BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16201_g1_i1 len=437 path=[1:0-174 176:175-212 214:213-436]

Length=437
                                                                      Score     E

ref|XP_009760265.1|  PREDICTED: nuclear transcription factor Y su...    174   2e-52   
ref|XP_009605488.1|  PREDICTED: nuclear transcription factor Y su...    173   4e-52   
ref|XP_011092666.1|  PREDICTED: nuclear transcription factor Y su...    168   4e-50   
ref|XP_010549755.1|  PREDICTED: nuclear transcription factor Y su...    166   2e-49   
emb|CBI39480.3|  unnamed protein product                                167   2e-49   
ref|XP_007030959.1|  Nuclear transcription factor Y subunit B-4         166   2e-49   
emb|CDP15496.1|  unnamed protein product                                166   5e-49   
ref|XP_004231278.1|  PREDICTED: nuclear transcription factor Y su...    165   6e-49   
ref|XP_010025198.1|  PREDICTED: nuclear transcription factor Y su...    166   8e-49   
ref|XP_010529024.1|  PREDICTED: nuclear transcription factor Y su...    164   2e-48   
ref|XP_011023651.1|  PREDICTED: nuclear transcription factor Y su...    163   5e-48   
ref|XP_010659617.1|  PREDICTED: nuclear transcription factor Y su...    163   8e-48   
ref|XP_010043071.1|  PREDICTED: nuclear transcription factor Y su...    162   1e-47   
gb|EYU28976.1|  hypothetical protein MIMGU_mgv1a023635mg                161   1e-47   
gb|EYU21005.1|  hypothetical protein MIMGU_mgv1a026263mg                160   2e-47   
emb|CDX95014.1|  BnaC05g06570D                                          161   2e-47   
ref|XP_009148158.1|  PREDICTED: nuclear transcription factor Y su...    161   2e-47   
ref|XP_010489638.1|  PREDICTED: nuclear transcription factor Y su...    161   3e-47   
ref|XP_006433383.1|  hypothetical protein CICLE_v10003157mg             161   3e-47   
ref|XP_003518964.1|  PREDICTED: nuclear transcription factor Y su...    161   3e-47   
ref|XP_002319001.1|  hypothetical protein POPTR_0013s02030g             161   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006304477.1|  hypothetical protein CARUB_v10011185mg             161   3e-47   
ref|NP_172377.1|  nuclear transcription factor Y subunit B-4            160   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006344838.1|  PREDICTED: nuclear transcription factor Y su...    160   6e-47   
ref|XP_002892478.1|  hypothetical protein ARALYDRAFT_888138             159   1e-46   
ref|XP_004309676.1|  PREDICTED: nuclear transcription factor Y su...    160   2e-46   
ref|XP_003536891.1|  PREDICTED: nuclear transcription factor Y su...    159   2e-46   
ref|XP_010269452.1|  PREDICTED: nuclear transcription factor Y su...    160   2e-46   
ref|XP_010458171.1|  PREDICTED: nuclear transcription factor Y su...    158   3e-46   
gb|KDO56274.1|  hypothetical protein CISIN_1g045194mg                   159   3e-46   
ref|XP_007207636.1|  hypothetical protein PRUPE_ppa021948mg             158   3e-46   
ref|XP_002512405.1|  ccaat-binding transcription factor subunit A...    159   4e-46   Ricinus communis
ref|XP_006417619.1|  hypothetical protein EUTSA_v10009804mg             158   4e-46   
ref|XP_003591124.1|  Nuclear transcription factor Y subunit B-4         157   6e-46   
gb|KDP23500.1|  hypothetical protein JCGZ_23333                         158   7e-46   
ref|XP_008246442.1|  PREDICTED: nuclear transcription factor Y su...    158   8e-46   
ref|XP_010674711.1|  PREDICTED: nuclear transcription factor Y su...    158   9e-46   
ref|XP_007144547.1|  hypothetical protein PHAVU_007G165100g             157   9e-46   
emb|CDP03522.1|  unnamed protein product                                157   2e-45   
ref|XP_002269496.1|  PREDICTED: nuclear transcription factor Y su...    156   3e-45   Vitis vinifera
gb|KDP28110.1|  hypothetical protein JCGZ_13881                         157   3e-45   
ref|XP_010652046.1|  PREDICTED: nuclear transcription factor Y su...    157   3e-45   
gb|AFK37153.1|  unknown                                                 157   3e-45   
emb|CAN82321.1|  hypothetical protein VITISV_021316                     157   4e-45   Vitis vinifera
ref|XP_010069971.1|  PREDICTED: nuclear transcription factor Y su...    157   4e-45   
ref|XP_010088954.1|  Nuclear transcription factor Y subunit B-4         156   6e-45   
ref|XP_006382502.1|  hypothetical protein POPTR_0005s02750g             155   9e-45   
ref|XP_009789273.1|  PREDICTED: nuclear transcription factor Y su...    155   1e-44   
ref|XP_008779404.1|  PREDICTED: nuclear transcription factor Y su...    155   1e-44   
ref|XP_008789950.1|  PREDICTED: nuclear transcription factor Y su...    155   1e-44   
ref|XP_009401183.1|  PREDICTED: nuclear transcription factor Y su...    155   1e-44   
ref|XP_004240535.1|  PREDICTED: nuclear transcription factor Y su...    155   1e-44   
ref|XP_011036836.1|  PREDICTED: nuclear transcription factor Y su...    154   1e-44   
ref|XP_010684402.1|  PREDICTED: nuclear transcription factor Y su...    155   2e-44   
ref|XP_006355798.1|  PREDICTED: nuclear transcription factor Y su...    155   2e-44   
ref|XP_002321022.2|  hypothetical protein POPTR_0014s12710g             154   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_004302413.1|  PREDICTED: nuclear transcription factor Y su...    154   3e-44   
ref|XP_011033579.1|  PREDICTED: nuclear transcription factor Y su...    154   5e-44   
ref|XP_007050837.1|  Nuclear transcription factor Y subunit B-5         154   6e-44   
ref|XP_004495979.1|  PREDICTED: nuclear transcription factor Y su...    152   6e-44   
ref|XP_009382552.1|  PREDICTED: nuclear transcription factor Y su...    153   7e-44   
ref|XP_009376649.1|  PREDICTED: nuclear transcription factor Y su...    152   7e-44   
ref|XP_009411690.1|  PREDICTED: nuclear transcription factor Y su...    153   9e-44   
ref|XP_006855503.1|  hypothetical protein AMTR_s00057p00202310          153   1e-43   
ref|XP_009596719.1|  PREDICTED: nuclear transcription factor Y su...    153   1e-43   
ref|XP_008359868.1|  PREDICTED: nuclear transcription factor Y su...    152   1e-43   
ref|XP_009775948.1|  PREDICTED: nuclear transcription factor Y su...    152   2e-43   
ref|XP_010259679.1|  PREDICTED: nuclear transcription factor Y su...    153   2e-43   
ref|XP_006419612.1|  hypothetical protein CICLE_v10006769mg             152   2e-43   
ref|XP_011079712.1|  PREDICTED: nuclear transcription factor Y su...    152   3e-43   
ref|XP_011082631.1|  PREDICTED: nuclear transcription factor Y su...    152   3e-43   
gb|KDO75175.1|  hypothetical protein CISIN_1g044287mg                   152   3e-43   
ref|XP_008235018.1|  PREDICTED: nuclear transcription factor Y su...    152   3e-43   
gb|KCW61120.1|  hypothetical protein EUGRSUZ_H03892                     152   4e-43   
ref|XP_007201677.1|  hypothetical protein PRUPE_ppa022586mg             151   4e-43   
ref|XP_010938445.1|  PREDICTED: nuclear transcription factor Y su...    151   4e-43   
ref|XP_006359445.1|  PREDICTED: nuclear transcription factor Y su...    150   5e-43   
ref|XP_008368975.1|  PREDICTED: nuclear transcription factor Y su...    151   5e-43   
gb|AFK36846.1|  unknown                                                 149   6e-43   
ref|XP_007144936.1|  hypothetical protein PHAVU_007G195900g             150   7e-43   
ref|XP_010921780.1|  PREDICTED: nuclear transcription factor Y su...    151   8e-43   
ref|XP_008370459.1|  PREDICTED: nuclear transcription factor Y su...    149   9e-43   
gb|KDP27778.1|  hypothetical protein JCGZ_18858                         149   1e-42   
ref|XP_010090782.1|  Nuclear transcription factor Y subunit B-5         150   2e-42   
ref|XP_008359408.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear tran...    150   2e-42   
ref|XP_006480108.1|  PREDICTED: nuclear transcription factor Y su...    148   2e-42   
ref|XP_004247445.1|  PREDICTED: nuclear transcription factor Y su...    148   3e-42   
ref|XP_003535337.1|  PREDICTED: nuclear transcription factor Y su...    148   3e-42   
ref|XP_003555607.1|  PREDICTED: nuclear transcription factor Y su...    148   4e-42   
ref|XP_011023652.1|  PREDICTED: nuclear transcription factor Y su...    148   4e-42   
ref|XP_006380166.1|  hypothetical protein POPTR_0008s22520g             148   4e-42   
ref|XP_009620709.1|  PREDICTED: nuclear transcription factor Y su...    148   4e-42   
ref|XP_007154257.1|  hypothetical protein PHAVU_003G103500g             148   5e-42   
gb|KEH15995.1|  nuclear transcription factor Y protein                  147   5e-42   
ref|XP_008451614.1|  PREDICTED: nuclear transcription factor Y su...    148   5e-42   
gb|KGN44907.1|  hypothetical protein Csa_7G395250                       148   6e-42   
ref|XP_011008710.1|  PREDICTED: nuclear transcription factor Y su...    147   6e-42   
ref|XP_010656509.1|  PREDICTED: nuclear transcription factor Y su...    147   7e-42   
ref|XP_003550533.2|  PREDICTED: nuclear transcription factor Y su...    147   7e-42   
gb|EYU26195.1|  hypothetical protein MIMGU_mgv1a022187mg                146   7e-42   
gb|KHN26570.1|  Nuclear transcription factor Y subunit B-5              147   1e-41   
ref|XP_004229223.1|  PREDICTED: nuclear transcription factor Y su...    146   1e-41   
gb|AFK49656.1|  nuclear transcription factor Y subunit B6               148   1e-41   
ref|XP_002319000.1|  hypothetical protein POPTR_0013s02020g             146   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_007035553.1|  Nuclear transcription factor Y subunit B-5         147   2e-41   
gb|AFK49668.1|  nuclear transcription factor Y subunit B18              148   2e-41   
ref|XP_006342784.1|  PREDICTED: nuclear transcription factor Y su...    146   2e-41   
ref|XP_003529577.1|  PREDICTED: nuclear transcription factor Y su...    145   2e-41   
gb|EYU46700.1|  hypothetical protein MIMGU_mgv1a023582mg                145   2e-41   
gb|KHN02981.1|  Nuclear transcription factor Y subunit B-5              145   2e-41   
ref|XP_009628180.1|  PREDICTED: nuclear transcription factor Y su...    144   3e-41   
ref|XP_004508609.1|  PREDICTED: nuclear transcription factor Y su...    145   3e-41   
ref|XP_009133828.1|  PREDICTED: nuclear transcription factor Y su...    146   3e-41   
ref|XP_004971188.1|  PREDICTED: nuclear transcription factor Y su...    146   3e-41   
ref|XP_002459056.1|  hypothetical protein SORBIDRAFT_03g045150          147   3e-41   Sorghum bicolor [broomcorn]
gb|EAY77127.1|  hypothetical protein OsI_05092                          146   5e-41   Oryza sativa Indica Group [Indian rice]
ref|NP_001172729.1|  Os01g0935200                                       146   5e-41   
ref|XP_003567445.1|  PREDICTED: nuclear transcription factor Y su...    146   5e-41   
ref|XP_006397975.1|  hypothetical protein EUTSA_v10001724mg             145   5e-41   
ref|XP_010098301.1|  Nuclear transcription factor Y subunit B-5         145   6e-41   
ref|XP_004488253.1|  PREDICTED: nuclear transcription factor Y su...    144   1e-40   
ref|XP_011091059.1|  PREDICTED: nuclear transcription factor Y su...    144   1e-40   
ref|XP_010507851.1|  PREDICTED: nuclear transcription factor Y su...    144   1e-40   
emb|CDM82922.1|  unnamed protein product                                145   1e-40   
ref|XP_010037376.1|  PREDICTED: nuclear transcription factor Y su...    143   1e-40   
gb|EYU42160.1|  hypothetical protein MIMGU_mgv1a018421mg                142   2e-40   
ref|XP_006646656.1|  PREDICTED: nuclear transcription factor Y su...    144   2e-40   
ref|XP_003609646.1|  Nuclear transcription factor Y subunit B-5         145   2e-40   
gb|AFK49666.1|  nuclear transcription factor Y subunit B16              145   2e-40   
ref|XP_006598369.1|  PREDICTED: nuclear transcription factor Y su...    143   3e-40   
ref|NP_182302.1|  nuclear transcription factor Y subunit B-5            143   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296212.1|  hypothetical protein CARUB_v10025377mg             143   5e-40   
ref|XP_007154047.1|  hypothetical protein PHAVU_003G086800g             142   5e-40   
ref|XP_010518498.1|  PREDICTED: nuclear transcription factor Y su...    142   6e-40   
ref|XP_009349502.1|  PREDICTED: nuclear transcription factor Y su...    142   7e-40   
ref|XP_009352332.1|  PREDICTED: nuclear transcription factor Y su...    142   7e-40   
ref|XP_010506819.1|  PREDICTED: nuclear transcription factor Y su...    142   8e-40   
ref|XP_010523933.1|  PREDICTED: nuclear transcription factor Y su...    142   8e-40   
ref|XP_008674580.1|  PREDICTED: nuclear transcription factor Y su...    142   2e-39   
ref|XP_002882133.1|  hypothetical protein ARALYDRAFT_483964             141   2e-39   
ref|XP_008223170.1|  PREDICTED: nuclear transcription factor Y su...    142   2e-39   
ref|XP_002516901.1|  ccaat-binding transcription factor subunit A...    141   3e-39   Ricinus communis
ref|XP_004496024.1|  PREDICTED: nuclear transcription factor Y su...    139   3e-39   
ref|XP_008367162.1|  PREDICTED: nuclear transcription factor Y su...    140   4e-39   
gb|AHI94921.1|  transcription factor subunit NF-YB5                     140   4e-39   
emb|CDP19543.1|  unnamed protein product                                140   5e-39   
emb|CDY53021.1|  BnaC04g00090D                                          140   7e-39   
ref|XP_006651500.1|  PREDICTED: nuclear transcription factor Y su...    139   8e-39   
ref|XP_007224115.1|  hypothetical protein PRUPE_ppa015692mg             140   9e-39   
emb|CDX80136.1|  BnaA05g00200D                                          140   1e-38   
gb|KHN46582.1|  Nuclear transcription factor Y subunit B-5              137   2e-38   
ref|XP_001785354.1|  predicted protein                                  137   2e-38   
ref|XP_003557724.1|  PREDICTED: nuclear transcription factor Y su...    140   3e-38   
gb|KCW84457.1|  hypothetical protein EUGRSUZ_B01293                     137   4e-38   
ref|XP_004135781.1|  PREDICTED: nuclear transcription factor Y su...    137   4e-38   
emb|CDY40552.1|  BnaC02g33400D                                          139   5e-38   
emb|CBI26063.3|  unnamed protein product                                137   6e-38   
ref|XP_004148262.1|  PREDICTED: nuclear transcription factor Y su...    138   6e-38   
ref|XP_010037234.1|  PREDICTED: nuclear transcription factor Y su...    137   6e-38   
gb|AEW09144.1|  hypothetical protein CL4270Contig1_06                   135   8e-38   
ref|XP_001781393.1|  predicted protein                                  137   1e-37   
gb|AEH25944.1|  transcription factor CBF/NF-YB/HAP3                     138   1e-37   
gb|ADY38381.1|  nuclear transcription factor Y subunit B3               138   1e-37   
gb|ADL14487.1|  NF-YB3                                                  138   2e-37   
ref|XP_008449032.1|  PREDICTED: nuclear transcription factor Y su...    139   2e-37   
ref|NP_001147727.1|  nuclear transcription factor Y subunit B-3         138   2e-37   Zea mays [maize]
tpg|DAA63543.1|  TPA: nuclear transcription factor Y subunit B-3        138   2e-37   
gb|AHI94916.1|  transcription factor subunit NF-YB2A                    137   2e-37   
gb|AIZ68337.1|  CCAAT-binding transcription factor A                    137   2e-37   
ref|XP_009128989.1|  PREDICTED: nuclear transcription factor Y su...    137   3e-37   
gb|ADY38383.1|  nuclear transcription factor Y subunit B5               135   3e-37   
gb|ABD64993.1|  transcription factor Hap3b, putative                    137   3e-37   Brassica oleracea
emb|CDY28916.1|  BnaA02g25600D                                          137   3e-37   
ref|XP_007026370.1|  Nuclear transcription factor Y subunit B-3         137   4e-37   
ref|XP_009414194.1|  PREDICTED: nuclear transcription factor Y su...    135   5e-37   
gb|EYU43932.1|  hypothetical protein MIMGU_mgv1a018640mg                134   5e-37   
ref|XP_009771322.1|  PREDICTED: nuclear transcription factor Y su...    135   6e-37   
ref|NP_001050358.1|  Os03g0413000                                       137   6e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011002366.1|  PREDICTED: nuclear transcription factor Y su...    135   6e-37   
gb|AAL47206.1|  HAP3-like transcriptional-activator                     137   6e-37   Oryza sativa Indica Group [Indian rice]
gb|EAZ27313.1|  hypothetical protein OsJ_11252                          137   7e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002308762.2|  hypothetical protein POPTR_0006s00730g             135   7e-37   Populus trichocarpa [western balsam poplar]
emb|CBI32238.3|  unnamed protein product                                134   8e-37   
ref|XP_010538453.1|  PREDICTED: nuclear transcription factor Y su...    135   8e-37   
ref|XP_004507593.1|  PREDICTED: nuclear transcription factor Y su...    134   8e-37   
ref|XP_009407345.1|  PREDICTED: nuclear transcription factor Y su...    135   8e-37   
dbj|BAJ92177.1|  predicted protein                                      135   9e-37   
gb|AFE55547.1|  NF-YB3                                                  135   9e-37   
ref|XP_010689278.1|  PREDICTED: nuclear transcription factor Y su...    137   9e-37   
ref|XP_008809529.1|  PREDICTED: nuclear transcription factor Y su...    136   1e-36   
gb|KHN03372.1|  Nuclear transcription factor Y subunit B-5              133   1e-36   
ref|XP_009114258.1|  PREDICTED: nuclear transcription factor Y su...    135   1e-36   
ref|XP_002320523.2|  hypothetical protein POPTR_0014s16580g             135   1e-36   Populus trichocarpa [western balsam poplar]
gb|AHI94917.1|  transcription factor subunit NF-YB2B                    135   1e-36   
gb|KCW84465.1|  hypothetical protein EUGRSUZ_B01300                     133   1e-36   
ref|XP_011011131.1|  PREDICTED: nuclear transcription factor Y su...    135   1e-36   
ref|XP_010497798.1|  PREDICTED: nuclear transcription factor Y su...    132   2e-36   
ref|XP_010441427.1|  PREDICTED: nuclear transcription factor Y su...    135   2e-36   
ref|XP_010495002.1|  PREDICTED: nuclear transcription factor Y su...    135   2e-36   
ref|XP_001766253.1|  predicted protein                                  132   2e-36   
ref|XP_010481289.1|  PREDICTED: nuclear transcription factor Y su...    134   2e-36   
gb|EMT04714.1|  Nuclear transcription factor Y subunit B-3              134   2e-36   
ref|XP_010495003.1|  PREDICTED: nuclear transcription factor Y su...    134   2e-36   
gb|AFK49658.1|  nuclear trancsription factor Y subunit B8               133   2e-36   
ref|XP_003634760.1|  PREDICTED: nuclear transcription factor Y su...    135   2e-36   
ref|XP_006586933.1|  PREDICTED: nuclear transcription factor Y su...    132   3e-36   
gb|ABK23156.1|  unknown                                                 135   3e-36   Picea sitchensis
ref|XP_002463163.1|  hypothetical protein SORBIDRAFT_02g038870          135   3e-36   Sorghum bicolor [broomcorn]
ref|XP_006398463.1|  hypothetical protein EUTSA_v10001037mg             134   3e-36   
gb|KFK31356.1|  nuclear transcription factor y subunit b-3              134   3e-36   
ref|NP_199575.1|  nuclear transcription factor Y subunit B-2            134   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003061751.1|  histone-like transcription factor                  132   3e-36   
emb|CAA74052.1|  Transcription factor                                   134   4e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AIZ68336.1|  CCAAT-binding transcription factor A                    134   4e-36   
ref|XP_004296821.1|  PREDICTED: nuclear transcription factor Y su...    133   4e-36   
ref|XP_009616488.1|  PREDICTED: nuclear transcription factor Y su...    133   4e-36   
gb|AIZ68342.1|  CCAAT-binding transcription factor A                    133   4e-36   
ref|XP_004972332.1|  PREDICTED: nuclear transcription factor Y su...    133   5e-36   
ref|NP_001147638.1|  nuclear transcription factor Y subunit B-3         134   5e-36   Zea mays [maize]
ref|XP_002507332.1|  histone-like transcription factor                  132   5e-36   Micromonas commoda
ref|XP_003546199.1|  PREDICTED: nuclear transcription factor Y su...    133   5e-36   
ref|XP_004984032.1|  PREDICTED: nuclear transcription factor Y su...    134   6e-36   
ref|XP_008670554.1|  PREDICTED: nuclear transcription factor Y su...    134   6e-36   
gb|EMS59764.1|  Nuclear transcription factor Y subunit B-3              134   6e-36   
ref|XP_004486346.1|  PREDICTED: nuclear transcription factor Y su...    132   6e-36   
gb|KHN40791.1|  Nuclear transcription factor Y subunit B-3              133   6e-36   
ref|XP_006827085.1|  hypothetical protein AMTR_s00010p00239530          133   6e-36   
ref|XP_002967268.1|  CCAAT-box binding factor HAP3                      132   6e-36   
ref|XP_007138891.1|  hypothetical protein PHAVU_009G246400g             131   6e-36   
ref|XP_009388900.1|  PREDICTED: nuclear transcription factor Y su...    134   6e-36   
ref|XP_003562720.1|  PREDICTED: nuclear transcription factor Y su...    134   6e-36   
ref|XP_010921842.1|  PREDICTED: nuclear transcription factor Y su...    132   7e-36   
ref|XP_004958263.1|  PREDICTED: nuclear transcription factor Y su...    134   7e-36   
ref|XP_009622977.1|  PREDICTED: nuclear transcription factor Y su...    131   7e-36   
gb|EMT31159.1|  Nuclear transcription factor Y subunit B-5              132   7e-36   
ref|XP_011040164.1|  PREDICTED: nuclear transcription factor Y su...    133   7e-36   
ref|XP_004503068.1|  PREDICTED: nuclear transcription factor Y su...    133   8e-36   
gb|ABW09462.1|  CCAAT-box binding factor HAP3-like protein              131   8e-36   Selaginella moellendorffii
ref|XP_006282223.1|  hypothetical protein CARUB_v10028496mg             133   8e-36   
ref|XP_010532973.1|  PREDICTED: nuclear transcription factor Y su...    134   8e-36   
ref|XP_002467695.1|  hypothetical protein SORBIDRAFT_01g032590          134   9e-36   Sorghum bicolor [broomcorn]
ref|XP_002960452.1|  CCAAT-box binding factor HAP3                      132   9e-36   
ref|XP_010252766.1|  PREDICTED: nuclear transcription factor Y su...    133   9e-36   
gb|AFE55545.1|  NF-YB1                                                  134   9e-36   
emb|CDX82424.1|  BnaA03g33970D                                          133   9e-36   
ref|XP_009142500.1|  PREDICTED: nuclear transcription factor Y su...    132   1e-35   
ref|XP_006657935.1|  PREDICTED: nuclear transcription factor Y su...    134   1e-35   
gb|AIZ68341.1|  CCAAT-binding transcription factor A                    132   1e-35   
ref|XP_002323121.2|  hypothetical protein POPTR_0016s00780g             133   1e-35   Populus trichocarpa [western balsam poplar]
gb|AFK49663.1|  nuclear transcription factor Y subunit B13              132   1e-35   
ref|XP_001757004.1|  predicted protein                                  130   1e-35   
ref|XP_003524310.1|  PREDICTED: nuclear transcription factor Y su...    133   1e-35   
ref|XP_004136178.1|  PREDICTED: nuclear transcription factor Y su...    131   1e-35   
ref|XP_004170612.1|  PREDICTED: nuclear transcription factor Y su...    131   1e-35   
ref|XP_010936420.1|  PREDICTED: nuclear transcription factor Y su...    133   1e-35   
ref|XP_002865110.1|  hypothetical protein ARALYDRAFT_916623             132   2e-35   
ref|XP_007205885.1|  hypothetical protein PRUPE_ppa011298mg             133   2e-35   
ref|XP_008246237.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-35   
ref|XP_007147615.1|  hypothetical protein PHAVU_006G139400g             132   2e-35   
ref|XP_001756878.1|  predicted protein                                  130   2e-35   
ref|NP_001238398.1|  uncharacterized protein LOC100305641               132   2e-35   
ref|XP_010314139.1|  PREDICTED: nuclear transcription factor Y su...    132   2e-35   
ref|XP_009387674.1|  PREDICTED: nuclear transcription factor Y su...    132   2e-35   
ref|XP_008785640.1|  PREDICTED: nuclear transcription factor Y su...    133   2e-35   
ref|XP_009146189.1|  PREDICTED: nuclear transcription factor Y su...    131   2e-35   
ref|XP_009413530.1|  PREDICTED: nuclear transcription factor Y su...    131   2e-35   
gb|AHI94918.1|  transcription factor subunit NF-YB3A                    131   2e-35   
ref|XP_008813182.1|  PREDICTED: nuclear transcription factor Y su...    131   2e-35   
ref|XP_010270446.1|  PREDICTED: nuclear transcription factor Y su...    132   2e-35   
ref|XP_009412257.1|  PREDICTED: nuclear transcription factor Y su...    132   3e-35   
ref|XP_004304851.1|  PREDICTED: nuclear transcription factor Y su...    132   3e-35   
ref|XP_010088452.1|  Nuclear transcription factor Y subunit B-3         132   3e-35   
gb|EPS69508.1|  hypothetical protein M569_05260                         129   3e-35   
gb|ABW09466.1|  CCAAT-box binding factor HAP3-like protein              130   3e-35   Selaginella moellendorffii
ref|NP_001060230.1|  Os07g0606600                                       132   3e-35   Oryza sativa Japonica Group [Japonica rice]
gb|AHI94920.1|  transcription factor subunit NF-YB3C                    131   4e-35   
gb|KFK32404.1|  nuclear transcription factor y subunit b-3              131   4e-35   
ref|XP_002974019.1|  CCAAT-box binding factor HAP3                      130   4e-35   
ref|XP_003532355.1|  PREDICTED: nuclear transcription factor Y su...    132   4e-35   
gb|KDP35229.1|  hypothetical protein JCGZ_09388                         131   4e-35   
ref|XP_006602134.1|  PREDICTED: nuclear transcription factor Y su...    131   4e-35   
ref|XP_006856299.1|  hypothetical protein AMTR_s00047p00121790          132   4e-35   
ref|XP_009795246.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-35   
ref|XP_010939223.1|  PREDICTED: nuclear transcription factor Y su...    132   4e-35   
ref|XP_010270236.1|  PREDICTED: nuclear transcription factor Y su...    132   4e-35   
emb|CDY20167.1|  BnaA01g28350D                                          130   4e-35   
emb|CDY21888.1|  BnaC01g35600D                                          130   4e-35   
emb|CDP04654.1|  unnamed protein product                                133   4e-35   
ref|XP_002530428.1|  ccaat-binding transcription factor subunit A...    131   4e-35   
ref|XP_010319776.1|  PREDICTED: nuclear transcription factor Y su...    131   4e-35   
ref|XP_006586138.1|  PREDICTED: nuclear transcription factor Y su...    131   4e-35   
gb|EPS69128.1|  hypothetical protein M569_05641                         130   4e-35   
ref|XP_007020507.1|  Nuclear transcription factor Y subunit B-3         133   5e-35   
ref|XP_010675924.1|  PREDICTED: nuclear transcription factor Y su...    131   5e-35   
ref|XP_008796244.1|  PREDICTED: nuclear transcription factor Y su...    131   5e-35   
ref|XP_010938448.1|  PREDICTED: transcriptional activator hap3-like     130   5e-35   
ref|XP_008778301.1|  PREDICTED: nuclear transcription factor Y su...    132   5e-35   
ref|XP_008451142.1|  PREDICTED: nuclear transcription factor Y su...    129   5e-35   
emb|CDX89608.1|  BnaC03g45220D                                          131   6e-35   
ref|XP_009136216.1|  PREDICTED: nuclear transcription factor Y su...    131   6e-35   
ref|XP_002974020.1|  CCAAT-box binding factor HAP3                      130   6e-35   
ref|XP_006355096.1|  PREDICTED: nuclear transcription factor Y su...    131   6e-35   
ref|XP_010061460.1|  PREDICTED: nuclear transcription factor Y su...    131   6e-35   
ref|XP_007049366.1|  Nuclear transcription factor Y subunit B-3         131   6e-35   
ref|XP_011021924.1|  PREDICTED: nuclear transcription factor Y su...    132   7e-35   
ref|XP_002870307.1|  CCAAT-box binding transcription factor subun...    130   7e-35   
ref|NP_193190.1|  nuclear transcription factor Y subunit B-3            130   7e-35   
gb|AIZ68338.1|  CCAAT-binding transcription factor A                    131   7e-35   
ref|XP_009135466.1|  PREDICTED: nuclear transcription factor Y su...    130   7e-35   
ref|XP_008376324.1|  PREDICTED: nuclear transcription factor Y su...    130   8e-35   
ref|XP_009376762.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear tran...    130   8e-35   
ref|XP_008349882.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear tran...    130   8e-35   
ref|XP_004291567.1|  PREDICTED: nuclear transcription factor Y su...    130   8e-35   
ref|XP_007159754.1|  hypothetical protein PHAVU_002G264300g             131   8e-35   
ref|XP_006406899.1|  hypothetical protein EUTSA_v10021580mg             130   8e-35   
ref|XP_010440452.1|  PREDICTED: nuclear transcription factor Y su...    129   9e-35   
ref|XP_010450027.1|  PREDICTED: nuclear transcription factor Y su...    129   9e-35   
gb|AHI94925.1|  transcription factor subunit NF-YB7B                    131   9e-35   
ref|XP_009112239.1|  PREDICTED: nuclear transcription factor Y su...    130   9e-35   
ref|XP_008362436.1|  PREDICTED: nuclear transcription factor Y su...    130   9e-35   
emb|CDY37212.1|  BnaA09g08330D                                          130   1e-34   
gb|KDP39275.1|  hypothetical protein JCGZ_01032                         130   1e-34   
emb|CDX81449.1|  BnaC09g08600D                                          130   1e-34   
ref|XP_010027624.1|  PREDICTED: nuclear transcription factor Y su...    131   1e-34   
ref|XP_008227167.1|  PREDICTED: nuclear transcription factor Y su...    130   1e-34   
ref|XP_008337146.1|  PREDICTED: nuclear transcription factor Y su...    131   1e-34   
ref|XP_007212085.1|  hypothetical protein PRUPE_ppa011714mg             130   1e-34   
ref|XP_006359336.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-34   
ref|XP_003635539.1|  PREDICTED: nuclear transcription factor Y su...    130   1e-34   
ref|XP_006285415.1|  hypothetical protein CARUB_v10006827mg             129   1e-34   
ref|XP_007142418.1|  hypothetical protein PHAVU_008G278900g             130   1e-34   
ref|XP_010435111.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-34   
ref|XP_009403188.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-34   
gb|KHN11144.1|  Nuclear transcription factor Y subunit B-3              130   1e-34   
ref|XP_009773122.1|  PREDICTED: nuclear transcription factor Y su...    130   1e-34   
ref|XP_005847098.1|  transcription factor                               127   1e-34   
ref|XP_008783688.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-34   
gb|ADE76920.1|  unknown                                                 129   1e-34   
emb|CDP12919.1|  unnamed protein product                                130   1e-34   
ref|XP_008783687.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-34   
ref|XP_010906198.1|  PREDICTED: nuclear transcription factor Y su...    130   1e-34   
ref|XP_007159859.1|  hypothetical protein PHAVU_002G273800g             131   1e-34   
ref|XP_009598349.1|  PREDICTED: nuclear transcription factor Y su...    131   1e-34   
ref|XP_009333773.1|  PREDICTED: nuclear transcription factor Y su...    130   1e-34   
ref|XP_002522752.1|  ccaat-binding transcription factor subunit A...    129   1e-34   
gb|ABW09463.1|  CCAAT-box binding factor HAP3-like protein              130   1e-34   
ref|XP_008783683.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-34   
ref|XP_008783689.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-34   
gb|KDP29932.1|  hypothetical protein JCGZ_18501                         130   1e-34   
gb|ABW09467.1|  CCAAT-box binding factor HAP3-like protein              129   1e-34   
ref|XP_008792219.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-34   
ref|XP_010039439.1|  PREDICTED: nuclear transcription factor Y su...    130   1e-34   
ref|XP_004503919.1|  PREDICTED: nuclear transcription factor Y su...    130   1e-34   
ref|XP_008783699.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
ref|XP_006354714.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-34   
ref|XP_003630291.1|  Nuclear transcription factor Y subunit B-3         130   2e-34   
ref|XP_008783700.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
ref|XP_008804488.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-34   
ref|XP_008783697.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
ref|XP_002310018.2|  hypothetical protein POPTR_0007s06480g             130   2e-34   
ref|NP_001266909.1|  HAP3-like protein                                  129   2e-34   
ref|XP_002284842.1|  PREDICTED: nuclear transcription factor Y su...    128   2e-34   
ref|XP_008783693.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
emb|CAN70795.1|  hypothetical protein VITISV_029202                     130   2e-34   
ref|XP_006452586.1|  hypothetical protein CICLE_v10009623mg             129   2e-34   
gb|EMT00567.1|  Nuclear transcription factor Y subunit B-3              131   2e-34   
ref|XP_010922510.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
emb|CAN71881.1|  hypothetical protein VITISV_035430                     130   2e-34   
gb|KHN20229.1|  Nuclear transcription factor Y subunit B-4              127   2e-34   
ref|XP_010922509.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
gb|KDO51658.1|  hypothetical protein CISIN_1g047516mg                   130   2e-34   
ref|XP_006432153.1|  hypothetical protein CICLE_v10003558mg             130   2e-34   
ref|XP_008783695.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
ref|XP_002298867.1|  hypothetical protein POPTR_0001s37620g             129   2e-34   
ref|XP_010922512.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
ref|XP_010922511.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
gb|EYU33704.1|  hypothetical protein MIMGU_mgv1a018555mg                130   2e-34   
gb|EEC72111.1|  hypothetical protein OsI_05091                          129   2e-34   
ref|XP_008790319.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-34   
ref|XP_008783698.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-34   
ref|XP_005651963.1|  CCAAT-binding transcription factor subunit A       127   2e-34   
gb|KFM24096.1|  Nuclear transcription factor Y subunit B-3              127   2e-34   
ref|XP_002459054.1|  hypothetical protein SORBIDRAFT_03g045130          128   2e-34   
ref|XP_010557718.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-34   
ref|XP_002306345.2|  hypothetical protein POPTR_0005s08510g             130   2e-34   
ref|XP_010939571.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-34   
ref|XP_007137789.1|  hypothetical protein PHAVU_009G155500g             130   2e-34   
ref|XP_002885881.1|  hypothetical protein ARALYDRAFT_899587             130   3e-34   
ref|XP_002531012.1|  ccaat-binding transcription factor subunit A...    129   3e-34   
ref|XP_002973728.1|  CCAAT-box binding factor HAP3                      129   3e-34   
gb|ABM66107.1|  CCAAT-box binding factor HAP3-like protein              129   3e-34   
ref|XP_009115140.1|  PREDICTED: nuclear transcription factor Y su...    128   3e-34   
ref|XP_002975778.1|  CCAAT-box binding factor HAP3                      129   3e-34   
gb|AGF36555.1|  nuclear transcription factor Y subunit B-3-like p...    129   3e-34   
ref|XP_009787043.1|  PREDICTED: nuclear transcription factor Y su...    129   3e-34   
ref|XP_006469452.1|  PREDICTED: nuclear transcription factor Y su...    130   3e-34   
ref|XP_002949581.1|  hypothetical protein VOLCADRAFT_117284             128   3e-34   
ref|XP_006409683.1|  hypothetical protein EUTSA_v10022845mg             129   3e-34   
ref|XP_010261127.1|  PREDICTED: nuclear transcription factor Y su...    129   3e-34   
gb|AFS30565.1|  floral meristem protein                                 128   3e-34   
emb|CDP13721.1|  unnamed protein product                                129   3e-34   
gb|ABW09465.1|  CCAAT-box binding factor HAP3-like protein              128   3e-34   
ref|XP_009355897.1|  PREDICTED: nuclear transcription factor Y su...    130   3e-34   
gb|KDO59945.1|  hypothetical protein CISIN_1g027605mg                   130   3e-34   
ref|XP_009416841.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
ref|XP_010909552.1|  PREDICTED: nuclear transcription factor Y su...    128   4e-34   
gb|ADM89632.1|  nuclear transcription factor Y-alpha                    130   4e-34   
ref|XP_011102080.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
ref|XP_010557719.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
ref|XP_009787044.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
ref|XP_010518434.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
ref|XP_008464158.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
gb|AHI94919.1|  transcription factor subunit NF-YB3B                    127   4e-34   
gb|AFK49662.1|  nuclear transcription factor Y subunit B12              129   4e-34   
ref|XP_007009711.1|  Nuclear transcription factor Y subunit B-10 ...    128   4e-34   
gb|KDP39443.1|  hypothetical protein JCGZ_03725                         129   4e-34   
dbj|BAD87172.1|  putative HAP3-like transcriptional-activator           129   4e-34   
ref|XP_002528664.1|  ccaat-binding transcription factor subunit A...    129   4e-34   
ref|XP_009352424.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
ref|XP_010488850.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
ref|XP_009342812.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-34   
gb|EYU17642.1|  hypothetical protein MIMGU_mgv1a021836mg                129   4e-34   
gb|AGE10680.1|  nuclear transcription factor YB7                        129   5e-34   
ref|XP_004139999.1|  PREDICTED: nuclear transcription factor Y su...    129   5e-34   
emb|CBI16248.3|  unnamed protein product                                127   5e-34   
ref|XP_006493850.1|  PREDICTED: nuclear transcription factor Y su...    129   5e-34   
gb|EYU28263.1|  hypothetical protein MIMGU_mgv1a022879mg                129   5e-34   
gb|KHN43896.1|  Nuclear transcription factor Y subunit B-3              127   5e-34   
ref|NP_001236061.1|  uncharacterized protein LOC100500556               127   5e-34   
ref|XP_010909551.1|  PREDICTED: nuclear transcription factor Y su...    128   5e-34   
ref|XP_004135780.1|  PREDICTED: nuclear transcription factor Y su...    126   5e-34   
gb|ABK21387.1|  unknown                                                 129   5e-34   
ref|XP_009593332.1|  PREDICTED: nuclear transcription factor Y su...    129   5e-34   
ref|XP_010039438.1|  PREDICTED: nuclear transcription factor Y su...    130   5e-34   
ref|XP_004236819.1|  PREDICTED: nuclear transcription factor Y su...    127   5e-34   
gb|AHI94924.1|  transcription factor subunit NF-YB7A                    129   6e-34   
ref|XP_010488851.1|  PREDICTED: nuclear transcription factor Y su...    129   6e-34   
ref|XP_011077038.1|  PREDICTED: nuclear transcription factor Y su...    127   6e-34   
ref|XP_006428057.1|  hypothetical protein CICLE_v10027508mg             129   6e-34   
ref|XP_010090819.1|  Nuclear transcription factor Y subunit B-7         129   6e-34   
ref|XP_008783691.1|  PREDICTED: nuclear transcription factor Y su...    128   6e-34   
ref|XP_008783690.1|  PREDICTED: nuclear transcription factor Y su...    128   6e-34   
ref|XP_010557717.1|  PREDICTED: nuclear transcription factor Y su...    130   6e-34   
ref|XP_010557716.1|  PREDICTED: nuclear transcription factor Y su...    130   7e-34   
ref|XP_008805034.1|  PREDICTED: nuclear transcription factor Y su...    127   7e-34   
ref|XP_008783694.1|  PREDICTED: nuclear transcription factor Y su...    127   7e-34   
ref|XP_008805035.1|  PREDICTED: nuclear transcription factor Y su...    127   7e-34   
ref|XP_003617812.1|  Nuclear transcription factor Y subunit B-3         128   7e-34   
ref|XP_008451143.1|  PREDICTED: beta-galactosidase 15-like              136   8e-34   
gb|KHG07188.1|  Nuclear transcription factor Y subunit B-10 -like...    127   8e-34   
ref|XP_006352051.1|  PREDICTED: nuclear transcription factor Y su...    127   8e-34   
ref|XP_010657477.1|  PREDICTED: nuclear transcription factor Y su...    129   8e-34   
ref|XP_004516103.1|  PREDICTED: nuclear transcription factor Y su...    128   8e-34   
ref|XP_002969299.1|  LEC1-type HAP3 subunit coding protein              127   8e-34   
gb|ABW09469.1|  CCAAT-box binding factor HAP3-like protein              127   9e-34   
ref|XP_010674594.1|  PREDICTED: nuclear transcription factor Y su...    129   9e-34   
ref|XP_004491514.1|  PREDICTED: nuclear transcription factor Y su...    128   9e-34   
ref|XP_008227414.1|  PREDICTED: nuclear transcription factor Y su...    129   9e-34   
ref|XP_007214389.1|  hypothetical protein PRUPE_ppa027072mg             129   9e-34   
ref|XP_010658456.1|  PREDICTED: nuclear transcription factor Y su...    127   1e-33   
gb|AFK41105.1|  unknown                                                 127   1e-33   
gb|KCW68398.1|  hypothetical protein EUGRSUZ_F02051                     130   1e-33   
gb|EMS61304.1|  Nuclear transcription factor Y subunit B-3              131   1e-33   
ref|XP_004149164.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-33   
ref|NP_178981.1|  nuclear transcription factor Y subunit B-7            128   1e-33   
ref|XP_004305679.1|  PREDICTED: nuclear transcription factor Y su...    128   1e-33   
ref|XP_010104073.1|  Nuclear transcription factor Y subunit B-3         128   1e-33   
ref|XP_010467247.1|  PREDICTED: nuclear transcription factor Y su...    128   1e-33   
gb|ABK28488.1|  unknown                                                 128   1e-33   
ref|XP_010527095.1|  PREDICTED: nuclear transcription factor Y su...    128   1e-33   
ref|XP_002278716.1|  PREDICTED: nuclear transcription factor Y su...    127   1e-33   
ref|XP_008811649.1|  PREDICTED: uncharacterized protein LOC103722753    132   1e-33   
ref|XP_009397767.1|  PREDICTED: nuclear transcription factor Y su...    128   1e-33   
ref|XP_001701668.1|  CCAAT-binding transcription factor subunit A       125   1e-33   
ref|XP_002516312.1|  ccaat-binding transcription factor subunit A...    129   1e-33   
emb|CDP04307.1|  unnamed protein product                                126   1e-33   
ref|XP_010467248.1|  PREDICTED: nuclear transcription factor Y su...    128   1e-33   
ref|XP_011099714.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-33   
ref|XP_011037351.1|  PREDICTED: nuclear transcription factor Y su...    127   1e-33   
ref|XP_004169107.1|  PREDICTED: nuclear transcription factor Y su...    125   1e-33   
ref|XP_004137802.1|  PREDICTED: nuclear transcription factor Y su...    127   1e-33   
ref|XP_010520136.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-33   
ref|XP_011038892.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   
ref|XP_009602971.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   
ref|XP_003571418.1|  PREDICTED: nuclear transcription factor Y su...    129   2e-33   
ref|XP_011100345.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-33   
ref|XP_008445851.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   
ref|XP_008380004.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-33   
ref|XP_009767972.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   
ref|XP_006296803.1|  hypothetical protein CARUB_v10016473mg             128   2e-33   
ref|XP_010920929.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   
gb|ABM66108.1|  CCAAT-box binding factor HAP3-like protein              127   2e-33   
ref|XP_008445850.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   
gb|EPS71973.1|  hypothetical protein M569_02785                         126   2e-33   
ref|XP_011036599.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-33   
ref|XP_010520134.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-33   
ref|XP_009767971.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   
ref|XP_010920928.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   
ref|XP_008357961.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear tran...    127   2e-33   
ref|XP_003564550.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-33   



>ref|XP_009760265.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Nicotiana 
sylvestris]
Length=127

 Score =   174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            DEH KL+PIANVGRIMKQILP  AKISKEAKE IQE ASEFI FVT EASDKCHKENR+T
Sbjct  4    DEHVKLVPIANVGRIMKQILPPTAKISKEAKETIQECASEFIGFVTGEASDKCHKENRRT  63

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            VNGDDI WALSSLG D+YAEAM RYL+K RE+E  RA+QT+G     +DE+TD
Sbjct  64   VNGDDICWALSSLGFDNYAEAMLRYLYKLREFERQRANQTKGS----NDEDTD  112



>ref|XP_009605488.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Nicotiana 
tomentosiformis]
Length=126

 Score =   173 bits (438),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 4/113 (4%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            DEH KL+PIANVGRIMKQILP  AKISKEAKE IQE ASEFI FVT EASDKCHKENR+T
Sbjct  4    DEHVKLVPIANVGRIMKQILPPTAKISKEAKETIQECASEFISFVTGEASDKCHKENRRT  63

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            VNGDD+ WA SSLG D+YAEAM RYL+K RE+E  RA+QT+G     +DE+TD
Sbjct  64   VNGDDVCWAFSSLGFDNYAEAMLRYLYKLREFERQRANQTKGS----NDEDTD  112



>ref|XP_011092666.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Sesamum 
indicum]
Length=141

 Score =   168 bits (426),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DEH+KLLPIANVGRIMKQILP  AKISKEAKE +QE ASEFI FVT EASD+CHKENR
Sbjct  1    MTDEHDKLLPIANVGRIMKQILPPSAKISKEAKETMQECASEFICFVTGEASDRCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEE  367
            KTVNGDDI WALSSLG D Y+EAM RYL K RE+E  RA+Q+   P+   +E+
Sbjct  61   KTVNGDDICWALSSLGFDHYSEAMLRYLQKLREFERQRANQSNYKPSSSTEEK  113



>ref|XP_010549755.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Tarenaya 
hassleriana]
Length=134

 Score =   166 bits (421),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGRIMKQILP  AKISKEAK+ +QE A+EFI FVTCEASDKCHKENR
Sbjct  1    MTDE-DRLLPIANVGRIMKQILPPNAKISKEAKQTVQECATEFISFVTCEASDKCHKENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEE  367
            KTVNGDDI WALS+LGLD+YA+AM RYLH +RE E  RA Q R      DDEE
Sbjct  60   KTVNGDDICWALSTLGLDNYADAMGRYLHNYRESERERAEQNR-----TDDEE  107



>emb|CBI39480.3| unnamed protein product [Vitis vinifera]
Length=147

 Score =   167 bits (422),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE + LLPIANVGRIMKQILP +AKISKE KE +QE ASEFI FVT EASDKCHKENR
Sbjct  1    MVDEQDHLLPIANVGRIMKQILPPRAKISKEGKETMQECASEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            KTVNGDDI WALS+LG DDYAEA+ RYLHK+RE+E  RA+Q +   + + DE ++
Sbjct  61   KTVNGDDICWALSALGFDDYAEAILRYLHKYREFERERANQNKVGGSEDKDEASN  115



>ref|XP_007030959.1| Nuclear transcription factor Y subunit B-4 [Theobroma cacao]
 gb|EOY11461.1| Nuclear transcription factor Y subunit B-4 [Theobroma cacao]
Length=144

 Score =   166 bits (421),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGRIMKQILP  AK+SKEAK+ +QE A+EF+ FVT EASDKCHKENR
Sbjct  1    MVDEQDQLLPIANVGRIMKQILPPSAKLSKEAKQTMQECATEFVSFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEET  370
            KTVNGDDI WALS LG D+YAEA+ RYLHK+RE E  +ASQ +   + + DEE+
Sbjct  61   KTVNGDDICWALSVLGFDNYAEAIVRYLHKYREAEREKASQNKATSSQDKDEES  114



>emb|CDP15496.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+M+QILP  AKISKEAKE IQE A+EFI FVT EASDKC+KENR
Sbjct  1    MVDEQDRLLPIANVGRVMRQILPPSAKISKEAKETIQECATEFISFVTAEASDKCYKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            KTVNGDDI WALS+LG D YAEAM RYLHK+RE+E  R +Q++ 
Sbjct  61   KTVNGDDICWALSTLGFDTYAEAMLRYLHKYREFERQRVNQSKA  104



>ref|XP_004231278.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Solanum 
lycopersicum]
Length=146

 Score =   165 bits (418),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DEH KL+PIANVGRIMKQILP  AKISKEAKE +QE ASEFI FVT EASDKCHKENR
Sbjct  1    MVDEHVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            +TVNGDDI WALSSLG D+YAE M RYL+K R++E +RA+Q +
Sbjct  61   RTVNGDDICWALSSLGFDNYAEVMLRYLYKLRDFERVRANQNK  103



>ref|XP_010025198.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Eucalyptus 
grandis]
 gb|KCW61806.1| hypothetical protein EUGRSUZ_H04502 [Eucalyptus grandis]
Length=169

 Score =   166 bits (420),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE EKLLPIANVGRIMK ILP  AKISKEAK+ IQE ASEFI FVT EASDKCHKENR
Sbjct  1    MVDEQEKLLPIANVGRIMKLILPPSAKISKEAKQTIQECASEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            KTVNGDDI WALSSLG DDYAEA+ RYLHK+RE+E  RA+
Sbjct  61   KTVNGDDICWALSSLGFDDYAEAIVRYLHKYREHESERAN  100



>ref|XP_010529024.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Tarenaya 
hassleriana]
Length=136

 Score =   164 bits (414),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQ+LPA AKISKEAK  +QE A+EFI FVTCEASDKCHKENR
Sbjct  1    MTDE-DRLLPIANVGRLMKQLLPANAKISKEAKLTMQECATEFISFVTCEASDKCHKENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            KTVNGDDI WALS+LGLD+YA+AM RYLH +RE E  RA Q+R
Sbjct  60   KTVNGDDICWALSTLGLDNYADAMGRYLHNYREAERERAEQSR  102



>ref|XP_011023651.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Populus 
euphratica]
Length=149

 Score =   163 bits (412),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M +E +KLLPIANVGRIMKQILP  AKISKEAK+ +QE A+EFI FVT EASDKCHKENR
Sbjct  1    MEEEQDKLLPIANVGRIMKQILPPTAKISKEAKQTMQECATEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR-ASQTRGPPAGEDDEETD  373
            KTVNGDDI WALSSLG DDYAEA+ RYLH++RE E  R A+Q +     +D EE++
Sbjct  61   KTVNGDDICWALSSLGFDDYAEAIVRYLHRYREVERERSANQHKASGTEQDIEESN  116



>ref|XP_010659617.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Vitis 
vinifera]
Length=165

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +2

Query  35   DEHEK--LLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            D H K  LLPIANVGRIMKQILP +AKISKE KE +QE ASEFI FVT EASDKCHKENR
Sbjct  19   DSHNKDHLLPIANVGRIMKQILPPRAKISKEGKETMQECASEFISFVTGEASDKCHKENR  78

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            KTVNGDDI WALS+LG DDYAEA+ RYLHK+RE+E  RA+Q +   + + DE ++
Sbjct  79   KTVNGDDICWALSALGFDDYAEAILRYLHKYREFERERANQNKVGGSEDKDEASN  133



>ref|XP_010043071.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Eucalyptus 
grandis]
 gb|KCW85105.1| hypothetical protein EUGRSUZ_B01940 [Eucalyptus grandis]
Length=160

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE E+LLPIANVGRIMK+ILP  AKISKEAK+ IQE A+EFI FVT EASD+CHKENR
Sbjct  1    MVDEQERLLPIANVGRIMKEILPPSAKISKEAKQTIQECATEFIGFVTGEASDRCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            KTVNGDDI WALS+LG D+YAEAM RYLHK+REYE
Sbjct  61   KTVNGDDICWALSNLGFDNYAEAMARYLHKYREYE  95



>gb|EYU28976.1| hypothetical protein MIMGU_mgv1a023635mg, partial [Erythranthe 
guttata]
Length=119

 Score =   161 bits (407),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 3/118 (3%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DEHEK+LPIANVGR+MK+ILP  AKIS+EAKER+Q+ ASEFI FVT EASD+CHKENR
Sbjct  1    MSDEHEKMLPIANVGRMMKKILPPSAKISREAKERMQQCASEFICFVTGEASDRCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPA--GED-DEETD  373
            KTVNGDDI WAL SLG D+Y+EAM RYL  FR +E   A+Q+    A  GE+ DEE++
Sbjct  61   KTVNGDDICWALRSLGFDNYSEAMLRYLQNFRGFERENANQSNNCKAYKGEEKDEESN  118



>gb|EYU21005.1| hypothetical protein MIMGU_mgv1a026263mg, partial [Erythranthe 
guttata]
 gb|EYU28978.1| hypothetical protein MIMGU_mgv1a023430mg, partial [Erythranthe 
guttata]
Length=101

 Score =   160 bits (405),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DEHEK+LPIANVGR+MK+ILP  AK+S+EAKER+Q+ ASEFI FVT EASD+CHKENR
Sbjct  1    MSDEHEKMLPIANVGRMMKKILPPSAKVSREAKERMQQCASEFICFVTGEASDRCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            KTVNGDDI WALSSLG D+Y+EAM RYL  FR +E   A+Q
Sbjct  61   KTVNGDDICWALSSLGFDNYSEAMLRYLQNFRGFERENANQ  101



>emb|CDX95014.1| BnaC05g06570D [Brassica napus]
Length=132

 Score =   161 bits (407),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 5/122 (4%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQILP+ AKISKEAK+ +QE A+EFI FVTCEASDKCH+ENR
Sbjct  1    MADE-DRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY*NL  388
            KTVNGDDI WALS+LGLD+YA+A+ RYLHK+RE E  RA   +      +D   +R  N+
Sbjct  60   KTVNGDDIWWALSTLGLDNYADAVGRYLHKYREAERERAENNKSS----NDSGNERELNI  115

Query  389  SS  394
            +S
Sbjct  116  TS  117



>ref|XP_009148158.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Brassica 
rapa]
Length=132

 Score =   161 bits (407),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 5/122 (4%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQILP+ AKISKEAK+ +QE A+EFI FVTCEASDKCH+ENR
Sbjct  1    MADE-DRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY*NL  388
            KTVNGDDI WALS+LGLD+YA+A+ RYLHK+RE E  RA   +      +D   +R  N+
Sbjct  60   KTVNGDDIWWALSTLGLDNYADAVGRYLHKYREAERERAENNKSS----NDSGNEREPNI  115

Query  389  SS  394
            +S
Sbjct  116  TS  117



>ref|XP_010489638.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Camelina 
sativa]
 ref|XP_010497678.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Camelina 
sativa]
Length=139

 Score =   161 bits (407),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQILP+ AKISKEAK+ +QE A+EFI FVTCEASDKCH+ENR
Sbjct  1    MTDE-DRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            KTVNGDDI WALS+LGLD+YA+A+ R+LHK+RE E  RA   +G
Sbjct  60   KTVNGDDIWWALSTLGLDNYADAVGRHLHKYREAERERAEHNKG  103



>ref|XP_006433383.1| hypothetical protein CICLE_v10003157mg [Citrus clementina]
 ref|XP_006472120.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Citrus 
sinensis]
 gb|ESR46623.1| hypothetical protein CICLE_v10003157mg [Citrus clementina]
Length=157

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M +E +KLLPIANVG+IMKQILP +AKISKEAK+ +QE A+EFI FVT EASDKCHKENR
Sbjct  1    MVEEQDKLLPIANVGKIMKQILPPRAKISKEAKQTMQECATEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEE  367
            KTVNGDDI WALS+LG D+Y EA+ RYLHK+RE E  RA       A   +EE
Sbjct  61   KTVNGDDICWALSTLGFDNYTEAIVRYLHKYREAERERAKNQSKVTATSSNEE  113



>ref|XP_003518964.1| PREDICTED: nuclear transcription factor Y subunit B-5 [Glycine 
max]
Length=147

 Score =   161 bits (407),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  35   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  94

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDDI WAL++LG DDY+E + RYLHK+RE+E  RA+Q +G
Sbjct  95   NGDDICWALATLGFDDYSEPLKRYLHKYREFEGERANQNKG  135



>ref|XP_002319001.1| hypothetical protein POPTR_0013s02030g [Populus trichocarpa]
 gb|EEE94924.1| hypothetical protein POPTR_0013s02030g [Populus trichocarpa]
Length=149

 Score =   161 bits (407),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 1/116 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M +E +KLLPIANVGRIMKQILP  AKISKEAK+ +QE A+EFI FVT EASDKCHKENR
Sbjct  1    MEEEQDKLLPIANVGRIMKQILPPTAKISKEAKQTMQECATEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR-ASQTRGPPAGEDDEETD  373
            KTVNGDDI WAL SLG DDYAEA+ RYLH++RE E  R A+Q +     +D EE++
Sbjct  61   KTVNGDDICWALGSLGFDDYAEAIVRYLHRYREVERERSANQHKASGTEQDIEESN  116



>ref|XP_006304477.1| hypothetical protein CARUB_v10011185mg [Capsella rubella]
 gb|EOA37375.1| hypothetical protein CARUB_v10011185mg [Capsella rubella]
Length=142

 Score =   161 bits (407),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQILP+ AKISKEAK+ +QE A+EFI FVTCEASDKCH+ENR
Sbjct  1    MTDE-DRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEE  367
            KTVNGDDI WALS+LGLD+YA+A+ R+LHK+RE E  RA   +G      +E+
Sbjct  60   KTVNGDDIWWALSTLGLDNYADAVGRHLHKYREAERERAEHNKGSNTDSGNEK  112



>ref|NP_172377.1| nuclear transcription factor Y subunit B-4 [Arabidopsis thaliana]
 sp|O04027.1|NFYB4_ARATH RecName: Full=Nuclear transcription factor Y subunit B-4; Short=AtNF-YB-4; 
AltName: Full=Transcriptional activator HAP3D 
[Arabidopsis thaliana]
 gb|AAB70405.1| Strong similarity to Arabidopsis CCAAT-binding factor (gb|Z97336) 
[Arabidopsis thaliana]
 gb|ABK32177.1| At1g09030 [Arabidopsis thaliana]
 dbj|BAH30281.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28385.1| nuclear transcription factor Y subunit B-4 [Arabidopsis thaliana]
Length=139

 Score =   160 bits (405),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQILP+ AKISKEAK+ +QE A+EFI FVTCEAS+KCH+ENR
Sbjct  1    MTDE-DRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASEKCHRENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            KTVNGDDI WALS+LGLD+YA+A+ R+LHK+RE E  R    +G     +++ET+
Sbjct  60   KTVNGDDIWWALSTLGLDNYADAVGRHLHKYREAERERTEHNKGSNDSGNEKETN  114



>ref|XP_006344838.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Solanum 
tuberosum]
Length=138

 Score =   160 bits (404),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE  KL+PIANVGRIMKQILP  AKISKEAKE +QE ASEFI FVT EASDKC KENR
Sbjct  1    MVDEQVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCQKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            +TVNGDDI WALSSLG D+YAE M RYL+K R++E +RA+Q +
Sbjct  61   RTVNGDDICWALSSLGFDNYAEVMLRYLYKLRDFERVRANQNK  103



>ref|XP_002892478.1| hypothetical protein ARALYDRAFT_888138 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68737.1| hypothetical protein ARALYDRAFT_888138 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score =   159 bits (403),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQILP+ AKISKEAK+ +QE A+EFI FVTCEASDKCH+ENR
Sbjct  1    MTDE-DRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEE  367
            KTVNGDDI WALS+LGLD+YA+A+ R+LHK+RE E  R    +G     +++E
Sbjct  60   KTVNGDDIWWALSTLGLDNYADAVGRHLHKYREAERERTEHNKGSNDSGNEKE  112



>ref|XP_004309676.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Fragaria 
vesca subsp. vesca]
Length=185

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M  E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE R
Sbjct  35   MIKEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKR  94

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGED  358
            KTVNGDDI WALS+LG DDY+E + RYLH+FRE E  +A Q++    GED
Sbjct  95   KTVNGDDICWALSTLGFDDYSEPLKRYLHRFRELEGEKAQQSKANSGGED  144



>ref|XP_003536891.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Glycine 
max]
 gb|KHN03737.1| Nuclear transcription factor Y subunit B-5 [Glycine soja]
Length=145

 Score =   159 bits (401),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QES SEFI FVT EASDKCHKE RKTV
Sbjct  34   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQESVSEFISFVTGEASDKCHKEKRKTV  93

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            NGDDI WAL++LG DDY+E + RYL+K+RE E  RA+Q +G    E++
Sbjct  94   NGDDICWALATLGFDDYSEPLKRYLYKYREMEGERANQNKGSNGYENN  141



>ref|XP_010269452.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Nelumbo 
nucifera]
Length=179

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 87/115 (76%), Gaps = 5/115 (4%)
 Frame = +2

Query  11   GRVRTKMGD-----EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTC  175
            G   T  GD     E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT 
Sbjct  22   GAASTSSGDDRSLKEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTG  81

Query  176  EASDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            EASDKCHKE RKTVNGDDI WAL +LG DDYAE + RYLH+FRE E  +A+Q +G
Sbjct  82   EASDKCHKEKRKTVNGDDICWALGTLGFDDYAEPLKRYLHRFRELEGEKANQDKG  136



>ref|XP_010458171.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Camelina 
sativa]
 ref|XP_010475725.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Camelina 
sativa]
Length=139

 Score =   158 bits (400),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQILP+ AKISKEAK+ +QE A+EFI FVTCEASDKCH+ENR
Sbjct  1    MTDE-DRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            KTVNGDDI WALS+LGLD+YA+A+ R+L+K+RE E  RA   +G
Sbjct  60   KTVNGDDIWWALSTLGLDNYADAVGRHLYKYREAERERAEHNKG  103



>gb|KDO56274.1| hypothetical protein CISIN_1g045194mg [Citrus sinensis]
Length=157

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M +E +KLLPIANVG+IMKQILP +AKISKEAK+ +QE A+EFI FVT EASDKCHKENR
Sbjct  1    MVEEQDKLLPIANVGKIMKQILPPRAKISKEAKQTMQECATEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRA  325
            KTVNGDDI WALS+LG D+Y EA+ RYLHK+RE E  RA
Sbjct  61   KTVNGDDICWALSTLGFDNYTEAIVRYLHKYREDERERA  99



>ref|XP_007207636.1| hypothetical protein PRUPE_ppa021948mg, partial [Prunus persica]
 gb|EMJ08835.1| hypothetical protein PRUPE_ppa021948mg, partial [Prunus persica]
Length=131

 Score =   158 bits (399),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE + LLPIANVGRIMKQILP +AKISKEAK+R+QE A+EF+ FVT EASDKCHKENR
Sbjct  1    MVDEQDGLLPIANVGRIMKQILPQRAKISKEAKQRMQECATEFLSFVTAEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            KTVNGDDI WALS+LG D+YA+A  RYLHK+RE E
Sbjct  61   KTVNGDDICWALSALGFDNYAQATIRYLHKYREAE  95



>ref|XP_002512405.1| ccaat-binding transcription factor subunit A, putative [Ricinus 
communis]
 gb|EEF49857.1| ccaat-binding transcription factor subunit A, putative [Ricinus 
communis]
Length=158

 Score =   159 bits (401),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANV R+MKQILP  AKISKEAKE +QE A+EFI FVT EASDKCHKENR
Sbjct  1    MVDEQDRLLPIANVCRVMKQILPPTAKISKEAKETMQECATEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            KTVNGDDI WALSSLG D+YAEA+ RYLHKFRE E
Sbjct  61   KTVNGDDICWALSSLGFDNYAEAIVRYLHKFREAE  95



>ref|XP_006417619.1| hypothetical protein EUTSA_v10009804mg [Eutrema salsugineum]
 gb|ESQ35972.1| hypothetical protein EUTSA_v10009804mg [Eutrema salsugineum]
Length=140

 Score =   158 bits (399),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MKQILP+ AKISKEAK+ +QE A+EFI FVTCEASDKCH+ENR
Sbjct  1    MTDE-DRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENR  59

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY  379
            KTVNGDDI WALS+LGLD+YA+A+ R+LHK+RE E  RA   +       ++E + Y
Sbjct  60   KTVNGDDIWWALSTLGLDNYADAVGRHLHKYREAERERAEHNKSSNDSGIEKEPNNY  116



>ref|XP_003591124.1| Nuclear transcription factor Y subunit B-4 [Medicago truncatula]
 gb|AES61375.1| nuclear transcription factor Y protein [Medicago truncatula]
 gb|AFK49661.1| nuclear transcription factor Y subunit B11 [Medicago truncatula]
Length=127

 Score =   157 bits (397),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE +K LPIANVGRIMKQ LP  AKISKE+K+ +QE A+EFI FVT EASDKCHKENR
Sbjct  1    MNDEGDKTLPIANVGRIMKQNLPPNAKISKESKQLMQECATEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            KTVNGDDI WAL SLG D+YAEA+ RYL+KFR+ E++R +Q +     +D  E D
Sbjct  61   KTVNGDDICWALCSLGFDNYAEAIGRYLYKFRQAELIRINQNKLHETAKDKFEED  115



>gb|KDP23500.1| hypothetical protein JCGZ_23333 [Jatropha curcas]
Length=153

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 95/118 (81%), Gaps = 2/118 (2%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M +E ++LLPIANVGR+MKQILP  AKISKEAK+ +QE A+EFI FVT EASDKC KENR
Sbjct  1    MEEEQDRLLPIANVGRMMKQILPPSAKISKEAKQTMQECATEFISFVTGEASDKCQKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRA--SQTRGPPAGEDDEETDR  376
            KTVNGDDI WALSSLG D+YAEA+ RYLHK+RE E  +A  +Q +  P+ ++ ++ ++
Sbjct  61   KTVNGDDICWALSSLGFDNYAEAIVRYLHKYREAEREKAYNNQNKANPSNQEKDDDNQ  118



>ref|XP_008246442.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Prunus 
mume]
Length=178

 Score =   158 bits (400),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE + LLPIANVGRIMKQILP +AKISKEAK+R+QE A+EF+ FVT EASDKCHKENR
Sbjct  1    MVDEQDGLLPIANVGRIMKQILPQRAKISKEAKQRMQECATEFLSFVTAEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            KTVNGDDI WALS+LG D+YA+A  RYLHK+RE E
Sbjct  61   KTVNGDDICWALSALGFDNYAQATIRYLHKYREAE  95



>ref|XP_010674711.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Beta vulgaris 
subsp. vulgaris]
Length=166

 Score =   158 bits (399),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGRIMKQILP  AKISK AKE +QE  +EFI FVT EASDKCHKENR
Sbjct  1    MVDEGDRLLPIANVGRIMKQILPPTAKISKGAKETMQECVTEFISFVTGEASDKCHKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            KTVNGDDI WALS+LG D+Y EA+T+YLHK+RE+E  +A Q +
Sbjct  61   KTVNGDDICWALSTLGFDNYGEAITQYLHKYREFEREKACQGK  103



>ref|XP_007144547.1| hypothetical protein PHAVU_007G165100g [Phaseolus vulgaris]
 gb|ESW16541.1| hypothetical protein PHAVU_007G165100g [Phaseolus vulgaris]
Length=151

 Score =   157 bits (398),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQ LP  AKISKEA+E +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  39   EQDRLLPIANVGRIMKQTLPPNAKISKEARETMQECVSEFISFVTGEASDKCHKEKRKTV  98

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDDI WAL++LG DDYAE + RYLHK+RE E  RA+Q +G
Sbjct  99   NGDDICWALATLGFDDYAEPLKRYLHKYRELEGERANQNKG  139



>emb|CDP03522.1| unnamed protein product [Coffea canephora]
Length=181

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILPA AKISKEAKE +QE ASEFI FVT EASDKCHKE RKTV
Sbjct  37   EQDRLLPIANVGRIMKQILPANAKISKEAKETMQECASEFISFVTGEASDKCHKEKRKTV  96

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDDI WAL SLG D+YAE + RYL++FRE E  RA+Q +
Sbjct  97   NGDDICWALGSLGFDEYAEPLKRYLNRFRELEGERANQNK  136



>ref|XP_002269496.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Vitis 
vinifera]
 emb|CBI27496.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   156 bits (394),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE + LLPIANVGRIMKQI P  AKISKEAKE +QE  SEFI+FVT EAS+KC +ENR
Sbjct  1    MADEQDLLLPIANVGRIMKQIPPPSAKISKEAKETMQECVSEFIKFVTGEASEKCQRENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            KTVNGDDI WALS+LG DD+AEA+ RYLHK+RE+E  R +Q
Sbjct  61   KTVNGDDICWALSALGFDDHAEAIVRYLHKYREFERERPNQ  101



>gb|KDP28110.1| hypothetical protein JCGZ_13881 [Jatropha curcas]
Length=174

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  33   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  92

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            NGDDI WAL++LG DDYAE + RYLH++RE E  RAS       G ++EE D
Sbjct  93   NGDDICWALATLGFDDYAEPLKRYLHRYREQEGERASNK-----GSNNEEND  139



>ref|XP_010652046.1| PREDICTED: nuclear transcription factor Y subunit B-5 [Vitis 
vinifera]
Length=175

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 3/114 (3%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  34   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  93

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY  379
            NGDDI WAL +LG DDYAE + RYLH++RE E  +A+Q++   A E+++E   Y
Sbjct  94   NGDDICWALGTLGFDDYAEPLKRYLHRYRELEGEKANQSK---ASEENDEPSNY  144



>gb|AFK37153.1| unknown [Lotus japonicus]
Length=175

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP+ AKISKEAKE +QE  SEF+ FVT EASDKCHKE RKTV
Sbjct  28   EQDRLLPIANVGRIMKQILPSNAKISKEAKETMQECVSEFVSFVTGEASDKCHKEKRKTV  87

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY*NLSS-  394
            NGDD+ WAL +LG DDYA+ + RYL+K+RE +  RA+Q +G  +G D    + Y N    
Sbjct  88   NGDDVCWALGTLGFDDYADPLKRYLNKYRELDGGRANQNKGNNSG-DGNNIEGYHNCEGK  146

Query  395  -PPA  403
             PPA
Sbjct  147  PPPA  150



>emb|CAN82321.1| hypothetical protein VITISV_021316 [Vitis vinifera]
Length=175

 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 3/114 (3%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  34   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  93

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY  379
            NGDDI WAL +LG DDYAE + RYLH++RE E  +A+Q++   A E+++E   Y
Sbjct  94   NGDDICWALGTLGFDDYAEPLKRYLHRYRELEGEKANQSK---ASEENDEPSNY  144



>ref|XP_010069971.1| PREDICTED: nuclear transcription factor Y subunit B-1 [Eucalyptus 
grandis]
 gb|KCW58516.1| hypothetical protein EUGRSUZ_H01189 [Eucalyptus grandis]
Length=184

 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  37   EQDRLLPIANVGRIMKHILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  96

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY  379
            NGDDIVWAL SLG DDYAE + RYL+++RE E  RASQ +    GE   E + Y
Sbjct  97   NGDDIVWALGSLGFDDYAEPLKRYLNRYREVEGERASQNK-VTGGESRNEKNLY  149



>ref|XP_010088954.1| Nuclear transcription factor Y subunit B-4 [Morus notabilis]
 gb|EXB37169.1| Nuclear transcription factor Y subunit B-4 [Morus notabilis]
Length=175

 Score =   156 bits (394),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E +++LPIANVGRIMKQILP  AKISKEAK+ +QE A+EFI FVT EASDKCHKENRKTV
Sbjct  6    EQDRMLPIANVGRIMKQILPPTAKISKEAKQTMQECATEFISFVTGEASDKCHKENRKTV  65

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDDI WAL++LG D+YAE + RYLHK+RE E  +A+Q
Sbjct  66   NGDDICWALTALGFDNYAEVLVRYLHKYREAEREKANQ  103



>ref|XP_006382502.1| hypothetical protein POPTR_0005s02750g [Populus trichocarpa]
 gb|ERP60299.1| hypothetical protein POPTR_0005s02750g [Populus trichocarpa]
Length=149

 Score =   155 bits (391),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MK+ILP  AKISKEAK+ +QE A+EF+ FVT EASDKC KENR
Sbjct  1    MDDEQDRLLPIANVGRMMKKILPPTAKISKEAKQTMQECATEFVSFVTGEASDKCQKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            KTVNGDDI WAL SLG DD+AEAM RYLHK+RE E  R++        +  EE++
Sbjct  61   KTVNGDDICWALISLGFDDHAEAMVRYLHKYREAERERSTNQHKASGTDQGEESN  115



>ref|XP_009789273.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Nicotiana 
sylvestris]
Length=167

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 89/123 (72%), Gaps = 5/123 (4%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E E+LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCH E RKTV
Sbjct  37   EQERLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHNEKRKTV  96

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD--EETDRY*NLS  391
            NGDDI WAL SLG DDY E + RYLHK+RE E  R +Q +    G ++  EE DR   L 
Sbjct  97   NGDDICWALGSLGFDDYVEPLKRYLHKYRELEGERVNQNK---VGGNNIIEERDREVGLY  153

Query  392  SPP  400
            S P
Sbjct  154  SSP  156



>ref|XP_008779404.1| PREDICTED: nuclear transcription factor Y subunit B-1-like [Phoenix 
dactylifera]
Length=181

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  37   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  96

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDDI WALS+LG DDYAE M RYL K+RE E  RA+
Sbjct  97   NGDDICWALSTLGFDDYAEPMRRYLQKYREMEGDRAA  133



>ref|XP_008789950.1| PREDICTED: nuclear transcription factor Y subunit B-1 [Phoenix 
dactylifera]
Length=175

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  31   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  90

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDDI WALS+LG DDYAE M RYL K+RE E  RA+
Sbjct  91   NGDDICWALSTLGFDDYAEPMRRYLQKYREMEGDRAA  127



>ref|XP_009401183.1| PREDICTED: nuclear transcription factor Y subunit B-1-like [Musa 
acuminata subsp. malaccensis]
Length=161

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 86/115 (75%), Gaps = 4/115 (3%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQ+LP  AKISKEAKE +QE  SEFI FVT EASD+CHKE RKTV
Sbjct  31   EQDRLLPIANVGRIMKQMLPPNAKISKEAKETMQECVSEFISFVTAEASDRCHKEKRKTV  90

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS----QTRGPPAGEDDEET  370
            NGDDI WAL +LG DDYAE M RYLHK+RE E  R++     TR    G  D +T
Sbjct  91   NGDDICWALGTLGFDDYAEPMRRYLHKYREVEGDRSASNGQNTRSSNFGTGDGQT  145



>ref|XP_004240535.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Solanum 
lycopersicum]
Length=178

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCH E RKT+
Sbjct  32   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHNEKRKTL  91

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEE  367
            NGDDI WAL SLG DDY E + RYLHK+RE E  R +Q++G   G + E+
Sbjct  92   NGDDICWALGSLGFDDYVEPLKRYLHKYRELEGERINQSKGVGLGNNIED  141



>ref|XP_011036836.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Populus 
euphratica]
Length=149

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE ++LLPIANVGR+MK+ILP  AKISKEAK+ +QE A+EFI FVT EASDKC KENR
Sbjct  1    MDDEQDRLLPIANVGRMMKKILPPTAKISKEAKQTMQECATEFISFVTGEASDKCQKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            KTVNGDDI WAL SLG DD+AEAM RYLHK+RE E  R++
Sbjct  61   KTVNGDDICWALISLGFDDHAEAMVRYLHKYREAERERST  100



>ref|XP_010684402.1| PREDICTED: nuclear transcription factor Y subunit B-5 [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP+ AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  64   EQDRLLPIANVGRIMKQILPSNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  123

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDDI WALSSLG DDYA+ + RYLH++RE+E  R + 
Sbjct  124  NGDDICWALSSLGFDDYADPLKRYLHRYREFEGERVAN  161



>ref|XP_006355798.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Solanum 
tuberosum]
Length=178

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCH E RKT+
Sbjct  32   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHNEKRKTL  91

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDR  376
            NGDDI WAL SLG DDY E + RYLHK RE E  R +Q++G   G + E+  R
Sbjct  92   NGDDICWALGSLGFDDYVEPLKRYLHKHRELEGERINQSKGVGFGNNIEDNQR  144



>ref|XP_002321022.2| hypothetical protein POPTR_0014s12710g [Populus trichocarpa]
 gb|EEE99337.2| hypothetical protein POPTR_0014s12710g [Populus trichocarpa]
Length=176

 Score =   154 bits (390),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  32   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  91

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEET  370
            NGDDI WAL+SLG DDY+E + RYL+K+RE E  RAS  +     E D+ +
Sbjct  92   NGDDICWALASLGFDDYSEPLKRYLYKYREVEGERASHNKASNNEEKDDSS  142



>ref|XP_004302413.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Fragaria 
vesca subsp. vesca]
Length=155

 Score =   154 bits (388),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            +E ++LLPIANVGRIMKQ LP +AK+SKEAK+R+QE A+EF+ FVT EASDKCHKENRKT
Sbjct  6    EEQDRLLPIANVGRIMKQGLPQRAKVSKEAKQRMQECATEFLSFVTAEASDKCHKENRKT  65

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR  322
            VNGDDI WA+S+LG D+YAEA TRYL+K+RE E  R
Sbjct  66   VNGDDICWAMSALGFDNYAEATTRYLNKYREAERHR  101



>ref|XP_011033579.1| PREDICTED: nuclear transcription factor Y subunit B-5 [Populus 
euphratica]
Length=176

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  32   EQDRLLPIANVGRIMKQILPPSAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  91

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEET  370
            NGDDI WAL+SLG DDY+E + RYL+K+RE E  RAS  +     E D+ +
Sbjct  92   NGDDICWALASLGFDDYSEPLKRYLYKYREVEGERASHNKASNNEERDDSS  142



>ref|XP_007050837.1| Nuclear transcription factor Y subunit B-5 [Theobroma cacao]
 gb|EOX94994.1| Nuclear transcription factor Y subunit B-5 [Theobroma cacao]
Length=175

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = +2

Query  2    AG*GRVRTKMG--DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTC  175
            AG G V  + G   E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT 
Sbjct  19   AGAGGVSGEDGIVKEQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTG  78

Query  176  EASDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAG-  352
            EASDKCHKE RKTVNGDDI WAL++LG D+YAE + RYLH++R+ E  R +Q R   AG 
Sbjct  79   EASDKCHKEKRKTVNGDDICWALATLGFDNYAEQLKRYLHRYRDQEGERVNQNR---AGN  135

Query  353  -EDDEETDRY  379
             E+ +ET  Y
Sbjct  136  HEEKQETSNY  145



>ref|XP_004495979.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Cicer 
arietinum]
Length=142

 Score =   152 bits (385),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEF+ FVT EASDKCHKE RKTV
Sbjct  38   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFVSFVTGEASDKCHKEKRKTV  97

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD+  A S+LG DDYAE + RYL+KFRE ++ R++Q +G
Sbjct  98   NGDDVCSAFSTLGFDDYAEPLKRYLNKFRELDVQRSNQNKG  138



>ref|XP_009382552.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Musa 
acuminata subsp. malaccensis]
Length=166

 Score =   153 bits (387),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  29   EQDRLLPIANVGRIMKQILPQNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  88

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDDI WAL++LG DDY E M RYL K+RE E  RA+   G
Sbjct  89   NGDDICWALNTLGFDDYVEPMKRYLQKYREMEGDRAAGGGG  129



>ref|XP_009376649.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Pyrus 
x bretschneideri]
Length=150

 Score =   152 bits (385),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E + +LPIANVGRIMKQILP +AKISKEAK+ +QE A+EF+ FVT EASDKCHKENRKTV
Sbjct  11   EQDGMLPIANVGRIMKQILPPRAKISKEAKQTMQECATEFLSFVTGEASDKCHKENRKTV  70

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDDI WALS+LG D+YA+A  RYLHK+RE E  +A+
Sbjct  71   NGDDICWALSALGFDNYAQAAMRYLHKYREAERDKAA  107



>ref|XP_009411690.1| PREDICTED: nuclear transcription factor Y subunit B-1-like [Musa 
acuminata subsp. malaccensis]
Length=175

 Score =   153 bits (386),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 91/128 (71%), Gaps = 6/128 (5%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  29   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  88

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS------QTRGPPAGEDDEETDRY  379
            NGDDI WAL++LG DDY E M RYL K+RE E  RA+      +  G  AG+ D   ++ 
Sbjct  89   NGDDICWALNTLGFDDYVEPMRRYLLKYREMEGDRAATGGHSNKATGSDAGDQDAVGEQR  148

Query  380  *NLSSPPA  403
             N  SP A
Sbjct  149  RNQPSPGA  156



>ref|XP_006855503.1| hypothetical protein AMTR_s00057p00202310 [Amborella trichopoda]
 gb|ERN16970.1| hypothetical protein AMTR_s00057p00202310 [Amborella trichopoda]
Length=191

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKT+
Sbjct  45   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTI  104

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGP  343
            NGDD+ WAL +LG DDY E + +YLHK+RE E  +AS ++ P
Sbjct  105  NGDDLCWALQTLGFDDYVEPLRKYLHKYRETEGEKASSSQNP  146



>ref|XP_009596719.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Nicotiana 
tomentosiformis]
Length=175

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E E+LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCH E RKTV
Sbjct  37   EQERLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHNEKRKTV  96

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDDI WAL SLG DDY E + RYLHK RE E  R +Q +
Sbjct  97   NGDDICWALGSLGFDDYVEPLKRYLHKHRELEGERVNQNK  136



>ref|XP_008359868.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Malus 
domestica]
Length=150

 Score =   152 bits (383),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E + +LPIANVGRIMKQILP +AKISKEAK+ +QE A+EF+ FVT EASDKCHKENRKTV
Sbjct  11   EQDGMLPIANVGRIMKQILPPRAKISKEAKQTMQECATEFLSFVTGEASDKCHKENRKTV  70

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDDI WALS+LG D+YA+A  RYLHK+RE E
Sbjct  71   NGDDICWALSALGFDNYAQATIRYLHKYREAE  102



>ref|XP_009775948.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Nicotiana 
sylvestris]
Length=161

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  25   EQDRLLPIANVGRIMKQILPQNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  84

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDR  376
            NGDD  WAL SLG D+YAE + RYLH++RE E  +A+Q +      +  E ++
Sbjct  85   NGDDTCWALGSLGFDNYAEPLKRYLHRYRESEGEKANQNKAATGNNNTGEREK  137



>ref|XP_010259679.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Nelumbo 
nucifera]
Length=206

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  57   EQDRLLPIANVGRIMKQILPLNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  116

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDDI WAL +LG DDYAE + RYLH++RE E  RA+  +
Sbjct  117  NGDDICWALGTLGFDDYAEPLKRYLHRYRELEGERAANNQ  156



>ref|XP_006419612.1| hypothetical protein CICLE_v10006769mg [Citrus clementina]
 ref|XP_006489109.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Citrus 
sinensis]
 gb|ESR32852.1| hypothetical protein CICLE_v10006769mg [Citrus clementina]
Length=177

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E E+LLPIANVGRIMKQILPA AKISKEAKE +QE  SEFI F+T EAS+KC KE RKTV
Sbjct  21   EQERLLPIANVGRIMKQILPANAKISKEAKETMQECVSEFISFITSEASEKCRKERRKTV  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDDI WAL +LG DDYA  + RYLHK+RE E  RA+Q
Sbjct  81   NGDDICWALGTLGFDDYAGPIRRYLHKYRELEGERANQ  118



>ref|XP_011079712.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Sesamum 
indicum]
Length=169

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 92/124 (74%), Gaps = 5/124 (4%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AK+SKEAKE +QE  SEFI FVT EAS+KCHKE RKTV
Sbjct  36   EQDRLLPIANVGRIMKQILPPNAKVSKEAKETMQECVSEFISFVTGEASEKCHKEKRKTV  95

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR---GPPAGEDDEETDRY*NL  388
            NGDDI WAL +LG DDYAE++ RYL ++RE E  RA+Q +   GP   + +E   R  N 
Sbjct  96   NGDDICWALGNLGFDDYAESLKRYLIRYREAEGERANQNKTGAGPEENQTEERQQRGPN-  154

Query  389  SSPP  400
             SPP
Sbjct  155  -SPP  157



>ref|XP_011082631.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Sesamum 
indicum]
Length=193

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  49   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  108

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY*NLSSP  397
            NGDDI WAL SLG D+YA+++ RYL K+RE E  R +Q R   +G ++   D   N  + 
Sbjct  109  NGDDICWALGSLGFDEYAQSLKRYLSKYREAEGERVNQNRAHYSGHEEIRIDDSSNGRAA  168

Query  398  P  400
            P
Sbjct  169  P  169



>gb|KDO75175.1| hypothetical protein CISIN_1g044287mg [Citrus sinensis]
Length=188

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E E+LLPIANVGRIMKQILPA AKISKEAKE +QE  SEFI F+T EAS+KC KE RKTV
Sbjct  32   EQERLLPIANVGRIMKQILPANAKISKEAKETMQECVSEFISFITSEASEKCRKERRKTV  91

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDDI WAL +LG DDYA  + RYLHK+RE E  RA+Q
Sbjct  92   NGDDICWALGTLGFDDYAGPIRRYLHKYRELEGERANQ  129



>ref|XP_008235018.1| PREDICTED: nuclear transcription factor Y subunit B-5 [Prunus 
mume]
Length=176

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  39   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  98

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY*NLSSP  397
            NGDDI WAL++LG DDYAE + RYLH++RE E  +A+      + E+  E        SP
Sbjct  99   NGDDICWALATLGFDDYAEPLKRYLHRYRELEGEKAAHQGKANSSEERNEV-------SP  151

Query  398  P  400
            P
Sbjct  152  P  152



>gb|KCW61120.1| hypothetical protein EUGRSUZ_H03892 [Eucalyptus grandis]
Length=183

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQ LP  AKISKEAKE +QE  SEFI FVT EASDKC KE RKTV
Sbjct  23   EQDRLLPIANVGRIMKQNLPPNAKISKEAKETMQECMSEFISFVTSEASDKCRKERRKTV  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY  379
            NGDDI WA+ +LG DDYA A+ RYLH++RE E  R +Q +    G +   TD Y
Sbjct  83   NGDDICWAMQALGFDDYASALRRYLHRYREIEGERVNQEKAASGGSEGLATDHY  136



>ref|XP_007201677.1| hypothetical protein PRUPE_ppa022586mg [Prunus persica]
 gb|EMJ02876.1| hypothetical protein PRUPE_ppa022586mg [Prunus persica]
Length=176

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  39   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  98

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY*NLSSP  397
            NGDDI WAL++LG DDYAE + RYLH++RE E  +A+      + E+  E        SP
Sbjct  99   NGDDICWALATLGFDDYAEPLKRYLHRYRELEGEKAAHQGKANSSEEKNEL-------SP  151

Query  398  P  400
            P
Sbjct  152  P  152



>ref|XP_010938445.1| PREDICTED: nuclear transcription factor Y subunit B-1 [Elaeis 
guineensis]
Length=174

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  30   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  89

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDDI WALS+LG DDY E M RYL K+RE E  R++
Sbjct  90   NGDDICWALSTLGFDDYVEPMRRYLQKYREMEGDRSA  126



>ref|XP_006359445.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Solanum 
tuberosum]
Length=143

 Score =   150 bits (379),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            EHEKLLPIANVGRIMK ILP  AKISKE KE +QE  SEFI FVT EAS+KCHKE RKT+
Sbjct  21   EHEKLLPIANVGRIMKHILPQNAKISKEGKETMQECVSEFISFVTGEASEKCHKEKRKTL  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDD+ WAL +LG DDY E + RYLH++RE E  +A+Q +
Sbjct  81   NGDDVCWALGNLGFDDYVEPLKRYLHRYRELEGEKANQNK  120



>ref|XP_008368975.1| PREDICTED: nuclear transcription factor Y subunit B-5 [Malus 
domestica]
Length=186

 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  45   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  104

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDDI WAL++LG DDYAE + RYLH++RE E  +A+ 
Sbjct  105  NGDDICWALATLGFDDYAEPLKRYLHRYRELEGEKAAH  142



>gb|AFK36846.1| unknown [Medicago truncatula]
 gb|AES91843.2| nuclear transcription factor Y protein [Medicago truncatula]
Length=129

 Score =   149 bits (377),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  22   EQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            NGDDI WAL +LG DDYAE M RYLH++RE E+ R   T
Sbjct  82   NGDDICWALGTLGFDDYAEPMRRYLHRYRELEVDRTPTT  120



>ref|XP_007144936.1| hypothetical protein PHAVU_007G195900g [Phaseolus vulgaris]
 gb|ESW16930.1| hypothetical protein PHAVU_007G195900g [Phaseolus vulgaris]
Length=145

 Score =   150 bits (378),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            +E +K LPIANVGRIMKQILP  AKISKE K+ +QE  +EFI FVT EASDKCHKENRKT
Sbjct  4    EEQDKALPIANVGRIMKQILPPSAKISKEGKQLMQECVTEFISFVTGEASDKCHKENRKT  63

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            VNGDDI WALSSLG D+YAE + RYLHK+R+ E
Sbjct  64   VNGDDICWALSSLGFDNYAETIARYLHKYRQAE  96



>ref|XP_010921780.1| PREDICTED: nuclear transcription factor Y subunit B-1-like [Elaeis 
guineensis]
Length=181

 Score =   151 bits (381),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  37   EQDRLLPIANVGRIMKHILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  96

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDDI WALS+LG DDY E M RYL K+RE E  RA+
Sbjct  97   NGDDICWALSTLGFDDYVEPMRRYLQKYREMEGDRAA  133



>ref|XP_008370459.1| PREDICTED: nuclear transcription factor Y subunit B-4 [Malus 
domestica]
Length=136

 Score =   149 bits (377),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  50   LLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVNGDD  229
            +LPIANVGRIMKQILP +AKISKEAK+ +QE A+EF+ FVT EASDKCHKENRKTVNGDD
Sbjct  1    MLPIANVGRIMKQILPPRAKISKEAKQTMQECATEFLSFVTGEASDKCHKENRKTVNGDD  60

Query  230  IVWALSSLGLDDYAEAMTRYLHKFREYE  313
            I WALS+LG D+YA+A  RYLHK+RE E
Sbjct  61   ICWALSALGFDNYAQAAMRYLHKYRETE  88



>gb|KDP27778.1| hypothetical protein JCGZ_18858 [Jatropha curcas]
Length=152

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  19   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTV  78

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDDI WA+ +LG DDYAE + RYL ++RE E  RA+Q +G
Sbjct  79   NGDDICWAMGALGFDDYAEPLRRYLQRYREIEGDRANQEKG  119



>ref|XP_010090782.1| Nuclear transcription factor Y subunit B-5 [Morus notabilis]
 gb|EXB40815.1| Nuclear transcription factor Y subunit B-5 [Morus notabilis]
Length=204

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  45   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  104

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDDI W L++LG DDYAE + RYLH++RE E  ++S
Sbjct  105  NGDDICWGLATLGFDDYAEPLKRYLHRYREIEGEKSS  141



>ref|XP_008359408.1| PREDICTED: LOW QUALITY PROTEIN: nuclear transcription factor 
Y subunit B-5-like [Malus domestica]
Length=191

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 91/128 (71%), Gaps = 6/128 (5%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQ LP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  43   EPDRLLPIANVGRIMKQNLPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  102

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY------  379
            NGDDI WAL++LG DDYAE + RYLH++RE E  +A+      + E+   T R       
Sbjct  103  NGDDICWALATLGFDDYAEPLKRYLHRYRELEGEKAANQGKANSNEEQTATXRTRFPTAA  162

Query  380  *NLSSPPA  403
             N S+PP+
Sbjct  163  ANTSNPPS  170



>ref|XP_006480108.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Citrus 
sinensis]
 gb|KDO87328.1| hypothetical protein CISIN_1g038014mg [Citrus sinensis]
Length=140

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  34   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  93

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR  322
            NGDDI WAL++LG D+YA+ + RYLH++RE E  R
Sbjct  94   NGDDICWALATLGFDNYADQLKRYLHRYRELEGER  128



>ref|XP_004247445.1| PREDICTED: nuclear transcription factor Y subunit B-5 [Solanum 
lycopersicum]
Length=138

 Score =   148 bits (373),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            EH+K LPIANVGRIMK ILP  AKISKE KE +QE  SEFI FVT EAS+KCHKE RKT+
Sbjct  21   EHDKFLPIANVGRIMKHILPQNAKISKEGKETMQECVSEFISFVTSEASEKCHKEKRKTL  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDDI WA+ +LG DDY E + RYLH++RE E  +A+Q +
Sbjct  81   NGDDICWAMGNLGFDDYVEPLNRYLHRYRELEGEKANQNK  120



>ref|XP_003535337.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Glycine 
max]
 gb|KHN16115.1| Nuclear transcription factor Y subunit B-4 [Glycine soja]
Length=141

 Score =   148 bits (373),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            DE ++ LPIANV RIMKQILP  AKISKE K+ +QE  +EFI FVT EASDKCHKENRKT
Sbjct  4    DEQDRALPIANVSRIMKQILPPSAKISKEGKQVMQECVTEFISFVTGEASDKCHKENRKT  63

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            VNGDDI WALSSLG D+YAEA+ RYLHK+R+ E
Sbjct  64   VNGDDICWALSSLGFDNYAEAIGRYLHKYRQAE  96



>ref|XP_003555607.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Glycine 
max]
Length=138

 Score =   148 bits (373),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            D  ++ LPIANVGRIMKQILP  AKISKE K+ +QE  +EFI FVT EASDKCHKENRKT
Sbjct  4    DVQDRALPIANVGRIMKQILPPSAKISKEGKQLMQECVTEFISFVTGEASDKCHKENRKT  63

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            VNGDDI WALSSLG D+YAEA+ RYLH +R+ E  + + T+
Sbjct  64   VNGDDICWALSSLGFDNYAEAIGRYLHIYRQGEREKINHTK  104



>ref|XP_011023652.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Populus 
euphratica]
Length=143

 Score =   148 bits (373),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            D+ ++LLPIANVGR+MKQ LP  A++SKEAK+R+QE A+EFI FVT EAS+KC KENRK 
Sbjct  4    DKQDQLLPIANVGRVMKQRLPPTARVSKEAKQRMQECATEFISFVTSEASNKCRKENRKA  63

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            +NGDD+ WALSSLG DDYA+   RYLHK+RE E  +A Q + 
Sbjct  64   LNGDDVCWALSSLGFDDYADTTVRYLHKYREAERAKADQKKA  105



>ref|XP_006380166.1| hypothetical protein POPTR_0008s22520g [Populus trichocarpa]
 gb|ERP57963.1| hypothetical protein POPTR_0008s22520g [Populus trichocarpa]
Length=150

 Score =   148 bits (373),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILPA AKISKEAKE +QE ASEFI FVT EAS+KC KE RKTV
Sbjct  19   EQDRLLPIANVGRIMKQILPANAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTV  78

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDD+ WA+ +LG DDYA  + RYL ++RE E  RA+Q +
Sbjct  79   NGDDVCWAMGALGFDDYAGPLRRYLQRYREIEGDRANQEK  118



>ref|XP_009620709.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Nicotiana 
tomentosiformis]
Length=160

 Score =   148 bits (374),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  25   EQDRLLPIANVGRIMKQILPQNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  84

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDR  376
            NGDDI WAL +LG D+YAE + RYL  +RE E  +A+Q +    G + EE ++
Sbjct  85   NGDDICWALENLGFDNYAEPLKRYLQSYRESEGEKANQNKA-VTGNNTEEREK  136



>ref|XP_007154257.1| hypothetical protein PHAVU_003G103500g [Phaseolus vulgaris]
 gb|ESW26251.1| hypothetical protein PHAVU_003G103500g [Phaseolus vulgaris]
Length=152

 Score =   148 bits (373),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 87/112 (78%), Gaps = 2/112 (2%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E + LLPIANVGRIMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  40   EQDCLLPIANVGRIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  99

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS-QTRG-PPAGEDDEE  367
            NGDDI WAL SLG DDYAE + RYLH++RE E+ R++ Q RG  P+ + D E
Sbjct  100  NGDDICWALGSLGFDDYAEPLRRYLHRYREVEVDRSAIQERGNSPSKDKDNE  151



>gb|KEH15995.1| nuclear transcription factor Y protein [Medicago truncatula]
Length=138

 Score =   147 bits (371),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AK+SKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  18   EQDRLLPIANVGRIMKQILPQNAKVSKEAKETMQECVSEFISFVTSEASEKCRKERRKTV  77

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEM  316
            NGDDI WAL++LG DDYAE M RYLH++RE E+
Sbjct  78   NGDDICWALATLGFDDYAEPMRRYLHRYRELEV  110



>ref|XP_008451614.1| PREDICTED: nuclear transcription factor Y subunit B-1 [Cucumis 
melo]
Length=161

 Score =   148 bits (373),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  47   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  106

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDDI  AL++LG DDYAE + RYL ++R+ E  RA Q +G
Sbjct  107  NGDDICCALATLGFDDYAEPLRRYLVRYRDMEGERAQQNKG  147



>gb|KGN44907.1| hypothetical protein Csa_7G395250 [Cucumis sativus]
Length=160

 Score =   148 bits (373),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  47   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  106

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDDI  AL++LG DDYAE + RYL ++R+ E  RA Q +G
Sbjct  107  NGDDICCALATLGFDDYAEPLRRYLVRYRDMEGERAQQNKG  147



>ref|XP_011008710.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Populus 
euphratica]
Length=150

 Score =   147 bits (372),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E +KLLPIANVGRIMKQILP  AKISKEAKE +QE ASEFI FVT EAS+KC KE RKTV
Sbjct  19   EQDKLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTV  78

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDD+ WA+ +LG DDYA  + RYL ++RE E  RA+Q +
Sbjct  79   NGDDVCWAMGALGFDDYAGPLRRYLQRYREIEGDRANQEK  118



>ref|XP_010656509.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Vitis 
vinifera]
 emb|CBI27499.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   147 bits (372),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M D+ + LLPIANVGRIMKQILP  AK+SKEAKE +QE  SEF++FVT EAS KC KE+R
Sbjct  1    MADKQDLLLPIANVGRIMKQILPPGAKVSKEAKETVQECVSEFVKFVTGEASAKCRKEDR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            +TV  DDI WALS+LGLDDYA A  RYLHK+RE+E  R +Q
Sbjct  61   QTVTVDDICWALSALGLDDYAGATVRYLHKYREFERERVNQ  101



>ref|XP_003550533.2| PREDICTED: nuclear transcription factor Y subunit B-5-like [Glycine 
max]
Length=123

 Score =   147 bits (370),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVG+IMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  21   EQDRLLPIANVGKIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPP  346
            NGDDI WAL SLG DDYAE + RYL ++RE E+ RA+    PP
Sbjct  81   NGDDICWALGSLGFDDYAEPLRRYLQRYREQELDRANN---PP  120



>gb|EYU26195.1| hypothetical protein MIMGU_mgv1a022187mg [Erythranthe guttata]
Length=125

 Score =   146 bits (369),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE E  LPIANVGR+MK+ILP  AKIS+EAKER+Q+ ASEFI FVT EA+ +C KENR
Sbjct  1    MSDEIELSLPIANVGRMMKKILPPSAKISREAKERMQQCASEFICFVTGEAAHRCQKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRA  325
            KTVNGDDI WALSSLG D+Y+EAM RYL  FRE+E  RA
Sbjct  61   KTVNGDDICWALSSLGFDNYSEAMLRYLENFREFERERA  99



>gb|KHN26570.1| Nuclear transcription factor Y subunit B-5 [Glycine soja]
Length=143

 Score =   147 bits (370),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGR+MKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  18   EQDRLLPIANVGRLMKQILPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTV  77

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEM  316
            NGDDI WAL++LG DDYAE M RYLH++RE E+
Sbjct  78   NGDDICWALATLGFDDYAEPMRRYLHRYREVEV  110



>ref|XP_004229223.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Solanum 
lycopersicum]
Length=138

 Score =   146 bits (369),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKC KE RKTV
Sbjct  23   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFIGFVTGEASDKCRKERRKTV  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDDI WAL +LG DDY+ A+ RYLH++RE E  + +Q
Sbjct  83   NGDDICWALGTLGFDDYSGALKRYLHRYRESEGEKVNQ  120



>gb|AFK49656.1| nuclear transcription factor Y subunit B6 [Medicago truncatula]
 gb|KEH43233.1| nuclear transcription factor Y protein [Medicago truncatula]
Length=194

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISK+AKE +QE  SEF+ FVT EASDKCHKE RKTV
Sbjct  36   EQDRLLPIANVGRIMKQILPPNAKISKDAKETMQECVSEFVSFVTGEASDKCHKEKRKTV  95

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRA  325
            NGDD+ WAL +LG DDYAE + RYL+K+RE +  R 
Sbjct  96   NGDDVCWALGTLGFDDYAEPLKRYLYKYRELDAERG  131



>ref|XP_002319000.1| hypothetical protein POPTR_0013s02020g [Populus trichocarpa]
 gb|EEE94923.1| hypothetical protein POPTR_0013s02020g [Populus trichocarpa]
Length=143

 Score =   146 bits (369),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            D+ ++LLPIANVGR+MKQ LP  A++SKEAK+R+QE A+EFI FVT EAS+KC KENRK 
Sbjct  4    DKQDQLLPIANVGRVMKQHLPPTARVSKEAKQRMQECATEFISFVTSEASNKCRKENRKA  63

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            +NGDD+ WALSSLG DDYA+   RYLHK+RE E  +A Q + 
Sbjct  64   LNGDDVCWALSSLGFDDYADTTVRYLHKYREAEREKADQKKA  105



>ref|XP_007035553.1| Nuclear transcription factor Y subunit B-5 [Theobroma cacao]
 gb|EOY06479.1| Nuclear transcription factor Y subunit B-5 [Theobroma cacao]
Length=166

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E E+LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  18   EQERLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTV  77

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDDI WAL++LG DDYA  + RYLHK+RE E  +A+ 
Sbjct  78   NGDDICWALATLGFDDYAVPLRRYLHKYRELEGDKAAN  115



>gb|AFK49668.1| nuclear transcription factor Y subunit B18 [Medicago truncatula]
Length=208

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AK+SKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  18   EQDRLLPIANVGRIMKQILPQNAKVSKEAKETMQECVSEFISFVTSEASEKCRKERRKTV  77

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEM  316
            NGDDI WAL++LG DDYAE M RYLH++RE E+
Sbjct  78   NGDDICWALATLGFDDYAEPMRRYLHRYRELEV  110



>ref|XP_006342784.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Solanum 
tuberosum]
Length=136

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKC KE RKTV
Sbjct  22   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFIGFVTSEASDKCRKERRKTV  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDD+ WAL +LG DDY  A+ RYLH++RE E  + +Q
Sbjct  82   NGDDVCWALGTLGFDDYGGALKRYLHRYRESEGEKVNQ  119



>ref|XP_003529577.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Glycine 
max]
Length=121

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  19   EQDRLLPIANVGRIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  78

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGE  355
            NGDDI WAL SLG DDYAE + RYL ++RE E+ R +    PP  E
Sbjct  79   NGDDICWALGSLGFDDYAEPLRRYLQRYRELEVDRGNS---PPKRE  121



>gb|EYU46700.1| hypothetical protein MIMGU_mgv1a023582mg, partial [Erythranthe 
guttata]
Length=135

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE ASEFI FVT EAS KCHKE RKTV
Sbjct  1    EQDRLLPIANVGRIMKQILPPSAKISKEAKETMQECASEFIGFVTGEASHKCHKEKRKTV  60

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD+ WALS+LG DDY++++ RYL ++R+ E  RA+Q + 
Sbjct  61   NGDDVCWALSNLGFDDYSDSLKRYLIRYRDAEGERANQNKA  101



>gb|KHN02981.1| Nuclear transcription factor Y subunit B-5 [Glycine soja]
Length=123

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  21   EQDRLLPIANVGRIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGE  355
            NGDDI WAL SLG DDYAE + RYL ++RE E+ R +    PP  E
Sbjct  81   NGDDICWALGSLGFDDYAEPLRRYLQRYRELEVDRGNS---PPKRE  123



>ref|XP_009628180.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Nicotiana 
tomentosiformis]
Length=106

 Score =   144 bits (364),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  12   EQDRLLPIANVGRIMKQILPPNAKISKEAKETVQECVSEFIGFVTGEASEKCRKERRKTV  71

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEML  319
            NGDD+ WAL +LG DDY  AM R+LH++RE E L
Sbjct  72   NGDDVCWALGTLGFDDYGGAMKRFLHRYRENEGL  105



>ref|XP_004508609.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Cicer 
arietinum]
Length=146

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  22   EQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS-----QTRGPPAGEDDEE  367
            NGDDI WAL +LG DDYAE M RYL ++RE E  R +     Q RG    E+D E
Sbjct  82   NGDDICWALGTLGFDDYAEPMRRYLIRYRELEADRNTNNINVQDRGNSPQENDHE  136



>ref|XP_009133828.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Brassica 
rapa]
 emb|CDX83320.1| BnaA03g21860D [Brassica napus]
Length=156

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M  E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE R
Sbjct  45   MIKEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKR  104

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            KTVNGDDI WA+++LG DDYAE + +YL+++R  E  RA+  RG
Sbjct  105  KTVNGDDICWAMANLGFDDYAEQLRKYLNRYRVIEGERANHGRG  148



>ref|XP_004971188.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Setaria 
italica]
Length=171

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  21   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD+ WA  +LG DDY + M RYLHK+RE E
Sbjct  81   NGDDVCWAFGALGFDDYVDPMRRYLHKYRELE  112



>ref|XP_002459056.1| hypothetical protein SORBIDRAFT_03g045150 [Sorghum bicolor]
 gb|EES04176.1| hypothetical protein SORBIDRAFT_03g045150 [Sorghum bicolor]
Length=182

 Score =   147 bits (370),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  34   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  93

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD+ WA  +LG DDY + M RYLHK+RE E
Sbjct  94   NGDDVCWAFGALGFDDYVDPMRRYLHKYRELE  125



>gb|EAY77127.1| hypothetical protein OsI_05092 [Oryza sativa Indica Group]
Length=177

 Score =   146 bits (368),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  34   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  93

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR  322
            NGDD+ WA  +LG DDY + M RYL+K+RE E  R
Sbjct  94   NGDDVCWAFGALGFDDYVDPMRRYLNKYRELEGDR  128



>ref|NP_001172729.1| Os01g0935200 [Oryza sativa Japonica Group]
 dbj|BAB64190.1| putative HAP3-like transcriptional-activator [Oryza sativa Japonica 
Group]
 dbj|BAB93258.1| putative HAP3-like transcriptional-activator [Oryza sativa Japonica 
Group]
 gb|EAZ14750.1| hypothetical protein OsJ_04677 [Oryza sativa Japonica Group]
 dbj|BAF64446.1| HAP3 subunit of HAP complex [Oryza sativa Japonica Group]
 dbj|BAH91459.1| Os01g0935200 [Oryza sativa Japonica Group]
Length=177

 Score =   146 bits (368),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  34   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  93

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR  322
            NGDD+ WA  +LG DDY + M RYL+K+RE E  R
Sbjct  94   NGDDVCWAFGALGFDDYVDPMRRYLNKYRELEGDR  128



>ref|XP_003567445.1| PREDICTED: nuclear transcription factor Y subunit B-1-like [Brachypodium 
distachyon]
Length=182

 Score =   146 bits (369),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  35   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  94

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD+ WA S+LG DDY + M RYL KFRE E
Sbjct  95   NGDDVCWAFSALGFDDYVDPMRRYLLKFRELE  126



>ref|XP_006397975.1| hypothetical protein EUTSA_v10001724mg [Eutrema salsugineum]
 gb|ESQ39428.1| hypothetical protein EUTSA_v10001724mg [Eutrema salsugineum]
Length=156

 Score =   145 bits (367),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  47   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  106

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDDI WA+++LG DDYAE + +YL+ +R +E+ RAS
Sbjct  107  NGDDICWAMANLGFDDYAEQLRKYLNLYRVFELERAS  143



>ref|XP_010098301.1| Nuclear transcription factor Y subunit B-5 [Morus notabilis]
 gb|EXB74805.1| Nuclear transcription factor Y subunit B-5 [Morus notabilis]
Length=169

 Score =   145 bits (367),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            EHE+LLPIANVGRIMK ILP   KISK++KE +QE  SEFI F+T EA+DKC KE RKTV
Sbjct  27   EHERLLPIANVGRIMKHILPPNVKISKQSKETMQECVSEFISFITGEATDKCRKERRKTV  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQ  331
            NGDD+ WAL +LG DDYA  + RYLHK+RE E  RA+Q
Sbjct  87   NGDDVCWALQALGFDDYAGPLRRYLHKYREMEGDRANQ  124



>ref|XP_004488253.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Cicer 
arietinum]
Length=130

 Score =   144 bits (362),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  20   EQDRLLPIANVGRIMKHILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  79

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEM  316
            NGDDI WAL++LG DDYAE M RYLH++RE E+
Sbjct  80   NGDDICWALATLGFDDYAEPMRRYLHRYRELEV  112



>ref|XP_011091059.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Sesamum 
indicum]
Length=154

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            +E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKT
Sbjct  29   NEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFIGFVTSEASEKCRKERRKT  88

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            VNGDDI WA+ +LG DDYA  + RYL+++RE E  + +Q R   + E +E
Sbjct  89   VNGDDICWAMGTLGFDDYAAPLMRYLNRYREVEGDKVNQNRASNSEEMEE  138



>ref|XP_010507851.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Camelina 
sativa]
Length=153

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  43   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  102

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS-QTRGPPA  349
            NGDDI WA+++LG DDYA  + +YLH+FR  E  +A+   +G P+
Sbjct  103  NGDDICWAMANLGFDDYAGQLKKYLHRFRVIEGEKANHHGKGGPS  147



>emb|CDM82922.1| unnamed protein product [Triticum aestivum]
Length=183

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQ+LP  AK+SKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  41   EQDRLLPIANVGRIMKQVLPPNAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  100

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD+ WA S+LG DDY + M RYL KFRE E
Sbjct  101  NGDDVCWAFSALGFDDYVDPMRRYLLKFRELE  132



>ref|XP_010037376.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Eucalyptus 
grandis]
 gb|KCW84467.1| hypothetical protein EUGRSUZ_B01303 [Eucalyptus grandis]
Length=114

 Score =   143 bits (360),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  14   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFIGFVTGEASEKCRKERRKTV  73

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDDI WA+ +LG D+YA  + RYLH++R+ E  +A+Q R
Sbjct  74   NGDDICWAMETLGFDNYAGPLRRYLHRYRDLEGDKANQDR  113



>gb|EYU42160.1| hypothetical protein MIMGU_mgv1a018421mg, partial [Erythranthe 
guttata]
Length=104

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M DE E  LPIANVG++MK+ILP  AKIS+E KER+Q+ ASEFI FVT EA+ +C KENR
Sbjct  1    MNDEIELSLPIANVGQMMKKILPPSAKISREGKERMQQCASEFICFVTGEAAHRCRKENR  60

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            KTV GDDI WALSSLG D+Y+E M RYL  FRE+E  RA+Q 
Sbjct  61   KTVTGDDICWALSSLGFDNYSETMLRYLENFREFERERANQN  102



>ref|XP_006646656.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Oryza 
brachyantha]
Length=162

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  23   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD+ WA  +LG DDY + M RYL+K+RE E
Sbjct  83   NGDDVCWAFGALGFDDYVDPMRRYLNKYRELE  114



>ref|XP_003609646.1| Nuclear transcription factor Y subunit B-5 [Medicago truncatula]
Length=216

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  21   EQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDDI WAL +LG DDYAE M RYLH++RE E
Sbjct  81   NGDDICWALGTLGFDDYAEPMRRYLHRYRELE  112



>gb|AFK49666.1| nuclear transcription factor Y subunit B16 [Medicago truncatula]
Length=217

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  22   EQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDDI WAL +LG DDYAE M RYLH++RE E
Sbjct  82   NGDDICWALGTLGFDDYAEPMRRYLHRYRELE  113



>ref|XP_006598369.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Glycine 
max]
 gb|KHN20809.1| Nuclear transcription factor Y subunit B-5 [Glycine soja]
Length=144

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 4/113 (4%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGR+MK+ILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  21   EQDRLLPIANVGRLMKRILPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTV  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEM----LRASQTRGPPAGEDDE  364
            NGDDI WAL++LG D+YAE M RYLH++RE E+    +   +    P  +DDE
Sbjct  81   NGDDICWALATLGFDNYAEPMRRYLHRYREVEVDHNKVNLQEKGNSPEEKDDE  133



>ref|NP_182302.1| nuclear transcription factor Y subunit B-5 [Arabidopsis thaliana]
 sp|O82248.1|NFYB5_ARATH RecName: Full=Nuclear transcription factor Y subunit B-5; Short=AtNF-YB-5 
[Arabidopsis thaliana]
 gb|AAC63635.1| putative CCAAT-box binding trancription factor [Arabidopsis thaliana]
 gb|AAO42012.1| putative CCAAT-box binding trancription factor [Arabidopsis thaliana]
 gb|AAO50614.1| putative CCAAT-box binding trancription factor [Arabidopsis thaliana]
 gb|AEC10890.1| nuclear transcription factor Y subunit B-5 [Arabidopsis thaliana]
Length=160

 Score =   143 bits (361),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M  E ++LLPIANVGRIMK ILPA AK+SKEAKE +QE  SEFI FVT EASDKCHKE R
Sbjct  48   MVKEQDRLLPIANVGRIMKNILPANAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKR  107

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFR--EYEMLRASQTRGPPAGEDD  361
            KTVNGDDI WA+++LG DDYA  + +YLH++R  E E        GP +  D+
Sbjct  108  KTVNGDDICWAMANLGFDDYAAQLKKYLHRYRVLEGEKPNHHGKGGPKSSPDN  160



>ref|XP_006296212.1| hypothetical protein CARUB_v10025377mg [Capsella rubella]
 gb|EOA29110.1| hypothetical protein CARUB_v10025377mg [Capsella rubella]
Length=154

 Score =   143 bits (360),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKT+
Sbjct  43   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTL  102

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDDI WA+++LG DDYA  +T YLH++R  E  RA+
Sbjct  103  NGDDICWAMANLGFDDYAGHLTNYLHRYRVTEGERAN  139



>ref|XP_007154047.1| hypothetical protein PHAVU_003G086800g [Phaseolus vulgaris]
 gb|ESW26041.1| hypothetical protein PHAVU_003G086800g [Phaseolus vulgaris]
Length=132

 Score =   142 bits (358),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    AG*GRVRTKMGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEA  181
            +G G+  + +  E ++LLPIANVGRIMK++LP  AKISKE+KE +QE  SEFI F+T EA
Sbjct  8    SGGGKNESSICREQDRLLPIANVGRIMKKVLPGNAKISKESKETMQECVSEFISFITGEA  67

Query  182  SDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            SDKC KE RKT+NGDD++WA++SLG +DYAE +  YLHK+RE E
Sbjct  68   SDKCQKEKRKTINGDDLLWAMASLGFEDYAEPLKAYLHKYREME  111



>ref|XP_010518498.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Camelina 
sativa]
Length=154

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  44   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  103

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS-QTRGPP  346
            NGDDI WA+++LG DDYA  + +YLH++R  E  +A+   +G P
Sbjct  104  NGDDICWAMANLGFDDYAGQLKKYLHRYRVVEGEKANHHGKGGP  147



>ref|XP_009349502.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Pyrus 
x bretschneideri]
Length=157

 Score =   142 bits (359),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE ASEFI FVT EAS+KC KE RKTV
Sbjct  24   EQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTV  83

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD+ WAL +LG DDY   + RYLH++RE E  R S
Sbjct  84   NGDDVCWALGALGFDDYTGPLRRYLHRYREQERDRIS  120



>ref|XP_009352332.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Pyrus 
x bretschneideri]
Length=157

 Score =   142 bits (359),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE ASEFI FVT EAS+KC KE RKTV
Sbjct  24   EQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTV  83

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD+ WAL +LG DDY   + RYLH++RE E  R S
Sbjct  84   NGDDVCWALGALGFDDYTGPLRRYLHRYREQERDRIS  120



>ref|XP_010506819.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Camelina 
sativa]
Length=157

 Score =   142 bits (359),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  47   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  106

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS-QTRGPP  346
            NGDDI WA+++LG DDYA  + +YLH++R  E  +A+  ++G P
Sbjct  107  NGDDICWAMANLGFDDYAGQLKKYLHRYRVIEGEKANHHSKGGP  150



>ref|XP_010523933.1| PREDICTED: nuclear transcription factor Y subunit B-5 [Tarenaya 
hassleriana]
Length=162

 Score =   142 bits (359),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E + LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  54   EQDMLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  113

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDDI WAL +LG D+YA+ + +YL++FR  E  RA   +G
Sbjct  114  NGDDICWALGNLGFDNYADQLKKYLNRFRMIEGERAHSAKG  154



>ref|XP_008674580.1| PREDICTED: nuclear transcription factor Y subunit B-1-like [Zea 
mays]
 tpg|DAA55943.1| TPA: hypothetical protein ZEAMMB73_781041 [Zea mays]
 gb|AIB04768.1| CCAAT-DR1 transcription factor, partial [Zea mays]
Length=179

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  29   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  88

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD+  A  +LG DDY + M RYLHK+RE E
Sbjct  89   NGDDVCCAFGALGFDDYVDPMRRYLHKYRELE  120



>ref|XP_002882133.1| hypothetical protein ARALYDRAFT_483964 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58392.1| hypothetical protein ARALYDRAFT_483964 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 80/110 (73%), Gaps = 2/110 (2%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AK+SKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  43   EQDRLLPIANVGRIMKNILPPNAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  102

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFR--EYEMLRASQTRGPPAGEDD  361
            NGDDI WA+++LG DDYA  + +YLH++R  E E       +G P    D
Sbjct  103  NGDDICWAMANLGFDDYATQLKKYLHRYRVLEGEKPNHHHGKGGPKSSPD  152



>ref|XP_008223170.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Prunus 
mume]
Length=167

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M  E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE R
Sbjct  22   MMKEQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTSEASEKCRKERR  81

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            KTVNGDD+ WAL +LG DDY   + R+LH++RE E  R S +
Sbjct  82   KTVNGDDVSWALGALGFDDYTAPLRRFLHRYREKEGERISSS  123



>ref|XP_002516901.1| ccaat-binding transcription factor subunit A, putative [Ricinus 
communis]
 gb|EEF45515.1| ccaat-binding transcription factor subunit A, putative [Ricinus 
communis]
Length=158

 Score =   141 bits (355),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  41   HEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVN  220
             ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTVN
Sbjct  42   QDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVN  101

Query  221  GDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            GDD+ WA+ +LG DDYA  + RYL ++RE E  RA+Q +
Sbjct  102  GDDVCWAMGALGFDDYAGPLRRYLQRYRELEGDRANQDK  140



>ref|XP_004496024.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Cicer 
arietinum]
Length=104

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +2

Query  26   KMGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKEN  205
            K GD  EK LPIANVGRIMKQ LP  AKISKE+KE +QES +EFI FVT EAS+KC KEN
Sbjct  2    KSGD-GEKTLPIANVGRIMKQNLPPNAKISKESKELMQESVTEFISFVTGEASEKCQKEN  60

Query  206  RKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEM  316
            RK+VNGDDI WAL SLG D+YAEA+ +YL+K+R+ ++
Sbjct  61   RKSVNGDDICWALCSLGFDNYAEAIGKYLYKYRQAQI  97



>ref|XP_008367162.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Malus 
domestica]
Length=157

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE ASEFI FVT EAS+KC KE RKTV
Sbjct  24   EQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTV  83

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD+ WAL +LG DDY   + RYLH++RE E
Sbjct  84   NGDDVCWALRALGFDDYTGPLRRYLHRYREQE  115



>gb|AHI94921.1| transcription factor subunit NF-YB5 [Brassica napus]
Length=155

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  46   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  105

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFR  304
            NGDDI WA+++LG DDYAE + +YL+++R
Sbjct  106  NGDDICWAMANLGFDDYAEQLKKYLNRYR  134



>emb|CDP19543.1| unnamed protein product [Coffea canephora]
Length=150

 Score =   140 bits (352),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  18   EQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFIGFVTSEASEKCRKERRKTV  77

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRA-SQTRGPPAGEDDEETDRY  379
            NGDDI W+L +LG DDYA  + RYL ++RE E  R+ +Q +   + E+ EE   Y
Sbjct  78   NGDDICWSLGTLGFDDYAGPLKRYLDRYRELEGDRSGNQDKVSNSAEEMEEPSSY  132



>emb|CDY53021.1| BnaC04g00090D [Brassica napus]
Length=155

 Score =   140 bits (352),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIAN+GRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  46   EQDRLLPIANIGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  105

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFR  304
            NGDDI WA+++LG DDYAE + +YL+++R
Sbjct  106  NGDDICWAMANLGFDDYAEQLKKYLNRYR  134



>ref|XP_006651500.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Oryza 
brachyantha]
Length=137

 Score =   139 bits (350),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD++WA+++LG +DY E +  YLHKFRE E  RA+ + G
Sbjct  83   NGDDLLWAMTTLGFEDYVEPLKHYLHKFREIEGERAAASTG  123



>ref|XP_007224115.1| hypothetical protein PRUPE_ppa015692mg [Prunus persica]
 gb|EMJ25314.1| hypothetical protein PRUPE_ppa015692mg [Prunus persica]
Length=163

 Score =   140 bits (352),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +2

Query  29   MGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENR  208
            M  E E+LLPIANVGRIM+QILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE R
Sbjct  23   MMKEQEQLLPIANVGRIMRQILPPNAKISKEAKETMQECVSEFISFVTSEASEKCRKERR  82

Query  209  KTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            KTVNGDD+ WAL +LG +DY   + R+LH++RE E  R S +
Sbjct  83   KTVNGDDVSWALGALGFEDYTGPLRRFLHRYREQEGERISSS  124



>emb|CDX80136.1| BnaA05g00200D [Brassica napus]
Length=172

 Score =   140 bits (352),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK ILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  63   EQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  122

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFR  304
            NGDDI WA+++LG DDYAE + +YL+++R
Sbjct  123  NGDDICWAMANLGFDDYAEQLKKYLNRYR  151



>gb|KHN46582.1| Nuclear transcription factor Y subunit B-5 [Glycine soja]
Length=99

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  80   MKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVNGDDIVWALSSLGL  259
            MKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTVNGDDI WAL++LG 
Sbjct  1    MKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGF  60

Query  260  DDYAEAMTRYLHKFREYEMLRASQTRG  340
            DDY+E + RYLHK+RE+E  RA+Q +G
Sbjct  61   DDYSEPLKRYLHKYREFEGERANQNKG  87



>ref|XP_001785354.1| predicted protein [Physcomitrella patens]
 gb|EDQ49839.1| predicted protein [Physcomitrella patens]
Length=111

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LP+ AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  3    EQDRFLPIANVSRIMKKALPSNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  62

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD++WA+S+LG +DY E +  YLHK+RE E  + S T+G
Sbjct  63   NGDDLLWAMSTLGFEDYVEPLKVYLHKYRELEGEKTSVTKG  103



>ref|XP_003557724.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Brachypodium 
distachyon]
Length=202

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPP  346
            NGDD++WA+++LG +DY + +  YLHKFRE E  RA+ + G P
Sbjct  83   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAAASTGTP  125



>gb|KCW84457.1| hypothetical protein EUGRSUZ_B01293 [Eucalyptus grandis]
Length=120

 Score =   137 bits (344),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQI+P  AKISKEAKE +Q+  SEFI FVT EAS+KC +E RKTV
Sbjct  14   EQDRLLPIANVGRIMKQIVPPNAKISKEAKETMQDCVSEFIGFVTSEASEKCRRERRKTV  73

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDDI  A+ +LG DDYA  + RYLH++RE E  +A+Q +
Sbjct  74   NGDDICCAMETLGFDDYAGMLRRYLHRYRELEGEKANQDK  113



>ref|XP_004135781.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Cucumis 
sativus]
 ref|XP_004157295.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Cucumis 
sativus]
 gb|KGN66077.1| hypothetical protein Csa_1G569530 [Cucumis sativus]
Length=118

 Score =   137 bits (344),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 6/118 (5%)
 Frame = +2

Query  29   MGDEHEKL-LPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKEN  205
            MG+  E L LPIANV RIMK+I+P K KISKEAK+R+QE A+EFI FVT EA+ +C  EN
Sbjct  1    MGENWESLQLPIANVERIMKKIVPEKGKISKEAKKRMQECANEFINFVTSEAAQRCQNEN  60

Query  206  RKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT-----RGPPAGEDDE  364
            R+T+NGDDI WA  SLGLD+YAEA ++YL KFRE E ++AS       +   AGE+D+
Sbjct  61   RRTLNGDDIYWAFDSLGLDNYAEASSKYLLKFREAERIKASDKAIITFQDQHAGEEDQ  118



>emb|CDY40552.1| BnaC02g33400D [Brassica napus]
Length=185

 Score =   139 bits (349),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK++LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  22   EQDRFLPIANVSRIMKKVLPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  RA   R    GE  E
Sbjct  82   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERAGVGRPQTGGEGGE  130



>emb|CBI26063.3| unnamed protein product [Vitis vinifera]
Length=138

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANV RIMKQ LP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  18   EQDRLLPIANVSRIMKQTLPTNAKISKEAKETMQECVSEFISFVTGEASEKCKKERRKTV  77

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRA-SQTRGPPAGEDDE  364
            NGDDI WAL++LG DDYA  + RYL ++RE E  R  +Q +     E+DE
Sbjct  78   NGDDICWALAALGFDDYAGPLKRYLQRYRELEGDRVLNQEKAGNTEENDE  127



>ref|XP_004148262.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Cucumis 
sativus]
 ref|XP_004164637.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Cucumis 
sativus]
 gb|KGN56019.1| hypothetical protein Csa_3G047800 [Cucumis sativus]
Length=184

 Score =   138 bits (348),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    AG*GRVRTKMGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEA  181
            +G G  ++    EH++LLPIANVGRIMK+ LP  AKISK+AKE +QE  SEFI FVT EA
Sbjct  8    SGGGYQKSPSPREHDRLLPIANVGRIMKKALPGNAKISKDAKETVQECVSEFISFVTGEA  67

Query  182  SDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            SDKCH E RKT+NGDD++WA+++LG +DY + +  YL +FRE E  R +
Sbjct  68   SDKCHNEKRKTINGDDLLWAMATLGFEDYVDPLKLYLQRFREIEGERTT  116



>ref|XP_010037234.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Eucalyptus 
grandis]
Length=146

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQI+P  AKISKEAKE +Q+  SEFI FVT EAS+KC +E RKTV
Sbjct  40   EQDRLLPIANVGRIMKQIVPPNAKISKEAKETMQDCVSEFIGFVTSEASEKCRRERRKTV  99

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDDI  A+ +LG DDYA  + RYLH++RE E  +A+Q +
Sbjct  100  NGDDICCAMETLGFDDYAGMLRRYLHRYRELEGEKANQDK  139



>gb|AEW09144.1| hypothetical protein CL4270Contig1_06, partial [Pinus radiata]
 gb|AFG47831.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47832.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47833.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47834.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47835.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47836.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47837.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47838.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47839.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47840.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47841.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47842.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47843.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47844.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47845.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47846.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47847.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
 gb|AFG47848.1| hypothetical protein CL4270Contig1_06, partial [Pinus taeda]
Length=103

 Score =   135 bits (341),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMK+ LP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKT+
Sbjct  8    EQDRLLPIANVGRIMKKTLPTNAKISKEAKEIMQECVSEFISFVTGEASDKCHKEKRKTI  67

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDDI+WA+++LG + YAE +  YL K+RE E
Sbjct  68   NGDDILWAMTTLGFEVYAEPLKVYLDKYRELE  99



>ref|XP_001781393.1| predicted protein [Physcomitrella patens]
 gb|EDQ53767.1| predicted protein [Physcomitrella patens]
Length=175

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LP+ AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  35   EQDRFLPIANVSRIMKKALPSNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  94

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD++WA+S+LG +DY E +  YLHK+RE E  +AS  +G
Sbjct  95   NGDDLLWAMSTLGFEDYVEPLKVYLHKYRELEGEKASTAKG  135



>gb|AEH25944.1| transcription factor CBF/NF-YB/HAP3 [Triticum aestivum]
Length=199

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            NGDD++WA+++LG +DY + +  YLHKFRE E  RA+ T
Sbjct  81   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAAAT  119



>gb|ADY38381.1| nuclear transcription factor Y subunit B3 [Triticum monococcum]
Length=199

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            NGDD++WA+++LG +DY + +  YLHKFRE E  RA+ T
Sbjct  81   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAAAT  119



>gb|ADL14487.1| NF-YB3 [Triticum aestivum]
Length=212

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  25   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  84

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            NGDD++WA+++LG +DY + +  YLHKFRE E  RA+ T
Sbjct  85   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAAAT  123



>ref|XP_008449032.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Cucumis 
melo]
Length=252

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    AG*GRVRTKMGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEA  181
            +G G  ++    EH++LLPIANVGRIMK+ LP  AKISK+AKE +QE  SEFI FVT EA
Sbjct  71   SGGGYQKSPSPREHDRLLPIANVGRIMKKALPGNAKISKDAKETVQECVSEFISFVTGEA  130

Query  182  SDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            SDKCH E RKT+NGDD++WA+++LG +DY + +  YL +FRE E  R +
Sbjct  131  SDKCHNEKRKTINGDDLLWAMATLGFEDYVDPLKLYLQRFREIEGERTT  179



>ref|NP_001147727.1| nuclear transcription factor Y subunit B-3 [Zea mays]
 gb|ACG28501.1| nuclear transcription factor Y subunit B-3 [Zea mays]
Length=212

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            NGDD++WA+++LG +DY E +  YLHKFRE E  +A+ T
Sbjct  81   NGDDLLWAMTTLGFEDYVEPLKLYLHKFRELEGEKAATT  119



>tpg|DAA63543.1| TPA: nuclear transcription factor Y subunit B-3 [Zea mays]
 gb|AIB05724.1| CCAAT-HAP3 transcription factor, partial [Zea mays]
Length=212

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            NGDD++WA+++LG +DY E +  YLHKFRE E  +A+ T
Sbjct  81   NGDDLLWAMTTLGFEDYVEPLKLYLHKFRELEGEKAATT  119



>gb|AHI94916.1| transcription factor subunit NF-YB2A [Brassica napus]
Length=185

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  22   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  RA   R    GE  E
Sbjct  82   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERAGVGRPQTGGEGGE  130



>gb|AIZ68337.1| CCAAT-binding transcription factor A [Triticum aestivum]
Length=207

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQT  334
            NGDD++WA+++LG +DY + +  YLHKFRE E  RA+ T
Sbjct  81   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAAAT  119



>ref|XP_009128989.1| PREDICTED: nuclear transcription factor Y subunit B-2-like [Brassica 
rapa]
Length=186

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  22   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  RA   R    GE  E
Sbjct  82   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERAGLGRPQTGGEGGE  130



>gb|ADY38383.1| nuclear transcription factor Y subunit B5 [Triticum monococcum]
Length=145

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  19   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  78

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD++WA+++LG +DY E +  YLHKFRE E  +A    G
Sbjct  79   NGDDLLWAMTTLGFEDYMEPLKLYLHKFRELEGEKAVGAGG  119



>gb|ABD64993.1| transcription factor Hap3b, putative [Brassica oleracea]
Length=185

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  22   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  RA   R    GE  E
Sbjct  82   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERAGVGRPQTGGEGGE  130



>emb|CDY28916.1| BnaA02g25600D [Brassica napus]
Length=186

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  22   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  RA   R    GE  E
Sbjct  82   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERAGLGRPQTGGEGGE  130



>ref|XP_007026370.1| Nuclear transcription factor Y subunit B-3 [Theobroma cacao]
 gb|EOY28992.1| Nuclear transcription factor Y subunit B-3 [Theobroma cacao]
Length=216

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  24   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  83

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            NGDD++WA+++LG +DY E +  YLHKFRE E  R +  R P    D    D
Sbjct  84   NGDDLLWAMTTLGFEDYVEPLKVYLHKFREMEGERTALGRQPTDQRDGSSAD  135



>ref|XP_009414194.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Musa 
acuminata subsp. malaccensis]
Length=166

 Score =   135 bits (341),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = +2

Query  32   GDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRK  211
            G +H  LLPIANVGRIMK+ LP  AKISK+AKE +QE ASEFI F+T EA+D C K NRK
Sbjct  35   GQDH--LLPIANVGRIMKKALPPNAKISKQAKETMQECASEFIGFITGEAADSCQKNNRK  92

Query  212  TVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            T+NGDDI  A+ +LGLDDYA+AM RYLH+++E+E
Sbjct  93   TINGDDICAAMKTLGLDDYADAMRRYLHRYKEHE  126



>gb|EYU43932.1| hypothetical protein MIMGU_mgv1a018640mg, partial [Erythranthe 
guttata]
Length=113

 Score =   134 bits (336),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  47   KLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVNGD  226
            +LLPIANVGRIMKQ LP  AKISKEAKE +QE ASEFI FVT EAS+KC KE RKTVNGD
Sbjct  2    RLLPIANVGRIMKQTLPNNAKISKEAKETMQECASEFIGFVTGEASEKCRKERRKTVNGD  61

Query  227  DIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            DI WA+  LG DDY   + RYL +FR++E
Sbjct  62   DICWAMGQLGFDDYVGPLKRYLIRFRDFE  90



>ref|XP_009771322.1| PREDICTED: nuclear transcription factor Y subunit B-10-like [Nicotiana 
sylvestris]
Length=165

 Score =   135 bits (340),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            EH++ LPIAN+GRIMK+ LPA AKI+KEAK+ +QE  SEFI F+T EASDKC KE RKT+
Sbjct  28   EHDRYLPIANIGRIMKKALPANAKIAKEAKDTVQECVSEFISFITSEASDKCQKEKRKTI  87

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD+VWAL++LG +DY E +  YL ++RE E       RG
Sbjct  88   NGDDLVWALTTLGFEDYIEPLKAYLIRYREMEGDTKGSARG  128



>ref|NP_001050358.1| Os03g0413000 [Oryza sativa Japonica Group]
 gb|AAS07059.1| putative DNA binding transcription factor [Oryza sativa Japonica 
Group]
 gb|ABF96585.1| CCAAT-binding transcription factor subunit A, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12272.1| Os03g0413000 [Oryza sativa Japonica Group]
 dbj|BAF64448.1| HAP3 subunit of HAP complex [Oryza sativa Japonica Group]
 dbj|BAG87374.1| unnamed protein product [Oryza sativa Japonica Group]
Length=219

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  24   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  83

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD++WA+++LG +DY + +  YLHKFRE E  RA+
Sbjct  84   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAA  120



>ref|XP_011002366.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Populus 
euphratica]
Length=185

 Score =   135 bits (341),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E +KLLPIANV RIMK+ LPA AKISK+ KE +QE  SEFI F+T EASDKC +E RKTV
Sbjct  25   EQDKLLPIANVSRIMKKALPANAKISKDGKETVQECVSEFISFITGEASDKCQREKRKTV  84

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD++WA+++LG +DYAE +  YL KFRE E  R +
Sbjct  85   NGDDLLWAMTTLGFEDYAEPLKIYLQKFRETEGERTA  121



>gb|AAL47206.1| HAP3-like transcriptional-activator [Oryza sativa Indica Group]
 gb|EEC75463.1| hypothetical protein OsI_12027 [Oryza sativa Indica Group]
Length=219

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  24   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  83

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD++WA+++LG +DY + +  YLHKFRE E  RA+
Sbjct  84   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAA  120



>gb|EAZ27313.1| hypothetical protein OsJ_11252 [Oryza sativa Japonica Group]
Length=225

 Score =   137 bits (344),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  24   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  83

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD++WA+++LG +DY + +  YLHKFRE E  RA+
Sbjct  84   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAA  120



>ref|XP_002308762.2| hypothetical protein POPTR_0006s00730g [Populus trichocarpa]
 gb|EEE92285.2| hypothetical protein POPTR_0006s00730g [Populus trichocarpa]
Length=183

 Score =   135 bits (341),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E +KLLPIANV RIMK+ LPA AKISK+ KE +QE  SEFI F+T EASDKC +E RKTV
Sbjct  25   EQDKLLPIANVSRIMKKALPANAKISKDGKETVQECVSEFISFITGEASDKCQREKRKTV  84

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD++WA+++LG +DYAE +  YL KFRE E  R +
Sbjct  85   NGDDLLWAMTTLGFEDYAEPLKIYLQKFRETEGERTA  121



>emb|CBI32238.3| unnamed protein product [Vitis vinifera]
Length=128

 Score =   134 bits (336),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = +2

Query  80   MKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVNGDDIVWALSSLGL  259
            MKQILP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTVNGDDI WAL +LG 
Sbjct  1    MKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALGTLGF  60

Query  260  DDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETDRY  379
            DDYAE + RYLH++RE E  +A+Q++   A E+++E   Y
Sbjct  61   DDYAEPLKRYLHRYRELEGEKANQSK---ASEENDEPSNY  97



>ref|XP_010538453.1| PREDICTED: nuclear transcription factor Y subunit B-2 [Tarenaya 
hassleriana]
Length=174

 Score =   135 bits (340),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISKEAKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  22   EQDRFLPIANVSRIMKKALPANAKISKEAKETMQECVSEFISFVTGEASDKCQKEKRKTI  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            NGDD++WA+++LG +DY + +  YL +FRE E  R   +R   A  DD
Sbjct  82   NGDDLLWAMTTLGFEDYVDPLKVYLQRFREMEGERTGLSRPYSAAGDD  129



>ref|XP_004507593.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Cicer 
arietinum]
Length=136

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +2

Query  41   HEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVN  220
             E+LLPIANVGRIMK+ LPAKAKISKEAKE +QE  SEFI F+T EAS+KC KE RKT+N
Sbjct  21   QERLLPIANVGRIMKKALPAKAKISKEAKETMQECVSEFISFITGEASEKCQKEKRKTIN  80

Query  221  GDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            GDD+VWA+++LG ++YA+++  YL K+RE E
Sbjct  81   GDDLVWAMTTLGFEEYADSLKIYLLKYREIE  111



>ref|XP_009407345.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407346.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Musa 
acuminata subsp. malaccensis]
Length=174

 Score =   135 bits (340),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +2

Query  11   GRVRTKMGD-----EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTC  175
            G+  +K G      E E+LLPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT 
Sbjct  10   GQSNSKAGSSAAAREQERLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTG  69

Query  176  EASDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            EASDKC +E RKT+NGDD++WA+++LG +DY E +  YL +FRE E  +A 
Sbjct  70   EASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREMEGEKAG  120



>dbj|BAJ92177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   135 bits (339),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR  322
            NGDD++WA+++LG +DY E +  YLHKFRE E  R
Sbjct  83   NGDDLLWAMTTLGFEDYVEPLKYYLHKFREIEGER  117



>gb|AFE55547.1| NF-YB3 [Hordeum vulgare]
Length=174

 Score =   135 bits (340),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY E +  YLHKFRE E
Sbjct  83   NGDDLLWAMTTLGFEDYVEPLKYYLHKFREIE  114



>ref|XP_010689278.1| PREDICTED: nuclear transcription factor Y subunit B-3 [Beta vulgaris 
subsp. vulgaris]
Length=229

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    AG*GRVRTKMGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEA  181
            +G G  R     E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EA
Sbjct  46   SGGGGNRELSAREQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEA  105

Query  182  SDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            SDKC +E RKT+NGDD++WA+++LG ++Y E +  YLHK+RE E  +++ T G   GE D
Sbjct  106  SDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLHKYREMEGEKSAVTPGGRPGEKD  165



>ref|XP_008809529.1| PREDICTED: nuclear transcription factor Y subunit B-1-like [Phoenix 
dactylifera]
Length=215

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            + ++ LPIANV RIMK+ +PA AKISKEAKE +QE  SEFI F+TCEASDKCH+E RKTV
Sbjct  36   DQDRFLPIANVNRIMKRSIPANAKISKEAKETVQECVSEFISFITCEASDKCHREKRKTV  95

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDD++WA+++LG D+Y   +  YL+K+RE E  + S  R
Sbjct  96   NGDDLLWAMTTLGFDNYVGPLKVYLNKYRETEGEKNSMAR  135



>gb|KHN03372.1| Nuclear transcription factor Y subunit B-5 [Glycine soja]
Length=111

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVG+IMKQILP  AKISKE+KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  21   EQDRLLPIANVGKIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTV  80

Query  218  NGDDIVWALSSLGLDDYAEAM-TRYLHKF  301
            NGDDI WAL SLG DDYAE + + YLH F
Sbjct  81   NGDDICWALGSLGFDDYAEPLRSWYLHPF  109



>ref|XP_009114258.1| PREDICTED: nuclear transcription factor Y subunit B-2 [Brassica 
rapa]
 emb|CDY41061.1| BnaA09g18400D [Brassica napus]
Length=184

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGEAGE  135



>ref|XP_002320523.2| hypothetical protein POPTR_0014s16580g [Populus trichocarpa]
 gb|EEE98838.2| hypothetical protein POPTR_0014s16580g [Populus trichocarpa]
Length=182

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            NGDD++WA+++LG ++Y E +  YL K+RE E  ++S  R  PAGE D
Sbjct  81   NGDDLLWAMTTLGFEEYVEPLKIYLQKYREMEGEKSSMGR--PAGEKD  126



>gb|AHI94917.1| transcription factor subunit NF-YB2B [Brassica napus]
 emb|CDY25955.1| BnaC09g20320D [Brassica napus]
Length=187

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGEAGE  135



>gb|KCW84465.1| hypothetical protein EUGRSUZ_B01300 [Eucalyptus grandis]
Length=120

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGRIMKQ+LP  AKISK+ KE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  14   EQDRLLPIANVGRIMKQVLPPNAKISKQTKETMQECVSEFIGFVTSEASEKCRKERRKTV  73

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDDI  A+ ++G DDYA  + RYLH +R  E  +A+Q +
Sbjct  74   NGDDICCAMETMGFDDYAGLLRRYLHIYRGLEGEKANQVK  113



>ref|XP_011011131.1| PREDICTED: nuclear transcription factor Y subunit B-3 [Populus 
euphratica]
Length=190

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            NGDD++WA+++LG ++Y E +  YL K+RE E  ++S  R  PAGE D
Sbjct  81   NGDDLLWAMTTLGFEEYVEPLKIYLQKYREMEGEKSSMGR--PAGEKD  126



>ref|XP_010497798.1| PREDICTED: nuclear transcription factor Y subunit B-2, partial 
[Camelina sativa]
Length=107

 Score =   132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +2

Query  41   HEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVN  220
             ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+N
Sbjct  1    QDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTIN  60

Query  221  GDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGE  355
            GDD++WA+++LG +DY E +  YL +FRE E  R    R    GE
Sbjct  61   GDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGE  105



>ref|XP_010441427.1| PREDICTED: nuclear transcription factor Y subunit B-2-like [Camelina 
sativa]
Length=185

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGEPGE  135



>ref|XP_010495002.1| PREDICTED: nuclear transcription factor Y subunit B-2-like isoform 
X1 [Camelina sativa]
Length=186

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGEPGE  135



>ref|XP_001766253.1| predicted protein [Physcomitrella patens]
 gb|EDQ68885.1| predicted protein [Physcomitrella patens]
Length=96

 Score =   132 bits (331),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LP+ AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  3    EQDRFLPIANVSRIMKKALPSNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  62

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+S+LG +DY E +  YLHK+RE E
Sbjct  63   NGDDLLWAMSTLGFEDYVEPLKVYLHKYRELE  94



>ref|XP_010481289.1| PREDICTED: nuclear transcription factor Y subunit B-2-like [Camelina 
sativa]
Length=185

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGEPGE  135



>gb|EMT04714.1| Nuclear transcription factor Y subunit B-3 [Aegilops tauschii]
Length=182

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD++WA+++LG +DY + +  YLHKFRE E  +A    G
Sbjct  81   NGDDLLWAMTTLGFEDYVDPLKHYLHKFRELEGEKAVGAGG  121



>ref|XP_010495003.1| PREDICTED: nuclear transcription factor Y subunit B-2-like isoform 
X2 [Camelina sativa]
Length=184

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGEPGE  135



>gb|AFK49658.1| nuclear trancsription factor Y subunit B8 [Medicago truncatula]
 gb|KEH32687.1| nuclear transcription factor Y protein [Medicago truncatula]
Length=136

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  41   HEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVN  220
             E+LLPIANVGRIMK+ LP +AKISKEAKE +QE  SEFI F+T EAS+KC KE RKT+N
Sbjct  20   QERLLPIANVGRIMKKALPTRAKISKEAKETMQECVSEFISFITGEASEKCQKEKRKTIN  79

Query  221  GDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            GDD+VWA+++LG ++YAE +  YL K+RE E
Sbjct  80   GDDLVWAMTTLGFEEYAEPLKGYLLKYREIE  110



>ref|XP_003634760.1| PREDICTED: nuclear transcription factor Y subunit B-3 [Vitis 
vinifera]
 ref|XP_010644567.1| PREDICTED: nuclear transcription factor Y subunit B-3 [Vitis 
vinifera]
 emb|CBI39730.3| unnamed protein product [Vitis vinifera]
Length=210

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE-----MLRASQTRGPPA  349
            NGDD++WA+++LG +DY + +  YLH+FRE E     M R  +  GP A
Sbjct  83   NGDDLLWAMTTLGFEDYVDPLKIYLHRFREMEGEKTSMGRQGEKDGPSA  131



>ref|XP_006586933.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Glycine 
max]
Length=117

 Score =   132 bits (332),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGR+MKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  18   EQDRLLPIANVGRLMKQILPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTV  77

Query  218  NGDDIVWALSSLGLDDYAEAMTR  286
            NGDDI WAL++LG DDYAE M R
Sbjct  78   NGDDICWALATLGFDDYAEPMRR  100



>gb|ABK23156.1| unknown [Picea sitchensis]
Length=228

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANVGRIMK+ LPA  K+SK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  32   EQDRFLPIANVGRIMKKALPANGKVSKDAKETVQECVSEFISFITGEASDKCQREKRKTI  91

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDD++WA+++LG +DY E +  YLHK+RE E  + S  +
Sbjct  92   NGDDLLWAMTTLGFEDYVEPLKIYLHKYREMEGEKVSMAK  131



>ref|XP_002463163.1| hypothetical protein SORBIDRAFT_02g038870 [Sorghum bicolor]
 gb|EER99684.1| hypothetical protein SORBIDRAFT_02g038870 [Sorghum bicolor]
Length=218

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD++WA+++LG +DY E +  YLHKFRE E  +A+
Sbjct  81   NGDDLLWAMTTLGFEDYIEPLKLYLHKFRELEGEKAA  117



>ref|XP_006398463.1| hypothetical protein EUTSA_v10001037mg [Eutrema salsugineum]
 gb|ESQ39916.1| hypothetical protein EUTSA_v10001037mg [Eutrema salsugineum]
Length=190

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGEAGE  135



>gb|KFK31356.1| nuclear transcription factor y subunit b-3 [Arabis alpina]
Length=191

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R   +GE  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTSGEAGE  135



>ref|NP_199575.1| nuclear transcription factor Y subunit B-2 [Arabidopsis thaliana]
 sp|Q9FGJ3.1|NFYB2_ARATH RecName: Full=Nuclear transcription factor Y subunit B-2; Short=AtNF-YB-2; 
AltName: Full=Transcriptional activator HAP3B 
[Arabidopsis thaliana]
 gb|AAK60334.1|AF385744_1 AT5g47640/MNJ7_23 [Arabidopsis thaliana]
 dbj|BAB09090.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL77727.1| AT5g47640/MNJ7_23 [Arabidopsis thaliana]
 gb|AED95545.1| nuclear transcription factor Y subunit B-2 [Arabidopsis thaliana]
Length=190

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGE  355
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGE  132



>ref|XP_003061751.1| histone-like transcription factor [Micromonas pusilla CCMP1545]
 gb|EEH54381.1| histone-like transcription factor [Micromonas pusilla CCMP1545]
Length=139

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIAN+ RIMK+ LPA AKI+K+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  25   EQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTI  84

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            NGDD++WA+S+LG ++Y E +  YLHK+RE E  +A +++ 
Sbjct  85   NGDDLLWAMSTLGFEEYVEPLKVYLHKYRETEGEKAEKSKA  125



>emb|CAA74052.1| Transcription factor [Arabidopsis thaliana]
Length=187

 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  24   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  83

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGE  355
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R    GE
Sbjct  84   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTGGE  129



>gb|AIZ68336.1| CCAAT-binding transcription factor A [Triticum aestivum]
Length=202

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  25   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  84

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR  322
            NGDD++WA+++LG +DY + +  YLHKFRE E  R
Sbjct  85   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGER  119



>ref|XP_004296821.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Fragaria 
vesca subsp. vesca]
Length=169

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  47   KLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVNGD  226
            +LLPIANVGR+MKQILP  AKISKEAK+ +QE  SEFI FVT EASDKC KE RKTVNGD
Sbjct  30   QLLPIANVGRMMKQILPPNAKISKEAKQTMQECVSEFISFVTGEASDKCRKERRKTVNGD  89

Query  227  DIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            DI  AL +LG DDYA  + RYLH++R+ E
Sbjct  90   DICCALGTLGFDDYAALLRRYLHRYRDQE  118



>ref|XP_009616488.1| PREDICTED: nuclear transcription factor Y subunit B-10-like [Nicotiana 
tomentosiformis]
Length=165

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            EH++ LPIAN+GRIMK+ LP  AKI+KEAK+ +QE  SEFI F+T EASDKC KE RKT+
Sbjct  28   EHDRYLPIANIGRIMKKALPTNAKIAKEAKDTVQECVSEFISFITSEASDKCQKEKRKTI  87

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG--PPAGED  358
            NGDD+VWAL++LG ++Y E +  YL ++RE E       RG   PA ED
Sbjct  88   NGDDLVWALTTLGFEEYIEPLKAYLIRYREMEGDTKGSARGGDGPARED  136



>gb|AIZ68342.1| CCAAT-binding transcription factor A, partial [Triticum aestivum]
Length=172

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 5/111 (5%)
 Frame = +2

Query  41   HEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVN  220
             E LLPIANVGRIMK +LP +AK+SK AKE IQE A+EFI FVT EAS++C +E RKTVN
Sbjct  39   QEGLLPIANVGRIMKDVLPPEAKVSKHAKEVIQECATEFIGFVTGEASERCRRERRKTVN  98

Query  221  GDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRA-----SQTRGPPAGED  358
            GDDI  A+++LGLD+YA AM RYL ++RE E L A     S++  PPA  D
Sbjct  99   GDDICHAMTTLGLDNYAGAMRRYLQRYREGEELAAVLNNHSRSPAPPAPGD  149



>ref|XP_004972332.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Setaria 
italica]
Length=167

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +2

Query  41   HEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVN  220
            H+ LLPIANVGRIMK+ LP +AKISK AKE IQE A+EF+ FVT EAS++C +E RKT+N
Sbjct  39   HDNLLPIANVGRIMKEALPPQAKISKRAKETIQECATEFVGFVTGEASERCRRERRKTIN  98

Query  221  GDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            GDDI  A+ SLGLD YA+AM RYL ++RE E L A+
Sbjct  99   GDDICHAMRSLGLDHYADAMRRYLQRYRESEELAAA  134



>ref|NP_001147638.1| nuclear transcription factor Y subunit B-3 [Zea mays]
 gb|ACG28215.1| nuclear transcription factor Y subunit B-3 [Zea mays]
Length=221

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY E +  YLHKFRE E
Sbjct  83   NGDDLLWAMTTLGFEDYVEPLKHYLHKFREIE  114



>ref|XP_002507332.1| histone-like transcription factor [Micromonas sp. RCC299]
 gb|ACO68590.1| histone-like transcription factor [Micromonas sp. RCC299]
Length=138

 Score =   132 bits (332),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = +2

Query  11   GRVRTKMGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDK  190
            G VR     E ++ LPIAN+ RIMK+ LPA AKI+K+AKE +QE  SEFI F+T EASDK
Sbjct  18   GNVR-----EQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDK  72

Query  191  CHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            C +E RKT+NGDD++WA+S+LG ++Y E +  YLHK+RE E  +A+  +
Sbjct  73   CQREKRKTINGDDLLWAMSTLGFEEYVEPLKVYLHKYRETEGEKATSIK  121



>ref|XP_003546199.1| PREDICTED: nuclear transcription factor Y subunit B-3 [Glycine 
max]
 gb|KHN34225.1| Nuclear transcription factor Y subunit B-3 [Glycine soja]
Length=171

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISKEAKE +QE  SEFI F+T EASDKC KE RKT+
Sbjct  26   EQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTI  85

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG ++Y E +  YLHK+RE E
Sbjct  86   NGDDLLWAMTTLGFEEYVEPLKVYLHKYRELE  117



>ref|XP_004984032.1| PREDICTED: nuclear transcription factor Y subunit B-2-like [Setaria 
italica]
Length=226

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY E +  YLHKFRE E
Sbjct  83   NGDDLLWAMTTLGFEDYVEPLKHYLHKFREIE  114



>ref|XP_008670554.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Zea 
mays]
 tpg|DAA41387.1| TPA: hypothetical protein ZEAMMB73_677443 [Zea mays]
 gb|AIB04770.1| CCAAT-DR1 transcription factor, partial [Zea mays]
Length=205

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+ KE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  22   EQDRFLPIANVSRIMKKALPANAKISKDGKETVQECVSEFISFITGEASDKCQREKRKTI  81

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD++WA+++LG +DY E +  YLHKFRE E  +A+
Sbjct  82   NGDDLLWAMTTLGFEDYVEPLKLYLHKFRELEGDKAA  118



>gb|EMS59764.1| Nuclear transcription factor Y subunit B-3 [Triticum urartu]
Length=203

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  25   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  84

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY + +  YLHKFRE E
Sbjct  85   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIE  116



>ref|XP_004486346.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Cicer 
arietinum]
Length=157

 Score =   132 bits (333),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISKEAKE +QE  SEFI F+T EASDKC KE RKT+
Sbjct  17   EQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTI  76

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS  328
            NGDD++WA+++LG +DY + +  YLHK+R+ E  + S
Sbjct  77   NGDDLLWAMTTLGFEDYVDPLKIYLHKYRDMEGDKTS  113



>gb|KHN40791.1| Nuclear transcription factor Y subunit B-3 [Glycine soja]
Length=177

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISKEAKE +QE  SEFI F+T EASDKC KE RKT+
Sbjct  26   EQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTI  85

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY + +  YLHK+RE E
Sbjct  86   NGDDLLWAMTTLGFEDYVDPLKIYLHKYREME  117



>ref|XP_006827085.1| hypothetical protein AMTR_s00010p00239530 [Amborella trichopoda]
 gb|ERM94322.1| hypothetical protein AMTR_s00010p00239530 [Amborella trichopoda]
Length=178

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  35   DEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKT  214
            D+ E+LLPIANVGRIMK+ LP+ AKISK+AKE +QE ASEFI FVT EASDKC +E RKT
Sbjct  18   DQQERLLPIANVGRIMKRSLPSNAKISKDAKETVQECASEFISFVTGEASDKCLREKRKT  77

Query  215  VNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRG  340
            +NGDD++WA+++LG ++Y   +  YL+K+R+ E  R  +  G
Sbjct  78   INGDDLIWAMTTLGFENYVAPLKAYLNKYRDIEGERVIKLSG  119



>ref|XP_002967268.1| CCAAT-box binding factor HAP3 [Selaginella moellendorffii]
 gb|EFJ31867.1| CCAAT-box binding factor HAP3 [Selaginella moellendorffii]
Length=154

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +2

Query  2    AG*GRVRTKMGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEA  181
             G G + +    E ++ LPIANV RIMK+ LP  AKISK+AKE +QE  SEFI FVT EA
Sbjct  16   GGGGNLSSLSPREQDRFLPIANVSRIMKRGLPGNAKISKDAKETVQECVSEFISFVTGEA  75

Query  182  SDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            SDKC +E RKT+NGDD++WA+S+LG +DY E +  YLHK+RE E  +A   +   AGE +
Sbjct  76   SDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLRVYLHKYREQEGEKAMLAK---AGERE  132

Query  362  EETD  373
               D
Sbjct  133  SHAD  136



>ref|XP_007138891.1| hypothetical protein PHAVU_009G246400g [Phaseolus vulgaris]
 gb|ESW10885.1| hypothetical protein PHAVU_009G246400g [Phaseolus vulgaris]
Length=110

 Score =   131 bits (329),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANVGR+MKQILP  AKISKEAKE +QE  SEFI FVT EAS+KC KE RKTV
Sbjct  19   EQDRLLPIANVGRLMKQILPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTV  78

Query  218  NGDDIVWALSSLGLDDYAEAMTR  286
            NGDDI WALS+LG DDYA  M R
Sbjct  79   NGDDICWALSTLGFDDYAAPMRR  101



>ref|XP_009388900.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Musa 
acuminata subsp. malaccensis]
Length=220

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            EH++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  27   EHDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG ++YAE +  YL +FRE E
Sbjct  87   NGDDLLWAMTTLGFEEYAEPLKVYLQRFREME  118



>ref|XP_003562720.1| PREDICTED: nuclear transcription factor Y subunit B-1-like [Brachypodium 
distachyon]
Length=223

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY E +  YLHKFRE E
Sbjct  83   NGDDLLWAMTTLGFEDYMEPLKLYLHKFRELE  114



>ref|XP_010921842.1| PREDICTED: nuclear transcription factor Y subunit B-4-like [Elaeis 
guineensis]
Length=171

 Score =   132 bits (333),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E   LLPIANVGRIMKQ LP  AKISK AKE IQE ASEFI FVT EASD+C K+NRKT+
Sbjct  33   EQSHLLPIANVGRIMKQALPQNAKISKRAKETIQECASEFISFVTEEASDRCCKDNRKTI  92

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDDI  A+ +LGLD+YA+AM  YL ++RE+E
Sbjct  93   NGDDICCAMKTLGLDEYADAMKIYLCRYREHE  124



>ref|XP_004958263.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Setaria 
italica]
Length=217

 Score =   134 bits (337),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY E +  YLHKFRE E
Sbjct  81   NGDDLLWAMTTLGFEDYIEPLKLYLHKFRELE  112



>ref|XP_009622977.1| PREDICTED: nuclear transcription factor Y subunit B-3-like, partial 
[Nicotiana tomentosiformis]
Length=128

 Score =   131 bits (330),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            NGDD++WA+++LG ++Y E +  YL K+RE E  + +   G P GE D
Sbjct  81   NGDDLLWAMTTLGFEEYVEPLKIYLAKYREMEGEKTTMG-GRPGGEKD  127



>gb|EMT31159.1| Nuclear transcription factor Y subunit B-5 [Aegilops tauschii]
Length=172

 Score =   132 bits (333),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 6/123 (5%)
 Frame = +2

Query  44   EKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVNG  223
            E LLPIANVGRIMK +LP +AK+SK AKE IQE A+EFI FVT EAS++C +E RKTVNG
Sbjct  40   EGLLPIANVGRIMKHVLPQEAKVSKHAKEVIQECATEFIGFVTGEASERCRRERRKTVNG  99

Query  224  DDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS---QTRG---PPAGEDDEETDRY*N  385
            DDI  A+++LGLD+YA AM RYL ++RE E L A+    +R    PP G+   + D +  
Sbjct  100  DDICHAMTTLGLDNYAGAMRRYLQRYREGEELAAALNNHSRSPAPPPPGDGMIQIDVWGE  159

Query  386  LSS  394
            LS+
Sbjct  160  LSN  162



>ref|XP_011040164.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Populus 
euphratica]
Length=196

 Score =   133 bits (335),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKTV
Sbjct  26   EQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTV  85

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY E +  YL KFRE E
Sbjct  86   NGDDLLWAMTTLGFEDYVEPLKIYLQKFREME  117



>ref|XP_004503068.1| PREDICTED: nuclear transcription factor Y subunit B-7-like [Cicer 
arietinum]
Length=184

 Score =   133 bits (334),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANVGRIMK+ +P+  KISK+AKE +QE  SEFI FVT EASDKC KE RKTV
Sbjct  28   EQDRFLPIANVGRIMKKAVPSNGKISKDAKEAVQECVSEFISFVTVEASDKCQKEKRKTV  87

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDDI+WA+++LG DDY + +  YL K++E E
Sbjct  88   NGDDIIWAITTLGFDDYVDPLKFYLQKYKEIE  119



>gb|ABW09462.1| CCAAT-box binding factor HAP3-like protein, partial [Selaginella 
moellendorffii]
Length=135

 Score =   131 bits (330),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LP  AKISK+AKE +QE  SEFI FVT EASDKC +E RKT+
Sbjct  9    EQDRFLPIANVSRIMKRGLPGNAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTI  68

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDEETD  373
            NGDD++WA+S+LG +DY E +  YLHK+RE E  +A   +   AGE +   D
Sbjct  69   NGDDLLWAMSTLGFEDYVEPLRVYLHKYREQEGEKAMLAK---AGERESHAD  117



>ref|XP_006282223.1| hypothetical protein CARUB_v10028496mg [Capsella rubella]
 gb|EOA15121.1| hypothetical protein CARUB_v10028496mg [Capsella rubella]
Length=189

 Score =   133 bits (334),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC KE RKT+
Sbjct  27   EQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTI  86

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDDE  364
            NGDD++WA+++LG +DY E +  YL +FRE E  R    R   A E  E
Sbjct  87   NGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGERTGLGRPQTAAEAGE  135



>ref|XP_010532973.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Tarenaya 
hassleriana]
Length=212

 Score =   134 bits (336),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            EH++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  29   EHDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  88

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDD++WA+++LG +DY E +  YL K+RE E  + +  R
Sbjct  89   NGDDLLWAMTTLGFEDYVEPLKVYLQKYREVEGEKTTTGR  128



>ref|XP_002467695.1| hypothetical protein SORBIDRAFT_01g032590 [Sorghum bicolor]
 gb|EER94693.1| hypothetical protein SORBIDRAFT_01g032590 [Sorghum bicolor]
Length=225

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLR  322
            NGDD++WA+++LG +DY + +  YLHKFRE E  R
Sbjct  83   NGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGER  117



>ref|XP_002960452.1| CCAAT-box binding factor HAP3 [Selaginella moellendorffii]
 gb|EFJ37991.1| CCAAT-box binding factor HAP3 [Selaginella moellendorffii]
Length=154

 Score =   132 bits (331),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +2

Query  2    AG*GRVRTKMGDEHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEA  181
             G G + +    E ++ LPIANV RIMK+ LP  AKISK+AKE +QE  SEFI FVT EA
Sbjct  16   GGGGNLSSLSPREQDRFLPIANVSRIMKRGLPGNAKISKDAKETVQECVSEFISFVTGEA  75

Query  182  SDKCHKENRKTVNGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            SDKC +E RKT+NGDD++WA+S+LG +DY E +  YLHK+RE E  +A   +   AGE +
Sbjct  76   SDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLRVYLHKYREQEGEKAMLAK---AGERE  132

Query  362  EETD  373
               D
Sbjct  133  AHAD  136



>ref|XP_010252766.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Nelumbo 
nucifera]
Length=208

 Score =   133 bits (335),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  23   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  82

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTRGPPAGEDD  361
            NGDD++WA+++LG ++Y E +  YL KFRE E  R+S  R    GE D
Sbjct  83   NGDDLLWAMTTLGFEEYVEPLKIYLQKFREMEGERSSMGR---QGEKD  127



>gb|AFE55545.1| NF-YB1 [Hordeum vulgare]
Length=224

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRA  325
            NGDD++WA+++LG +DY E +  YLHKFRE E  +A
Sbjct  81   NGDDLLWAMTTLGFEDYMEPLKLYLHKFRELEGEKA  116



>emb|CDX82424.1| BnaA03g33970D [Brassica napus]
Length=189

 Score =   133 bits (334),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI FVT EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRASQTR  337
            NGDD++WA+++LG +DY E +  YL K+RE E  R +  R
Sbjct  81   NGDDLLWAMTTLGFEDYVEPLKVYLQKYREVEGERTTTGR  120



>ref|XP_009142500.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Brassica 
rapa]
Length=155

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++L PIANVG IMK +LP  AKISKEAKE +QE  SEFI FVT EASDKCHKE RKTV
Sbjct  46   EQDRLPPIANVGGIMKNMLPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTV  105

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFR  304
            NGDDI WA+++LG DDYAE + +Y +++R
Sbjct  106  NGDDICWAMANLGFDDYAEQLKKYSNRYR  134



>ref|XP_006657935.1| PREDICTED: nuclear transcription factor Y subunit B-3-like [Oryza 
brachyantha]
Length=218

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  21   EQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  80

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY E +  YLHKFRE E
Sbjct  81   NGDDLLWAMTTLGFEDYIEPLKLYLHKFRELE  112



>gb|AIZ68341.1| CCAAT-binding transcription factor A [Triticum aestivum]
Length=172

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 6/124 (5%)
 Frame = +2

Query  41   HEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTVN  220
             E LLPIANVGRIMK +LP +AK+SK AKE IQE A+EFI FVT EAS++C +E RKTVN
Sbjct  39   QEGLLPIANVGRIMKDVLPPEAKVSKHAKEVIQECATEFIGFVTGEASERCRRERRKTVN  98

Query  221  GDDIVWALSSLGLDDYAEAMTRYLHKFREYEMLRAS---QTRG---PPAGEDDEETDRY*  382
            GDDI  A+++LGLD+YA AM RYL ++RE E L A+    +R    PP G+   + D + 
Sbjct  99   GDDICHAMTTLGLDNYAGAMRRYLQRYREGEELAAALNNHSRSPAPPPPGDGMIQIDVWG  158

Query  383  NLSS  394
             LS+
Sbjct  159  ELSN  162



>ref|XP_002323121.2| hypothetical protein POPTR_0016s00780g [Populus trichocarpa]
 gb|EEF04882.2| hypothetical protein POPTR_0016s00780g [Populus trichocarpa]
Length=197

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++LLPIANV RIMK+ LPA AKISK+AKE +QE  SEFI F+T EASDKC +E RKT+
Sbjct  26   EQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTI  85

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE  313
            NGDD++WA+++LG +DY E +  YL KFRE E
Sbjct  86   NGDDLLWAMTTLGFEDYVEPLKIYLQKFREME  117



>gb|AFK49663.1| nuclear transcription factor Y subunit B13 [Medicago truncatula]
 gb|KEH36990.1| nuclear transcription factor Y protein [Medicago truncatula]
Length=166

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +2

Query  38   EHEKLLPIANVGRIMKQILPAKAKISKEAKERIQESASEFIRFVTCEASDKCHKENRKTV  217
            E ++ LPIANV RIMK+ LPA AKISKEAKE +QE  SEFI F+T EASDKC KE RKT+
Sbjct  17   EQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTI  76

Query  218  NGDDIVWALSSLGLDDYAEAMTRYLHKFREYE-----MLRASQTRGPPAGE  355
            NGDD++WA+++LG +DY E +  YL K+RE E     M+  S  R    GE
Sbjct  77   NGDDLLWAMTTLGFEDYVEPLKIYLSKYREMEGEKSAMIGRSDQRDGNVGE  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519632749224