
             V+++YR K LG+V S+ G + A  S+Y+ A  +L GV +  DV+ LI D+A+GS+ FDT
Sbjct  110  HVAVSYRGKTLGHVRSDGGQVTAMGSTYVEAETELNGVAVFPDVIHLIRDLAKGSIEFDT  169

Query  632  VTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYP  754
            VTE SG+LG+  L  PL+ KV C I+VNT N+TIS Q+C P
Sbjct  170  VTETSGKLGIMFLRFPLKAKVECGILVNTVNQTISRQSCKP  210



>ref|XP_008644593.1| PREDICTED: uncharacterized protein LOC100273513 [Zea mays]
 gb|AFW67926.1| hypothetical protein ZEAMMB73_453012 [Zea mays]
Length=224

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WP+DP +S+AR  L    V   P  ++ I   L V+V+N D +++DY  L V+I YR K 
Sbjct  73   WPADPDISLARFHLGHVSVVARPAVAVTISAALKVRVRNPDLFALDYTRLDVAIGYRGKP  132

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG VTS  G ++ARA SY++A LQL G+ ++ D + L++D+ARGSV FD + E+ G L  
Sbjct  133  LGLVTSGGGRVQARAVSYVDANLQLDGIRVVEDAIYLLKDLARGSVPFDALAEVEGHLHF  192

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            F L +P++G++SC + VN  N+TI HQ+CYPE
Sbjct  193  FFLSIPVKGRISCVVHVNPHNQTIVHQDCYPE  224



>ref|XP_010049704.1| PREDICTED: uncharacterized protein LOC104438290 [Eucalyptus grandis]
Length=235

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 124/192 (65%), Gaps = 3/192 (2%)
 Frame = +2

Query  191  IIVLPNY-YRSHSYISRTCRRRLIYSAGllllavavflI-WPSDPGVSVARLKLRGFRVH  364
            ++VLP Y  R  S +    RR L +S+  LL+A A   + +PSDP V +AR++L   R+ 
Sbjct  34   VVVLPFYPRRRGSALRPRLRRCLCFSSSFLLVAAAAGFVLFPSDPTVELARIRLNRVRIA  93

Query  365  PFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYIN  541
              P  +LD+  ++ ++V+NRD +S+   +L VS+ YR + LG VTS    + AR SSY++
Sbjct  94   TSPALTLDLSFNVTLRVRNRDVFSMYLRSLNVSVGYRGRELGSVTSAGEMIAARGSSYVD  153

Query  542  ATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTK  721
             T+ L G+ ++ D   L+ED+A+G V FD    ++G LG+  ++LP++ +VSCEI VN K
Sbjct  154  TTVDLDGLRVVYDAFYLLEDLAKGVVPFDADARVNGLLGISFVELPIKARVSCEISVNVK  213

Query  722  NETISHQNCYPE  757
            N+TI+HQNC PE
Sbjct  214  NQTIAHQNCSPE  225



>ref|XP_009417167.1| PREDICTED: uncharacterized protein LOC103997612 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=245

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPSDP V+V R  L   RV P P  ++ I L + ++V+N DF+S+D+ ++VVSI YR +
Sbjct  93   LWPSDPVVTVTRFHLEDIRVTPPPLAAIGISLRVDLRVRNPDFFSLDHRSIVVSIGYRGR  152

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG VT+  GH+KAR  S+++A L++ G+ +  D + LIED+AR S+  DTVTE+ G++ 
Sbjct  153  PLGSVTANGGHIKARGVSHVHAKLKIDGIRVWNDAIYLIEDLARRSLPLDTVTEVDGRMR  212

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF +D+P+QGK+SC + VN +   + +Q+CYPE
Sbjct  213  LFFVDVPVQGKISCLVSVNPETRELINQDCYPE  245



>ref|XP_009417166.1| PREDICTED: uncharacterized protein LOC103997612 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=254

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPSDP V+V R  L   RV P P  ++ I L + ++V+N DF+S+D+ ++VVSI YR +
Sbjct  93   LWPSDPVVTVTRFHLEDIRVTPPPLAAIGISLRVDLRVRNPDFFSLDHRSIVVSIGYRGR  152

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG VT+  GH+KAR  S+++A L++ G+ +  D + LIED+AR S+  DTVTE+ G++ 
Sbjct  153  PLGSVTANGGHIKARGVSHVHAKLKIDGIRVWNDAIYLIEDLARRSLPLDTVTEVDGRMR  212

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF +D+P+QGK+SC + VN +   + +Q+CYPE
Sbjct  213  LFFVDVPVQGKISCLVSVNPETRELINQDCYPE  245



>ref|XP_003597772.1| hypothetical protein MTR_2g102080 [Medicago truncatula]
Length=182

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 108/152 (71%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            +PSDP + + RLKL+  +VH  P  ++DI +   ++VQN D YS+D+ A+ V+++YR K 
Sbjct  5    YPSDPYLKIVRLKLKKIKVHRVPHITVDISMLFTLRVQNVDVYSMDFGAVDVAVSYRGKP  64

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG+VTS+ GH++A  SS+++A  +  G+ ++ +++ L+ED+A+G V FDTV+++ G++G+
Sbjct  65   LGHVTSKNGHVRAMGSSFVDADAEFSGIGVLPEIVLLLEDLAKGMVPFDTVSQVRGKMGI  124

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
                 P++ K+SC ++V+T N+TI  Q+C  E
Sbjct  125  LFFYFPIKAKLSCAVLVSTINQTIIRQHCLYE  156



>ref|XP_002516077.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46497.1| conserved hypothetical protein [Ricinus communis]
Length=215

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  128  SCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIW  307
             CS    Y+ P+P +     Y+++ P  +     I    RR LI +  + LL   ++L W
Sbjct  13   QCS---HYYTPIPCQ-HDDNYVVLQPLDHHRFPTIRLPPRRILIVTGVIFLLISVIYLFW  68

Query  308  PSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRL  484
            PSDP + + RL+L    +H  P  ++D+ L + VKV+N D YS+D+  L +++ YR KRL
Sbjct  69   PSDPTLKIVRLRLNKLHIHTLPIINIDVSLHVTVKVRNVDVYSMDFTHLDIALRYRGKRL  128

Query  485  GYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
            G+V S +GH++A ASSY++A L+  GV +++DV+ L+ED+ARG V FDTVT++ 
Sbjct  129  GHVRSGQGHVRALASSYVDAELEFSGVGVLSDVVFLLEDLARGKVPFDTVTKVD  182



>gb|KCW69598.1| hypothetical protein EUGRSUZ_F03017 [Eucalyptus grandis]
Length=196

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 115/186 (62%), Gaps = 9/186 (5%)
 Frame = +2

Query  92   MTSSRHSDPLPPSCSTQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAG  271
            M SS+ ++P PP   T   Y+ PLP +P  P YI+ LP +   H   +   R   I +  
Sbjct  1    MDSSK-ANPPPP---TLPIYYTPLPPQPDAPNYIL-LPLH---HPATASPRRLHTICAVS  52

Query  272  llllavavflIWPSDPGVSVARLKLRGFRVHPFPPSL-DIYLDLIVKVQNRDFYSVDYNA  448
            L+LLA   ++++PS+P + V RL+L   + H  P  L DI L L +KV N D YS+DY+ 
Sbjct  53   LILLASVAYILYPSEPDIDVVRLRLNRVQFHTQPHVLVDISLFLTIKVCNADVYSMDYST  112

Query  449  LVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFD  628
            L V++ YR K LG+V S+ GH+ A  SSY++A L+  GVE+ +DV+ L+ED+A+G+V  D
Sbjct  113  LDVAVGYRGKMLGHVKSDHGHVMALGSSYVDAELEFDGVEVFSDVVFLLEDLAKGTVPLD  172

Query  629  TVTEIS  646
            TVT I 
Sbjct  173  TVTTID  178



>gb|AES68023.2| late embryogenesis abundant protein [Medicago truncatula]
Length=200

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             +PSDP + + RLKL+  +VH  P  ++DI +   ++VQN D YS+D+ A+ V+++YR K
Sbjct  4    FYPSDPYLKIVRLKLKKIKVHRVPHITVDISMLFTLRVQNVDVYSMDFGAVDVAVSYRGK  63

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
             LG+VTS+ GH++A  SS+++A  +  G+ ++ +++ L+ED+A+G V FDTV+++ G++G
Sbjct  64   PLGHVTSKNGHVRAMGSSFVDADAEFSGIGVLPEIVLLLEDLAKGMVPFDTVSQVRGKMG  123

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            +     P++ K+SC ++V+T N+TI  Q+C  E
Sbjct  124  ILFFYFPIKAKLSCAVLVSTINQTIIRQHCLYE  156



>gb|KEH27093.1| late embryogenesis abundant protein [Medicago truncatula]
Length=262

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 124/213 (58%), Gaps = 13/213 (6%)
 Frame = +2

Query  134  STQERYFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllavavflIWPS  313
            S    Y HPLP        ++ LP+YY  H + +R  R  +I +  LL LA A+F ++PS
Sbjct  32   SQNNSYSHPLPQ-----NVVVGLPSYYPIHRHNNR--RNWIISATVLLFLAAAIFFLYPS  84

Query  314  DPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGY  490
            DP + +AR++L    +   P P LD+   L +K++NRDF+SV Y+ L VS+ YR + +G 
Sbjct  85   DPEIHLARIQLNHIAIKANPKPILDLSFSLKLKIRNRDFFSVAYDKLDVSLGYRGREIGT  144

Query  491  VTS-EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglfl  667
            V+S   G ++AR S Y++  L +   E+I D   LIED+ +G + FDTV+++ G+LG   
Sbjct  145  VSSVGGGKIRARGSDYVDVVLSIDAFEVIYDAFYLIEDMVKGVIVFDTVSKVDGKLGFIP  204

Query  668  ldlplqgKVSCEIVVNTKNETISHQNCYPE*YG  766
            L       VSCE+ VN   + +  QNCYPE  G
Sbjct  205  LKAT----VSCEVYVNIYQQMVVRQNCYPESLG  233



>ref|XP_003529998.2| PREDICTED: uncharacterized protein LOC100775891, partial [Glycine 
max]
Length=227

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 127/212 (60%), Gaps = 11/212 (5%)
 Frame = +2

Query  149  YFHPLPAEPQTPQYIIVLPNYYRSHSYISRTCRRRLIYSAGllllav---avflIWPSDP  319
            Y+ P P  P     +++LP+Y        R C   ++YSA L L  +   A FL++PSDP
Sbjct  7    YYDPNP-HPYPQNVVVLLPSYRLRSHRRRRRC---ILYSAALFLFLLIAGAAFLLYPSDP  62

Query  320  GVSVARLKLR--GFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYV  493
             + + R++L   G R +P  P LD+   + VKV NRDF+S+ Y+ L VS+ YR ++LG+V
Sbjct  63   EIRLTRIRLNRIGIRTNP-RPILDLSFSITVKVHNRDFFSLTYDTLAVSVGYRGRQLGFV  121

Query  494  TSEEGHLKARA-SSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglfll  670
            T   G       SSY++ATL + G E+I D   L+ED+A+G + FDT T + G+LGLF  
Sbjct  122  TGGGGGRIRARGSSYVDATLTIDGFEVIYDAFYLLEDIAKGVIPFDTDTRVEGKLGLFFF  181

Query  671  dlplqgKVSCEIVVNTKNETISHQNCYPE*YG  766
             +PL+  VSCE+ VN   +TI  Q+CYP+  G
Sbjct  182  TVPLKATVSCEVYVNINQQTIVRQDCYPKSLG  213



>ref|XP_010937278.1| PREDICTED: uncharacterized protein LOC105056680 [Elaeis guineensis]
Length=236

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 104/153 (68%), Gaps = 1/153 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WPSDP + V+ +++   RV  P   +LD+ + + V+V+N D+ ++DY +L VS+ YR +
Sbjct  84   LWPSDPELRVSHIRVDRIRVSRPGGAALDVSVGIEVRVRNPDYSAIDYGSLAVSVWYRGQ  143

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            RLG  T+   H++AR SSY+ A L+L G++ + D   LIED+  GS+  DTV+E  G++ 
Sbjct  144  RLGTGTTRGWHVRARGSSYVGADLRLDGIQFLDDSSDLIEDLNSGSLVLDTVSEFKGKIR  203

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            LF   +P+QG+VSC + VN +N+ I HQ+CYPE
Sbjct  204  LFFFQVPVQGRVSCSVNVNPENQKIIHQDCYPE  236



>dbj|BAJ98808.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=235

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 104/152 (68%), Gaps = 1/152 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WPSDPGVSVARL+L    V   P  +L++   L  +V+N + +++ Y+ L V+I YR + 
Sbjct  84   WPSDPGVSVARLRLAHVSVVARPAVALNVSAALKARVRNPNLFALGYSRLDVAIGYRGRP  143

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlgl  661
            LG V+S  G ++ARA SY++A L L G+ ++ D + L+ED+ARGS+ FD V E+ G L  
Sbjct  144  LGTVSSGGGLVRARAVSYVDADLHLDGIRVVEDAVYLLEDLARGSIPFDAVVEVEGHLHF  203

Query  662  flldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            F L +P++G+++C + VN  ++TI HQ+CYP+
Sbjct  204  FFLSVPVKGRIACVVHVNPHDQTIVHQDCYPK  235



>ref|XP_010497631.1| PREDICTED: uncharacterized protein LOC104774984, partial [Camelina 
sativa]
Length=151

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRV-HPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            ++PSDP ++V+R+ L    V      +LD+   L +KV+NRDF+S+DY++LVVSI YR +
Sbjct  23   LYPSDPDITVSRINLNHISVLDSHKIALDLSFSLTIKVRNRDFFSLDYDSLVVSIGYRGR  82

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             LG V S+ GHL+AR SSYI+ATL+L G+E++ DV+ LI D+A+G V FDTV ++
Sbjct  83   ELGVVKSKGGHLRARDSSYIDATLELDGLEVVHDVIYLIGDLAKGVVPFDTVAQV  137



>ref|XP_007024137.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 1 [Theobroma cacao]
 ref|XP_007024138.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY26759.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY26760.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 1 [Theobroma cacao]
Length=165

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
             WPS P V + R+ ++  ++H  P  +LDI L + +KV+N D YS+D+ +L +++ YR K
Sbjct  14   FWPSQPEVKIVRMHVKRMQMHTVPIIALDISLLVTLKVRNSDVYSMDFTSLDMAVGYRGK  73

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
             LG+V SE  HL+A  SSY+ A L+L GVE+++DV+ ++ED+ARG+V FDT+TE++
Sbjct  74   MLGHVKSEHDHLRAWGSSYLQAELELNGVEVLSDVVYMLEDLARGTVPFDTITEVA  129



>ref|XP_007150661.1| hypothetical protein PHAVU_005G171000g [Phaseolus vulgaris]
 gb|ESW22655.1| hypothetical protein PHAVU_005G171000g [Phaseolus vulgaris]
Length=199

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 126/194 (65%), Gaps = 2/194 (1%)
 Frame = +2

Query  182  PQYIIVLPNYYRSHSYISRTCRRRLIYSA-GllllavavflIWPSDPGVSVARLKLRGFR  358
            P +  +L +    H  +    RRR+I  A  + LL   ++++WPS P + +  LKLR  +
Sbjct  6    PSFCALLLHKPYHHQNLVVLSRRRVISCAVSMALLVTTLYVLWPSGPDLKIVGLKLRRIK  65

Query  359  VHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSY  535
            VHP PP ++DI + L ++V+N D Y +D  A+ V++AYR K LG+V S E H++AR SS+
Sbjct  66   VHPVPPITVDISMLLTLRVRNADVYFMDLGAVNVAVAYRGKMLGHVRSREVHVRARGSSH  125

Query  536  INATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVN  715
            + A ++  G+ ++ +++ L+EDVA+G V FDTV+  SGQLGLF    P++ K+SCE++V+
Sbjct  126  VEADVEFAGISVLPELVLLLEDVAKGIVPFDTVSHTSGQLGLFFFHFPMKAKLSCEVLVS  185

Query  716  TKNETISHQNCYPE  757
              N+TI  Q+C  +
Sbjct  186  IVNQTIIRQHCLHQ  199



>ref|XP_004512968.1| PREDICTED: uncharacterized protein LOC101515080 [Cicer arietinum]
Length=247

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLR--GFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRR  475
            ++PSDP + +AR+++   G R +P  P LD+   + VKV+NRDF+S+ Y++L V++ YR 
Sbjct  77   LYPSDPEIQLARIRINHIGIRTNP-KPILDLSFSVTVKVRNRDFFSLTYDSLSVAVGYRG  135

Query  476  KRLGYVTS-EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgq  652
            ++LG V S   G +KAR SSY++  L + G E+I D   LI+D+A+G + F+T T + G+
Sbjct  136  RQLGLVHSIGGGRIKARGSSYVDVVLSVDGFEVIYDAFYLIQDIAKGVIPFETHTTVDGK  195

Query  653  lglflldlplqgKVSCEIVVNTKNETISHQNCYPE*YG  766
            LGL L ++PL+  VSC++ VN   + I  Q+CYPE  G
Sbjct  196  LGLLLFNVPLKATVSCDVYVNLNKQVIERQDCYPESLG  233



>ref|XP_010694099.1| PREDICTED: uncharacterized protein LOC104906954 [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 121/208 (58%), Gaps = 21/208 (10%)
 Frame = +2

Query  164  PAEPQTPQYIIV-----LPNY---YRSHSYISRTCRRRLIYSAGllllavavflIWPSDP  319
            P+ PQT  YI++     LP +    R   Y  RT    LI +          +L+WPS P
Sbjct  15   PSNPQTRNYIVLNLPFNLPAWDPPLRKKIY--RTSLIILILTT-------LFYLLWPSCP  65

Query  320  GVSVARLKLR--GFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYV  493
             V + R  L    F+ HP   ++++ LD  V+V+NR  Y+++Y+ L V+I YR K LG V
Sbjct  66   DVGIVRTTLHHVKFQTHPHI-AVNVSLDATVRVRNRAVYTMNYDRLDVAIGYRGKELGPV  124

Query  494  TSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflld  673
             S  GH++A+ SSY+   ++   VE+  +++ L+ED+A+G V FDTVT+  G  G     
Sbjct  125  VSGGGHVRAKGSSYVKTKMEFYEVEVGWELIYLLEDLAKGFVQFDTVTQFDGSFGFSFFQ  184

Query  674  lplqgKVSCEIVVNTKNETISHQNCYPE  757
            +PL+ K+SCEIVVN K +T + QNCYPE
Sbjct  185  VPLKAKISCEIVVNMKQQT-NTQNCYPE  211



>ref|XP_007024139.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 3 [Theobroma cacao]
 gb|EOY26761.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
isoform 3 [Theobroma cacao]
Length=158

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WPS P V + R+ ++  ++H  P  +LDI L + +KV+N D YS+D+ +L +++ YR K 
Sbjct  15   WPSQPEVKIVRMHVKRMQMHTVPIIALDISLLVTLKVRNSDVYSMDFTSLDMAVGYRGKM  74

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
            LG+V SE  HL+A  SSY+ A L+L GVE+++DV+ ++ED+ARG+V FDT+TE++
Sbjct  75   LGHVKSEHDHLRAWGSSYLQAELELNGVEVLSDVVYMLEDLARGTVPFDTITEVA  129



>ref|XP_004982101.1| PREDICTED: uncharacterized protein LOC101764044 [Setaria italica]
Length=227

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 98/156 (63%), Gaps = 5/156 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WP+DP VS+ARL+L    V   P  +++I   L V+V+N DF+++DY+ L V I YR  R
Sbjct  72   WPADPDVSLARLRLAHVSVVARPAVAINISAALKVRVRNPDFFALDYSRLDVDIGYRGAR  131

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVT----EISg  649
            LG VTS  G ++ARA SY++A L L  + ++ D + L+ED+ARGSV F  +      +  
Sbjct  132  LGRVTSGGGRVRARAVSYVDADLHLDRIRVVQDAIYLLEDLARGSVPFSLLAVFDLHVLI  191

Query  650  qlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
                 ++   LQG++SC + VN  N+TI HQ+CYPE
Sbjct  192  LNSFVIVLGFLQGRISCVVHVNPHNQTIVHQDCYPE  227



>ref|XP_008777264.1| PREDICTED: uncharacterized protein LOC103697223 [Phoenix dactylifera]
Length=232

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 121/197 (61%), Gaps = 7/197 (4%)
 Frame = +2

Query  182  PQYIIVLPNYYRSHSYISRTCRRR--LIYSAGllllavavflIWPSDPGVSVARLKLRGF  355
            P +I + P  +    + +  C     L+++   +L+A+A +L+WPSDP + V+  +L   
Sbjct  38   PAFIFLPPYPFPRRRWWALLCSLTCLLVFALATILIALAAYLLWPSDPELQVSHFRLD--  95

Query  356  RVH---PFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARA  526
            R+H   P   ++D+ L + + V+N DF +++Y +L VS+ YR +RLG VTS  G + AR 
Sbjct  96   RIHISRPPDAAMDVTLGVELLVRNPDFVALNYGSLAVSVGYRGQRLGTVTSSGGRVSARG  155

Query  527  SSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEI  706
             SY++  L+L G++ + D   LIED+ RGS+  DT  E+ G+L  F   +P+QG+VSC +
Sbjct  156  LSYVDVELRLDGIQFLDDASYLIEDLNRGSLLLDTFAEVQGKLRPFFFQVPVQGRVSCSV  215

Query  707  VVNTKNETISHQNCYPE  757
             +N + + I HQ+CYPE
Sbjct  216  NINPETQKIIHQDCYPE  232



>gb|ABK22511.1| unknown [Picea sitchensis]
Length=227

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 100/157 (64%), Gaps = 8/157 (5%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLR--GFRVHPFPPS------LDIYLDLIVKVQNRDFYSVDYNALVV  457
             WP+ P + V  +      F+  P P S      ++I +D+ +KV N+D++S++Y++L V
Sbjct  68   FWPTQPVIQVIGVNFNTINFQAAPQPGSVVPRLFMNISMDMALKVNNKDYFSLEYDSLDV  127

Query  458  SIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVT  637
             + YR +R+G V SE G L AR ++Y+N+TL+L GVEI  D + L+ED+ R  +  DTV 
Sbjct  128  GLGYRGRRIGVVESEGGRLPARHTAYVNSTLELDGVEIFHDTVYLLEDLVRKELPLDTVA  187

Query  638  EISgqlglflldlplqgKVSCEIVVNTKNETISHQNC  748
            E +G + + L+ +PL+  VSCE+VVN  N+TI  Q+C
Sbjct  188  EFNGSVRVLLVKVPLKKVVSCEVVVNPDNQTILSQDC  224



>ref|XP_006859125.1| hypothetical protein AMTR_s00070p00082830 [Amborella trichopoda]
 gb|ERN20592.1| hypothetical protein AMTR_s00070p00082830 [Amborella trichopoda]
Length=338

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 6/119 (5%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHP-----FPPSL-DIYLDLIVKVQNRDFYSVDYNALVVSIA  466
            WPS P + VAR  L            FP  L DI +DL ++V+NRDF+S+DY  +VV I 
Sbjct  72   WPSKPQIRVARASLNHVHFSTDQSSIFPSVLMDISMDLTLRVRNRDFFSLDYERVVVWIG  131

Query  467  YRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
            YR ++LG+V SE G LKAR SSY+NATL L G++++ D   LIED+ARGSV   T+TE 
Sbjct  132  YRGRKLGFVRSEGGELKARGSSYVNATLHLNGIQVLEDAFYLIEDLARGSVPLYTITEF  190



>gb|KFK35787.1| hypothetical protein AALP_AA4G036600 [Arabis alpina]
Length=124

 Score =   110 bits (275),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 61/121 (50%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +2

Query  392  LDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEI  571
            L + +KV N D YS D+ AL V++ YR K LG+V+S+ GH+ A  SS++ A  +L GV +
Sbjct  3    LLVTLKVTNADVYSFDFTALDVAVDYRGKTLGHVSSDGGHVTAFGSSFLEAETELDGVTV  62

Query  572  ITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCY  751
              DV+ LI D+A+GSV FDTVTE +G+LG+F    PL+ K++C I+V+T N+TISHQ+C 
Sbjct  63   FADVIHLIHDLAKGSVEFDTVTETNGKLGVFFFRFPLKAKIACGIMVDTVNQTISHQSCR  122

Query  752  P  754
            P
Sbjct  123  P  123



>ref|NP_001077704.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAX23784.1| hypothetical protein At1g52330 [Arabidopsis thaliana]
 gb|AAZ52707.1| expressed protein [Arabidopsis thaliana]
 gb|AEE32788.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=227

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +2

Query  245  RRRLIYSAGllllavavflI-WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQN  418
            RRR I S  L+  A  +  I WPSDP + + R+K+    VH  P PS+D+ L + +KV N
Sbjct  42   RRRFIISIFLISFASILIYIFWPSDPRIKIIRVKISHVHVHRRPVPSIDMTLLVTLKVSN  101

Query  419  RDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIE  598
             D YS D+  L V+I YR K LG+V+S+ GH+ A  SSY++A  +L GV +  DV+ LI 
Sbjct  102  ADVYSFDFTDLDVTIDYRGKTLGHVSSDGGHVTAFGSSYLDAEAELDGVMVFPDVIHLIH  161

Query  599  DVARGSVTFDTVTE  640
            D+A+GSV FDTVTE
Sbjct  162  DLAKGSVEFDTVTE  175



>ref|XP_004506853.1| PREDICTED: uncharacterized protein LOC101490196 isoform X1 [Cicer 
arietinum]
Length=190

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 93/152 (61%), Gaps = 4/152 (3%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WP DP V + RL +R  RVHP PP S D+ L L V V N  FY ++   + V + YR  
Sbjct  36   LWPRDPEVEMERLTVRKVRVHPLPPLSADVALSLTVNVHNSGFYFMELGEVDVGVKYRGN  95

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            +LG+V +E  H+  R+S+++   L+  G+    DV  L++D+A+G V F T  E++GQLG
Sbjct  96   KLGHVETEGWHVGRRSSAHVFGELEFSGLA-SADVAHLMQDIAKGRVHFHTSVEVTGQLG  154

Query  659  lflldlplqgKV--SCEIVVNTKNETISHQNC  748
            L    +P   KV  SCE++VNTKN +I  Q+C
Sbjct  155  LSFFHVPKIFKVVLSCEVLVNTKNHSILQQHC  186



>gb|ABK23452.1| unknown [Picea sitchensis]
Length=233

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 100/158 (63%), Gaps = 9/158 (6%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHP--FPPS------LDIYLDLIVKVQNRDFYSVDYNALVV  457
            +WPSDP + V R+ L      P  FP S      L++ ++L VKV N+D+  V Y+ + V
Sbjct  70   VWPSDPRIEVVRMGLNKIEWRPEKFPGSFLPRVFLNLSMELTVKVTNKDYLGVYYDHVNV  129

Query  458  SIAYRRKRLGYVTSEE-GHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTV  634
             IAYR +++G VTSE   ++  R ++Y++ATL + G++++ DV+ L+ED+ARG +   TV
Sbjct  130  GIAYRGEKIGRVTSENSAYIPPRGTAYVDATLDIDGIQVLADVIYLLEDIARGHIPLQTV  189

Query  635  TEISgqlglflldlplqgKVSCEIVVNTKNETISHQNC  748
            T+  G + LF L +PLQ  +SCE+ V+T  +T+  Q C
Sbjct  190  TDFDGYIRLFSLKVPLQAIMSCEVDVDTNEQTVLRQEC  227



>ref|XP_007135691.1| hypothetical protein PHAVU_010G150300g [Phaseolus vulgaris]
 gb|ESW07685.1| hypothetical protein PHAVU_010G150300g [Phaseolus vulgaris]
Length=188

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 96/152 (63%), Gaps = 4/152 (3%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WP  P + + R+ ++  RVHP PP   D+++ L V V+NR  Y +D   + V + YR K
Sbjct  34   LWPWSPELKIQRMNVKRVRVHPLPPVGADVWITLSVAVKNRGMYWLDLAEVDVGVKYRGK  93

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            ++G+V SE  H+++ AS  ++  LQ  G+   T+V  L+ED+A+G V F TV E++GQ+G
Sbjct  94   KMGHVESEGWHVRSWASKDVDGDLQFSGLP-STEVAHLLEDMAKGEVYFHTVIEVAGQIG  152

Query  659  lflldlplqgK--VSCEIVVNTKNETISHQNC  748
               +++P   K  ++CE++VNTK+  I  Q+C
Sbjct  153  FLTINIPFTFKTILACEVLVNTKSHAIILQHC  184



>gb|AAO19373.1| hypothetical protein [Oryza sativa Japonica Group]
Length=259

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WP+DP VSVARL+L    V   P   + I   L V+V+N D +++DY  L V I YR  
Sbjct  74   LWPADPDVSVARLRLAHVSVSARPTVRVTISAALKVRVRNPDLFALDYGRLDVDIGYRGA  133

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             LG VTS  G ++ARA SYI+A L L G+ ++ D + L+ED+ARGSV FDTV E+
Sbjct  134  PLGRVTSGGGRVRARAVSYIDANLSLDGISVVEDAIYLLEDLARGSVPFDTVAEV  188



>ref|XP_008665013.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 tpg|DAA50804.1| TPA: hypothetical protein ZEAMMB73_010184 [Zea mays]
Length=214

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WP+DP +S+ARL L    V   P  ++ I   L V+V+N D +++DY  L V+I YR   
Sbjct  76   WPADPDISLARLHLAHVSVVARPAVAVTISATLKVRVRNPDLFALDYTRLDVAIGYRGAG  135

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
            LG VTS  G ++ARA SY++A LQL G+ ++ D + L+ED+A+GSV FDT+ E+
Sbjct  136  LGRVTSGGGRVRARAVSYVDANLQLDGIRVVEDAMYLLEDLAQGSVPFDTIAEV  189



>ref|NP_001136584.1| hypothetical protein [Zea mays]
 gb|ACF82220.1| unknown [Zea mays]
 tpg|DAA50805.1| TPA: hypothetical protein ZEAMMB73_010184 [Zea mays]
Length=221

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            WP+DP +S+ARL L    V   P  ++ I   L V+V+N D +++DY  L V+I YR   
Sbjct  76   WPADPDISLARLHLAHVSVVARPAVAVTISATLKVRVRNPDLFALDYTRLDVAIGYRGAG  135

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
            LG VTS  G ++ARA SY++A LQL G+ ++ D + L+ED+A+GSV FDT+ E+
Sbjct  136  LGRVTSGGGRVRARAVSYVDANLQLDGIRVVEDAMYLLEDLAQGSVPFDTIAEV  189



>gb|KHG13960.1| tRNA modification GTPase MnmE [Gossypium arboreum]
Length=161

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  449  LVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFD  628
            LVVS+ YR K  G V SE G ++AR  SY+NATL L G E++ DV+ LIED A+G + FD
Sbjct  59   LVVSVGYRGKEFGVVNSEGGRVRARGRSYVNATLDLNGFEVVHDVIYLIEDWAKGVIPFD  118

Query  629  TVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            T T+++G LGL  L +PL+ KV+CE+ VNT+N+TI  Q+C+ +
Sbjct  119  TTTKVNGVLGLCFLKIPLKAKVACEVSVNTRNQTIIRQDCHAQ  161



>ref|XP_006585593.1| PREDICTED: uncharacterized protein LOC100815479 isoform X2 [Glycine 
max]
Length=188

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 97/152 (64%), Gaps = 4/152 (3%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WP +P + + R+ ++  +VHP PP S D+++ L V+VQNR  Y ++   + V + YR K
Sbjct  34   LWPWEPELKIERMNVKRVKVHPIPPVSADVWISLSVRVQNRCMYWMELTDVDVGVKYRGK  93

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            ++G+V SE  H++  AS+ ++  L+  G+   ++V  L++D+A G + F TV ++ GQLG
Sbjct  94   KMGHVESEGWHVRGWASTKVDGVLEFSGLP-SSEVAHLLQDLAMGKIYFHTVIKVYGQLG  152

Query  659  lflldlplqgK--VSCEIVVNTKNETISHQNC  748
              L  +P   +  ++CEI+VNTKN +I  Q+C
Sbjct  153  FLLFRIPHFLQTILACEILVNTKNHSIILQHC  184



>gb|ABK21986.1| unknown [Picea sitchensis]
Length=152

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 84/124 (68%), Gaps = 1/124 (1%)
 Frame = +2

Query  380  LDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEE-GHLKARASSYINATLQL  556
            LD+ + L VKV NRD+  V Y+ + V IAYR +++G VTSE   ++  R ++Y++ATL +
Sbjct  23   LDLNMGLTVKVTNRDYLGVYYDHVKVGIAYRGEKIGQVTSENSAYIPPRGTAYVDATLDI  82

Query  557  KGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETIS  736
             G++++ DV+ L+ED+ARG +   TVT+  G + LF L +PLQ  +SCE+ V+T  +T+ 
Sbjct  83   HGIQVLADVIYLLEDIARGRIPLQTVTDFDGYIRLFSLKVPLQAIMSCEVDVDTNEQTVL  142

Query  737  HQNC  748
             Q C
Sbjct  143  RQEC  146



>ref|XP_003604446.1| hypothetical protein MTR_4g012450 [Medicago truncatula]
 gb|AES86643.1| late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family protein, putative [Medicago truncatula]
Length=197

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 86/152 (57%), Gaps = 4/152 (3%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WP +P + +  L ++  +VHP PP S+D+ L + VK+ N+  Y ++   + V I YR  
Sbjct  37   LWPLNPEIEMESLIVKRAKVHPLPPLSVDVSLSVTVKIHNKVLYWMELAEVDVGIKYRGH  96

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI--Sgq  652
            +LG+V +   H+K   S ++   L+  G+    DV  L++D+A+  V F T   +  +  
Sbjct  97   KLGHVETRGWHVKGWGSEHVFGELEFGGLP-SPDVAHLMQDLAKKRVHFHTAVGVVGNLG  155

Query  653  lglflldlplqgKVSCEIVVNTKNETISHQNC  748
            L  F      + K+SCE++VNTKN TI HQ+C
Sbjct  156  LFAFHFPKIFKVKLSCEVLVNTKNHTIVHQHC  187



>gb|KHN32607.1| hypothetical protein glysoja_022289 [Glycine soja]
Length=135

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 54/120 (45%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  398  LIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIIT  577
            L ++V N D Y +D+ A+ V++AYR K LG+VTS   H++AR SSY++A ++  G+ ++ 
Sbjct  3    LTLRVHNVDVYFMDFGAVNVAVAYRGKMLGHVTSRRMHVRARGSSYVDADVEFAGISVLP  62

Query  578  DVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            +++ L+EDVARG V FDT++   GQLGL     P++ K+SCE+VV+  N+TI  Q+C  E
Sbjct  63   ELVLLLEDVARGIVPFDTISHAKGQLGLLFFHFPIKAKLSCEVVVSIINQTIVRQHCLHE  122



>ref|XP_004506854.1| PREDICTED: uncharacterized protein LOC101490196 isoform X2 [Cicer 
arietinum]
Length=174

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 69/116 (59%), Gaps = 2/116 (2%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            +WP DP V + RL +R  RVHP PP S D+ L L V V N  FY ++   + V + YR  
Sbjct  36   LWPRDPEVEMERLTVRKVRVHPLPPLSADVALSLTVNVHNSGFYFMELGEVDVGVKYRGN  95

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
            +LG+V +E  H+  R+S+++   L+  G+    DV  L++D+A+G V F T  E++
Sbjct  96   KLGHVETEGWHVGRRSSAHVFGELEFSGLA-SADVAHLMQDIAKGRVHFHTSVEVT  150



>ref|XP_003531681.1| PREDICTED: uncharacterized protein LOC100815479 isoform X1 [Glycine 
max]
Length=189

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 95/155 (61%), Gaps = 8/155 (5%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRK  478
            IWP  P + + R++++  +V P PP   D+ + + V+V+NRD Y ++   + V + YRRK
Sbjct  33   IWPWYPELKIERMEVKRVKVRPVPPVGADVSISMSVRVRNRDIYWMEMREVDVGMKYRRK  92

Query  479  RLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLP-LIEDVARGSVTFDTVTEISgql  655
            ++G+V  +   +K  +S+++ A +     E+ +  +P L+EDVA+G V F TV E+SGQ 
Sbjct  93   KMGHVELKGWQVKGWSSTHVEAEVVF--AELPSSQVPYLLEDVAKGKVYFRTVVELSGQF  150

Query  656  glflldlplqgK----VSCEIVVNTKNETISHQNC  748
            G+     PL  +    ++CEI+VNTKN +I  Q+C
Sbjct  151  GILSFRTPLPLEFKTILACEILVNTKNHSIILQHC  185



>gb|EEC75999.1| hypothetical protein OsI_13134 [Oryza sativa Indica Group]
Length=153

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +2

Query  326  SVARLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSE  502
            SVARL+L    V   P   + I   L V+V+N D +++DY  L V I YR   LG VTS 
Sbjct  27   SVARLRLAHVSVSARPTVRVTISAALKVRVRNPDLFALDYGRLDVDIGYRGAPLGRVTSG  86

Query  503  EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             G ++ARA SYI+A L L G+ ++ D + L+ED+ARGSV FDTV E+
Sbjct  87   GGRVRARAVSYIDANLSLDGISVVEDAIYLLEDLARGSVPFDTVAEV  133



>gb|EEE59744.1| hypothetical protein OsJ_12210 [Oryza sativa Japonica Group]
Length=171

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +2

Query  404  VKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDV  583
            V+V+N D +++DY  L V I YR   LG VTS  G ++ARA SYI+A L L G+ ++ D 
Sbjct  72   VRVRNPDLFALDYGRLDVDIGYRGAPLGRVTSGGGRVRARAVSYIDANLSLDGISVVEDA  131

Query  584  LPLIEDVARGSVTFDTVTEI  643
            + L+ED+ARGSV FDTV E+
Sbjct  132  IYLLEDLARGSVPFDTVAEV  151



>ref|XP_006651720.1| PREDICTED: uncharacterized protein LOC102705061, partial [Oryza 
brachyantha]
Length=90

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  491  VTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglfll  670
            +TS  G ++ARA SYI+A L L G+ ++ D + L+ED+ARGS+ FDTV E+ G + LF L
Sbjct  2    LTSGGGRVRARAVSYIDADLSLDGISVVEDAIYLLEDLARGSIPFDTVAEVEGHVRLFFL  61

Query  671  dlplqgKVSCEIVVNTKNETISHQNCYPE  757
             +P++G++SC + +N  N+TI HQ+CYPE
Sbjct  62   RIPVKGRISCVVHINPHNQTIVHQDCYPE  90



>dbj|BAJ86713.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=276

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 92/153 (60%), Gaps = 4/153 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFY-SVDYNALVVSIAYRRK  478
            +PS P   VA ++L  FRV+P P P+LD  L L ++V+N  F   + Y A+  +++YR +
Sbjct  124  YPSAPAARVADIRLDRFRVNPPPFPALDFNLALGLRVRNPGFLLPLRYRAVSAAVSYRGR  183

Query  479  RLGYVTSE--EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgq  652
             LG  T+    G L AR  +Y ++ + +    ++ DV+ LI D+A GSV  + VTE+ G 
Sbjct  184  LLGSGTARPGSGELAARGVTYASSEVWVDAGRVLDDVIELIGDIAAGSVPLEIVTEVVGA  243

Query  653  lglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            + LF  ++P++G +SC + VN   ++I  Q+CY
Sbjct  244  IRLFHFNIPVKGLMSCSVNVNPDTQSIISQDCY  276



>ref|XP_010228236.1| PREDICTED: uncharacterized protein LOC100842709 [Brachypodium 
distachyon]
 ref|XP_010228237.1| PREDICTED: uncharacterized protein LOC100842709 [Brachypodium 
distachyon]
Length=252

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 91/153 (59%), Gaps = 4/153 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFY-SVDYNALVVSIAYRRK  478
            +PS P   VA ++L  FRV+P P P+LD  L L ++V N  F   + Y A+  +++YR +
Sbjct  100  YPSAPAARVADIRLDRFRVNPPPLPALDFNLALRLRVHNPGFLLPLRYRAVSSAVSYRGR  159

Query  479  RLGYVTSE--EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgq  652
             LG  T+    G L AR  +Y  + + +   +++ DV+ LI D+A GSV  + VTE+ G 
Sbjct  160  LLGSATARPGSGELAARGDTYAYSEVWVDAGKVLDDVIELIGDIAAGSVPLEIVTEVIGA  219

Query  653  lglflldlplqgKVSCEIVVNTKNETISHQNCY  751
            + +F  D+P++G +SC + V+   ++I  Q+CY
Sbjct  220  VRVFRFDIPVKGLISCSVNVSPDTQSIISQDCY  252



>gb|AII99863.1| late embryogenesis abundant protein [Cicer arietinum]
Length=125

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = +2

Query  335  RLKLRGFRVHPFPP-SLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGH  511
            RL +R  RVHP PP S D+ L L V V N  FY ++   + V + YR  +LG+V +E  H
Sbjct  3    RLTVRKVRVHPLPPLSADVALSLTVNVHNSGFYFMELGEVDVGVKYRGNKLGHVETEGWH  62

Query  512  LKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
            +  R+S+++   L+  G+    DV  L++D+A+G V F T  E++
Sbjct  63   VGRRSSAHVFGELEFSGLA-SADVAHLMQDIAKGRVHFHTSVEVT  106



>ref|XP_001778135.1| predicted protein [Physcomitrella patens]
 gb|EDQ57025.1| predicted protein [Physcomitrella patens]
Length=220

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 84/156 (54%), Gaps = 7/156 (4%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRV-----HPFPPS--LDIYLDLIVKVQNRDFYSVDYNALVVS  460
             WP+   V     KL G  +         PS  L++ L+++V+++N ++  V Y+ + + 
Sbjct  63   FWPTPLDVQAKEWKLNGISIVTKETKSILPSYQLNVSLNVLVEIKNPNYAGVVYDNVTLR  122

Query  461  IAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTE  640
            I YR   LG V +E   +K R+++ + AT+ LKG EI++D   L+ED + G +   T T 
Sbjct  123  IVYRGDDLGQVKAEGSRIKPRSTANLTATVNLKGNEILSDAKQLMEDYSDGKLPLTTYTA  182

Query  641  ISgqlglflldlplqgKVSCEIVVNTKNETISHQNC  748
              G + L+ +   L   V+C++V+N +++ I  Q C
Sbjct  183  FDGSVQLWFVKPLLNVTVACDLVLNPEDKIILSQEC  218



>ref|XP_002983453.1| hypothetical protein SELMODRAFT_422757 [Selaginella moellendorffii]
 gb|EFJ15354.1| hypothetical protein SELMODRAFT_422757 [Selaginella moellendorffii]
Length=227

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 80/163 (49%), Gaps = 14/163 (9%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPPSL--------DIYLDLIVKVQ------NRDFYSVD  439
            +WPSD  + V + +L          ++        D+ LDL +K Q      N +++ V 
Sbjct  61   LWPSDVKIEVHKTELVSMSWDSLKRAIVEQQQRSNDLGLDLDLKFQVQLLVRNPNYFGVR  120

Query  440  YNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSV  619
            Y+ +VV + YR  +LG V  E G + A     ++  + LKG+ +  +   L+ D+ARG +
Sbjct  121  YDRIVVELGYRGDKLGRVVLEGGEIPALKVVTVDGVMDLKGMRVFVNAGSLLLDIARGRL  180

Query  620  TFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNC  748
              +T    SG L   L+   L+ K+SCEIVVN     I  ++C
Sbjct  181  PLETDMNFSGNLEFLLVHPHLEAKLSCEIVVNPGTNEIMEKSC  223



>gb|EMT09918.1| hypothetical protein F775_19204 [Aegilops tauschii]
Length=238

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 69/117 (59%), Gaps = 4/117 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFY-SVDYNALVVSIAYRRK  478
            +PS P   VA ++L  FRV+P P P+LD  L L ++V+N  F   + Y A+  +++YR +
Sbjct  101  YPSAPAARVADIRLDSFRVNPPPFPALDFNLALSLRVRNSGFLLPLRYRAVSAAVSYRGR  160

Query  479  RLGYVTSE--EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             LG  T+    G L AR  +Y ++ + +    ++ DV+ LI D+A GSV  + VTE+
Sbjct  161  LLGSGTARPGSGELAARGVTYASSEVWVDAGRVLDDVIELIGDIAAGSVPLEIVTEV  217



>ref|XP_002974039.1| hypothetical protein SELMODRAFT_414233 [Selaginella moellendorffii]
 gb|EFJ24994.1| hypothetical protein SELMODRAFT_414233 [Selaginella moellendorffii]
Length=227

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 14/163 (9%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPPSL--------DIYLDLIVKVQ------NRDFYSVD  439
            +WPSD  + V + +L          ++        D+ LDL +K Q      N +++ V 
Sbjct  61   LWPSDVKIEVQKTELVSMSWDSLKRAIVEQQQRSNDLGLDLDLKFQVQLLVRNPNYFGVR  120

Query  440  YNALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSV  619
            Y+ +VV + YR  +LG V  E G + A     ++  + LKG+ +  +   L+ D+ARG +
Sbjct  121  YDRIVVELGYRGDKLGRVVLEGGEIPALKVVTVDGVMDLKGMRVFVNAGSLLLDIARGRL  180

Query  620  TFDTVTEISgqlglflldlplqgKVSCEIVVNTKNETISHQNC  748
              +T    SG L   L+   L+ K+SC+IVVN     I  ++C
Sbjct  181  PLETDMNFSGNLEFLLVHPHLEAKLSCDIVVNPGTNEIMEKSC  223



>ref|XP_004955793.1| PREDICTED: uncharacterized protein LOC101756814 [Setaria italica]
Length=254

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 84/152 (55%), Gaps = 5/152 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPPSLDIYLDLIVKVQNRDFY-SVDYNALVVSIAYRRKR  481
            +PS P   V  +++  FRV P  P LD+ L L ++V N  F   + Y A+  +++YR   
Sbjct  105  YPSPPAARVGDIRVDRFRVDP--PVLDLGLALRLRVLNPGFLLPLRYRAVSAAVSYRGHL  162

Query  482  LGYVTS--EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgql  655
            LG   +    G L AR   Y +A + +    ++ DV+ LI D+A GSV  + VTE+ G +
Sbjct  163  LGSAKAWPGSGELAARDEVYADAEVWVDAGRVLDDVVDLIGDLATGSVPLEIVTEVVGSI  222

Query  656  glflldlplqgKVSCEIVVNTKNETISHQNCY  751
             LF   +P++G +SC + ++ + + I  Q+CY
Sbjct  223  RLFRFHIPVKGLISCSVNISPETQGIISQDCY  254



>ref|XP_010322682.1| PREDICTED: uncharacterized protein LOC104648055 [Solanum lycopersicum]
Length=82

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = -3

Query  1371  MCYPHPYWVQLHESGKGDRAEEARARVVP----GGGARAVSSGSMKQCLCSPTNHPGSFR  1204
             MCYP     +     +G R E+   +VV      G   +  +G+MKQC+CSPT+HPGSFR
Sbjct  1     MCYPRERPGRFVPPDEGQRREQVEIQVVSREVSNGNGSSAEAGTMKQCVCSPTHHPGSFR  60

Query  1203  CRLHHKEYKWGCQ  1165
             CR HH +YKW  Q
Sbjct  61    CRHHHADYKWAAQ  73



>dbj|BAJ94476.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 69/117 (59%), Gaps = 4/117 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDFY-SVDYNALVVSIAYRRK  478
            +PS P   VA ++L  FRV+P P P+LD  L L ++V+N  F   + Y A+  +++YR +
Sbjct  117  YPSAPAARVADIRLDRFRVNPPPFPALDFNLALGLRVRNPGFLLPLRYRAVSAAVSYRGR  176

Query  479  RLGYVTSE--EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             LG  T+    G L AR  +Y ++ + +    ++ DV+ LI D+A GSV  + VTE+
Sbjct  177  LLGSGTARPGSGELAARGVTYASSEVWVDAGRVLDDVIELIGDIAAGSVPLEIVTEV  233



>ref|XP_006356160.1| PREDICTED: uncharacterized protein LOC102579994 [Solanum tuberosum]
Length=77

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  1299  ARVVPGGGARAVSSGSMKQCLCSPTNHPGSFRCRLHHKEYKWGCQL  1162
             +R V  G   +  +G MKQC+CSPT HPGSFRCR HH +YKW  QL
Sbjct  24    SREVSNGNGSSAEAGMMKQCVCSPTQHPGSFRCRHHHADYKWAAQL  69



>ref|NP_001059155.1| Os07g0206800 [Oryza sativa Japonica Group]
 dbj|BAC83239.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF21069.1| Os07g0206800 [Oryza sativa Japonica Group]
Length=237

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDF-YSVDYNALVVSIAYRRK  478
            +PS P   V  L+L  FRV+P P PS+D++L L ++V+N      + Y A+  +++YR  
Sbjct  105  YPSAPVARVEGLRLDRFRVNPPPLPSVDLHLALRLRVRNPGLVLPLRYRAVSAAVSYRGH  164

Query  479  RLGYVTSE--EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             LG   +    G L AR ++Y +A + +    ++ DV+ LI D+A GS+  + VTE+
Sbjct  165  LLGSAAARPGSGELGARGTTYADAEVWVDAGRVVDDVIDLIGDLAAGSLPLEIVTEV  221



>ref|XP_009786429.1| PREDICTED: uncharacterized protein LOC104234552 [Nicotiana sylvestris]
Length=89

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 44/85 (52%), Gaps = 3/85 (4%)
 Frame = -3

Query  1371  MCYPH-PYWVQLHESGKGDRAEEARARVVPGGGARAVSSGSMK--QCLCSPTNHPGSFRC  1201
             MCY   PYWV  H+  +G     AR +V         +   M+  QC+CSPT HPGSFRC
Sbjct  1     MCYSGVPYWVGAHDKREGRYRPVAREQVASASTGSIGAGAGMRKFQCVCSPTKHPGSFRC  60

Query  1200  RLHHKEYKWGCQLTPKHSQ*TAISV  1126
             R HH +YKW   L  K S     SV
Sbjct  61    RHHHSDYKWVAPLGIKPSNHLGTSV  85



>ref|XP_002461671.1| hypothetical protein SORBIDRAFT_02g006180 [Sorghum bicolor]
 gb|EER98192.1| hypothetical protein SORBIDRAFT_02g006180 [Sorghum bicolor]
Length=261

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 86/152 (57%), Gaps = 5/152 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPPSLDIYLDLIVKVQNRDFY-SVDYNALVVSIAYRRKR  481
            +PS P   VA +++  FRV P  P LD+ L L ++V+N  F   + Y A+  +++YR   
Sbjct  112  YPSAPAARVADVRVDSFRVQP--PLLDLGLALRLRVRNPGFLLPLRYRAVSAAVSYRGHL  169

Query  482  LGYVTS--EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgql  655
            LG   +    G L AR   Y +A + +    ++ DV+ LI DVA GSV  + V+E+ G +
Sbjct  170  LGSAKAWPGSGELAARDEVYADAQVWVDAGRVLDDVIELIGDVAAGSVPLEIVSEVVGSI  229

Query  656  glflldlplqgKVSCEIVVNTKNETISHQNCY  751
             +F   +P++G +SC + ++ + + I  Q+CY
Sbjct  230  KVFRFHIPVKGLMSCSVNISPETQRIISQDCY  261



>gb|EEC81715.1| hypothetical protein OsI_25326 [Oryza sativa Indica Group]
Length=278

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDF-YSVDYNALVVSIAYRRK  478
            +PS P   V  L+L  FRV+P P PS+D++L L ++V+N      + Y A+  +++YR  
Sbjct  105  YPSAPVARVEGLRLDRFRVNPPPLPSVDLHLALRLRVRNPGLVLPLRYRAVSAAVSYRGH  164

Query  479  RLGYVTSE--EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
             LG   +    G L AR ++Y +A + +    ++ DV+ LI D+A GS+  + VTE+
Sbjct  165  LLGSAAARPGSGELGARGTTYADAEVWVDAGRVVDDVIDLIGDLAAGSLPLEIVTEV  221



>gb|EAZ39074.1| hypothetical protein OsJ_23504 [Oryza sativa Japonica Group]
Length=1066

 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = +2

Query  305   WPSDPGVSVARLKLRGFRVHPFP-PSLDIYLDLIVKVQNRDF-YSVDYNALVVSIAYRRK  478
             +PS P   V  L+L  FRV+P P PS+D++L L ++V+N      + Y A+  +++YR  
Sbjct  934   YPSAPVARVEGLRLDRFRVNPPPLPSVDLHLALRLRVRNPGLVLPLRYRAVSAAVSYRGH  993

Query  479   RLGYVTSE--EGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
              LG   +    G L AR ++Y +A + +    ++ DV+ LI D+A GS+  + VTE+
Sbjct  994   LLGSAAARPGSGELGARGTTYADAEVWVDAGRVVDDVIDLIGDLAAGSLPLEIVTEV  1050



>ref|NP_001136794.1| hypothetical protein [Zea mays]
 gb|ACF82650.1| unknown [Zea mays]
 tpg|DAA59978.1| TPA: hypothetical protein ZEAMMB73_370127 [Zea mays]
 tpg|DAA59979.1| TPA: hypothetical protein ZEAMMB73_370127 [Zea mays]
Length=253

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 83/152 (55%), Gaps = 5/152 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPPSLDIYLDLIVKVQNRDF-YSVDYNALVVSIAYRRKR  481
            +PS P   VA L++  FR  P  P L + L L ++V N  F   + Y A+  +++YR   
Sbjct  104  YPSAPAARVADLRVDSFRAQP--PVLGLGLALRLRVSNPGFVLPLRYRAVSAAVSYRGHL  161

Query  482  LGYVTS--EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgql  655
            LG   +    G L AR   Y +A + +   +++ DV+ LI DVA GSV  + V+E+ G +
Sbjct  162  LGAAKAWPGSGELAARNEVYADAEVWVDAGKVLDDVIELIGDVAAGSVPLEIVSEVVGSI  221

Query  656  glflldlplqgKVSCEIVVNTKNETISHQNCY  751
             +F   +P++G +SC + ++   + I  Q+CY
Sbjct  222  KVFRFHIPVKGLISCSVSISPVTQGIISQDCY  253



>ref|NP_001144261.1| uncharacterized protein LOC100277135 [Zea mays]
 gb|ACG39087.1| hypothetical protein [Zea mays]
Length=255

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 83/152 (55%), Gaps = 5/152 (3%)
 Frame = +2

Query  305  WPSDPGVSVARLKLRGFRVHPFPPSLDIYLDLIVKVQNRDF-YSVDYNALVVSIAYRRKR  481
            +PS P   VA L++  FR  P  P L + L L ++V N  F   + Y A+  +++YR   
Sbjct  106  YPSAPAARVADLRVDSFRAQP--PVLGLGLALRLRVSNPGFVLPLRYRAVSAAVSYRGHL  163

Query  482  LGYVTS--EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgql  655
            LG   +    G L AR   Y +A + +   +++ DV+ LI DVA GSV  + V+E+ G +
Sbjct  164  LGAAKAWPGSGELAARDEVYADAEVWVDAGKVLDDVIELIGDVAAGSVPLEIVSEVVGSI  223

Query  656  glflldlplqgKVSCEIVVNTKNETISHQNCY  751
             +F   +P++G +SC + ++   + I  Q+CY
Sbjct  224  KVFRFHIPVKGLISCSVSISPVTQGIISQDCY  255



>gb|ACG40692.1| hypothetical protein [Zea mays]
Length=206

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 82/151 (54%), Gaps = 5/151 (3%)
 Frame = +2

Query  308  PSDPGVSVARLKLRGFRVHPFPPSLDIYLDLIVKVQNRDF-YSVDYNALVVSIAYRRKRL  484
            PS P   VA L++  FR  P  P L + L L ++V N  F   + Y A+  +++YR   L
Sbjct  58   PSAPAARVADLRVDSFRAQP--PVLGLGLALRLRVSNPGFVLPLRYRAVSAAVSYRGHLL  115

Query  485  GYVTS--EEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlg  658
            G   +    G L AR   Y +A + +   +++ DV+ LI DVA GSV  + V+E+ G + 
Sbjct  116  GAAKAWPGSGELAARNEVYADAEVWVDAGKVLDDVIELIGDVAAGSVPLEIVSEVVGSIK  175

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCY  751
            +F   +P++G +SC + ++   + I  Q+CY
Sbjct  176  VFRFHIPVKGLISCSVSISPVTQGIISQDCY  206



>ref|XP_007013201.1| Uncharacterized protein TCM_037899 [Theobroma cacao]
 gb|EOY30820.1| Uncharacterized protein TCM_037899 [Theobroma cacao]
Length=84

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 36/67 (54%), Gaps = 4/67 (6%)
 Frame = -3

Query  1350  WVQLHESGKGDRAEEARARVV-PGGGARAVSSGSMKQCLCSPTNHPGSFRCRLHHKEYKW  1174
             W  L  S         RA V    GGA    S SMKQCLCSPT HPGSFRCR HH EY W
Sbjct  20    WFVLQASMMAAARHAPRAGVARETGGA---GSTSMKQCLCSPTKHPGSFRCRHHHAEYVW  76

Query  1173  GCQLTPK  1153
             G +   K
Sbjct  77    GGRFISK  83



>ref|XP_009628211.1| PREDICTED: uncharacterized protein LOC104118631 [Nicotiana tomentosiformis]
Length=93

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = -3

Query  1371  MCYPH-PYWV--QLHESGKGDRAEEARARVVPGGGARAVSSGSMK-----QCLCSPTNHP  1216
             MCY   PYWV  Q    G+G     AR +V       ++ +G  K     QC+CSPT HP
Sbjct  1     MCYSGVPYWVGNQCKREGRGRYRPVAREQVTSVSTGISIGAGMKKFQFQFQCVCSPTKHP  60

Query  1215  GSFRCRLHHKEYKW  1174
             GSFRCR HH +YKW
Sbjct  61    GSFRCRHHHSDYKW  74



>ref|XP_001758636.1| predicted protein [Physcomitrella patens]
 gb|EDQ76614.1| predicted protein [Physcomitrella patens]
Length=207

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 57/114 (50%), Gaps = 8/114 (7%)
 Frame = +2

Query  302  IWPSDPGVSVARLKLRGFRVHPFPPS--------LDIYLDLIVKVQNRDFYSVDYNALVV  457
            +WP+ P + +   KL G                 L+I LD+++K++N +F  + Y+ L V
Sbjct  60   LWPAQPQIELEHWKLVGINFDTKEEGRSIIPVVYLNISLDVVLKIKNPNFVGIYYDFLDV  119

Query  458  SIAYRRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSV  619
             I YR   LG    + GH+ AR +  + A L L+  EI+ +   L+ D+A G +
Sbjct  120  EIQYRGSYLGNAQLKGGHILARRTVLVPAILNLEAREILENASELLMDIAHGEI  173



>ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago truncatula]
 ref|XP_003630804.1| hypothetical protein MTR_8g103600 [Medicago truncatula]
 gb|AET04118.1| hypothetical protein MTR_8g083460 [Medicago truncatula]
Length=83

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  1284  GGGARAVSSGSMKQCLCSPTNHPGSFRCRLHHKEYKW  1174
             GGG RA   GS+KQC+CSP+ HPGSFRCR H  +Y W
Sbjct  41    GGGDRAGEDGSIKQCVCSPSKHPGSFRCRQHQAKYVW  77



>ref|XP_006664899.1| PREDICTED: uncharacterized protein LOC102714338 [Oryza brachyantha]
Length=167

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = +2

Query  362  HPFPPS-LDIYLDLIVKVQNRDF-YSVDYNALVVSIAYRRKRLGYVTSE--EGHLKARAS  529
            + FP S +D+ L L + V+N      + Y A+  +++YR   LG   +    G L AR +
Sbjct  34   YAFPASAVDLDLALRLSVRNPGLVLPLRYRAVSAAVSYRGHLLGSAAARPGSGDLDARGT  93

Query  530  SYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVSCEIV  709
            +Y +A + +    +I DV+ LI D+A GS+  + VTE+ G + +F  D+P++G +SC + 
Sbjct  94   TYADAEVWVDAGRVIDDVIDLIGDLAAGSLPLEIVTEVVGAVRVFRFDIPVKGLISCSVN  153

Query  710  VNTKNETISHQNCY  751
            V+   + I  Q+CY
Sbjct  154  VSPDTQRIISQDCY  167



>ref|XP_006381709.1| hypothetical protein POPTR_0006s16210g [Populus trichocarpa]
 gb|ERP59506.1| hypothetical protein POPTR_0006s16210g [Populus trichocarpa]
Length=88

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = -3

Query  1305  ARARVVPGGGARAVSSGSMKQCLCSPTNHPGSFRCRLHHKEYKWGCQLTPK  1153
             AR  V  GGG+    S S+ +CLCSPT HPGSFRCR H  +Y W  ++T K
Sbjct  33    ARTEVAAGGGS--AISRSINKCLCSPTRHPGSFRCRHHRSDYVWSGRITRK  81



>gb|ABK25772.1| unknown [Picea sitchensis]
Length=88

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
 Frame = -3

Query  1314  AEEARARVVPGGGARAVSSGSMKQ--CLCSPTNHPGSFRCRLHHKEYKWG  1171
             AEEA  R++        + GS K   CLCSPTNH GSFRCRLH   YKWG
Sbjct  32    AEEAGNRLISPRSEEETAEGSGKNKFCLCSPTNHAGSFRCRLHRSSYKWG  81



>ref|XP_002324414.1| hypothetical protein POPTR_0018s05880g [Populus trichocarpa]
 gb|EEF02979.1| hypothetical protein POPTR_0018s05880g [Populus trichocarpa]
Length=85

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = -3

Query  1290  VPGGGARAVSSGSMKQCLCSPTNHPGSFRCRLHHKEYKWGCQLT  1159
             V   G+ AV+ GS+K+CLCSPT HPGSFRCR H  +Y WG ++T
Sbjct  37    VAATGSSAVA-GSIKKCLCSPTRHPGSFRCRHHRSDYVWGGRIT  79



>ref|XP_007140030.1| hypothetical protein PHAVU_008G078400g [Phaseolus vulgaris]
 gb|ESW12024.1| hypothetical protein PHAVU_008G078400g [Phaseolus vulgaris]
Length=222

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 70/150 (47%), Gaps = 5/150 (3%)
 Frame = +2

Query  314  DPGVSVARLKLRGFRVHPFPPSLDIY----LDLIVKVQNRDFYSVDYNALVVSIAYRRKR  481
            DP   +    L G       P++DI     LDL V+V+NR+  S  +      + Y+ K 
Sbjct  67   DPRTQLVAATLEGISPRVTFPAIDIQINVTLDLKVQVENRNRASFKHEGGKSVLLYKGKE  126

Query  482  LGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEI-Sgqlg  658
            +G      G + +R S+ ++  L L+  E+ +++    EDV  G ++ DTVT I      
Sbjct  127  VGETYIYPGLIPSRGSAILSCRLTLQADELASNLTTFFEDVMDGDISMDTVTRIPGKVTF  186

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNC  748
            L  +   +  K  C+  V+  N  I++QNC
Sbjct  187  LGFIKKHIVAKSFCQFTVSIPNFKITNQNC  216



>ref|XP_006465532.1| PREDICTED: uncharacterized protein LOC102614963 [Citrus sinensis]
Length=78

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 6/49 (12%)
 Frame = -3

Query  1305  ARARVVPGGGARAVSSG----SMKQCLCSPTNHPGSFRCRLHHKEYKWG  1171
             A+ARV   G  + VS G    + + C+CSPT+HPGSFRCR H  EYKWG
Sbjct  26    AQARVT--GSQQTVSDGGDAKTTRVCVCSPTSHPGSFRCRYHRIEYKWG  72



>gb|ADP02176.1| hypothetical protein 1E5.1 [Triticum aestivum]
Length=386

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 18/93 (19%)
 Frame = +2

Query  533  YINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISg------------------qlg  658
            Y++A L+L G+ ++ D + L+ED+ARGS+ FD V E+ G                     
Sbjct  119  YVDADLRLDGIRVVEDAIYLLEDLARGSIPFDAVVEVEGHLHFFLSIPVKLWIAIPLTRQ  178

Query  659  lflldlplqgKVSCEIVVNTKNETISHQNCYPE  757
            L L+   + G+++C + VN  ++TI HQ+CYP+
Sbjct  179  LMLISTFVMGRIACVVHVNPHDQTIVHQDCYPK  211



>ref|XP_010923414.1| PREDICTED: uncharacterized protein LOC105046513 [Elaeis guineensis]
Length=92

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -3

Query  1248  KQCLCSPTNHPGSFRCRLHHKEYKWG  1171
             KQC+CSPT+HP SFRCR HH+EYKWG
Sbjct  46    KQCICSPTHHPRSFRCRHHHREYKWG  71



>gb|KDP33658.1| hypothetical protein JCGZ_07229 [Jatropha curcas]
Length=86

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  1254  SMKQCLCSPTNHPGSFRCRLHHKEYKWGCQLTPK  1153
             S+K C+CSPT H GSFRCR HH +Y+WG ++T K
Sbjct  53    SIKSCICSPTRHAGSFRCRYHHGDYEWGRRITKK  86



>ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48276.1| conserved hypothetical protein [Ricinus communis]
Length=90

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  1251  MKQCLCSPTNHPGSFRCRLHHKEYKWGCQLTPK  1153
             +K C+CSPT HPGSFRCR HH +Y WG ++T K
Sbjct  58    IKMCVCSPTRHPGSFRCRHHHVDYAWGRRITKK  90



>tpg|DAA48645.1| TPA: hypothetical protein ZEAMMB73_005874 [Zea mays]
Length=190

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 49/113 (43%), Gaps = 1/113 (1%)
 Frame = +2

Query  308  PSDPGVSVARLKLRGFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLG  487
            P DP   +  + L  F   P P +LDI L L V   N +   V Y    VSI Y    LG
Sbjct  36   PRDPRFELISISLSAFHFRP-PAALDIGLTLTVHATNPNVVPVRYGPSTVSILYGGAHLG  94

Query  488  YVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
                + G   A +   ++   +L GVE+      L+ DVAR  +  D   EI+
Sbjct  95   TARLDAGEQPATSCRLLHLPARLDGVELAHRARALLSDVARRHMELDAAVEIA  147



>ref|XP_009347169.1| PREDICTED: uncharacterized protein LOC103938850 [Pyrus x bretschneideri]
Length=104

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  1254  SMKQCLCSPTNHPGSFRCRLHHKEYKWG  1171
             + ++CLCSPT HPGSFRCR HH EY WG
Sbjct  65    NTRRCLCSPTRHPGSFRCRQHHAEYAWG  92



>gb|EPS66146.1| hypothetical protein M569_08632, partial [Genlisea aurea]
Length=182

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 29/46 (63%), Gaps = 4/46 (9%)
 Frame = -3

Query  1272  RAVSSGSMKQCLCSPTNHPGSFRCRLHHKE----YKWGCQLTPKHS  1147
             R ++SG  K CLCSPTNHPGSFRC LH K     Y  G Q TP  S
Sbjct  77    RPLNSGGKKTCLCSPTNHPGSFRCSLHKKNLMPGYNHGNQTTPYRS  122



>ref|XP_010249769.1| PREDICTED: uncharacterized protein LOC104592234 [Nelumbo nucifera]
Length=93

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  1290  VPGGGARAVSSGSMKQCLCSPTNHPGSFRCRLHHKEYKWGCQL  1162
             VP       + GS ++C+CSPT HPGSFRCR HH EY+WG ++
Sbjct  43    VPTAEGGGGAGGSPRRCVCSPTRHPGSFRCRRHHGEYEWGGRI  85



>ref|XP_004503417.1| PREDICTED: uncharacterized protein LOC101489104 [Cicer arietinum]
Length=72

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = -3

Query  1311  EEARARVVPGGGARAVSSGSMKQCLCSPTNHPGSFRCRLHHKEYKW  1174
             E+  A V+  G       GS KQC+CSP+ HPGSFRCR H  +Y W
Sbjct  21    EQEPAVVLVAGQGHGGEDGSTKQCVCSPSKHPGSFRCRHHQAKYVW  66



>ref|XP_006846191.1| hypothetical protein AMTR_s00012p00214100 [Amborella trichopoda]
 gb|ERN07866.1| hypothetical protein AMTR_s00012p00214100 [Amborella trichopoda]
Length=98

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  1242  CLCSPTNHPGSFRCRLHHKEYKWGCQLTPKHSQ  1144
             C+CSPT HPGSFRCR HHK Y+WG + T + ++
Sbjct  63    CICSPTRHPGSFRCRYHHKYYQWGSKRTTEDTE  95



>ref|XP_009395975.1| PREDICTED: uncharacterized protein LOC103981098 [Musa acuminata 
subsp. malaccensis]
Length=201

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 67/140 (48%), Gaps = 7/140 (5%)
 Frame = +2

Query  335  RLKLRGFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYN-ALVVSIAYRRKRLGYVTSEEGH  511
            R+ L   RV      L++ LDL V+V NR++ +  +      S+ YR  ++G      G 
Sbjct  61   RVDLPALRVE-----LNVTLDLAVRVHNRNYAAFTHAPGGRTSLLYRGTQVGEADVAPGR  115

Query  512  LKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgK  691
            + +R S  +   L ++   I+ ++  L+ DV  G+V FDTVT + G++            
Sbjct  116  IPSRGSELLQLALAVEVDRIVAELGSLLSDVVAGAVAFDTVTRLPGRVTFMGFIKRHAVA  175

Query  692  VS-CEIVVNTKNETISHQNC  748
             S C +V+   + ++  Q+C
Sbjct  176  TSDCHVVIGVSDLSVRSQDC  195



>ref|XP_003574930.1| PREDICTED: uncharacterized protein LOC100825530 [Brachypodium 
distachyon]
Length=192

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 50/113 (44%), Gaps = 1/113 (1%)
 Frame = +2

Query  308  PSDPGVSVARLKLRGFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLG  487
            P DP   +  + L  F   P P +LD+ L L V   N +   V Y A  V+I Y   RLG
Sbjct  37   PRDPRFELISISLSSFHFRP-PAALDMGLTLTVHATNPNVVPVRYGASTVTILYGGDRLG  95

Query  488  YVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
                + G   A +   I    +L GVE+ +    ++ D AR  +  D   EI+
Sbjct  96   TARLDAGGQPATSCRLIQLPARLDGVELASHAGAILADAARRHMELDAEVEIA  148



>gb|ABR17408.1| unknown [Picea sitchensis]
Length=166

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -3

Query  1308  EARARVVPGGGARAVSSGSMKQCLCSPTNHPGSFRCRLHHK  1186
             + RA   PG G  + S+ S K C+CSPTNHPGSFRCRLH K
Sbjct  53    QVRAACDPGNGISS-SASSRKACMCSPTNHPGSFRCRLHRK  92



>ref|XP_006451138.1| hypothetical protein CICLE_v10010038mg [Citrus clementina]
 gb|ESR64378.1| hypothetical protein CICLE_v10010038mg [Citrus clementina]
Length=91

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  1251  MKQCLCSPTNHPGSFRCRLHHKEYKWGCQLTPKHS  1147
             +KQC+CSPT HPGSFRCR HH +Y W  ++T   S
Sbjct  52    IKQCVCSPTTHPGSFRCRHHHAQYVWRGRITKVES  86



>gb|KGN45357.1| hypothetical protein Csa_7G446750 [Cucumis sativus]
Length=78

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 34/67 (51%), Gaps = 4/67 (6%)
 Frame = -3

Query  1371  MCYPHPYWVQLHESGKGDRAEEARARVVPGGGA-RAVSSGSMKQCLCSPTNHPGSFRCRL  1195
             MCYP    +  H       A   R+ V     A R   SG   +C+CSPT HPGSF+CR 
Sbjct  1     MCYPT---LPFHRPTAFSFASHGRSVVAAVEEAVRQQRSGGGYKCICSPTTHPGSFKCRF  57

Query  1194  HHKEYKW  1174
             H  +YKW
Sbjct  58    HQGDYKW  64



>ref|XP_008386523.1| PREDICTED: uncharacterized protein LOC103449029 [Malus domestica]
Length=105

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  1248  KQCLCSPTNHPGSFRCRLHHKEYKWG  1171
             + CLCSPT HPGSFRCR HH EY WG
Sbjct  68    RWCLCSPTQHPGSFRCRQHHAEYVWG  93



>gb|KGN65356.1| hypothetical protein Csa_1G369510 [Cucumis sativus]
Length=90

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 36/78 (46%), Gaps = 21/78 (27%)
 Frame = -3

Query  1371  MCYPHPY------------WVQLHESGKGDRAEEARARVVPGGGARAVSSGSMKQCLCSP  1228
             MCYPH +            WV    +     AE+A   +   G          ++CLCSP
Sbjct  1     MCYPHHFLSRRDFSSLQCNWVLFQTTP----AEDATPAIESCG-----DESGKRRCLCSP  51

Query  1227  TNHPGSFRCRLHHKEYKW  1174
             T HPGSFRCRLH  EY W
Sbjct  52    TRHPGSFRCRLHRNEYVW  69



>ref|XP_001778238.1| predicted protein [Physcomitrella patens]
 gb|EDQ56905.1| predicted protein [Physcomitrella patens]
Length=207

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 54/119 (45%), Gaps = 6/119 (5%)
 Frame = +2

Query  308  PSDPGVSVARLKLRGFRVHPFPPSL------DIYLDLIVKVQNRDFYSVDYNALVVSIAY  469
            P DP   V  ++L GF+V     SL      D+ + + +KV N +   + Y +  + + Y
Sbjct  24   PKDPSFEVIHIELSGFKVRWMTESLIPYAVVDVAMKISIKVTNPNITPIKYTSTTMVMFY  83

Query  470  RRKRLGYVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
            R  ++G    E G   AR+   I    +L G++I   +  L +DV +  +    V  I+
Sbjct  84   RGTKMGTADVEAGSQDARSDQVIEIPAKLDGLKITEHLKELFQDVRKREMVMSAVVTIT  142



>ref|XP_009394853.1| PREDICTED: uncharacterized protein LOC103980249 [Musa acuminata 
subsp. malaccensis]
Length=214

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 62/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  380  LDIYLDLIVKVQNRDFYSVDY-NALVVSIAYRRKRLGYVTSEEGHLKARASSYINATLQL  556
             +I LDL V+V+NR++ S  + +     + YR   +G    E G + AR +  +   L++
Sbjct  84   FNITLDLAVRVRNRNYASFAHASGGHTQLLYRGAEVGKARVEPGRIPARGTELLRLALEV  143

Query  557  KGVEIITDVLPLIEDVARGSVTFDTVTEISgqlglflldlplqgKVS-CEIVVNTKNETI  733
            +  ++ TD+  L+ D A G+V FD  T + G++ L           S C +V+   + ++
Sbjct  144  EVDQLATDLGSLLADAASGAVAFDAETRMPGRVTLLGFIKHHAVATSDCHVVIGVPDLSV  203

Query  734  SHQNC  748
              Q C
Sbjct  204  QSQEC  208



>ref|XP_002445681.1| hypothetical protein SORBIDRAFT_07g024160 [Sorghum bicolor]
 gb|EES15176.1| hypothetical protein SORBIDRAFT_07g024160 [Sorghum bicolor]
Length=190

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 49/113 (43%), Gaps = 1/113 (1%)
 Frame = +2

Query  308  PSDPGVSVARLKLRGFRVHPFPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLG  487
            P DP   +  + L  F     P +LDI L L V   N +   V Y A  VSI Y    LG
Sbjct  36   PRDPRFELISISLSAFHFRA-PAALDIGLTLTVHATNPNVVPVRYGASTVSILYGGAHLG  94

Query  488  YVTSEEGHLKARASSYINATLQLKGVEIITDVLPLIEDVARGSVTFDTVTEIS  646
                + G   A +   ++   +L GVE+      ++ DVAR  +  D   EI+
Sbjct  95   TARLDAGEQPATSCRLLHLPARLDGVELAHRARAILSDVARRHMELDAAVEIA  147



>ref|XP_007152821.1| hypothetical protein PHAVU_004G162600g [Phaseolus vulgaris]
 gb|ESW24815.1| hypothetical protein PHAVU_004G162600g [Phaseolus vulgaris]
Length=72

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  1248  KQCLCSPTNHPGSFRCRLHHKEYKW  1174
             K+C+CSP+ HPGSFRCRLHH EY W
Sbjct  42    KRCVCSPSQHPGSFRCRLHHGEYVW  66



>ref|XP_008788146.1| PREDICTED: uncharacterized protein LOC103705995 [Phoenix dactylifera]
Length=213

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 0/92 (0%)
 Frame = +2

Query  368  FPPSLDIYLDLIVKVQNRDFYSVDYNALVVSIAYRRKRLGYVTSEEGHLKARASSYINAT  547
            F   L++ L+L+V V N +  + D+     ++ YR   +G    E G +  R  +Y+   
Sbjct  80   FHIELNVTLELMVLVHNPNRAAFDHAEGDTALLYRGALVGDAVVEPGRIPPRGDAYVQLN  139

Query  548  LQLKGVEIITDVLPLIEDVARGSVTFDTVTEI  643
            L+++   +   +L L+ DVA G V FDT T I
Sbjct  140  LRVEADRLAAKLLSLVADVAAGEVAFDTSTRI  171



>gb|EYU24693.1| hypothetical protein MIMGU_mgv1a018247mg [Erythranthe guttata]
Length=88

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 42/88 (48%), Gaps = 13/88 (15%)
 Frame = -3

Query  1371  MCYPH-PYWVQLHESGKGDR-----AEEARARVVPGGGARAVSSGS-------MKQCLCS  1231
             MCYP   YW   ++     R     A EA   V   G   A + G         K C+CS
Sbjct  1     MCYPQVAYWEGGYKCATRRRQLIAPAAEADTEVAVRGRQEANTGGGGGGGGGMTKVCVCS  60

Query  1230  PTNHPGSFRCRLHHKEYKWGCQLTPKHS  1147
             PT HPGSFRCR HH EY+W  +L  K S
Sbjct  61    PTGHPGSFRCRHHHGEYQWVNRLGTKPS  88



>gb|KHN20688.1| hypothetical protein glysoja_019005 [Glycine soja]
Length=76

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -3

Query  1251  MKQCLCSPTNHPGSFRCRLHHKEYKW  1174
             +K C+CSP+ HPGSFRCRLHH EY W
Sbjct  45    VKHCVCSPSQHPGSFRCRLHHGEYVW  70



>gb|KCW79696.1| hypothetical protein EUGRSUZ_C01049 [Eucalyptus grandis]
Length=83

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 40/82 (49%), Gaps = 21/82 (26%)
 Frame = -3

Query  1371  MCYPHPYWVQLHESGKGDRAEEARARVVPGGGARAVSS----------------GSMKQC  1240
             MC+P+     +  S  GD A  +R +V P  G  + +                 G M++C
Sbjct  1     MCHPN-----VPVSSLGDPARPSRWQVSPVTGISSTAEAGVLAREAAPEAGSRGGVMRRC  55

Query  1239  LCSPTNHPGSFRCRLHHKEYKW  1174
             +CSPT H GSFRCRLH  EY W
Sbjct  56    MCSPTGHAGSFRCRLHIAEYVW  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4161078891900