BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1619_g1_i1 len=1833 path=[1:0-1832]

Length=1833
                                                                      Score     E

ref|XP_006355165.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          622   0.0      
ref|XP_004235137.2|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          610   0.0      
ref|XP_011076306.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          592   0.0      
gb|EYU25024.1|  hypothetical protein MIMGU_mgv1a005841mg                590   0.0      
emb|CDP05277.1|  unnamed protein product                                577   0.0      
ref|XP_009613726.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          576   0.0      
gb|EPS61758.1|  hypothetical protein M569_13036                         571   0.0      
ref|XP_009804515.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          568   0.0      
ref|XP_010662351.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               561   0.0      
ref|XP_002510886.1|  acyltransferase, putative                          552   0.0      Ricinus communis
ref|XP_002510885.1|  acyltransferase, putative                          544   0.0      Ricinus communis
ref|XP_008439394.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          542   0.0      
ref|XP_007038507.1|  3-ketoacyl-CoA synthase 6                          541   0.0      
ref|XP_006490456.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          540   0.0      
ref|XP_003592382.1|  3-ketoacyl-CoA synthase                            539   0.0      
ref|XP_003555356.2|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          539   0.0      
ref|XP_004308142.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          538   0.0      
ref|XP_004160899.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          538   0.0      
ref|XP_008439130.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          538   0.0      
ref|XP_010025262.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          538   0.0      
ref|XP_006421785.1|  hypothetical protein CICLE_v10006481mg             537   0.0      
ref|XP_006589575.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          536   0.0      
ref|XP_004148151.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          536   0.0      
ref|XP_004148150.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          534   0.0      
gb|KGN57309.1|  hypothetical protein Csa_3G178510                       534   0.0      
ref|XP_004160900.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          533   0.0      
ref|XP_002321860.1|  hypothetical protein POPTR_0015s14120g             532   1e-180   Populus trichocarpa [western balsam poplar]
ref|XP_009343519.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          530   6e-180   
ref|XP_004148152.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          530   1e-179   
ref|XP_009348644.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          528   2e-179   
ref|XP_011041661.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          529   3e-179   
ref|XP_004160898.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          528   5e-179   
ref|XP_008234332.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          528   8e-179   
ref|XP_008439129.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          526   4e-178   
ref|XP_004496843.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          525   7e-178   
ref|XP_007143338.1|  hypothetical protein PHAVU_007G064000g             525   9e-178   
ref|XP_010693652.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          521   3e-176   
ref|XP_010248065.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          520   7e-176   
gb|KDP22365.1|  hypothetical protein JCGZ_26196                         516   1e-175   
gb|AGK30004.1|  3-ketoacyl-CoA synthase 21                              518   2e-175   
ref|XP_010109073.1|  3-ketoacyl-CoA synthase 5                          513   9e-175   
ref|XP_007219157.1|  hypothetical protein PRUPE_ppa016296mg             513   3e-173   
ref|XP_003601095.1|  3-ketoacyl-CoA synthase                            513   5e-173   
ref|XP_003601093.1|  3-ketoacyl-CoA synthase                            513   5e-173   
gb|KHN15705.1|  3-ketoacyl-CoA synthase 6                               505   1e-171   
gb|KCW90793.1|  hypothetical protein EUGRSUZ_A02860                     500   2e-169   
gb|AGK30018.1|  3-ketoacyl-CoA synthase                                 501   3e-168   
gb|AGK30019.1|  3-ketoacyl-CoA synthase                                 493   6e-165   
ref|XP_003619363.1|  3-ketoacyl-CoA synthase                            491   2e-164   
gb|AES75581.2|  3-ketoacyl-CoA synthase-like protein                    488   2e-163   
ref|XP_002267475.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          487   9e-163   Vitis vinifera
ref|XP_002267424.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               485   6e-162   Vitis vinifera
emb|CAN79857.1|  hypothetical protein VITISV_030200                     480   3e-160   Vitis vinifera
ref|XP_010248462.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          479   3e-160   
ref|XP_006857988.1|  hypothetical protein AMTR_s00069p00182480          467   5e-155   
gb|KHN02772.1|  3-ketoacyl-CoA synthase 6                               459   3e-153   
ref|XP_008812849.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          454   7e-152   
emb|CBI24529.3|  unnamed protein product                                441   4e-145   
ref|XP_010926125.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          421   6e-137   
ref|XP_010916172.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          420   1e-136   
ref|XP_010681548.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          419   2e-136   
ref|XP_009390849.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          419   2e-136   
gb|AIV98044.1|  3-ketoacyl-CoA synthase                                 415   6e-136   
ref|XP_002890689.1|  hypothetical protein ARALYDRAFT_472828             416   4e-135   
gb|AIE57499.1|  KCS6                                                    415   1e-134   
gb|AAM67234.1|  fatty acid condensing enzyme CUT1, putative             415   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499108.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               415   1e-134   
ref|XP_010477925.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          415   1e-134   
ref|XP_006307339.1|  hypothetical protein CARUB_v10008957mg             415   1e-134   
ref|XP_006841272.1|  hypothetical protein AMTR_s00135p00117490          415   1e-134   
gb|AGK29999.1|  3-ketoacyl-CoA synthase 13                              414   2e-134   
ref|XP_009390357.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          414   2e-134   
ref|XP_009356268.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               414   3e-134   
ref|XP_008802438.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          414   4e-134   
ref|NP_173916.1|  3-ketoacyl-CoA synthase 5                             413   6e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414779.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          413   6e-134   
ref|XP_009391408.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               412   9e-134   
gb|AGK30000.1|  3-ketoacyl-CoA synthase 5                               412   1e-133   
ref|XP_009356269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          412   2e-133   
ref|XP_008775195.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    412   2e-133   
ref|XP_008339680.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               412   2e-133   
gb|KHN11421.1|  3-ketoacyl-CoA synthase 6                               410   2e-133   
ref|XP_009605061.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          412   4e-133   
ref|XP_003555901.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          411   4e-133   
gb|KHN05569.1|  3-ketoacyl-CoA synthase 6                               409   4e-133   
ref|NP_001130497.1|  uncharacterized protein LOC100191595               410   5e-133   Zea mays [maize]
gb|EYU44641.1|  hypothetical protein MIMGU_mgv1a005164mg                410   7e-133   
ref|XP_002465630.1|  hypothetical protein SORBIDRAFT_01g042600          410   7e-133   Sorghum bicolor [broomcorn]
ref|XP_008243224.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               410   7e-133   
ref|XP_008668455.1|  PREDICTED: uncharacterized protein LOC100191...    410   7e-133   
ref|XP_003536684.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               410   8e-133   
ref|XP_010910111.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          410   1e-132   
ref|XP_004299082.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          409   2e-132   
ref|XP_009380079.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          409   3e-132   
ref|XP_008389290.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          408   4e-132   
ref|XP_004985167.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          407   8e-132   
gb|ACZ51240.1|  3-ketoacyl-CoA synthase                                 407   9e-132   
gb|ABA01490.1|  3-ketoacyl-CoA synthase                                 407   9e-132   Gossypium hirsutum [American cotton]
ref|XP_010066726.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               407   1e-131   
ref|XP_009786212.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               407   1e-131   
ref|NP_001049406.1|  Os03g0220100                                       407   1e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008446598.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               407   1e-131   
gb|KDP29403.1|  hypothetical protein JCGZ_18324                         407   1e-131   
ref|XP_006344141.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          407   2e-131   
ref|XP_004135091.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...    405   2e-131   
ref|XP_002315942.1|  ECERIFERUM 6 family protein                        407   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_007044356.1|  3-ketoacyl-CoA synthase 6                          406   3e-131   
emb|CDP00616.1|  unnamed protein product                                406   4e-131   
ref|XP_004497096.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          406   4e-131   
ref|XP_004135090.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...    405   5e-131   
ref|XP_003614634.1|  3-ketoacyl-CoA synthase                            405   5e-131   
ref|XP_008660394.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          405   5e-131   
emb|CDP02779.1|  unnamed protein product                                405   8e-131   
ref|XP_003637444.1|  3-ketoacyl-CoA synthase                            405   1e-130   
ref|XP_007153392.1|  hypothetical protein PHAVU_003G031300g             406   1e-130   
gb|AAO42223.1|  putative fatty acid condensing enzyme CUT1              404   1e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099559.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               405   1e-130   
ref|XP_006651174.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          405   1e-130   
ref|XP_003558474.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          404   2e-130   
ref|XP_006391129.1|  hypothetical protein EUTSA_v10018446mg             404   2e-130   
ref|XP_009598968.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               404   3e-130   
gb|EPS61116.1|  hypothetical protein M569_13682                         404   3e-130   
gb|KDP38510.1|  hypothetical protein JCGZ_04435                         404   3e-130   
gb|EYU26766.1|  hypothetical protein MIMGU_mgv1a005018mg                403   4e-130   
ref|XP_002282526.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               403   4e-130   Vitis vinifera
ref|XP_006344142.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          403   5e-130   
ref|XP_011076851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          403   6e-130   
gb|EYU34398.1|  hypothetical protein MIMGU_mgv1a005204mg                402   1e-129   
ref|XP_009115318.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               402   1e-129   
emb|CDY04232.1|  BnaC06g25830D                                          402   1e-129   
ref|XP_008801160.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               403   1e-129   
ref|XP_011097190.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          402   1e-129   
ref|XP_006842379.1|  hypothetical protein AMTR_s00079p00192440          400   1e-129   
ref|XP_007142908.1|  hypothetical protein PHAVU_007G027100g             402   1e-129   
emb|CDY42109.1|  BnaA09g28510D                                          402   2e-129   
ref|XP_009762000.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          402   2e-129   
ref|XP_004238923.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          401   2e-129   
ref|XP_009597817.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          401   2e-129   
ref|XP_009356710.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          401   2e-129   
ref|XP_010692961.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          401   2e-129   
ref|XP_009105040.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               400   4e-129   
ref|XP_008800778.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          397   5e-129   
ref|XP_009627040.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               401   5e-129   
ref|XP_006415873.1|  hypothetical protein EUTSA_v10007453mg             400   5e-129   
gb|AHX25585.1|  3-ketoacyl-CoA synthase 6                               400   5e-129   
ref|XP_002311457.1|  hypothetical protein POPTR_0008s11920g             400   7e-129   Populus trichocarpa [western balsam poplar]
ref|XP_011007926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               400   7e-129   
ref|XP_009784659.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          400   9e-129   
ref|XP_003531926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          400   1e-128   
ref|XP_006829706.1|  hypothetical protein AMTR_s00126p00068780          398   1e-128   
ref|XP_008800772.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          399   1e-128   
ref|XP_006416504.1|  hypothetical protein EUTSA_v10007370mg             400   1e-128   
ref|XP_009777704.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          399   1e-128   
ref|XP_002510394.1|  acyltransferase, putative                          399   2e-128   Ricinus communis
ref|XP_006302169.1|  hypothetical protein CARUB_v10020179mg             399   2e-128   
gb|ABG35744.1|  putative very long chain fatty acid condensing en...    399   2e-128   Hordeum vulgare [barley]
ref|XP_010104374.1|  3-ketoacyl-CoA synthase 4                          399   2e-128   
ref|XP_009336207.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               397   2e-128   
gb|KFK41273.1|  hypothetical protein AALP_AA2G108700                    399   2e-128   
ref|XP_009760261.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               399   3e-128   
ref|XP_011083903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               399   6e-128   
ref|XP_002531630.1|  acyltransferase, putative                          397   7e-128   Ricinus communis
emb|CDP07508.1|  unnamed protein product                                398   7e-128   
gb|EMT20723.1|  3-ketoacyl-CoA synthase 6                               397   8e-128   
gb|ABY82171.2|  3-ketoacyl-CoA synthase I                               397   9e-128   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010527537.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          397   1e-127   
ref|XP_010539905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               397   1e-127   
ref|XP_010263663.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          397   2e-127   
gb|AAM65060.1|  very-long-chain fatty acid condensing enzyme CUT1       396   2e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AAL50069.1|  At1g68530/T26J14_10                                     396   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364915.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          397   2e-127   
ref|XP_008388058.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          397   2e-127   
ref|XP_004238922.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               396   2e-127   
ref|NP_177020.1|  3-ketoacyl-CoA synthase 6                             396   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232364.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               395   3e-127   
gb|KFK44525.1|  hypothetical protein AALP_AA1G267900                    395   4e-127   
ref|XP_009399728.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          395   4e-127   
ref|XP_004233492.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          395   5e-127   
ref|XP_010415473.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               395   5e-127   
ref|XP_009365554.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          396   6e-127   
ref|XP_010028602.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          395   6e-127   
ref|XP_007136167.1|  hypothetical protein PHAVU_009G023600g             395   6e-127   
ref|XP_010511851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          395   6e-127   
ref|XP_006304681.1|  hypothetical protein CARUB_v10011929mg             395   6e-127   
gb|KFK44079.1|  hypothetical protein AALP_AA1G213300                    395   8e-127   
ref|XP_002888670.1|  hypothetical protein ARALYDRAFT_894621             395   9e-127   
ref|XP_006363119.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          395   9e-127   
ref|XP_011048431.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          395   1e-126   
ref|XP_002890341.1|  hypothetical protein ARALYDRAFT_472173             395   2e-126   
ref|XP_009149432.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               394   2e-126   
ref|XP_002313793.1|  hypothetical protein POPTR_0009s11940g             394   2e-126   Populus trichocarpa [western balsam poplar]
ref|NP_173376.1|  3-ketoacyl-CoA synthase 4                             394   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459615.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          394   2e-126   
ref|XP_006341948.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          394   3e-126   
ref|XP_003631663.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               393   4e-126   
ref|XP_010265151.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          393   4e-126   
ref|XP_011037520.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          393   4e-126   
ref|XP_009389417.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          394   4e-126   
gb|KDO69954.1|  hypothetical protein CISIN_1g011007mg                   393   4e-126   
ref|XP_010477163.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          394   5e-126   
ref|XP_010925903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          391   6e-126   
ref|XP_010498362.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               393   7e-126   
ref|XP_011099560.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          392   8e-126   
ref|XP_008357196.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          392   2e-125   
ref|XP_004238271.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               392   2e-125   
ref|XP_007222865.1|  hypothetical protein PRUPE_ppa004284mg             392   2e-125   
ref|XP_006437664.1|  hypothetical protein CICLE_v10031329mg             391   2e-125   
ref|XP_010932594.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          390   3e-125   
gb|KDP46259.1|  hypothetical protein JCGZ_10099                         391   4e-125   
ref|XP_002963631.1|  hypothetical protein SELMODRAFT_79947              391   5e-125   
ref|XP_002321310.2|  very-long-chain fatty acid condensing enzyme...    392   5e-125   Populus trichocarpa [western balsam poplar]
gb|ACT21783.1|  CER6                                                    390   5e-125   Solanum lycopersicum
ref|XP_002974719.1|  hypothetical protein SELMODRAFT_101692             391   6e-125   
gb|AGK30005.1|  3-ketoacyl-CoA synthase                                 390   6e-125   
ref|XP_008444712.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          390   8e-125   
ref|XP_006346917.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          389   8e-125   
ref|XP_002305431.1|  hypothetical protein POPTR_0004s16290g             390   9e-125   Populus trichocarpa [western balsam poplar]
emb|CDX68323.1|  BnaA07g23630D                                          387   1e-124   
ref|XP_002283730.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               389   2e-124   Vitis vinifera
gb|ACQ41892.1|  3-ketoacyl-CoA synthase                                 389   2e-124   Camellia oleifera [abura-tsubaki]
ref|XP_009104926.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like          387   2e-124   
ref|XP_004507452.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          389   3e-124   
emb|CDY49219.1|  BnaCnng17080D                                          386   3e-124   
ref|XP_004959613.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          390   4e-124   
ref|XP_004152699.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          388   6e-124   
ref|XP_002979460.1|  hypothetical protein SELMODRAFT_444233             387   8e-124   
ref|XP_009782317.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          387   9e-124   
gb|AGH32920.1|  ketoacyl-CoA synthase                                   387   9e-124   
ref|XP_007200967.1|  hypothetical protein PRUPE_ppa004500mg             387   1e-123   
ref|XP_002977865.1|  hypothetical protein SELMODRAFT_443640             387   1e-123   
ref|XP_009378513.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          387   1e-123   
ref|XP_009594431.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    387   1e-123   
gb|KDO49072.1|  hypothetical protein CISIN_1g010687mg                   387   1e-123   
ref|XP_010551269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               385   2e-123   
ref|XP_002282403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               386   3e-123   Vitis vinifera
ref|XP_003567862.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               386   3e-123   
ref|XP_010548056.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          386   3e-123   
ref|XP_011088406.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          385   4e-123   
ref|XP_009117539.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               386   4e-123   
emb|CDY21665.1|  BnaA09g44160D                                          386   4e-123   
ref|XP_010690872.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               385   4e-123   
gb|ABS18382.1|  3-ketoacyl-CoA synthase                                 385   5e-123   Eranthis hyemalis
gb|EPS60765.1|  hypothetical protein M569_14036                         385   5e-123   
ref|XP_009416553.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          386   5e-123   
ref|XP_006423278.1|  hypothetical protein CICLE_v10028243mg             385   6e-123   
gb|AAP74371.1|  FAE1                                                    385   8e-123   Marchantia polymorpha
ref|XP_010427942.1|  PREDICTED: 3-ketoacyl-CoA synthase 7               383   9e-123   
ref|XP_004289669.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          384   1e-122   
ref|XP_008236905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          384   1e-122   
gb|AFW81175.1|  acyltransferase                                         384   2e-122   
ref|NP_001056354.1|  Os05g0568000                                       384   2e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002509491.1|  acyltransferase, putative                          384   2e-122   Ricinus communis
ref|XP_009406296.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          384   3e-122   
emb|CDP00615.1|  unnamed protein product                                383   3e-122   
ref|XP_008377297.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          383   3e-122   
ref|XP_009112385.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    384   3e-122   
gb|KFK41268.1|  hypothetical protein AALP_AA2G107900                    384   3e-122   
ref|XP_006300424.1|  hypothetical protein CARUB_v10021968mg             381   4e-122   
ref|NP_177272.1|  3-ketoacyl-CoA synthase 7                             381   5e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888823.1|  beta-ketoacyl-CoA synthase family protein          380   7e-122   
ref|XP_003606927.1|  3-ketoacyl-CoA synthase                            382   8e-122   
ref|XP_010243778.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               382   1e-121   
gb|AFW79234.1|  hypothetical protein ZEAMMB73_025891                    382   1e-121   
gb|AGK29996.1|  3-ketoacyl-CoA synthase 18                              382   1e-121   
ref|XP_010248169.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          382   1e-121   
ref|NP_001130522.1|  uncharacterized protein LOC100191621               382   1e-121   Zea mays [maize]
ref|XP_006847589.1|  hypothetical protein AMTR_s00014p00234760          382   1e-121   
emb|CDX81929.1|  BnaC08g36720D                                          382   1e-121   
ref|XP_002441534.1|  hypothetical protein SORBIDRAFT_09g028860          382   2e-121   Sorghum bicolor [broomcorn]
ref|XP_009341963.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          381   2e-121   
ref|XP_010924276.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          382   2e-121   
ref|XP_006655600.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          380   2e-121   
ref|XP_004293205.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          381   2e-121   
ref|XP_010548057.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          380   3e-121   
ref|XP_010255306.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          381   3e-121   
gb|AGK30016.1|  3-ketoacyl-CoA synthase                                 380   4e-121   
ref|NP_001148270.1|  acyltransferase                                    379   4e-121   Zea mays [maize]
ref|XP_007017550.1|  3-ketoacyl-CoA synthase 4                          380   4e-121   
ref|XP_006409460.1|  hypothetical protein EUTSA_v10022654mg             380   5e-121   
ref|XP_011088405.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...    378   5e-121   
ref|NP_001130638.1|  g14A                                               379   6e-121   
ref|XP_010471130.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like is...    378   8e-121   
ref|XP_010088926.1|  3-ketoacyl-CoA synthase 4                          379   8e-121   
ref|XP_010415822.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like          378   9e-121   
gb|EAY99068.1|  hypothetical protein OsI_21025                          380   9e-121   
ref|XP_003549437.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          379   1e-120   
tpg|DAA62349.1|  TPA: acyltransferase                                   378   1e-120   
dbj|BAJ98276.1|  predicted protein                                      379   1e-120   
ref|XP_006299088.1|  hypothetical protein CARUB_v10015226mg             379   1e-120   
ref|XP_008378462.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          379   1e-120   
ref|XP_010263648.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          379   2e-120   
ref|XP_004965181.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          378   2e-120   
gb|EMS50435.1|  3-ketoacyl-CoA synthase 4                               378   2e-120   
ref|XP_007224573.1|  hypothetical protein PRUPE_ppa1027226mg            375   3e-120   
dbj|BAK06985.1|  predicted protein                                      377   3e-120   
ref|XP_011088403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...    378   3e-120   
gb|KFK41553.1|  hypothetical protein AALP_AA2G144200                    376   3e-120   
gb|ACO72624.1|  g14a                                                    377   4e-120   
ref|XP_010530834.1|  PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1    378   4e-120   
ref|XP_008805392.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          378   5e-120   
gb|KDO84579.1|  hypothetical protein CISIN_1g010193mg                   378   5e-120   
gb|AGK29994.1|  3-ketoacyl-CoA synthase 4                               377   6e-120   
ref|NP_179223.1|  3-ketoacyl-CoA synthase 9                             377   6e-120   
ref|NP_001267518.1|  uncharacterized protein LOC100797855               377   6e-120   
ref|XP_006390797.1|  hypothetical protein EUTSA_v10018513mg             375   7e-120   
ref|XP_008223232.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 20     374   7e-120   
gb|ACO72625.1|  g14a                                                    376   7e-120   
gb|ACO72623.1|  g14a                                                    376   7e-120   
emb|CDX71278.1|  BnaC07g05570D                                          377   8e-120   
ref|XP_006581119.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          375   9e-120   
ref|XP_002884160.1|  hypothetical protein ARALYDRAFT_900287             377   9e-120   
ref|XP_010548059.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like i...    376   1e-119   
ref|XP_011005212.1|  PREDICTED: 3-ketoacyl-CoA synthase 7               375   1e-119   
ref|XP_002271250.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               376   1e-119   
ref|XP_009630522.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          377   1e-119   
ref|XP_010467354.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          377   1e-119   
ref|XP_010254814.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          376   1e-119   
ref|XP_010471128.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like is...    377   1e-119   
emb|CDO97044.1|  unnamed protein product                                377   1e-119   
ref|XP_010489197.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          377   1e-119   
ref|XP_010265150.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          376   1e-119   
ref|XP_009779121.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          376   2e-119   
emb|CDY66107.1|  BnaA02g35570D                                          374   2e-119   
ref|XP_007160751.1|  hypothetical protein PHAVU_001G014100g             376   3e-119   
gb|ABG73470.1|  long-chain fatty acid condensing enzyme                 375   3e-119   
ref|XP_007042184.1|  3-ketoacyl-CoA synthase 4                          375   3e-119   
emb|CAN63425.1|  hypothetical protein VITISV_040442                     375   3e-119   
ref|XP_009400075.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          372   4e-119   
ref|XP_002298171.1|  beta-ketoacyl-CoA synthase family protein          373   4e-119   
ref|XP_006361008.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          376   4e-119   
ref|XP_007148513.1|  hypothetical protein PHAVU_006G215000g             373   5e-119   
ref|XP_009127852.1|  PREDICTED: 3-ketoacyl-CoA synthase 7               373   6e-119   
ref|XP_001757568.1|  predicted protein                                  375   6e-119   
dbj|BAK05491.1|  predicted protein                                      374   7e-119   
ref|NP_001146356.1|  uncharacterized protein LOC100279934               374   1e-118   
ref|XP_001753137.1|  predicted protein                                  374   1e-118   
emb|CDX69040.1|  BnaC01g04130D                                          372   2e-118   
emb|CDY46211.1|  BnaA07g03590D                                          373   3e-118   
ref|XP_010093608.1|  3-ketoacyl-CoA synthase 5                          371   4e-118   
ref|XP_004953823.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          372   4e-118   
ref|XP_010551616.1|  PREDICTED: 3-ketoacyl-CoA synthase 7               370   5e-118   
ref|XP_009121221.1|  PREDICTED: 3-ketoacyl-CoA synthase 9               372   5e-118   
gb|AGK29998.1|  3-ketoacyl-CoA synthase 9                               372   6e-118   
ref|XP_008796071.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         372   6e-118   
ref|XP_004499254.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          372   6e-118   
ref|XP_002284986.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              372   7e-118   
ref|XP_006435002.1|  hypothetical protein CICLE_v10000889mg             372   7e-118   
gb|AFW76936.1|  hypothetical protein ZEAMMB73_155419                    371   9e-118   
ref|XP_010516877.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    372   1e-117   
ref|XP_004248096.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               372   1e-117   
gb|EYU26763.1|  hypothetical protein MIMGU_mgv1a027040mg                372   1e-117   
ref|NP_001048023.2|  Os02g0731900                                       370   1e-117   
emb|CDY37951.1|  BnaC02g20600D                                          369   1e-117   
ref|XP_006412251.1|  hypothetical protein EUTSA_v10025022mg             370   2e-117   
ref|XP_001758798.1|  predicted protein                                  371   2e-117   
ref|XP_006656861.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          369   2e-117   
ref|XP_004513574.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         370   3e-117   
gb|KEH37969.1|  3-ketoacyl-CoA synthase-like protein                    370   3e-117   
gb|EAZ00421.1|  hypothetical protein OsI_22442                          370   3e-117   
ref|XP_004485499.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like          368   4e-117   
ref|XP_010103772.1|  3-ketoacyl-CoA synthase 6                          369   5e-117   
emb|CDX75415.1|  BnaA01g02870D                                          368   6e-117   
emb|CCW28736.1|  putative 3-Oxoacyl-[acyl-carrier-protein (ACP)] ...    370   7e-117   
ref|XP_006647846.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          369   7e-117   
gb|EAY99126.1|  hypothetical protein OsI_21086                          370   7e-117   
ref|XP_009114823.1|  PREDICTED: 3-ketoacyl-CoA synthase 16              368   8e-117   
ref|XP_007138322.1|  hypothetical protein PHAVU_009G199000g             369   1e-116   
dbj|BAD46681.1|  putative very-long-chain fatty acid condensing e...    366   1e-116   
gb|KDO56277.1|  hypothetical protein CISIN_1g014606mg                   366   1e-116   
gb|AID60137.1|  3-ketoacyl-CoA synthase 16                              368   1e-116   
ref|XP_003536202.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         369   1e-116   
gb|EAY87409.1|  hypothetical protein OsI_08815                          365   1e-116   
ref|XP_007013801.1|  3-ketoacyl-CoA synthase                            369   1e-116   
dbj|BAF98214.1|  CM0216.300.nc                                          369   1e-116   
ref|XP_010027082.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 20     367   1e-116   
dbj|BAJ90995.1|  predicted protein                                      368   1e-116   
ref|XP_002441557.1|  hypothetical protein SORBIDRAFT_09g029260          369   2e-116   
ref|XP_010932851.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         369   2e-116   
dbj|BAJ89275.1|  predicted protein                                      368   2e-116   
ref|XP_006418385.1|  hypothetical protein EUTSA_v10007351mg             369   2e-116   
ref|XP_007218983.1|  hypothetical protein PRUPE_ppa003977mg             369   2e-116   
emb|CDX76286.1|  BnaA08g11140D                                          367   2e-116   
ref|XP_010254302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         368   3e-116   
ref|XP_010048253.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         368   3e-116   
ref|NP_001056391.1|  Os05g0574600                                       368   3e-116   
ref|XP_004301507.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like          366   4e-116   
ref|XP_008233066.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          368   4e-116   
ref|XP_009108847.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      366   5e-116   
ref|XP_008650048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         367   5e-116   
ref|XP_010914511.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         366   5e-116   
gb|KHN05051.1|  3-ketoacyl-CoA synthase 11                              366   6e-116   
gb|AAC99312.1|  fatty acid elongase 3-ketoacyl-CoA synthase 1           367   6e-116   
ref|XP_006433377.1|  hypothetical protein CICLE_v10003754mg             365   6e-116   
ref|XP_009606335.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               368   6e-116   
ref|XP_003626601.1|  3-ketoacyl-CoA synthase                            368   6e-116   
ref|NP_171620.2|  3-ketoacyl-CoA synthase 1                             367   7e-116   
ref|XP_008340798.1|  PREDICTED: 3-ketoacyl-CoA synthase 7               365   8e-116   
emb|CDY46243.1|  BnaC03g66040D                                          365   8e-116   
ref|NP_195177.1|  3-ketoacyl-CoA synthase 17                            366   9e-116   
dbj|BAD46682.1|  putative very-long-chain fatty acid condensing e...    366   9e-116   
gb|AAG28600.1|AF247134_1  fatty acid elongase 1-like protein            366   1e-115   
gb|KDP28427.1|  hypothetical protein JCGZ_14198                         367   1e-115   
ref|XP_002529975.1|  acyltransferase, putative                          367   1e-115   
ref|XP_004245214.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         366   1e-115   
gb|KFK30058.1|  hypothetical protein AALP_AA7G211400                    363   2e-115   
gb|KDO40517.1|  hypothetical protein CISIN_1g044359mg                   362   2e-115   
ref|NP_001057327.1|  Os06g0260500                                       365   2e-115   
ref|XP_002460542.1|  hypothetical protein SORBIDRAFT_02g030230          365   2e-115   
gb|EYU26540.1|  hypothetical protein MIMGU_mgv1a006237mg                364   2e-115   
ref|XP_009758872.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               366   2e-115   
gb|AGK29990.1|  3-ketoacyl-CoA synthase 11                              365   2e-115   
ref|XP_002516940.1|  acyltransferase, putative                          364   2e-115   
ref|XP_002284751.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              365   2e-115   
ref|XP_001778803.1|  predicted protein                                  366   2e-115   
ref|XP_003555524.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         365   3e-115   
ref|XP_002889383.1|  3-ketoacyl-CoA synthase 1                          366   3e-115   
ref|XP_003570501.2|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          365   3e-115   
ref|XP_003536489.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         365   3e-115   
ref|XP_006284916.1|  hypothetical protein CARUB_v10006212mg             364   4e-115   
ref|XP_006654826.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         365   4e-115   
ref|XP_009138277.1|  PREDICTED: 3-ketoacyl-CoA synthase 16-like         364   4e-115   
gb|AGK30001.1|  3-ketoacyl-CoA synthase                                 365   4e-115   
ref|XP_008352048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         365   4e-115   
ref|XP_010102812.1|  3-ketoacyl-CoA synthase 11                         365   4e-115   
ref|XP_001753229.1|  predicted protein                                  365   4e-115   
ref|XP_010437646.1|  PREDICTED: 3-ketoacyl-CoA synthase 16              364   4e-115   
emb|CDX90012.1|  BnaA10g00700D                                          365   4e-115   
gb|AAC34858.1|  senescence-associated protein 15                        365   5e-115   
ref|XP_009142612.1|  PREDICTED: 3-ketoacyl-CoA synthase 13              363   5e-115   
ref|XP_008797159.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         363   6e-115   
ref|XP_006661452.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          363   7e-115   
ref|XP_002529285.1|  acyltransferase, putative                          362   7e-115   
gb|KHN46008.1|  3-ketoacyl-CoA synthase 11                              363   9e-115   
gb|KHN13761.1|  3-ketoacyl-CoA synthase 11                              363   9e-115   
ref|XP_003593031.1|  3-ketoacyl-CoA synthase                            362   1e-114   
ref|XP_003522916.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    364   1e-114   
ref|XP_002324276.1|  hypothetical protein POPTR_0018s01300g             364   1e-114   
ref|XP_006431876.1|  hypothetical protein CICLE_v10003348mg             361   1e-114   
ref|XP_002264721.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               364   2e-114   
ref|XP_004965180.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          362   2e-114   
ref|XP_006471121.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like          361   2e-114   
ref|XP_009801870.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         363   2e-114   
dbj|BAE98925.1|  putative fatty acid elongase 3-ketoacyl-CoA synt...    363   2e-114   
ref|XP_011081914.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              363   2e-114   
ref|XP_007013326.1|  3-ketoacyl-CoA synthase                            363   2e-114   
ref|XP_004306622.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          364   2e-114   
gb|EMS60411.1|  3-ketoacyl-CoA synthase 6                               363   2e-114   
ref|XP_002869143.1|  3-ketoacyl-CoA synthase 2                          362   2e-114   
ref|XP_002464724.1|  hypothetical protein SORBIDRAFT_01g025820          364   2e-114   
ref|XP_010274236.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         363   2e-114   
ref|XP_003547051.2|  PREDICTED: 3-ketoacyl-CoA synthase 7-like          361   2e-114   
ref|XP_009349773.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         363   3e-114   
gb|EMS59568.1|  3-ketoacyl-CoA synthase 6                               359   3e-114   
ref|XP_010249963.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         363   3e-114   
gb|EMT28137.1|  3-ketoacyl-CoA synthase 6                               362   3e-114   
ref|XP_011026502.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         363   3e-114   
ref|XP_007223150.1|  hypothetical protein PRUPE_ppa004354mg             363   3e-114   
ref|XP_009394797.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         363   3e-114   
ref|XP_008659433.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          359   4e-114   
ref|XP_008391016.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like i...    363   4e-114   
ref|XP_007224449.1|  hypothetical protein PRUPE_ppa022113mg             359   4e-114   
ref|XP_006450506.1|  hypothetical protein CICLE_v10008045mg             362   4e-114   
gb|EMS47031.1|  3-ketoacyl-CoA synthase 6                               362   4e-114   
ref|XP_003519009.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         363   4e-114   
gb|EMT13637.1|  hypothetical protein F775_42822                         361   4e-114   
ref|XP_009392409.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         362   5e-114   
ref|XP_006483306.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         362   5e-114   
ref|XP_004141205.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like          360   5e-114   
ref|XP_006286166.1|  hypothetical protein CARUB_v10007737mg             362   5e-114   
ref|NP_001049540.1|  Os03g0245700                                       363   5e-114   
ref|XP_002960812.1|  hypothetical protein SELMODRAFT_437285             362   6e-114   
ref|XP_004965965.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         362   6e-114   
ref|XP_009122553.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              362   6e-114   
ref|XP_008381144.1|  PREDICTED: 3-ketoacyl-CoA synthase 7-like          360   6e-114   
ref|XP_007154946.1|  hypothetical protein PHAVU_003G160400g             362   7e-114   
ref|XP_010688098.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              362   7e-114   
ref|XP_004494857.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          362   8e-114   
emb|CDX70186.1|  BnaA10g25350D                                          362   8e-114   
gb|ACJ85761.1|  unknown                                                 362   8e-114   
ref|XP_004965179.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          361   8e-114   
ref|XP_004961143.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         362   9e-114   
ref|XP_008363965.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          362   9e-114   
ref|XP_009347466.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         361   1e-113   
ref|XP_004234025.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         362   1e-113   
ref|XP_009119672.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               362   1e-113   
ref|XP_010447115.1|  PREDICTED: 3-ketoacyl-CoA synthase 16-like         360   1e-113   
ref|XP_009348991.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         362   1e-113   
ref|XP_010473048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    361   1e-113   
ref|XP_009334788.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         361   1e-113   
ref|XP_010432405.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      360   1e-113   
ref|XP_006475774.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         361   1e-113   
gb|KEH42797.1|  3-ketoacyl-CoA synthase-like protein                    361   2e-113   
ref|XP_010547021.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 20     359   2e-113   
gb|EMT15143.1|  3-ketoacyl-CoA synthase 6                               360   2e-113   
ref|XP_006451014.1|  hypothetical protein CICLE_v10007916mg             361   2e-113   
ref|XP_009374066.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              361   2e-113   
emb|CDX98800.1|  BnaC09g50350D                                          361   2e-113   
gb|KDP32347.1|  hypothetical protein JCGZ_13272                         361   2e-113   
ref|XP_009614092.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         361   2e-113   
ref|XP_001784675.1|  predicted protein                                  359   2e-113   



>ref|XP_006355165.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Solanum tuberosum]
Length=475

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/406 (71%), Positives = 349/406 (86%), Gaps = 4/406 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVYVVD+ CFKPPN  R+PF++++E+ +M+  FFD K V+F+ KIL+LSGL EQTY PP 
Sbjct  73    PVYVVDFTCFKPPNCLRVPFTAYIENARMLD-FFDDKSVSFISKILHLSGLGEQTYFPPG  131

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             L ++P +SG ++AINEVHM+LF +F+ LLS   +SP+DIDIL+VNCSGFCP+PSL+SIIV
Sbjct  132   LFYMPPKSGHKEAINEVHMILFSVFENLLSKTNISPQDIDILIVNCSGFCPNPSLSSIIV  191

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+A++  VK++ ++GMGCSAN+LAVDM RNIM TH   NAVILSTEILSTGWYPG+E+ 
Sbjct  192   NKYALKEGVKSYTISGMGCSANSLAVDMARNIMCTHDNSNAVILSTEILSTGWYPGRERP  251

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
             F++LNCIFR+GGAA+LLSNK+EAK  AKYKLLW+LRTQGAFDD+ Y +A RDEDS G+TG
Sbjct  252   FMILNCIFRVGGAAILLSNKKEAKRHAKYKLLWTLRTQGAFDDKGYYSAYRDEDSSGITG  311

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             +RLNGDVL VAG+TLQTH+P+LG +FLP+ E LRF+ S    K   +S EIY+PNF+ A 
Sbjct  312   VRLNGDVLQVAGDTLQTHMPVLGGRFLPLIEKLRFVRSVLMYK---RSKEIYIPNFRRAF  368

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFCFPATGKSVVRETAKRLKLGD DMEAALMTL+RFGNQSSASLWYELAYLE KERVK+
Sbjct  369   QHFCFPATGKSVVRETAKRLKLGDRDMEAALMTLHRFGNQSSASLWYELAYLEGKERVKE  428

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             GDKVWQLGMGTGPKCNS+V++CIRPILGEA  GPWAD I+ YP+ +
Sbjct  429   GDKVWQLGMGTGPKCNSVVMECIRPILGEALIGPWADTINAYPLTI  474



>ref|XP_004235137.2| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Solanum lycopersicum]
Length=475

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/405 (70%), Positives = 345/405 (85%), Gaps = 4/405 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VYVVD+ CFKPPN   +P++S++EH +M+  FFD K V+F+ KIL LSGL +QTY PP L
Sbjct  74    VYVVDFTCFKPPNCLIVPYTSYIEHARMLD-FFDDKSVSFISKILQLSGLGDQTYFPPGL  132

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
              ++P +SG ++AINEVHM+LF +F+ LLS   +SP+DIDIL+VN SGFCP+PSL+SIIVN
Sbjct  133   FYMPPKSGHKEAINEVHMILFSVFENLLSKTNISPQDIDILIVNYSGFCPNPSLSSIIVN  192

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+A++  VK++ ++GMGCSAN+LAVDM RNIM TH   NAVILSTEILSTGWYPG+E+ F
Sbjct  193   KYALKEGVKSYTISGMGCSANSLAVDMARNIMCTHDNSNAVILSTEILSTGWYPGRERPF  252

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             ++LNCIFR+GGAA+LLSNK++AK+ AKYKLLW+LRTQGAFDD+ Y +A RDEDS G+TG+
Sbjct  253   MILNCIFRVGGAAILLSNKKQAKNQAKYKLLWTLRTQGAFDDKGYYSAYRDEDSSGITGV  312

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
             RLNGDVL VAG+TL+TH+P+LG +FLP+ E LRF+ S    K   +S EIY+PNF+ A Q
Sbjct  313   RLNGDVLQVAGDTLRTHMPVLGGRFLPLIEKLRFVRSVLMYK---RSKEIYIPNFRRAFQ  369

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFCFPATGKSVVRETAKRLKLGD DMEAALMTL+RFGNQSSASLWYELAYLE KERVKKG
Sbjct  370   HFCFPATGKSVVRETAKRLKLGDRDMEAALMTLHRFGNQSSASLWYELAYLEGKERVKKG  429

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             DKVWQLGMGTGPKCNS+V++CIRPILGEA  GPWAD I+  P+ +
Sbjct  430   DKVWQLGMGTGPKCNSVVMECIRPILGEALIGPWADTINTCPLTI  474



>ref|XP_011076306.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Sesamum indicum]
Length=485

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/403 (65%), Positives = 339/403 (84%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ CFKPPNFCR+PFS+++EH +M+  F D + VAFM K+L  SG  EQTY+PPA+
Sbjct  74    VYLVDFSCFKPPNFCRVPFSTYIEHARMLD-FLDEESVAFMAKVLKHSGQGEQTYIPPAI  132

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +SG Q+A+ E HMVLFP+ + LLS    SP++IDIL+VNCSGFCP PSL+SIIVN
Sbjct  133   HYIPPKSGHQEALKEAHMVLFPVVEDLLSKTNTSPQEIDILIVNCSGFCPAPSLSSIIVN  192

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+++F ++GMGCSA+ LA+DM +NI KTH+  NA+ILSTEILSTGWYPGKE+  
Sbjct  193   KYSMREDIRSFTISGMGCSASALAIDMAQNIFKTHKNSNALILSTEILSTGWYPGKEQPM  252

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             +VLNC+FRMG AA+L++NKREAK  AKYKLL++ R+Q AFDD+ Y +AIR+EDS+G+TG+
Sbjct  253   MVLNCLFRMGAAAILVTNKREAKKTAKYKLLYTHRSQRAFDDKGYYSAIREEDSDGVTGV  312

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D+L VAGETL+ +I +LG+KFLP TE++ +  S FK+K+++KSTEIYVPNFK  +Q
Sbjct  313   TLRRDLLQVAGETLRANIAVLGSKFLPYTEMILYALSIFKKKYLNKSTEIYVPNFKRVVQ  372

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +GK V+RE  K L+LG+ +ME ALMTL+RFGNQSS+SLWYEL+Y+EAKERVKKG
Sbjct  373   HFCLPTSGKPVIREIGKGLRLGEREMEPALMTLHRFGNQSSSSLWYELSYMEAKERVKKG  432

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQLGMG+GPKCN+LV +CIRPI+GEAQKG WAD IH YP+
Sbjct  433   DRVWQLGMGSGPKCNTLVWECIRPIVGEAQKGVWADSIHSYPV  475



>gb|EYU25024.1| hypothetical protein MIMGU_mgv1a005841mg [Erythranthe guttata]
Length=468

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/405 (66%), Positives = 333/405 (82%), Gaps = 1/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ C KPPNFCR+PFS+++EH QM+  F D + V FM K+L  SG  EQTYLPP +
Sbjct  60    LYLVDFSCLKPPNFCRVPFSTYIEHAQMLD-FLDKESVDFMAKVLTHSGQGEQTYLPPCI  118

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP +S  ++AINEVHM LFP+F+ LLS  K+SP +ID+L+VNCSGFCP PSL+SIIVN
Sbjct  119   HIIPPKSSHREAINEVHMALFPVFEDLLSKTKISPTEIDVLIVNCSGFCPAPSLSSIIVN  178

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR DVK+FN++GMGCSA+ LA+DM  NI+KTH+  NAVILSTEILSTGWYPGK++  
Sbjct  179   KYSMRDDVKSFNISGMGCSASALAIDMAHNILKTHKNSNAVILSTEILSTGWYPGKQQTM  238

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             LVLNCIFRMG AA+L++NK+EAK  AKYKLL +LRTQ AFDD+ Y +A R+EDS+G TG+
Sbjct  239   LVLNCIFRMGAAAILVTNKKEAKKTAKYKLLHTLRTQRAFDDKGYYSAFREEDSDGFTGV  298

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D+L VAGETL+++I ILG K LP TE++ +  S  K+K+ DKS+EIYVPNFK A+Q
Sbjct  299   TLRRDLLQVAGETLRSNITILGTKILPYTEMILYAISITKKKYFDKSSEIYVPNFKRAVQ  358

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC PA+GK V+RE  K LKLG+ DME A+MTL+RFGNQSS+SLWYEL Y+EAK+RVKKG
Sbjct  359   HFCLPASGKPVIREIGKGLKLGERDMEPAMMTLHRFGNQSSSSLWYELGYMEAKDRVKKG  418

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             DKVWQLGMG+GPKCNSLV +C+RPI GEAQ G WADCI  YP+ L
Sbjct  419   DKVWQLGMGSGPKCNSLVWECLRPICGEAQNGVWADCIDSYPVVL  463



>emb|CDP05277.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 331/404 (82%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C KPP+FCR+PFS++LEH QM   F D +  AFM KIL  SG  E+TYLPPA
Sbjct  51    PVYLVDFSCLKPPSFCRVPFSTYLEHAQMFD-FLDHQSRAFMAKILIQSGQGERTYLPPA  109

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP RS  QDA  EVHM LFPIF  LLS  +LSP+DID+L+VNCSGFCP PSL+SII+
Sbjct  110   LHYIPPRSSHQDATGEVHMALFPIFDDLLSKTRLSPRDIDVLIVNCSGFCPAPSLSSIII  169

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR D+K+FN++GMGCSA+ LA+DM ++++KTH+  NAVILSTEILSTGWYPGKE+ 
Sbjct  170   NKYRMREDIKSFNVSGMGCSASALAIDMAQSVLKTHKNWNAVILSTEILSTGWYPGKERP  229

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              +VLNC+FRMGGAA+LL+N+REAK  +KYKLL S RTQ AFDD+ Y +AIR+EDS G TG
Sbjct  230   MIVLNCLFRMGGAAILLTNRREAKRASKYKLLLSQRTQRAFDDKGYYSAIREEDSRGHTG  289

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L VAGETL+++I ILGA+ LP TE + +  S F++KF+DK+TEIYVPNFK+ I
Sbjct  290   ITLRRDLLHVAGETLRSNISILGARILPYTEQIWYAVSVFRKKFMDKATEIYVPNFKTVI  349

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +GK V+ E  K LKLG+ DME ALMT++RFGNQSS+SLWYELAY+EAK RVKK
Sbjct  350   QHFCLPTSGKPVIGEIGKGLKLGERDMEPALMTMHRFGNQSSSSLWYELAYMEAKGRVKK  409

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQLGMG+GPKC+SLV +CIRP+  +A+ GPWAD +  +PI
Sbjct  410   GDRVWQLGMGSGPKCSSLVWECIRPMSSDAEIGPWADSLEGHPI  453



>ref|XP_009613726.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana tomentosiformis]
Length=453

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/406 (64%), Positives = 329/406 (81%), Gaps = 1/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C KPPN CR+P ++F+EH QMM  F D + + FM K+L+ SG SE+TYLPPA
Sbjct  49    PVYLVDYSCLKPPNSCRVPHAAFIEHAQMMD-FLDKESINFMSKVLSHSGQSEETYLPPA  107

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP +SG Q+AI EVHM LF +F+ LL+   LSP+DID+L+VNCSGFCP PSL+SIIV
Sbjct  108   IHYIPPKSGHQEAIEEVHMSLFTVFEDLLAKTNLSPQDIDVLIVNCSGFCPAPSLSSIIV  167

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NKF+MR D+K++ ++GMGCSA+ LA+DM +NI+KTH+  NA+ILSTEILSTGWYPGKE++
Sbjct  168   NKFSMREDIKSYTISGMGCSASALAIDMAQNILKTHKNSNAIILSTEILSTGWYPGKERS  227

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              LVLNC+FRMG A +L+SNK+EAK  AKYKLL +LR+Q AF+D+ Y +A R+EDS G TG
Sbjct  228   MLVLNCLFRMGAAGILISNKKEAKKTAKYKLLKTLRSQRAFNDKAYFSAYREEDSNGFTG  287

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L  AGETL+T+I  LG++ LP TE + F  S  ++ F+DKSTEIYVPNFKS I
Sbjct  288   VTLKRDLLQAAGETLRTNITTLGSQMLPFTEKIWFGVSLLRKMFVDKSTEIYVPNFKSVI  347

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +GK V++E  K L LG  DME ALMTL+RFGNQSS+SLWYELAY+EAKE+VKK
Sbjct  348   QHFCLPTSGKPVIKEMGKGLNLGQSDMEPALMTLHRFGNQSSSSLWYELAYIEAKEKVKK  407

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             GDK+W LGMGTG KC SL+ +C RPI GEAQKGPWA+ IH+YP+ +
Sbjct  408   GDKIWLLGMGTGTKCTSLIWECNRPIYGEAQKGPWAETIHRYPLTM  453



>gb|EPS61758.1| hypothetical protein M569_13036, partial [Genlisea aurea]
Length=426

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/404 (63%), Positives = 330/404 (82%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+VCF PP FCR+PFS+F+EH++MM    D + + FM K+L  SG S++TYLPP+
Sbjct  24    PVYLVDFVCFTPPKFCRVPFSTFIEHVKMMD-LVDERSIDFMAKVLTRSGQSQETYLPPS  82

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP +S  ++A+ EV M LFP+ QQLL     SPKD+D+L+VNCSGFCP+PSL+S+++
Sbjct  83    LHYIPPKSDHREAVGEVEMALFPVLQQLLDGTNTSPKDVDLLIVNCSGFCPNPSLSSMVI  142

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N+F+MR DVK+F LTGMGCSA+ +AVDM RNI++T+R  NAVILSTEILSTGWY GK+++
Sbjct  143   NRFSMREDVKSFTLTGMGCSASAVAVDMARNILRTNRNSNAVILSTEILSTGWYTGKDQS  202

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC+FRMG AAVL+SN++EAK  AKYKL+ S+RTQ AFDDR Y +AIR+EDS+GLTG
Sbjct  203   MLMLNCLFRMGAAAVLVSNRKEAKRTAKYKLIHSVRTQRAFDDRAYLSAIREEDSDGLTG  262

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L VAGETL+++I ILG K LP TEIL +  S  K+++ DKS EIY P+F+ A+
Sbjct  263   VTLRKDLLQVAGETLRSNIKILGRKLLPYTEILLYTISVIKKRYWDKSAEIYTPDFRRAV  322

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC P +GK+V+ E  K L+L D +ME ALMTL+RFGNQSS+SLWYEL+YLEAK R+ +
Sbjct  323   KHFCLPTSGKAVIGEIGKGLRLADGEMEPALMTLHRFGNQSSSSLWYELSYLEAKGRIME  382

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQLGMGTGPKC SLV + +RPIL  A KGPWADCIH+YP+
Sbjct  383   GDRVWQLGMGTGPKCTSLVWESLRPILASAHKGPWADCIHRYPV  426



>ref|XP_009804515.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana sylvestris]
Length=453

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/406 (64%), Positives = 326/406 (80%), Gaps = 1/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C KPPN CR+P ++F+EH QMM  F D + + FM K+L+ SG SE+TYLPPA
Sbjct  49    PVYLVDYSCLKPPNSCRVPRAAFIEHAQMMD-FLDKESINFMSKVLSHSGQSEETYLPPA  107

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP +S  Q+AINEVHM LF +F+ LL+   LSP DID+L+VNCSGFCP PSL+SIIV
Sbjct  108   IHYIPPKSDHQEAINEVHMSLFTVFEDLLAKTNLSPLDIDVLIVNCSGFCPAPSLSSIIV  167

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NKF+MR D+K++ ++GMGCSA+ LA+DM +NI+KTH+  NAVILSTEILSTGWYPGKE  
Sbjct  168   NKFSMREDIKSYTISGMGCSASALAIDMAQNILKTHKNFNAVILSTEILSTGWYPGKEPT  227

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              LVLNC+FRMG  A+L+SNK+E K  AKYKLL +LR+Q +FDD+ Y +A R+EDS G TG
Sbjct  228   MLVLNCLFRMGAGAILISNKKEGKKTAKYKLLNTLRSQRSFDDKAYFSAYREEDSNGFTG  287

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L  AGETL+T+I  LG++ LP TE + F  S  ++ F+DKSTEIYVPNFKS I
Sbjct  288   VTLKRDLLQAAGETLRTNITNLGSQMLPYTEKIWFGVSVLRKMFVDKSTEIYVPNFKSVI  347

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +GK V++E  K LKLG+ DME ALMTL+RFGNQSS+SLWYELAY+EAKE+VKK
Sbjct  348   QHFCLPTSGKPVIKEMGKGLKLGESDMEPALMTLHRFGNQSSSSLWYELAYIEAKEKVKK  407

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             GDK+W LGMGTG KC SL+ +C RPI GEAQKGPWA+ I KYP+ +
Sbjct  408   GDKIWLLGMGTGTKCTSLIWECNRPIYGEAQKGPWAETIDKYPLTM  453



>ref|XP_010662351.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Vitis vinifera]
Length=494

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/403 (63%), Positives = 322/403 (80%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPPNFCR+PFSSFLEH  M+G F D + + FM KIL  SGL EQTYLPPAL
Sbjct  86    VYLVDFSCLKPPNFCRVPFSSFLEHTSMIGSF-DRESIDFMAKILASSGLGEQTYLPPAL  144

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP  +  Q++I EVHMVLF + + LLS  KLSP+DIDIL++NCSGFCP PSL+SII+N
Sbjct  145   HYIPPMTDLQESIKEVHMVLFHVMEDLLSKTKLSPRDIDILIINCSGFCPSPSLSSIIIN  204

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMGCSA  L V + +N++K H+   AV+LSTEILSTGWYPG E+  
Sbjct  205   KYSMRNDIKSFNLSGMGCSAGILGVHLAQNLLKVHKNTYAVVLSTEILSTGWYPGNERPK  264

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FR G AA+LL+NK EAK  +KY+LL +LR Q AFDD+ Y +AIR+EDS G+TG 
Sbjct  265   LLLNCLFRTGSAAILLTNKEEAKKTSKYRLLHTLRIQRAFDDKAYRSAIREEDSNGITGF  324

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D+L  AGETL+++I ILG+  LP  E  R   S F+++FI KS E+YVP F++ IQ
Sbjct  325   TLSRDILQAAGETLRSNITILGSSMLPFLEKFRHGVSIFRKRFIHKSAEVYVPEFRTVIQ  384

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HF  P +G+SV++E  K LKLG+ +MEAALMTL RFGNQSS+SLWYELAY+EAKERVKKG
Sbjct  385   HFVLPTSGRSVIKEIGKGLKLGEGEMEAALMTLQRFGNQSSSSLWYELAYMEAKERVKKG  444

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVWQLGMG+GPKC ++V +CIR ++GE+ KGPWADCI KYPI
Sbjct  445   DKVWQLGMGSGPKCGTVVWECIRSMVGESTKGPWADCIDKYPI  487



>ref|XP_002510886.1| acyltransferase, putative [Ricinus communis]
 gb|EEF51488.1| acyltransferase, putative [Ricinus communis]
Length=481

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/407 (61%), Positives = 332/407 (82%), Gaps = 1/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ CFKPP+FC++PFS FL H  M+  F D   VAFM KIL  SG SEQTYLPPA
Sbjct  76    PVYLVDFSCFKPPDFCKVPFSKFLGHASMIKSFNDDT-VAFMAKILTSSGQSEQTYLPPA  134

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH IP R+  Q++I EV MVLFP+ + LLS  ++SP +IDIL+VNCSGFCP PSL+SII+
Sbjct  135   LHHIPPRTDYQESIKEVEMVLFPVVEDLLSKTRVSPHNIDILIVNCSGFCPSPSLSSIII  194

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK++MRAD+K+++L+GMGCSA  +++D+  N++K H+   A++LSTEILSTGWY G EK+
Sbjct  195   NKYSMRADIKSYSLSGMGCSAGAISIDLAHNLLKIHKNSYALVLSTEILSTGWYSGNEKS  254

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC FRMG AA+LL+NK+EAK  +KYKL   +RTQ AF+D+ Y +A R+EDS+G  G
Sbjct  255   KLLLNCFFRMGSAAILLTNKKEAKESSKYKLFCRVRTQRAFEDKVYISAFREEDSDGKLG  314

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L GD+L VAGETL+++I ILG+K LP +E LR+  S  +++FIDKS EIYVP+FK+ I
Sbjct  315   VTLKGDLLQVAGETLRSNIKILGSKILPPSEKLRYGISIIRKRFIDKSGEIYVPDFKTVI  374

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC P TG+ VV+E AK LKLG+ ++EAA MTL+RFGNQSS+SLWYELAY+EAK+RVKK
Sbjct  375   DHFCLPTTGRPVVKEIAKGLKLGEREVEAAFMTLHRFGNQSSSSLWYELAYVEAKDRVKK  434

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             GDKVWQ+G+G+GPK NS+V +C+RPI+GE++KGPWADC+++YP+ ++
Sbjct  435   GDKVWQIGLGSGPKGNSVVWECLRPIVGESKKGPWADCVNQYPVAIA  481



>ref|XP_002510885.1| acyltransferase, putative [Ricinus communis]
 gb|EEF51487.1| acyltransferase, putative [Ricinus communis]
Length=482

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/404 (61%), Positives = 328/404 (81%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+ +VD+ CFKPPNFC++P S FLEH  M+  F D + VAFM KIL  SG SE+TYLPPA
Sbjct  76    PICLVDFSCFKPPNFCKVPSSKFLEHSSMIESF-DCESVAFMAKILTSSGQSEETYLPPA  134

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH IP ++  Q++I EV MVLFP+ + LLS  ++ P +IDIL+VNCSGFCP PS++SII+
Sbjct  135   LHHIPPKTDYQESIKEVEMVLFPVVEDLLSKTRVPPDNIDILIVNCSGFCPSPSVSSIII  194

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+AMRAD+K++NL+GMGCSA+ +++D+   ++K H++  A++LSTEILSTGWY G EKA
Sbjct  195   NKYAMRADIKSYNLSGMGCSASAISIDLAHTLLKIHKKSYALVLSTEILSTGWYSGNEKA  254

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC+FRMG AA+LL+NKREA++ +KYKLL ++RTQ AF+D+ Y +A R+EDSEG  G
Sbjct  255   KLLLNCLFRMGSAAILLTNKREAETSSKYKLLCTVRTQRAFEDKAYLSAFREEDSEGKLG  314

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L VAGETL+++I ILG+K LP  E +R   S  +++FIDKS EIYVPNFK+ I
Sbjct  315   VTLKTDLLQVAGETLRSNITILGSKVLPPLEKVRHGISIIRKRFIDKSGEIYVPNFKTVI  374

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC P +G+ V+++ AK LKLG+ ++EAA MTL+RFGNQSS+SLWYELAYLEAKER+KK
Sbjct  375   DHFCLPTSGRPVIKQIAKALKLGERNVEAAFMTLHRFGNQSSSSLWYELAYLEAKERMKK  434

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQLGMG+GPK +S+V +C+RPI+GE+  GPW+DC H++P+
Sbjct  435   GDKVWQLGMGSGPKASSVVWECLRPIIGESNTGPWSDCAHQFPV  478



>ref|XP_008439394.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Cucumis melo]
Length=473

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/403 (61%), Positives = 322/403 (80%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP+F R+PFS+FLE+  +M   FD + ++FM + L  SG SEQT LPPAL
Sbjct  67    VYLVDFSCLKPPSFFRVPFSTFLENATLMD-IFDGESISFMARTLMSSGQSEQTCLPPAL  125

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP ++  Q++INEVH+VLFP+   LL+   LSP DIDIL+VNCSGFCP PSL+SI++N
Sbjct  126   HFIPPKTHLQESINEVHIVLFPVMDDLLTKTHLSPSDIDILIVNCSGFCPSPSLSSIVIN  185

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMGCSA+ +A+ +  N+++ H+  NAV+LSTEILS GWY GKE++ 
Sbjct  186   KYSMRNDIKSFNLSGMGCSASAIAIHLAENLLQVHKNSNAVVLSTEILSNGWYAGKERSK  245

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LLSNK +AK  +KYKL+ +LRTQ AFDD+ Y +A+R+ED++G  G+
Sbjct  246   LILNCLFRMGSAAILLSNKTQAKESSKYKLIKTLRTQRAFDDKSYLSALREEDTDGKLGV  305

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D+L VAGETL+++I ILGA  LP++E LR   S  +++F+DKS +IY+PNFK+ IQ
Sbjct  306   TLTRDLLHVAGETLRSNITILGASILPLSEKLRHGFSRLRKRFLDKSQDIYIPNFKTVIQ  365

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G +V+RE  K LKL D D+EAAL TL+RFGNQSS+SLWYELAYLEAKERV+KG
Sbjct  366   HFCLPVSGGAVIREIGKVLKLNDKDVEAALTTLHRFGNQSSSSLWYELAYLEAKERVEKG  425

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D VWQ+GMGTGPKC SL+ +CIRPI GE+   PWAD I +YPI
Sbjct  426   DSVWQIGMGTGPKCVSLIWECIRPISGESNNEPWADVIDRYPI  468



>ref|XP_007038507.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
 gb|EOY23008.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
Length=499

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/403 (61%), Positives = 321/403 (80%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ CFKPPN C++PFS F EH  M+  F DS+ V FM KIL  SGLSE TYLPPAL
Sbjct  89    VYLVDFSCFKPPNCCKVPFSHFTEHASMIESF-DSESVEFMAKILASSGLSEDTYLPPAL  147

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP ++  ++ + E  MVLFP+   LLS  KLSP+DIDIL++NCSGFCP PSL+SIIVN
Sbjct  148   HCIPPKTHQREYVKEAEMVLFPLMDDLLSKAKLSPRDIDILIINCSGFCPSPSLSSIIVN  207

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+DVK+++L+GMGCSA  + +D+ +N++KT+R   A++LSTEILS GWY G+E++ 
Sbjct  208   KYSMRSDVKSYSLSGMGCSAGAIGIDLAQNLLKTNRNSIAIVLSTEILSAGWYSGRERSM  267

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AAVLL+NK+EA   +KYKLL +LRTQ AF+D+ Y   IR+ED+ G  G+
Sbjct  268   LLLNCLFRMGSAAVLLTNKKEASKSSKYKLLRTLRTQTAFEDKAYLTVIREEDTGGKLGV  327

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              +N D+L  AGE L++HI ILG++ LP    LR   S  + KFI KS +IY+P+FK+AIQ
Sbjct  328   TINKDLLQAAGEILRSHITILGSQILPFKAKLRHAISIIRMKFIKKSGKIYMPSFKTAIQ  387

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G++V+RE AK LKL + D+EAALMTL+RFGNQSS+S+WYELAY+EAKERVK+G
Sbjct  388   HFCLPTSGRAVIREIAKALKLDERDIEAALMTLHRFGNQSSSSMWYELAYMEAKERVKEG  447

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVW LGMGTGPKCNS  L+C+RPI+GE++K PW+DCI+ YPI
Sbjct  448   DKVWLLGMGTGPKCNSFGLECVRPIVGESKKNPWSDCINLYPI  490



>ref|XP_006490456.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Citrus sinensis]
 gb|KDO65332.1| hypothetical protein CISIN_1g039838mg [Citrus sinensis]
Length=466

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/403 (60%), Positives = 322/403 (80%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
              Y+VD+ C+KPP FCR+PFSSFLE+  ++  F DS+ +AFM K+L  SG SE+TYLPPAL
Sbjct  62    TYLVDFSCYKPPCFCRVPFSSFLENSSLVETF-DSESMAFMSKVLTCSGQSEETYLPPAL  120

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
              +IP ++  Q++I E  MVLFP+ + LLS  ++SP+DIDIL++NCSGFCP PSL+SII+N
Sbjct  121   QYIPPKTNQQESIKEAQMVLFPVIENLLSKVQISPQDIDILIINCSGFCPSPSLSSIIIN  180

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++M++D+K FNL+GMGCSA+ LA+DM + ++KT +  +A++LSTEILSTGWY G EK  
Sbjct  181   KYSMKSDIKNFNLSGMGCSASALAIDMAQALLKTQKDSDALVLSTEILSTGWYSGNEKPK  240

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG  AVLL+NK++AK  +KYK++ ++RT  AFDD+ YN+ +R+EDS G  G+
Sbjct  241   LLLNCLFRMGSVAVLLTNKKQAKRSSKYKVVRTVRTNKAFDDKAYNSGMREEDSNGKLGV  300

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              LN D+L +AGETL+ +I ILG K LP  E+     S  K+ FI  S ++YVPNFK+A+Q
Sbjct  301   TLNRDLLQIAGETLRANITILGFKILPFRELFWLGVSVIKKGFIKNSCDVYVPNFKAAVQ  360

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G+ V+RE AK LKLG+ D+EAALMTL+RFGNQSS+SLWYELAY+EAKERVKKG
Sbjct  361   HFCLPVSGRPVIREIAKNLKLGERDIEAALMTLHRFGNQSSSSLWYELAYMEAKERVKKG  420

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VW +G GTG KC S+VLQC+RPI+GE+ KGPWA C+ +YP+
Sbjct  421   DRVWLIGAGTGSKCGSVVLQCLRPIVGESNKGPWAGCVEEYPV  463



>ref|XP_003592382.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES62633.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=487

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/405 (60%), Positives = 326/405 (80%), Gaps = 2/405 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY++D+ C KPPN+CR+PFS+FLE+  +   F D++ +AFMEK+L+ SG SE+T LPP+
Sbjct  81    PVYLIDFSCLKPPNYCRVPFSTFLENASLFECF-DNESMAFMEKVLHSSGQSEETCLPPS  139

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP ++   ++I E+HM+LFPI   L +  KLSP DIDIL++NCSGFC  PSL SI+V
Sbjct  140   LHYIPPKTHHSESIKELHMLLFPIIDDLFAKTKLSPFDIDILILNCSGFCSSPSLTSIVV  199

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+AMR+D+K++N++GMGCSA+ + +D+ +N++K H++ N ++LSTEILS GWYPGKEK+
Sbjct  200   NKYAMRSDIKSYNVSGMGCSASAICIDLAQNLLKVHKKSNVIVLSTEILSHGWYPGKEKS  259

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L++NC+FRMG AA+LLSNK+EA   AKY LL +LRTQ AFDD+ Y + IR+EDS+G  G
Sbjct  260   KLLINCLFRMGSAAILLSNKKEASKNAKYLLLRTLRTQRAFDDKAYLSCIREEDSDGKLG  319

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTE-IYVPNFKSA  549
             + L  DVL VAGETL+++I I+G++ LP++E   +L S  K++F+    E IYVP+FK+ 
Sbjct  320   VTLKRDVLHVAGETLRSNISIIGSEILPVSEKFWYLVSVMKKRFVFMKCEGIYVPDFKTV  379

Query  548   IQHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVK  369
             IQHFC P +G+ V+RE  K LKLG+ ++E ALMTL+RFGNQSS+SLWYELAYLEAKE+VK
Sbjct  380   IQHFCLPCSGRGVIREVGKGLKLGEKEIEPALMTLHRFGNQSSSSLWYELAYLEAKEKVK  439

Query  368   KGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             KGD VWQ+GMG+G KC S+VL+C RPILGE+ KGPW DCIH+YPI
Sbjct  440   KGDNVWQVGMGSGTKCCSVVLKCNRPILGESHKGPWGDCIHQYPI  484



>ref|XP_003555356.2| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Glycine max]
Length=511

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/404 (61%), Positives = 325/404 (80%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C KPP+ CR+PF++FLE+  M+   FDS+ +AFM K+L+ SG SE+  LPP+
Sbjct  106   PIYLVDFSCLKPPSHCRVPFTTFLENASMLE-VFDSESIAFMAKVLHSSGQSEEACLPPS  164

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP  +   ++I EV MVLFPI + LL+   LSP DIDIL++NCSGFC  PSL SI++
Sbjct  165   LHYIPPNTHHTESIKEVQMVLFPIVEDLLAKTNLSPLDIDILIINCSGFCSSPSLTSIVI  224

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK++MR D+K++N++GMGCSA+ L +D+ +N++  H+  NA++LSTEILSTGWY G EK+
Sbjct  225   NKYSMRNDIKSYNISGMGCSASALCIDLAQNLLSVHKNSNAIVLSTEILSTGWYSGNEKS  284

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L++NC+FRMG AA+LLSNK+EAK  AKY+L+ +LRTQ AFDD+ Y +AIR+EDS+G  G
Sbjct  285   KLLINCLFRMGSAAILLSNKKEAKKTAKYRLVRTLRTQRAFDDKSYFSAIREEDSDGKLG  344

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L VAGETL+T+I ILG++ L ++E   +  S  K++FI KS  IYVPNFK+ I
Sbjct  345   VTLKRDLLQVAGETLRTNISILGSEILHLSEKFSYGVSVIKKRFI-KSEGIYVPNFKTVI  403

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G+ V+RE  K LKL + D+E ALMTL+RFGNQSS+SLWYELAYLEAKERV K
Sbjct  404   QHFCLPCSGRPVIREIGKGLKLSERDIEPALMTLHRFGNQSSSSLWYELAYLEAKERVHK  463

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQLGMG+GPKCNS+VL+CIRPI+GE +KGPWADCI++YPI
Sbjct  464   GDKVWQLGMGSGPKCNSVVLKCIRPIVGEYEKGPWADCINQYPI  507



>ref|XP_004308142.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/403 (60%), Positives = 317/403 (79%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ C KPP+ C++PFS FL++  M+ GF DS+ VAFM  IL  SG S++TYLPPAL
Sbjct  66    IYLVDFSCLKPPSHCKVPFSKFLKNSSMIEGF-DSESVAFMANILASSGQSQETYLPPAL  124

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP ++   + I EVHMVLFPI   LL+  KLSP+DIDIL+VNCSGF P PSL SI++N
Sbjct  125   HHIPPKTHHHEYIKEVHMVLFPIMDDLLAKTKLSPQDIDILIVNCSGFNPTPSLTSIVIN  184

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
              ++M++D+K+FNL+GMGCSA  L +DM +N+++ H+   AV+LSTEILSTGWY G EK  
Sbjct  185   HYSMKSDIKSFNLSGMGCSAGALGIDMAQNLLQIHKNSYAVVLSTEILSTGWYAGHEKPK  244

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LL+NK +     KY+L  +LRT  ++DDR Y + IR+EDSEG  G+
Sbjct  245   LILNCLFRMGSAAILLTNKNQTSKHPKYELFKTLRTNKSYDDRAYLSTIREEDSEGKLGV  304

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              +  D+L VAGETL+ ++ +LG+  LP++E      S  +++F++KS EIYVPNFKS I+
Sbjct  305   TIKRDLLQVAGETLRANVTVLGSSILPLSEKFWHGVSIIRKRFLNKSAEIYVPNFKSVIE  364

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC PA+G+ V+RE  K LKLGD +MEAA+MTL+RFGNQSS++LWYELAYLE KERVKKG
Sbjct  365   HFCLPASGRPVIREIGKGLKLGDREMEAAVMTLHRFGNQSSSALWYELAYLEGKERVKKG  424

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVWQLGMGTGPKC SLV +CIRPI GE+++GPWADCIH+YPI
Sbjct  425   DKVWQLGMGTGPKCTSLVWKCIRPIEGESKRGPWADCIHRYPI  467



>ref|XP_004160899.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Cucumis sativus]
Length=490

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/404 (60%), Positives = 319/404 (79%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C KPP+FCR+PFS FLE+  +M  F D+  ++FM K L  SG SE+T LPPA
Sbjct  83    PVYLVDFSCLKPPSFCRVPFSLFLENATLMNTF-DNNSLSFMAKTLKSSGQSEETCLPPA  141

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LHFIP ++  Q++I+EVHMVLFP+   LL+   LSP DIDIL+VNCSGFCP PSL+SI++
Sbjct  142   LHFIPPKTHQQESIHEVHMVLFPVMDDLLTKTHLSPCDIDILIVNCSGFCPSPSLSSIVI  201

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK++MR+D+K++NL+GMGCSA+ +A+ +  N+++ H   N V+LSTEILS GWY GKE +
Sbjct  202   NKYSMRSDIKSYNLSGMGCSASAVAIHLAENLLQVHENSNVVVLSTEILSNGWYAGKEHS  261

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC FRMGGAA+LL+N++EAK  +KYKL  +LRTQ ++DDR Y +AIR+ED EG  G
Sbjct  262   RLILNCYFRMGGAAILLTNRKEAKLFSKYKLFKTLRTQTSYDDRSYLSAIREEDKEGKLG  321

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + +  D L V  ETL+ +I +LG+  LP++E LR++ S  +++F+DKS EIY+PNFK  I
Sbjct  322   VSVTRDTLQVFPETLRINITLLGSSILPLSEKLRYVVSRLRKRFVDKSQEIYIPNFKRVI  381

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G +V+R     LKL D ++EAALMTL+RFGNQSS++LWYELAYLEAKERV+K
Sbjct  382   QHFCLPVSGGAVIRAIGNVLKLNDKEVEAALMTLHRFGNQSSSALWYELAYLEAKERVEK  441

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQ+GMGTGPKC SL+ +CIRPILGE+ K PWAD I +YPI
Sbjct  442   GDKVWQIGMGTGPKCVSLIWECIRPILGESSKDPWADVIDRYPI  485



>ref|XP_008439130.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Cucumis melo]
Length=490

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/404 (61%), Positives = 318/404 (79%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C KPP+FCR+PFS FLE+  +M  F D   ++FM K L  SG SEQT LPPA
Sbjct  83    PVYLVDFSCLKPPSFCRVPFSLFLENATLMNTF-DKNSLSFMAKTLKSSGQSEQTCLPPA  141

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LHFIP ++  Q++I+EVHMVLFP+   LL+   LSP DIDIL+VNCSGFCP PSL+SI+V
Sbjct  142   LHFIPPKTHQQESIHEVHMVLFPVMDDLLTKTHLSPCDIDILIVNCSGFCPSPSLSSIVV  201

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK++MR+D+K++NL+GMGCSA+ +A+ +  N+++ H   NAV+LSTEILS GWY GKE +
Sbjct  202   NKYSMRSDIKSYNLSGMGCSASAVAIHLAENLLQVHENSNAVVLSTEILSNGWYAGKEHS  261

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC FRMGGAA+LL+N++EAK  +KYKL  +LRTQ ++DDR Y +AIR+ED EG  G
Sbjct  262   RLILNCYFRMGGAAILLTNRKEAKLFSKYKLFKTLRTQTSYDDRSYFSAIREEDMEGKLG  321

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + +  D L V  ETL+ +I +LG+  LP++E LR + S  +++F+DKS EIY+PNFK  I
Sbjct  322   VSVTRDTLQVFPETLRINITLLGSSILPLSEKLRHVVSRLRKRFVDKSQEIYIPNFKRVI  381

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G +V+R   K LKL D ++EAALMTL+RFGNQSS++LWYELAYLEAKERV+K
Sbjct  382   QHFCLPVSGGAVIRAIGKVLKLNDKEVEAALMTLHRFGNQSSSALWYELAYLEAKERVEK  441

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQ+GMGTGPKC SL+ +CIRPILGE+   PWAD I +YPI
Sbjct  442   GDKVWQIGMGTGPKCVSLIWECIRPILGESSNDPWADVIDQYPI  485



>ref|XP_010025262.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Eucalyptus grandis]
Length=490

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/405 (60%), Positives = 318/405 (79%), Gaps = 1/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP+ CR+PF+SFLEH  MM   FD + + FM KIL  SG SE+TYLPP L
Sbjct  82    VYIVDFSCLKPPSSCRVPFASFLEHASMMN-IFDRESIDFMAKILTSSGQSEETYLPPPL  140

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP R+  Q++I EVH  LFP+   LL    + P+DIDIL+VNCSGFCP PSL+SIIVN
Sbjct  141   HYIPPRTEFQESIKEVHTALFPVLDDLLEKTNVHPRDIDILIVNCSGFCPSPSLSSIIVN  200

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             +++MR+DVK FN++GMGC+A+ + +DM ++++K H+   AV+LSTEILSTGWY G+E+  
Sbjct  201   RYSMRSDVKNFNISGMGCTASAIGIDMAKSLLKVHKNSYAVVLSTEILSTGWYSGRERPK  260

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LL+NK +AK+ +KYKL+ SLRTQ A +D+ Y AA  DED+EG  G+
Sbjct  261   LLLNCLFRMGSAAILLTNKPKAKNVSKYKLVHSLRTQTALEDKAYYAAYLDEDAEGKLGV  320

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D+L VAGETL++H  ILG++ LP TE      S F+++F+ KS +IYVPNFK+ +Q
Sbjct  321   TLKRDLLQVAGETLRSHATILGSRVLPFTEKFWHGLSVFRKRFVHKSCDIYVPNFKTVVQ  380

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC PA+G+ V+RE  K LKLG+ D EAALMTLYRFGNQSS+SLWYELAY+EAK+RVKKG
Sbjct  381   HFCLPASGRPVIREIGKGLKLGEADTEAALMTLYRFGNQSSSSLWYELAYMEAKQRVKKG  440

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             DK W LGMGTG KC SL+L+ +RPILGE++KGPWA CIH YP+ +
Sbjct  441   DKAWLLGMGTGTKCISLILERVRPILGESEKGPWASCIHDYPVAI  485



>ref|XP_006421785.1| hypothetical protein CICLE_v10006481mg [Citrus clementina]
 gb|ESR35025.1| hypothetical protein CICLE_v10006481mg [Citrus clementina]
Length=491

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/403 (59%), Positives = 321/403 (80%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
              Y+VD+ C+KPP FCR+PFSSFLE+  ++  F DS+ +AFM K+L  SG SE+TYLPPAL
Sbjct  87    TYLVDFSCYKPPCFCRVPFSSFLENSSLVETF-DSESMAFMSKVLTCSGQSEETYLPPAL  145

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
              +IP ++  Q++I E  MVLFP+ + LLS  ++SP+DIDIL++NCSGFCP PSL+SII+N
Sbjct  146   QYIPPKTNQQESIKEAQMVLFPVIENLLSKVQISPQDIDILIINCSGFCPSPSLSSIIIN  205

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++M++D+K FNL+GMGCSA+ LA+DM + ++KT +  +A++LSTEILSTGWY G EK  
Sbjct  206   KYSMKSDIKNFNLSGMGCSASALAIDMAQALLKTQKDSDALVLSTEILSTGWYSGNEKPK  265

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG  AVLL+NK++AK  +KYK++ ++RT  AFDD+ YN+ +R+EDS G  G+
Sbjct  266   LLLNCLFRMGSVAVLLTNKKQAKRSSKYKVVRTVRTNKAFDDKAYNSGMREEDSNGKLGV  325

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              LN D+L +AGETL+ +I  LG K LP  E+     S  K+ FI  S ++YVPNFK+A+Q
Sbjct  326   TLNRDLLQIAGETLRANITSLGFKILPFRELFWLGVSVIKKGFIKNSCDVYVPNFKAAVQ  385

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G+ V+RE AK LKLG+ D+EAALMTL+RFGNQSS+SLWYELAY+EAKERVKKG
Sbjct  386   HFCLPVSGRPVIREIAKNLKLGERDIEAALMTLHRFGNQSSSSLWYELAYMEAKERVKKG  445

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VW +G GTG KC S+VLQC+RPI+GE+ KGPWA C+ +YP+
Sbjct  446   DRVWLIGAGTGSKCGSVVLQCLRPIVGESNKGPWAGCVEEYPV  488



>ref|XP_006589575.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
Length=481

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/404 (61%), Positives = 324/404 (80%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C KPP+ CR+PF++FLE+  M+   FDS+ +AFM K+L+ SG SE+T LPP+
Sbjct  76    PIYLVDFSCLKPPSHCRVPFATFLENASMLE-VFDSESIAFMAKVLHSSGQSEETCLPPS  134

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP  +   ++I EV MVLFPI   LL+   LSP DIDILVVNCSGFC  PSL S ++
Sbjct  135   LHYIPPNTDHTESIKEVQMVLFPIMDDLLAKTNLSPLDIDILVVNCSGFCSSPSLTSTVI  194

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK++MR+D+K++N++GMGCSA+ L +D+ +N++  H   NAV+LSTEILSTGWY G EK+
Sbjct  195   NKYSMRSDIKSYNISGMGCSASALCIDLAQNLLSVHNNSNAVVLSTEILSTGWYSGNEKS  254

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L++NC+FRMG AA+LLSNK+ AK  AKY+L+ +LRTQ AFDD+ Y++AIR+EDS+G  G
Sbjct  255   KLLINCLFRMGSAAILLSNKKVAKKTAKYRLVRTLRTQRAFDDKAYSSAIREEDSDGKLG  314

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L VAGETL+ +I ILG++ LP++E   +  S  K++FI KS  IYVPNFK+ I
Sbjct  315   VTLKRDLLQVAGETLRENISILGSEILPLSEKFWYGVSVIKKRFI-KSEGIYVPNFKTVI  373

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G+ V++E  K LKL + D+E ALMTL+RFGNQSS+SLWYELA+LEAKERV K
Sbjct  374   QHFCLPCSGRPVIKEIGKGLKLSERDIEPALMTLHRFGNQSSSSLWYELAHLEAKERVHK  433

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQLGMG+GPKCNS+VL+CIRPI+GE +KGPWADCI++YPI
Sbjct  434   GDKVWQLGMGSGPKCNSVVLKCIRPIVGEYKKGPWADCINQYPI  477



>ref|XP_004148151.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Cucumis sativus]
 gb|KGN57308.1| hypothetical protein Csa_3G178500 [Cucumis sativus]
Length=490

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/404 (60%), Positives = 318/404 (79%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C KPP+FCR+PFS FLE+  +M  F D+  ++FM K L  SG SE+T LPPA
Sbjct  83    PVYLVDFSCLKPPSFCRVPFSLFLENATLMNTF-DNNSLSFMAKTLKSSGQSEETCLPPA  141

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LHFIP ++  Q++I+EVHMVLFP+   LL+   LSP DIDIL+VNCSGFCP PSL+SI++
Sbjct  142   LHFIPPKTHQQESIHEVHMVLFPVMDDLLTKTHLSPCDIDILIVNCSGFCPSPSLSSIVI  201

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK++MR+D+K++NL+GMGCSA+ +A+ +  N+++ H   N V+LSTEILS GWY GKE +
Sbjct  202   NKYSMRSDIKSYNLSGMGCSASAVAIHLAENLLQVHENSNVVVLSTEILSNGWYAGKEHS  261

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC FRMGGAA+LL+N++EAK  +KYKL  +LRTQ ++DDR Y +AIR+ED EG  G
Sbjct  262   RLILNCYFRMGGAAILLTNRKEAKLFSKYKLFKTLRTQTSYDDRSYLSAIREEDKEGKLG  321

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + +  D L V  ETL+ +I +LG+  LP++E LR++ S  +++F+DKS EIY+PNFK  I
Sbjct  322   VSVTRDTLQVFPETLRINITLLGSSILPLSEKLRYVVSRLRKRFVDKSQEIYIPNFKRVI  381

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G +V+R     LKL D ++EAALMTL+RFGNQSS++LWYELAYLEAKERV+K
Sbjct  382   QHFCLPVSGGAVIRAIGNVLKLNDKEVEAALMTLHRFGNQSSSALWYELAYLEAKERVEK  441

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQ+GMGTGPKC SL+ +CIRPILGE+   PWAD I +YPI
Sbjct  442   GDKVWQIGMGTGPKCVSLIWECIRPILGESSNDPWADVIDRYPI  485



>ref|XP_004148150.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Cucumis sativus]
Length=473

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 319/402 (79%), Gaps = 1/402 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP+F R+PFS+FLE+  +M   FDS+ ++FM + L  SG SEQT LPPAL
Sbjct  67    VYLVDFSCLKPPSFFRVPFSTFLENATLMD-IFDSESISFMARTLKSSGQSEQTCLPPAL  125

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP ++  Q++INEVH+VLFP+   LL+   LSP DIDIL+VNCSGFC  PSL+SI++N
Sbjct  126   HFIPPKTHIQESINEVHIVLFPVMNDLLTKTHLSPSDIDILIVNCSGFCQSPSLSSIVIN  185

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMGCSA+ +A+ +  N+++ H+  NAV+LSTEILS GWY GKE++ 
Sbjct  186   KYSMRNDIKSFNLSGMGCSASAIAIHLAENLLRVHKNSNAVVLSTEILSNGWYAGKERSK  245

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LLSNK++AK  +KYKL+ +LRTQ AFDD+ Y +A+R+ED  G  G+
Sbjct  246   LILNCLFRMGSAAILLSNKKQAKESSKYKLIKTLRTQRAFDDKSYLSALREEDRYGKLGV  305

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D+  VAGETL+++I ILGA  LP++E LR   S  +++F+DKS +IY+PNFK+ IQ
Sbjct  306   ALTRDLPHVAGETLRSNITILGASILPLSEKLRHAVSRLRKRFLDKSQDIYIPNFKTVIQ  365

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G +V+RE  K LKL D D+EAAL TL+RFGNQSS+SLWYELAYLEAK RV+KG
Sbjct  366   HFCLPVSGGAVIREIGKVLKLNDKDVEAALATLHRFGNQSSSSLWYELAYLEAKRRVEKG  425

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYP  237
             ++VWQ+GMGTGPKC SL+ +CIRPI GE+   PWAD I +YP
Sbjct  426   ERVWQIGMGTGPKCVSLIWECIRPISGESNNEPWADVIDRYP  467



>gb|KGN57309.1| hypothetical protein Csa_3G178510 [Cucumis sativus]
Length=473

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 319/402 (79%), Gaps = 1/402 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP+F R+PFS+FLE+  +M   FDS+ ++FM + L  SG SEQT LPPAL
Sbjct  67    VYLVDFSCLKPPSFFRVPFSTFLENATLMD-IFDSESISFMARTLKSSGQSEQTCLPPAL  125

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP ++  Q++INEVH+VLFP+   LL+   LSP DIDIL+VNCSGFC  PSL+SI++N
Sbjct  126   HFIPPKTHIQESINEVHIVLFPVMNDLLTKTHLSPSDIDILIVNCSGFCQSPSLSSIVIN  185

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMGCSA+ +A+ +  N+++ H+  NAV+LSTEILS GWY GKE++ 
Sbjct  186   KYSMRNDIKSFNLSGMGCSASAIAIHLAENLLRVHKNSNAVVLSTEILSNGWYAGKERSK  245

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LLSNK++AK  +KYKL+ +LRTQ AFDD+ Y +A+R+ED  G  G+
Sbjct  246   LILNCLFRMGSAAILLSNKKQAKESSKYKLIKTLRTQRAFDDKSYLSALREEDRYGKLGV  305

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D+  VAGETL+++I ILGA  LP++E LR   S  +++F+DKS +IY+PNFK+ IQ
Sbjct  306   ALTRDLPHVAGETLRSNITILGASVLPLSEKLRHAVSRLRKRFLDKSQDIYIPNFKTVIQ  365

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G +V+RE  K LKL D D+EAAL TL+RFGNQSS+SLWYELAYLEAK RV+KG
Sbjct  366   HFCLPVSGGAVIREIGKVLKLNDKDVEAALATLHRFGNQSSSSLWYELAYLEAKRRVEKG  425

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYP  237
             ++VWQ+GMGTGPKC SL+ +CIRPI GE+   PWAD I +YP
Sbjct  426   ERVWQIGMGTGPKCVSLIWECIRPISGESNNEPWADVIDRYP  467



>ref|XP_004160900.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Cucumis sativus]
Length=473

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/402 (60%), Positives = 319/402 (79%), Gaps = 1/402 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP+F R+PFS+FLE+  +M   FD++ ++FM + L  SG SEQT LPPAL
Sbjct  67    VYLVDFSCLKPPSFFRVPFSTFLENATLMD-IFDNESISFMARTLKSSGQSEQTCLPPAL  125

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP ++  Q++INEVH+VLFP+   LL+   LSP DIDIL+VNCSGFC  PSL+SI++N
Sbjct  126   HFIPPKTHIQESINEVHIVLFPVMNDLLTKTHLSPSDIDILIVNCSGFCQSPSLSSIVIN  185

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMGCSA+ +A+ +  N+++ H+  NAV+LSTEILS GWY GKE++ 
Sbjct  186   KYSMRNDIKSFNLSGMGCSASAIAIHLAENLLRVHKNSNAVVLSTEILSNGWYAGKERSK  245

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LLSNK++AK  +KYKL+ +LRTQ AFDD+ Y +A+R+ED  G  G+
Sbjct  246   LILNCLFRMGSAAILLSNKKQAKESSKYKLIKTLRTQRAFDDKSYLSALREEDRYGKLGV  305

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D+  VAGETL+++I ILGA  LP++E LR   S  +++F+DKS +IY+PNFK+ IQ
Sbjct  306   ALTRDLPHVAGETLRSNITILGASVLPLSEKLRHAVSRLRKRFLDKSQDIYIPNFKTVIQ  365

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G +V+RE  K LKL D D+EAAL TL+RFGNQSS+SLWYELAYLEAK RV+KG
Sbjct  366   HFCLPVSGGAVIREIGKVLKLNDKDVEAALATLHRFGNQSSSSLWYELAYLEAKRRVEKG  425

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYP  237
             ++VWQ+GMGTGPKC SL+ +CIRPI GE+   PWAD I +YP
Sbjct  426   ERVWQIGMGTGPKCVSLIWECIRPISGESNNEPWADVIDRYP  467



>ref|XP_002321860.1| hypothetical protein POPTR_0015s14120g [Populus trichocarpa]
 gb|EEF05987.1| hypothetical protein POPTR_0015s14120g [Populus trichocarpa]
Length=478

 Score =   532 bits (1370),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 314/404 (78%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ CFKPPNFC++P SSFLE+   +G F D + VAFM KIL  SGL E+TYLPPA
Sbjct  74    PVYLVDFSCFKPPNFCKVPPSSFLENASKIGSF-DKESVAFMAKILTSSGLGEETYLPPA  132

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH IP +S  Q++I E  MVL PI + LLS  K+SP+DIDIL+VNCSGFCP PSL+SII+
Sbjct  133   LHCIPPKSHQQESIKEAEMVLLPIMEDLLSKTKISPQDIDILIVNCSGFCPSPSLSSIII  192

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NKF+MR DV++F+L+GMGC A  +A+DM +N++K H+   AV+LSTEILSTGWYPG E++
Sbjct  193   NKFSMRDDVRSFSLSGMGCGAGAIAIDMAQNLLKVHKNSYAVVLSTEILSTGWYPGHERS  252

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC FRMG AA+LL+NK EA+  +KYKL  S+RTQ +F+D+ Y +A R+EDSEG  G
Sbjct  253   KLLLNCSFRMGSAAILLTNKNEARKSSKYKLFSSVRTQRSFEDKSYMSAFREEDSEGKIG  312

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + ++ DV  V GE L+ +I ILGA+ LP  E      S  +++F +KS EIYVPNFKS I
Sbjct  313   VTIHSDVFQVFGEVLRFNIKILGAQILPPLEKFWHGVSTIRKRFFEKSREIYVPNFKSVI  372

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC P +G+ ++RE AK LKLG+ + EAALMTL+RFGNQSS+SLWYELAY+EAK  VKK
Sbjct  373   HHFCLPTSGRPLIREIAKGLKLGENEDEAALMTLHRFGNQSSSSLWYELAYMEAKGMVKK  432

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVW LGMGTGPKC SLV +C RPI+ E+ KGPWAD I +YPI
Sbjct  433   GDKVWVLGMGTGPKCCSLVWECFRPIVDESSKGPWADSIDRYPI  476



>ref|XP_009343519.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Pyrus x bretschneideri]
Length=460

 Score =   530 bits (1364),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 243/404 (60%), Positives = 317/404 (78%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP+ C +PFS FL +      F D + +AFMEK+L  SG  ++TYLPPAL
Sbjct  53    VYLVDFSCLKPPSSCIVPFSKFLGNASKFESF-DMESLAFMEKVLASSGHGQETYLPPAL  111

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP  S  Q++I EVHMVLFPI   LL+   LSP++IDIL+VNCSGFCP PS ASI++N
Sbjct  112   HHIPPLSYHQESIEEVHMVLFPIMDDLLAKTNLSPQEIDILIVNCSGFCPSPSFASIVIN  171

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+DVK+++L+GMGCSA+ LA+D+ +N++K H+   AV+LSTEILSTGWY G E+  
Sbjct  172   KYSMRSDVKSYSLSGMGCSASALAIDLAKNLLKVHKNSYAVVLSTEILSTGWYAGHEQPK  231

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LL+NK++ K  +KY+L  +LRTQ AFDDR Y + IR+EDS G  G+
Sbjct  232   LILNCVFRMGSAAILLTNKKQEKMNSKYELFLTLRTQKAFDDRAYLSTIREEDSNGKLGV  291

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              +  D+L VAGE L+ ++ +LG+  LP  E  R+  S  ++++IDKSTEIYVPNFK+ I+
Sbjct  292   TIKRDILEVAGELLRWNVMVLGSSILPFLEKFRYGVSVIRKRYIDKSTEIYVPNFKTVIE  351

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G+ +V E AK LKLGD +MEAALMTL+RFGNQSS+SLWYELAYLEAK+RVKKG
Sbjct  352   HFCLPTSGRQLVSELAKGLKLGDREMEAALMTLHRFGNQSSSSLWYELAYLEAKQRVKKG  411

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPI-LGEAQKGPWADCIHKYPI  234
             D+VWQLGMGTGPKC SLV +CIRP+   E++KGPWAD IH+YP+
Sbjct  412   DRVWQLGMGTGPKCTSLVWKCIRPMDEDESKKGPWADSIHQYPL  455



>ref|XP_004148152.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Cucumis sativus]
 gb|KGN57307.1| hypothetical protein Csa_3G178490 [Cucumis sativus]
Length=484

 Score =   530 bits (1364),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 241/403 (60%), Positives = 316/403 (78%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP  C + FS+FL++  M+   F+S  + FMEK L  SGLSEQT LPPAL
Sbjct  78    VYLVDFSCLKPPTSCTVLFSTFLQN-AMLLDTFNSDSLCFMEKTLRSSGLSEQTCLPPAL  136

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP ++  Q++INEVHMVLFP+   LL+   LS  DIDIL+VNCSGFCP PSL+SI++N
Sbjct  137   HFIPHKTHQQESINEVHMVLFPVMDDLLTKTHLSSSDIDILIVNCSGFCPSPSLSSIVIN  196

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+D+K++NL+GMGCSA+ +A+ +  N+++ H+   AV+LSTEILSTGWY G E++ 
Sbjct  197   KYSMRSDIKSYNLSGMGCSASAVAIQLAENLLQVHQNSYAVVLSTEILSTGWYAGNERSK  256

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L +NC+FRMG AA+LLSNK  AK  +KYKL+ +LRTQ AFDD+ + ++IR+ED +G  G+
Sbjct  257   LFINCLFRMGSAAILLSNKTRAKESSKYKLIKTLRTQRAFDDKSHLSSIREEDKDGNLGV  316

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L   V+ +AGETL+++I ILGA  LP++E LR   S  +++F+DKS EIY+PNFK+AIQ
Sbjct  317   TLTKGVVQIAGETLRSNITILGASILPLSEKLRHGTSRLRKRFLDKSQEIYIPNFKTAIQ  376

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G +V+RE  K LKL D D+EAAL TL+RFGNQSS+SLWYELAYLEAKERV+KG
Sbjct  377   HFCLPVSGGAVIREIGKVLKLNDKDVEAALATLHRFGNQSSSSLWYELAYLEAKERVEKG  436

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVWQ+G+GTGPKC SL+L+CIRPI GE    PWA  I +YPI
Sbjct  437   DKVWQIGLGTGPKCVSLILECIRPIYGEYNNDPWAQVIDQYPI  479



>ref|XP_009348644.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Pyrus x bretschneideri]
Length=460

 Score =   528 bits (1361),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 242/404 (60%), Positives = 316/404 (78%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP+ C +PFS FL +      F D + +AFM K+L  SG  ++TYLPPAL
Sbjct  53    VYLVDFSCLKPPSSCIVPFSKFLGNASKFESF-DKESLAFMAKVLASSGHGQETYLPPAL  111

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP  S  Q++I EVHMVLFPI   LL+   LSP++IDIL+VNCSGFCP PS ASI++N
Sbjct  112   HHIPPLSHHQESIEEVHMVLFPIMDDLLAKTNLSPQEIDILIVNCSGFCPSPSFASIVIN  171

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+DVK+++L+GMGCSA+ LA+D+ +N++K H+   AV+LSTEILSTGWY G E+  
Sbjct  172   KYSMRSDVKSYSLSGMGCSASALAIDLAKNLLKVHKNSYAVVLSTEILSTGWYAGHEQPK  231

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LL+NK++ K  +KY+L  +LRTQ AFDDR Y + IR+EDS G  G+
Sbjct  232   LILNCVFRMGSAAILLTNKKQEKMNSKYELFLTLRTQKAFDDRAYLSTIREEDSNGKLGV  291

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              +  D+L VAGE L+ ++ +LG+  LP  E  R+  S  ++++IDKSTEIYVPNFK+ I+
Sbjct  292   TIKRDILEVAGELLRWNVMVLGSSILPFLEKFRYGVSVIRKRYIDKSTEIYVPNFKTVIE  351

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G+ +V E AK LKLGD +MEAALMTL+RFGNQSS+SLWYELAYLEAK+RVKKG
Sbjct  352   HFCLPTSGRQLVSELAKGLKLGDREMEAALMTLHRFGNQSSSSLWYELAYLEAKQRVKKG  411

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPI-LGEAQKGPWADCIHKYPI  234
             D+VWQLGMGTGPKC SLV +CIRP+   E++KGPWAD IH+YP+
Sbjct  412   DRVWQLGMGTGPKCTSLVWKCIRPMDEDESKKGPWADSIHRYPL  455



>ref|XP_011041661.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Populus euphratica]
Length=499

 Score =   529 bits (1363),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 246/404 (61%), Positives = 314/404 (78%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ CFKPP+FC+ P S FLE+   +G F D K VAFM KIL  SGL E+TYLPPA
Sbjct  87    PVYLVDFSCFKPPDFCKAPSSLFLENASKIGSF-DKKSVAFMAKILTSSGLGEETYLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH IP +S  Q++I E  MVL PI + LLS  K+SP+DIDIL+VNCSGFCP PSL+SII+
Sbjct  146   LHCIPPKSHQQESIKEAEMVLLPIMEDLLSKTKISPRDIDILIVNCSGFCPSPSLSSIII  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NKF+MR DV+ F+L+GMGC A  +A+DM +N++K H+   AV+LSTEILSTGWYPG E++
Sbjct  206   NKFSMRDDVRNFSLSGMGCCAGAIAIDMAQNLLKVHKNSYAVVLSTEILSTGWYPGHERS  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC FRMG AA+LL+NK EA+  +KY+L  S+RTQ +FDD+ Y +A+R+EDSEG  G
Sbjct  266   KLLLNCGFRMGSAAILLTNKNEARKSSKYRLFSSVRTQRSFDDKSYMSAVREEDSEGKIG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + ++ DV  + GE L+ +I ILGA+ LP  E      S  +++F +KS EIYVPNFKS I
Sbjct  326   VTIHSDVFQLFGEVLRFNITILGAQILPPMEKFWHGVSTIRKRFFEKSREIYVPNFKSVI  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G+S++RE  K LKLG+ + EAALMTL+RFGNQSS+SLWYE+AY+EAK  +KK
Sbjct  386   QHFCLPTSGRSLIREITKGLKLGENEDEAALMTLHRFGNQSSSSLWYEVAYMEAKGMIKK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVW LGMGTGPKC SLV +C+RPI+ E+ KGPWAD I +YPI
Sbjct  446   GDKVWVLGMGTGPKCCSLVWECLRPIVDESSKGPWADSIDRYPI  489



>ref|XP_004160898.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Cucumis sativus]
Length=484

 Score =   528 bits (1360),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 240/403 (60%), Positives = 316/403 (78%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP  C + FS+FL++  M+   F+S  + FMEK L  SGLSEQT LPPAL
Sbjct  78    VYLVDFSCLKPPTSCTVLFSTFLQN-AMLLDTFNSDSLCFMEKTLRSSGLSEQTCLPPAL  136

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP ++  Q++INEVHMVLFP+   LL+   LS  DIDIL+VNCSGFCP PSL+SI++N
Sbjct  137   HFIPHKTHQQESINEVHMVLFPVMDDLLTKTHLSSSDIDILIVNCSGFCPSPSLSSIVIN  196

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+D+K++NL+GMGCSA+ +A+ +  N+++ H+   AV+LSTEILSTGWY G E++ 
Sbjct  197   KYSMRSDIKSYNLSGMGCSASAVAIQLAENLLQVHQNSYAVVLSTEILSTGWYAGNERSK  256

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L +NC+FRMG AA+LLSNK  AK  +KYKL+ +LRTQ AFDD+ + ++IR+ED +G  G+
Sbjct  257   LFINCLFRMGSAAILLSNKTRAKESSKYKLIKTLRTQRAFDDKSHLSSIREEDKDGNLGV  316

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L   V+ +AGETL+++I ILGA  LP++E LR   S  +++F+DKS EIY+PNFK+AI+
Sbjct  317   TLTKGVVQIAGETLRSNITILGASILPLSEKLRHGTSRLRKRFLDKSQEIYIPNFKTAIK  376

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G +V+RE  K LKL D D+EAAL TL+RFGNQSS+SLWYELAYLEAKERV+KG
Sbjct  377   HFCLPVSGGAVIREIGKVLKLNDKDVEAALATLHRFGNQSSSSLWYELAYLEAKERVEKG  436

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVWQ+G+GTGPKC SL+L+CIRPI GE    PWA  I +YPI
Sbjct  437   DKVWQIGLGTGPKCVSLILECIRPIYGEYNNDPWAQVIDQYPI  479



>ref|XP_008234332.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Prunus mume]
Length=494

 Score =   528 bits (1360),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 240/404 (59%), Positives = 318/404 (79%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP+ C++PFS+FL +   +  F D++ +AFM K+L  SG  ++TYLPPAL
Sbjct  87    VYLVDFSCLKPPSSCKVPFSTFLGNASKIESF-DAQSLAFMAKVLTSSGQGQETYLPPAL  145

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP +S  Q++I EVHMVLFPI   LL+  KLSP++IDIL+VNCSGFCP PSL SI++N
Sbjct  146   HHIPPKSHHQESIKEVHMVLFPIMDDLLAKTKLSPQEIDILIVNCSGFCPSPSLCSILIN  205

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+D+K++NL+GMGCSA+ LA+D+ +N+++ H +  A++LSTEILSTGWY G E+  
Sbjct  206   KYSMRSDIKSYNLSGMGCSASALAIDLAQNLLQVHYKSYAIVLSTEILSTGWYAGHEQPK  265

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FRMG AA+LL+NK++    +KY+L  +LRTQ AFDDR Y + IR+EDS G  G+
Sbjct  266   LILNCLFRMGSAAILLTNKKQDMKSSKYQLFRTLRTQKAFDDRAYLSTIREEDSNGKLGV  325

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              +  D+L   GE L+ ++ ++G+  LP +E  R   S  +++FIDKS EIYVPNFKSAI+
Sbjct  326   TIKRDILEACGEILRWNVTVIGSSILPFSEKFRHGVSKIRKRFIDKSAEIYVPNFKSAIE  385

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G+ +V+E  K LKLGD +MEAALMTL+RFGNQSS+SLWYELAYLEAK+R+KKG
Sbjct  386   HFCLPMSGRQLVKELGKGLKLGDGEMEAALMTLHRFGNQSSSSLWYELAYLEAKQRLKKG  445

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPIL-GEAQKGPWADCIHKYPI  234
             DKVWQ+GMGTGPKC SLV +CIRPI   EA KGPWAD IH+YPI
Sbjct  446   DKVWQVGMGTGPKCTSLVWKCIRPINDDEAMKGPWADSIHRYPI  489



>ref|XP_008439129.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Cucumis melo]
Length=483

 Score =   526 bits (1354),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 240/403 (60%), Positives = 315/403 (78%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C KPP  C + FS+FL++  M+   F+   + FMEK L  SGLSEQT LPPAL
Sbjct  77    VYLVDFSCLKPPTSCTVLFSTFLQN-AMLLDTFNKDSLCFMEKTLRSSGLSEQTCLPPAL  135

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP ++  Q++INEVHMVLFP+   LL+   LS  DIDIL+VNCSGFCP PSL+SI++N
Sbjct  136   HFIPHKTHQQESINEVHMVLFPVMDDLLTKTHLSSSDIDILIVNCSGFCPSPSLSSIVIN  195

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+D+K++NL+GMGCSA+ +A+ +  N+++ H+   AV+LSTEILSTGWY G E++ 
Sbjct  196   KYSMRSDIKSYNLSGMGCSASAIAIQLAENLLQVHQNSYAVVLSTEILSTGWYAGNERSK  255

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L +NC+FRMG AA+LLSNK  AK  +KYKL+ +LRTQ AFDD+ + +AIR+ED +G  G+
Sbjct  256   LAINCLFRMGSAAILLSNKTRAKESSKYKLIKTLRTQRAFDDKCHLSAIREEDKDGNLGV  315

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L   V+ V+GETL+++I ILGA  LP++E LR   S  +++F+DK  EIY+PNFK+AIQ
Sbjct  316   TLTKGVVQVSGETLRSNITILGASILPLSEKLRHGVSRLRKRFLDKWQEIYIPNFKTAIQ  375

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G +V+RE  K LKL D D+EAAL TL+RFGNQSS+SLWYELAYLEAKERV+KG
Sbjct  376   HFCLPVSGGAVIREIGKVLKLNDKDVEAALTTLHRFGNQSSSSLWYELAYLEAKERVEKG  435

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+GMGTGPKC SL+ +CIRPI GE+   PWAD I +YPI
Sbjct  436   DRVWQIGMGTGPKCVSLIWECIRPISGESNNEPWADVIDRYPI  478



>ref|XP_004496843.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Cicer arietinum]
Length=488

 Score =   525 bits (1353),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 235/403 (58%), Positives = 318/403 (79%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ CFKPPN+CR+PFS+FLE+  +   F D + ++FMEKIL+ SG S+QT LPP+L
Sbjct  84    VYIVDFSCFKPPNYCRVPFSTFLENASLFQCF-DRESISFMEKILDSSGQSQQTCLPPSL  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP ++   ++I EV MVLFPI   L +  K+SP +ID+L++NCSGFC  PSL SI+VN
Sbjct  143   HYIPPKTQNSESIKEVQMVLFPIMNDLFAKTKISPFEIDMLILNCSGFCSSPSLTSIVVN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+  R+D+K++NL+GMGCSA+ +++D+  N++K H+  N ++LSTEILSTGWY G EK  
Sbjct  203   KYPFRSDIKSYNLSGMGCSASAISIDLAHNLLKVHKNSNVIVLSTEILSTGWYSGNEKPK  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L++NC+FRMG AA+LLSNK+EA   +KY+L+ +LRTQ AFDD+ Y +AIR+EDS+G  G+
Sbjct  263   LLINCLFRMGSAAILLSNKKEASESSKYRLIRTLRTQRAFDDKAYFSAIREEDSDGKLGV  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D+L VA ETL +++ ILG + LPI E   +  S  +++F+ K  EIYVP+FKS I+
Sbjct  323   TLKRDLLHVAAETLGSNVSILGGEMLPIYEKFWYGVSVIRKRFM-KFEEIYVPDFKSVIE  381

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +GK V+RE  K LKLG+ ++E ALMTL+RFGNQSS+SLWYELAYLEAKERVKKG
Sbjct  382   HFCLPCSGKGVIREVGKGLKLGEREIECALMTLHRFGNQSSSSLWYELAYLEAKERVKKG  441

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D +W LGMG+GPKC S+VL+CIRPI+G++  GPWADC+H+YPI
Sbjct  442   DNIWLLGMGSGPKCCSVVLKCIRPIIGDSHMGPWADCVHQYPI  484



>ref|XP_007143338.1| hypothetical protein PHAVU_007G064000g [Phaseolus vulgaris]
 gb|ESW15332.1| hypothetical protein PHAVU_007G064000g [Phaseolus vulgaris]
Length=482

 Score =   525 bits (1352),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 238/404 (59%), Positives = 317/404 (78%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C KPP+ CR+PF++F+E+  M    FD++ + FM+KIL+ SG SE+T LPPA
Sbjct  77    PIYLVDFSCLKPPSHCRVPFATFIENASMWE-VFDTESIDFMDKILHSSGQSEETCLPPA  135

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP ++   ++I EV MVLFPI   LL+   +SP DIDIL++NCSGFCP PSL S+++
Sbjct  136   LHYIPPKTHHTESIKEVQMVLFPILDDLLAKTNVSPLDIDILMINCSGFCPSPSLTSLVI  195

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
              K++MR+D+K++N++GMGCSA+ L +DM +N+++ H+  NA++LSTEILSTGWY G EK+
Sbjct  196   GKYSMRSDIKSYNVSGMGCSASALCIDMAQNLLRVHKNSNALLLSTEILSTGWYSGNEKS  255

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L++NC+FRMG AA+LLSNK+ A   AKY+L+ + R Q AFDD+ Y +A R+EDS+G  G
Sbjct  256   KLLINCLFRMGSAAILLSNKKAANKTAKYRLVRTRRAQRAFDDKAYFSAFREEDSDGKLG  315

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L VAGETL+ +I ILG   LP++E  R   S  K+KF+ KS + YVPNFK+ I
Sbjct  316   VTLKRDLLNVAGETLRANISILGCDILPLSEKFRCGVSVIKKKFL-KSDQTYVPNFKTVI  374

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G+ V+RE  K LKL + D+E ALMTL+RFGNQSS+SLWYELAYLEAKERV K
Sbjct  375   QHFCLPCSGRPVIREIGKGLKLSERDIEPALMTLHRFGNQSSSSLWYELAYLEAKERVHK  434

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVW LGMG+GPKCNS+V QCI PI+GE +KGPWADCIH+YPI
Sbjct  435   GDKVWLLGMGSGPKCNSVVFQCISPIVGEYKKGPWADCIHQYPI  478



>ref|XP_010693652.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   521 bits (1341),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 232/402 (58%), Positives = 313/402 (78%), Gaps = 2/402 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +++VD+ C+KPPN+CRIP SSF+EH+ ++   FD +   FM KILN SG   +TYLPP+L
Sbjct  69    IFLVDFSCYKPPNYCRIPLSSFIEHVHLIN--FDKQSADFMSKILNSSGQGPETYLPPSL  126

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP R     +I E  MVLFPI + LL  + LSP DIDIL+VNCSG C  PSL +++VN
Sbjct  127   HFIPPRPTHYKSIEEAQMVLFPIMEDLLIKSNLSPLDIDILIVNCSGLCSSPSLTTLVVN  186

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             KF +R ++KTFNL+GMGCSA+ +++ + ++++  HR  N VILSTEIL+ GWY G +++ 
Sbjct  187   KFKLRPNIKTFNLSGMGCSASMISMGLAQDLLLLHRESNVVILSTEILTMGWYSGNDRSK  246

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             LVLNC+FRMGGAA+LLSN+++A++G+KY+L+W+ R Q AF DR Y +A R+EDS GLTG+
Sbjct  247   LVLNCLFRMGGAAILLSNRKKAQNGSKYRLIWNSRAQRAFIDRAYKSAFREEDSNGLTGV  306

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              LN D+L VA + ++  +  LG+  LP  E L+F+ S  ++K++ KS EIY+PNFK+ I+
Sbjct  307   TLNKDILEVASDMIRAQLIALGSFMLPALEKLKFVTSIVRKKYLKKSAEIYMPNFKTIIR  366

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             H+C P +GK V+RE  K LKLG+ DMEAAL TL+RFGNQSS+SLWYELAYLEAKERV++G
Sbjct  367   HYCLPVSGKPVIREIGKGLKLGERDMEAALATLHRFGNQSSSSLWYELAYLEAKERVREG  426

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYP  237
             ++VW LGMG+GPKC S+VL+CI+PILGE+ KGPWA CI KYP
Sbjct  427   ERVWMLGMGSGPKCTSVVLECIKPILGESNKGPWAGCIDKYP  468



>ref|XP_010248065.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=492

 Score =   520 bits (1340),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 316/404 (78%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P Y+VD+ C +PP FCR+PFS+F+EH+ MM  F D   VAFM KI+  SG  E+TYLPP+
Sbjct  85    PTYLVDFSCLRPPGFCRVPFSTFIEHVAMMKSF-DEASVAFMAKIITTSGQGEETYLPPS  143

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LHF+P R+   + + EVHMVLFP+   LL   K+SP+DIDIL+VNCSGFCP PSL+SI+V
Sbjct  144   LHFLPPRTHQLECLKEVHMVLFPVMDDLLCKTKISPRDIDILIVNCSGFCPSPSLSSIVV  203

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++AMRAD+KTFNL+GMGCSA  + +++  N++K HR   AV+LSTEI+STGWY G E++
Sbjct  204   NRYAMRADIKTFNLSGMGCSAGAIGINLASNLLKIHRNSYAVVLSTEIVSTGWYDGNERS  263

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC+FRMG AA+LL+N++EA+  +KYKL  ++RTQ AFDD+ Y +AIR+EDS+G+TG
Sbjct  264   KLLLNCLFRMGSAAILLTNRKEAEETSKYKLFRTVRTQRAFDDKAYLSAIREEDSKGITG  323

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L VAGETL+++  +LGA  LP++E +R   S  +++FI+    +YVP+F+S I
Sbjct  324   VTLTRDLLKVAGETLRSNATVLGASILPLSEKVRHSLSVLRQRFINPCKGVYVPDFRSVI  383

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +H+C P +G +V+RE  K LKL + +MEAA+MT +RFGN SS+++WYELAY+EAKE VK 
Sbjct  384   RHYCIPTSGIAVIREIGKGLKLSEEEMEAAMMTFHRFGNLSSSAMWYELAYMEAKESVKI  443

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQLGMGTGPK NS+V +C+R I  E ++GPW DCI +YPI
Sbjct  444   GDKVWQLGMGTGPKSNSVVWECLRDI-DERKRGPWYDCIDRYPI  486



>gb|KDP22365.1| hypothetical protein JCGZ_26196 [Jatropha curcas]
Length=382

 Score =   516 bits (1328),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 232/371 (63%), Positives = 303/371 (82%), Gaps = 0/371 (0%)
 Frame = -2

Query  1346  FDSKGVAFMEKILNLSGLSEQTYLPPALHFIPARSGPQDAINEVHMVLFPIFQQLLSNNK  1167
             FDS+ V+FM KIL+ SG S++TYLPPALH IP ++  Q +I EV MVLFPI Q LLS  K
Sbjct  5     FDSESVSFMAKILSSSGQSQETYLPPALHCIPPKTNQQQSIKEVQMVLFPILQDLLSKTK  64

Query  1166  LSPKDIDILVVNCSGFCPDPSLASIIVNKFAMRADVKTFNLTGMGCSANTLAVDMVRNIM  987
             +SP+DIDIL+VNCSGFCP PSL+SII+NK++MRAD+K++NL+GMGCSA  +++D+  N++
Sbjct  65    ISPRDIDILIVNCSGFCPSPSLSSIIINKYSMRADIKSYNLSGMGCSAGAISIDLAFNLL  124

Query  986   KTHRRCNAVILSTEILSTGWYPGKEKAFLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLW  807
             K  +   A+ILSTEILSTGWY G EK+ L+LNC+FRMG AA+LL+NK EAK  +KYKL  
Sbjct  125   KVQKNAYALILSTEILSTGWYSGHEKSKLLLNCLFRMGSAAILLTNKNEAKKSSKYKLFC  184

Query  806   SLRTQGAFDDRRYNAAIRDEDSEGLTGMRLNGDVLFVAGETLQTHIPILGAKFLPITEIL  627
             ++R Q A DD+ Y++AIR+EDS G  G+ L  D+L VAGETL+ +I ILG++ LP  E+L
Sbjct  185   TVRAQRASDDKSYHSAIREEDSNGRLGVTLRRDLLQVAGETLRPNITILGSRILPFPEML  244

Query  626   RFLASAFKRKFIDKSTEIYVPNFKSAIQHFCFPATGKSVVRETAKRLKLGDIDMEAALMT  447
             R++ S  + ++IDKS ++YVPNFK  IQHFC P +G+ V++E AK LKLGD ++EAALMT
Sbjct  245   RYIVSIIQNRYIDKSGQVYVPNFKRVIQHFCLPTSGRPVIKEIAKGLKLGDREVEAALMT  304

Query  446   LYRFGNQSSASLWYELAYLEAKERVKKGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKG  267
             L+RFGNQSS+S+WYELAY+EAKE+VKKG KVWQ GMGTGPKC S+V +C+RPI+GE++KG
Sbjct  305   LHRFGNQSSSSIWYELAYMEAKEKVKKGHKVWQFGMGTGPKCASVVWECLRPIIGESKKG  364

Query  266   PWADCIHKYPI  234
             PWADCI +YPI
Sbjct  365   PWADCIDRYPI  375



>gb|AGK30004.1| 3-ketoacyl-CoA synthase 21 [Gossypium raimondii]
Length=457

 Score =   518 bits (1334),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 314/404 (78%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD++C+KPP+ C++PFSSF+ H  M+  F D++ V FM K L  SGLS++TYLPPA
Sbjct  53    PVYLVDFLCYKPPSKCKVPFSSFIHHASMIEAF-DTESVEFMAKTLVSSGLSQETYLPPA  111

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH IP ++  +++INE  MVLFP+  +LLS  KLSP DIDIL++NCSGFCP PSL+SII+
Sbjct  112   LHCIPPKTHDRESINEAQMVLFPVMDELLSKTKLSPYDIDILILNCSGFCPSPSLSSIII  171

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK++M++D+K++NL+GMGCSA T+ VD+ +N++KTH    A++LSTEILSTGWY G EK 
Sbjct  172   NKYSMKSDIKSYNLSGMGCSAGTIGVDLAQNLLKTHENKTAIVLSTEILSTGWYSGHEKP  231

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC+FRMGGA +LLSNK++A++ +KYKL+ SLRTQ A+DD  Y A  R+EDS G+ G
Sbjct  232   KLILNCVFRMGGAGILLSNKKQAENTSKYKLIHSLRTQRAYDDTAYYAVYREEDSRGILG  291

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             +  N D+L    ETL++HI +LG++ LP TE    + S  ++K ID+S EIY P FK+ +
Sbjct  292   VTFNKDLLQAVSETLRSHITLLGSQILPFTEQFFHVISILRKKLIDESAEIYTPRFKTVV  351

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P++GK ++RE AK L L   ++E ALMTL+RFGNQSS+S WYEL Y+E K RVKK
Sbjct  352   QHFCLPSSGKPLIREVAKGLNLNGRNIEPALMTLHRFGNQSSSSWWYELGYMEGKWRVKK  411

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDK+W LG+GTG KC SLVL+C+RPI+ + +K PW+ CI +YPI
Sbjct  412   GDKIWVLGLGTGIKCCSLVLECLRPIVEDDKKSPWSCCIQQYPI  455



>ref|XP_010109073.1| 3-ketoacyl-CoA synthase 5 [Morus notabilis]
 gb|EXC20873.1| 3-ketoacyl-CoA synthase 5 [Morus notabilis]
Length=370

 Score =   513 bits (1321),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 230/369 (62%), Positives = 302/369 (82%), Gaps = 0/369 (0%)
 Frame = -2

Query  1331  VAFMEKILNLSGLSEQTYLPPALHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKD  1152
             +AFM KIL+ SG SE+T+LPPALH+IP +    ++I EVHM LF +   LL+   LSP+D
Sbjct  1     MAFMAKILSSSGQSEETFLPPALHYIPPKIHLHESIKEVHMSLFTVMDDLLAKTNLSPQD  60

Query  1151  IDILVVNCSGFCPDPSLASIIVNKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRR  972
             +D+L+VNCSGFCP PSL+SI+VNK+AMR+DVK+FNL+GMGCSA+ L +D+ +N++K H  
Sbjct  61    VDVLIVNCSGFCPSPSLSSIVVNKYAMRSDVKSFNLSGMGCSASALGIDLAQNLLKIHEN  120

Query  971   CNAVILSTEILSTGWYPGKEKAFLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQ  792
              NA++LSTEILS GWY G EK  L+LNC+FRMG AA+LL+NK+EAK+ +KY+L+ +LRTQ
Sbjct  121   SNAIVLSTEILSPGWYSGNEKPMLLLNCLFRMGSAAILLTNKKEAKTVSKYELIKTLRTQ  180

Query  791   GAFDDRRYNAAIRDEDSEGLTGMRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLAS  612
              AF+D+ Y +AIR+EDS G  G+ L  D+L VAGETL++++ +LG+  LP+ E LR+  S
Sbjct  181   RAFEDKAYLSAIREEDSNGNLGVTLRRDLLQVAGETLRSNVAVLGSSILPLKEKLRYGVS  240

Query  611   AFKRKFIDKSTEIYVPNFKSAIQHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFG  432
                R+F+DKS EIYVP+FK+ I+HFC P +G  V++E AK L+LG+ DMEAALMTL+RFG
Sbjct  241   VLIRRFLDKSCEIYVPDFKTVIEHFCLPTSGGPVIKEIAKGLRLGERDMEAALMTLHRFG  300

Query  431   NQSSASLWYELAYLEAKERVKKGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADC  252
             NQSS+SLWYELAYLEAKER+KKGDKVWQLGMG+GPKCNS+V +C+RPI+GE+ K PWADC
Sbjct  301   NQSSSSLWYELAYLEAKERIKKGDKVWQLGMGSGPKCNSVVWKCVRPIVGESNKSPWADC  360

Query  251   IHKYPIPLS  225
             IH+YPI  S
Sbjct  361   IHRYPIVTS  369



>ref|XP_007219157.1| hypothetical protein PRUPE_ppa016296mg [Prunus persica]
 gb|EMJ20356.1| hypothetical protein PRUPE_ppa016296mg [Prunus persica]
Length=484

 Score =   513 bits (1322),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 240/404 (59%), Positives = 312/404 (77%), Gaps = 12/404 (3%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             V +VD+ C  PP+ CR+PFS+FL +   +  F D++ +AFM K+L  SG  ++TYLPPAL
Sbjct  87    VSLVDFSCLTPPSSCRVPFSTFLGNASKIESF-DAQSLAFMAKVLTSSGQGQETYLPPAL  145

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP +S  Q++I EVHMVLFPI   LL+  K S +DIDIL+VNCSGFCP P L SI++N
Sbjct  146   HHIPPKSHHQESIKEVHMVLFPIMDDLLAKTKHSAQDIDILIVNCSGFCPSP-LCSILIN  204

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+D+K++NL+GMGCSA+ LA+D+ +N+++ H   +A++LSTEILSTGWY G E+  
Sbjct  205   KYSMRSDIKSYNLSGMGCSASALAIDLAQNLLQVHNNSDAIVLSTEILSTGWYAGHEQPK  264

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC+FR+G AA+ L+NK++    +KY+LLW+LRTQ AFDDR Y + IR+EDS G  G 
Sbjct  265   LILNCLFRIGSAAIWLTNKKQDIKSSKYQLLWTLRTQKAFDDRAYLSTIREEDSNGKLG-  323

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
                     VAGE L+ ++ +LG+  LP++E  R   S  +++F DKS EIYVPNFKSAI+
Sbjct  324   --------VAGEILRWNVTVLGSSILPLSEKFRHGVSRIRKRFTDKSAEIYVPNFKSAIE  375

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G+ +V+E AK LKLGD +MEAALMTL+RFGNQSS+SLWYELAYLEAK+RVKKG
Sbjct  376   HFCLPTSGRQLVKELAKGLKLGDGEMEAALMTLHRFGNQSSSSLWYELAYLEAKQRVKKG  435

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPI-LGEAQKGPWADCIHKYPI  234
             DKVWQLGMGTGPKC SLV +CIRPI   EA KGPWAD IH+YPI
Sbjct  436   DKVWQLGMGTGPKCTSLVWKCIRPIDDDEAMKGPWADSIHRYPI  479



>ref|XP_003601095.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES71346.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=487

 Score =   513 bits (1321),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 230/404 (57%), Positives = 311/404 (77%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C KPP  CR+PFS+F+E+  ++   FDS+ + +M+K+L  SG SE T LPP+
Sbjct  81    PIYLVDFSCLKPPRCCRVPFSAFIENASLIESCFDSESIDYMKKVLYSSGQSEDTCLPPS  140

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP ++   ++I E HMVLFPI   L +   + P DID+L++NCSGFCP PSL +I+V
Sbjct  141   LHYIPPKTKTIESIKEAHMVLFPIMDDLFAKTNILPIDIDMLILNCSGFCPSPSLTAIVV  200

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR+D+K++N++GMGCSA+ + +D+  N+++ H+  N ++LSTEILS GWYPGKE++
Sbjct  201   NKYCMRSDIKSYNVSGMGCSASAICIDLAHNLLRVHKNANVIVLSTEILSNGWYPGKERS  260

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L LNC FRMG AA+LLSNK+EA   AKYKL+ SLRTQ AFDD+ Y +  R+EDS+G  G
Sbjct  261   KLHLNCTFRMGSAAILLSNKKEASKTAKYKLVRSLRTQRAFDDKAYFSCRREEDSDGKLG  320

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + LN DV   AGETL ++I  LG++ LP++E   ++ S  K +FI KS  IYVP+FK+ I
Sbjct  321   VTLNKDVAQAAGETLLSNISTLGSEILPLSEKFWYVVSMIKERFI-KSEGIYVPDFKTVI  379

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHF  P+ G+ V+R   KRLKLG+ DMEAALMTL+RFGNQSS+SLWYELAYLEAKE+V+K
Sbjct  380   QHFILPSPGRGVIRGVGKRLKLGERDMEAALMTLHRFGNQSSSSLWYELAYLEAKEKVQK  439

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD +W LG+G+G KC S+VL+C RP LGE+ KGPW+DCIH+YPI
Sbjct  440   GDNIWLLGIGSGTKCCSVVLKCNRPKLGESNKGPWSDCIHQYPI  483



>ref|XP_003601093.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES71344.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=487

 Score =   513 bits (1321),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 230/404 (57%), Positives = 311/404 (77%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C KPP  CR+PFS+F+E+  ++   FDS+ + +M+K+L  SG SE T LPP+
Sbjct  81    PIYLVDFSCLKPPRCCRVPFSAFIENASLIESCFDSESIDYMKKVLYSSGQSEDTCLPPS  140

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP ++   ++I E HMVLFPI   L +   + P DID+L++NCSGFCP PSL +I+V
Sbjct  141   LHYIPPKTKTIESIKEAHMVLFPIMDDLFAKTNILPIDIDMLILNCSGFCPSPSLTAIVV  200

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR+D+K++N++GMGCSA+ + +D+  N+++ H+  N ++LSTEILS GWYPGKE++
Sbjct  201   NKYCMRSDIKSYNVSGMGCSASAICIDLAHNLLRVHKNANVIVLSTEILSNGWYPGKERS  260

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L LNC FRMG AA+LLSNK+EA   AKYKL+ SLRTQ AFDD+ Y +  R+EDS+G  G
Sbjct  261   KLHLNCTFRMGSAAILLSNKKEASKTAKYKLVRSLRTQRAFDDKAYFSCRREEDSDGKLG  320

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + LN DV   AGETL ++I  LG++ LP++E   ++ S  K +FI KS  IYVP+FK+ I
Sbjct  321   VTLNKDVAQAAGETLLSNISTLGSEILPLSEKFWYVVSMIKERFI-KSEGIYVPDFKTVI  379

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHF  P+ G+ V+R   KRLKLG+ DMEAALMTL+RFGNQSS+SLWYELAYLEAKE+V+K
Sbjct  380   QHFILPSPGRGVIRGVGKRLKLGERDMEAALMTLHRFGNQSSSSLWYELAYLEAKEKVQK  439

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD +W LG+G+G KC S+VL+C RP LGE+ KGPW+DCIH+YPI
Sbjct  440   GDNIWLLGIGSGTKCCSVVLKCNRPKLGESNKGPWSDCIHQYPI  483



>gb|KHN15705.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=378

 Score =   505 bits (1300),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 230/371 (62%), Positives = 300/371 (81%), Gaps = 1/371 (0%)
 Frame = -2

Query  1346  FDSKGVAFMEKILNLSGLSEQTYLPPALHFIPARSGPQDAINEVHMVLFPIFQQLLSNNK  1167
             FDS+ +AFM K+L+ SG SE+T LPP+LH+IP  +   ++I EV MVLFPI   LL+   
Sbjct  5     FDSESIAFMAKVLHSSGQSEETCLPPSLHYIPPNTDHTESIKEVQMVLFPIMDDLLAKTN  64

Query  1166  LSPKDIDILVVNCSGFCPDPSLASIIVNKFAMRADVKTFNLTGMGCSANTLAVDMVRNIM  987
             LSP DIDIL++NCSGFC  PSL SI++NK++MR D+K++N++GMGCSA+ L +D+ +N++
Sbjct  65    LSPLDIDILIINCSGFCSSPSLTSIVINKYSMRNDIKSYNISGMGCSASALCIDLAQNLL  124

Query  986   KTHRRCNAVILSTEILSTGWYPGKEKAFLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLW  807
               H+  NA++LSTEILSTGWY G EK+ L++NC+FRMG AA+LLSNK+EAK  AKY+L+ 
Sbjct  125   SVHKNSNAIVLSTEILSTGWYSGNEKSKLLINCLFRMGSAAILLSNKKEAKKTAKYRLVR  184

Query  806   SLRTQGAFDDRRYNAAIRDEDSEGLTGMRLNGDVLFVAGETLQTHIPILGAKFLPITEIL  627
             +LRTQ AFDD+ Y +AIR+EDS+G  G+ L  D+L VAGETL+T+I ILG++ L ++E  
Sbjct  185   TLRTQRAFDDKSYFSAIREEDSDGKLGVTLKRDLLQVAGETLRTNISILGSEILHLSEKF  244

Query  626   RFLASAFKRKFIDKSTEIYVPNFKSAIQHFCFPATGKSVVRETAKRLKLGDIDMEAALMT  447
              +  S  K++FI KS  IYVPNFK+ IQHFC P +G+ V+RE  K LKL + D+E ALMT
Sbjct  245   SYGVSVIKKRFI-KSEGIYVPNFKTVIQHFCLPCSGRPVIREIGKGLKLSERDIEPALMT  303

Query  446   LYRFGNQSSASLWYELAYLEAKERVKKGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKG  267
             L+RFGNQSS+SLWYELAYLEAKERV KGDKVWQLGMG+GPKCNS+VL+CIRPI+GE +KG
Sbjct  304   LHRFGNQSSSSLWYELAYLEAKERVHKGDKVWQLGMGSGPKCNSVVLKCIRPIVGEYKKG  363

Query  266   PWADCIHKYPI  234
             PWADCI++YPI
Sbjct  364   PWADCINQYPI  374



>gb|KCW90793.1| hypothetical protein EUGRSUZ_A02860 [Eucalyptus grandis]
Length=382

 Score =   500 bits (1287),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 227/377 (60%), Positives = 295/377 (78%), Gaps = 0/377 (0%)
 Frame = -2

Query  1358  MGGFFDSKGVAFMEKILNLSGLSEQTYLPPALHFIPARSGPQDAINEVHMVLFPIFQQLL  1179
             M   FD + + FM KIL  SG SE+TYLPP LH+IP R+  Q++I EVH  LFP+   LL
Sbjct  1     MMNIFDRESIDFMAKILTSSGQSEETYLPPPLHYIPPRTEFQESIKEVHTALFPVLDDLL  60

Query  1178  SNNKLSPKDIDILVVNCSGFCPDPSLASIIVNKFAMRADVKTFNLTGMGCSANTLAVDMV  999
                 + P+DIDIL+VNCSGFCP PSL+SIIVN+++MR+DVK FN++GMGC+A+ + +DM 
Sbjct  61    EKTNVHPRDIDILIVNCSGFCPSPSLSSIIVNRYSMRSDVKNFNISGMGCTASAIGIDMA  120

Query  998   RNIMKTHRRCNAVILSTEILSTGWYPGKEKAFLVLNCIFRMGGAAVLLSNKREAKSGAKY  819
             ++++K H+   AV+LSTEILSTGWY G+E+  L+LNC+FRMG AA+LL+NK +AK+ +KY
Sbjct  121   KSLLKVHKNSYAVVLSTEILSTGWYSGRERPKLLLNCLFRMGSAAILLTNKPKAKNVSKY  180

Query  818   KLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGMRLNGDVLFVAGETLQTHIPILGAKFLPI  639
             KL+ SLRTQ A +D+ Y AA  DED+EG  G+ L  D+L VAGETL++H  ILG++ LP 
Sbjct  181   KLVHSLRTQTALEDKAYYAAYLDEDAEGKLGVTLKRDLLQVAGETLRSHATILGSRVLPF  240

Query  638   TEILRFLASAFKRKFIDKSTEIYVPNFKSAIQHFCFPATGKSVVRETAKRLKLGDIDMEA  459
             TE      S F+++F+ KS +IYVPNFK+ +QHFC PA+G+ V+RE  K LKLG+ D EA
Sbjct  241   TEKFWHGLSVFRKRFVHKSCDIYVPNFKTVVQHFCLPASGRPVIREIGKGLKLGEADTEA  300

Query  458   ALMTLYRFGNQSSASLWYELAYLEAKERVKKGDKVWQLGMGTGPKCNSLVLQCIRPILGE  279
             ALMTLYRFGNQSS+SLWYELAY+EAK+RVKKGDK W LGMGTG KC SL+L+ +RPILGE
Sbjct  301   ALMTLYRFGNQSSSSLWYELAYMEAKQRVKKGDKAWLLGMGTGTKCISLILERVRPILGE  360

Query  278   AQKGPWADCIHKYPIPL  228
             ++KGPWA CIH YP+ +
Sbjct  361   SEKGPWASCIHDYPVAI  377



>gb|AGK30018.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=501

 Score =   501 bits (1290),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 310/404 (77%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ CFKPP+ C++P S F++H   +  F DS+ V FM KI+  SGLSEQTYLPPAL
Sbjct  90    VYLVDFSCFKPPSTCQLPLSRFIQHASSIISF-DSQSVEFMAKIVASSGLSEQTYLPPAL  148

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
                P ++  ++ I E  M+L P+   LL+  KLSP+ IDILV++CS FCP PSL+SIIVN
Sbjct  149   LSSPPKTHQREYIKEAEMILLPLMDDLLTKAKLSPRAIDILVIHCSAFCPSPSLSSIIVN  208

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+DVK+FNL+GMGCSA  + +D+ +N++KT+  C A+++STEILS GWY G E++ 
Sbjct  209   KYSMRSDVKSFNLSGMGCSAGAIGIDLAQNLLKTNNNCYAIVISTEILSAGWYSGHERSK  268

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L++NC+FRMG AA+LL+N++EA   +KY+L+ +LRTQ AFDD+ Y  AIR+ED +G  G+
Sbjct  269   LLINCLFRMGSAALLLTNRKEATKTSKYRLIRTLRTQTAFDDKAYLTAIREEDDDGKLGV  328

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              +N  +L  AGE L++H+ ILG K LP+TE L+ + S  ++KF DK  EIY+P+FK+AIQ
Sbjct  329   TINKGLLAAAGELLRSHMTILGLKILPLTEKLKHVVSVIRKKFKDKEGEIYMPSFKTAIQ  388

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G++++ E AK L L   D+EA+LMTL+RFGNQSS+S+WYELAY+EA+ERVKKG
Sbjct  389   HFCLPTSGRALIGEIAKGLNLDGRDVEASLMTLHRFGNQSSSSMWYELAYMEARERVKKG  448

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQK-GPWADCIHKYPI  234
             DKV  LGMGTGPKC S V +C+RPI G++ K  PW DCIH YPI
Sbjct  449   DKVLMLGMGTGPKCGSCVWECVRPIAGDSNKNNPWRDCIHLYPI  492



>gb|AGK30019.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=501

 Score =   493 bits (1269),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 308/404 (76%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ CFKPP+ C++P S F++H   +  F DS+ V FM KI+  SGLSEQTYLPPAL
Sbjct  90    VYLVDFSCFKPPSTCQLPLSRFIQHASSIISF-DSQSVEFMAKIVASSGLSEQTYLPPAL  148

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
                P ++  ++ I E  M+L P+   LL+  KLSP+DIDILV++CS FCP PSL+SIIVN
Sbjct  149   LSSPPKTHQREYIKEAEMILLPLMDDLLTKAKLSPRDIDILVIHCSAFCPSPSLSSIIVN  208

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR+DVK+FNL+GMGCS+  + +D+ +N++KT+  C A+++STEILS GWY G E++ 
Sbjct  209   KYSMRSDVKSFNLSGMGCSSGAIGIDLAQNLLKTNNNCYAIVISTEILSAGWYSGHERSK  268

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L++NC+FRMG AA+LL+N++EA   +KY+ + +LRTQ AFDD+ Y  AIR+ED +G  G+
Sbjct  269   LLINCLFRMGSAALLLTNRKEASKTSKYRFIRTLRTQTAFDDKAYLTAIREEDDDGKLGV  328

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              +N  +L  AGE L++H+ ILG K LP+TE L+ + S  ++KF DK  EIY+P+FK+AIQ
Sbjct  329   TINKGLLPAAGELLRSHMTILGLKILPLTEKLKHVVSVIRKKFKDKEGEIYMPSFKTAIQ  388

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC P +G++++ E AK L L   D+EA+LMTL+RFGNQSS+S+WYELAY+EAKERVKKG
Sbjct  389   HFCLPTSGRALIGEIAKGLNLDGRDVEASLMTLHRFGNQSSSSMWYELAYMEAKERVKKG  448

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQK-GPWADCIHKYPI  234
             DKV  LGMGTGPKC S V + +RPI G++ K  PW DCI  YPI
Sbjct  449   DKVLMLGMGTGPKCCSCVWERVRPIAGDSNKNNPWRDCIRLYPI  492



>ref|XP_003619363.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=486

 Score =   491 bits (1264),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 310/404 (77%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C KPP  CR+PFS+F+E+  ++   FDS+ + +M+K+L  SG SE+T +PP+
Sbjct  80    PIYLVDFSCLKPPRCCRVPFSTFIENASLIESCFDSESIDYMQKVLYSSGQSEETCVPPS  139

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             L +IP ++   ++I E HMVLFPI   L     + P DIDIL++NCSGFCP PSL SI+V
Sbjct  140   LLYIPPKTQNIESIKEAHMVLFPIMDDLFVKTNILPIDIDILILNCSGFCPSPSLTSIVV  199

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR+D+K++N++GMGCSA+ + +D+  N+++ H+  N ++LSTEILS GWYPGKE++
Sbjct  200   NKYCMRSDIKSYNVSGMGCSASVICIDLAHNLLRVHKNANVIVLSTEILSNGWYPGKERS  259

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L LNC FRMG AA+LLSNK+EA   AKYKL+ SLRTQ AFDD+ Y A  R+EDS+G+ G
Sbjct  260   KLHLNCSFRMGSAAILLSNKKEASKTAKYKLVRSLRTQRAFDDKAYFACRREEDSDGILG  319

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + LN DV+  AGE L ++I  LG++ LP++E   ++ S  K +FI KS  IYVP+FK+ I
Sbjct  320   VTLNKDVVQAAGEILLSNISTLGSEILPVSEKFWYVVSMIKERFI-KSEGIYVPDFKTVI  378

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHF  P  G+ V+R   KRLKLG+ DMEAA MTL+RFGNQSS+SLWYELAYLEAKE+V+K
Sbjct  379   QHFILPCPGRGVIRGVGKRLKLGERDMEAAWMTLHRFGNQSSSSLWYELAYLEAKEKVQK  438

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD +W LG+G+G KC+S++L+C RP LGE+ KGPW+DCIH+YPI
Sbjct  439   GDNIWLLGIGSGFKCSSVILKCNRPKLGESNKGPWSDCIHQYPI  482



>gb|AES75581.2| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=486

 Score =   488 bits (1257),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 308/404 (76%), Gaps = 1/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C KPP  CR+PFS+F+E+  ++   FDS+ + +M+K+L  SG SE+T +PP+
Sbjct  80    PIYLVDFSCLKPPRCCRVPFSTFIENASLIESCFDSESIDYMQKVLYSSGQSEETCVPPS  139

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             L +IP ++   ++I E HMVLFPI   L     + P DIDIL++NCSGFCP PSL SI+V
Sbjct  140   LLYIPPKTQNIESIKEAHMVLFPIMDDLFVKTNILPIDIDILILNCSGFCPSPSLTSIVV  199

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR+D+K++N++GMGCSA+ + +D+  N+++ H+  N ++LSTEILS GWYPGKE++
Sbjct  200   NKYCMRSDIKSYNVSGMGCSASVICIDLAHNLLRVHKNANVIVLSTEILSNGWYPGKERS  259

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L LNC FRMG AA+LLSNK+EA   AKYKL+ SLRTQ AFDD+ Y A  R+EDS+G+ G
Sbjct  260   KLHLNCSFRMGSAAILLSNKKEASKTAKYKLVRSLRTQRAFDDKAYFACRREEDSDGILG  319

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + LN DV+  AGE L ++I  LG++ LP++E   ++ S  K +FI KS  IYVP+FK+ I
Sbjct  320   VTLNKDVVQAAGEILLSNISTLGSEILPVSEKFWYVVSMIKERFI-KSEGIYVPDFKTVI  378

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHF  P  G+ V+R   KRLKLG+ DMEAALMTL+RFGNQSS+SLWYELAYLEAKE+V+K
Sbjct  379   QHFILPCPGRGVIRGVGKRLKLGERDMEAALMTLHRFGNQSSSSLWYELAYLEAKEKVQK  438

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD +W LG+G+G KC S+ L+C  P LGE+ KGPW+DCIH+YPI
Sbjct  439   GDNIWLLGIGSGFKCCSVFLKCNSPKLGESNKGPWSDCIHQYPI  482



>ref|XP_002267475.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Vitis vinifera]
Length=493

 Score =   487 bits (1253),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 310/403 (77%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ CFKPPN CR+PFS FLEH  M+  F DSK + FM K+L  SG  EQT+L PAL
Sbjct  85    IYIVDFSCFKPPNCCRVPFSLFLEHASMIESF-DSKSIGFMAKLLKSSGQGEQTHLSPAL  143

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             ++IP  +  Q++I EVHM+LFP+ + LLS  KLSP+DIDIL+VNC+  C  PSL+SII+N
Sbjct  144   YYIPPITHLQESIKEVHMILFPVMEDLLSKTKLSPQDIDILIVNCTSLCSSPSLSSIIIN  203

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMGCSA  L V + +N++K H+   A++LSTEI S GWY G +K+ 
Sbjct  204   KYSMRDDIKSFNLSGMGCSAGILGVHLAQNLLKVHKNSYAIVLSTEITSAGWYAGNDKSK  263

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NCIFRMGGAA+LL+N+ E K  +KY+LL ++R Q AFDD+ Y + +R+EDS G  G+
Sbjct  264   LLSNCIFRMGGAAILLTNREEMKKTSKYRLLHTVRIQRAFDDKAYLSTVREEDSNGALGV  323

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
               + D++ V  ET++++I +LG+  LP+ E  R+ AS F++++I KS E+YVP+F+  IQ
Sbjct  324   TFSHDIVQVVSETVRSNITVLGSAILPLLEKFRYRASRFRKRYIQKSAEVYVPDFRRVIQ  383

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HF  PA+G+S++ +  K L LG+ + EA+LMTL RFGNQSS+S WY LAY+EAKERVKKG
Sbjct  384   HFVLPASGRSLIIDIGKGLNLGERETEASLMTLRRFGNQSSSSSWYVLAYMEAKERVKKG  443

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVWQLGMG+GPKC S V +C+RP++ E++KGPWADCI +YPI
Sbjct  444   DKVWQLGMGSGPKCVSFVWECMRPMVEESKKGPWADCIGEYPI  486



>ref|XP_002267424.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Vitis vinifera]
 emb|CBI24530.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   485 bits (1248),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 233/403 (58%), Positives = 309/403 (77%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ CFKPPNFCR+P SSFLEH  M+  F D KG+ FM K+L  SGL EQT+L PAL
Sbjct  86    IYIVDFSCFKPPNFCRVPTSSFLEHSSMIEPF-DRKGIDFMAKLLKSSGLGEQTHLSPAL  144

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
              +IP  +  Q++I EVHMVLFP+ + LLS  KLSP+DIDIL++NCS  C  PSL+SII+N
Sbjct  145   FYIPPIAHLQESIKEVHMVLFPVMEDLLSKTKLSPRDIDILIINCSSLCSSPSLSSIIIN  204

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMGCSA  L+  + +N++K H+   A++LSTEI S GWY G +++ 
Sbjct  205   KYSMRDDIKSFNLSGMGCSAGILSTHLAQNLLKVHKNSYAIVLSTEITSAGWYAGNDRSK  264

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L++NCIFRMGGAA+LL+NK E +  +KY+LL ++R Q AFDDR Y A +R+EDS G  G+
Sbjct  265   LLVNCIFRMGGAAILLTNKEEMRKTSKYRLLQTVRIQRAFDDRAYLATVREEDSNGALGV  324

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              ++ D++ V  ET++++I ILG+  LP  E  +   S F++++I KS E+YVP+FK  IQ
Sbjct  325   SVSHDLVQVVAETVRSNIAILGSCILPFLEKFKCGVSMFRKRYISKSAEVYVPDFKKVIQ  384

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HF  PA+G+S +RE  K LKLG  D EA+LMTL RFGNQSS+S WY LAYLEAKER+KKG
Sbjct  385   HFVLPASGRSWIREIGKGLKLGKRDTEASLMTLRRFGNQSSSSSWYVLAYLEAKERMKKG  444

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVWQLG+G+GPKC S V +C RPI+GE+ KGPWADCI +YP+
Sbjct  445   DKVWQLGIGSGPKCISFVWECNRPIVGESMKGPWADCIDEYPV  487



>emb|CAN79857.1| hypothetical protein VITISV_030200 [Vitis vinifera]
Length=494

 Score =   480 bits (1236),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 231/403 (57%), Positives = 308/403 (76%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ CFKPPNFCR+P SSFLEH  M+  F D K + FM K+L  SGL EQT+L PAL
Sbjct  86    IYIVDFSCFKPPNFCRVPTSSFLEHSSMIEPF-DRKXIDFMAKLLKSSGLGEQTHLSPAL  144

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             ++IP  +  Q++I EVHMVLFP+ + LLS  KLSP+DIDIL++NCS  C  PSL+SII+N
Sbjct  145   YYIPPIAHLQESIKEVHMVLFPVMEDLLSKTKLSPRDIDILIINCSSLCSSPSLSSIIIN  204

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMGCSA  L+  + +N++K H+   A++LSTEI S GWY G +++ 
Sbjct  205   KYSMRDDIKSFNLSGMGCSAGILSTHLAQNLLKVHKNSYAIVLSTEITSAGWYAGNDRSK  264

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L++NCIFRMGGAA+LL+NK E +  +KY+LL ++R Q AFDDR Y A +R+EDS G  G+
Sbjct  265   LLVNCIFRMGGAAILLTNKEEMRKTSKYRLLQTVRIQRAFDDRAYLATVREEDSNGALGV  324

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              ++ D++ V  ET++++I ILG+  LP  E  +   S F++++I KS  +YVP+FK  IQ
Sbjct  325   SVSHDLVQVVAETVRSNIXILGSCILPFLEKFKCGVSMFRKRYISKSAXVYVPDFKKVIQ  384

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HF  PA+G+S +RE  K LKLG  D EA+LMTL RFGNQSS+S WY LAYLEAKER+KKG
Sbjct  385   HFVLPASGRSWIREIGKGLKLGKRDTEASLMTLRRFGNQSSSSSWYVLAYLEAKERMKKG  444

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVWQLG+G+GPKC S V +C RPI+GE+ KGPWADCI +YP+
Sbjct  445   DKVWQLGIGSGPKCISFVWECNRPIVGESMKGPWADCIDEYPV  487



>ref|XP_010248462.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=468

 Score =   479 bits (1234),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 298/404 (74%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C +PP FCR+P S F+E +      F+ + V FM KI+  SG  E+TY PP+L
Sbjct  61    IYMVDYSCLRPPGFCRVPLSFFVELVSN-ANIFNKETVDFMAKIITSSGQGEETYFPPSL  119

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP RS  QD+INEVHM LFP+   LLS   +SP DIDIL+VNC+ FCP PSL SIIVN
Sbjct  120   HYIPLRSHQQDSINEVHMALFPVMDDLLSKTNISPADIDILIVNCTVFCPSPSLPSIIVN  179

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             ++AMR D+KTF+L+GMGCSA+++A+ +V +++K ++  NAVILSTEILS GWYPG E++ 
Sbjct  180   RYAMRDDIKTFHLSGMGCSASSVALTLVSDLLKVYKNSNAVILSTEILSAGWYPGNERSK  239

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC FRMGGAA+LL+N+ +A+  +KYKL  ++R+Q A  D+ + + +R+EDS+G  G+
Sbjct  240   LLLNCTFRMGGAAILLTNRNKARETSKYKLFRTVRSQIASIDKAHFSVMREEDSQGKLGV  299

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKF-IDKSTEIYVPNFKSAI  546
              +N + L   G TL++HI + GA  LPI E LR+     K++  I++S +IYVPNF+S I
Sbjct  300   NINQNFLQFVGLTLRSHITLFGASILPIKEKLRYTLYVLKKRLMINQSGDIYVPNFRSVI  359

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G   +R     LKL + +MEAA+MT +RFGNQSSA++WYEL Y+EAKE VK+
Sbjct  360   QHFCLPVSGIPFIRRIGSGLKLTEREMEAAIMTFHRFGNQSSAAMWYELGYMEAKEMVKQ  419

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQLG+GTG K  S+V +C+R +L E   GPW DCI KYPI
Sbjct  420   GDKVWQLGLGTGWKAASVVWECLRDLLDEKDNGPWFDCIDKYPI  463



>ref|XP_006857988.1| hypothetical protein AMTR_s00069p00182480 [Amborella trichopoda]
 gb|ERN19455.1| hypothetical protein AMTR_s00069p00182480 [Amborella trichopoda]
Length=488

 Score =   467 bits (1201),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 214/411 (52%), Positives = 300/411 (73%), Gaps = 6/411 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+KPP+  ++P  SF+EH    G F + + V FM +++ LSG  E+T LPPA
Sbjct  76    PVYLVDFACYKPPSHLQVPLHSFMEHSSRFGCF-EKESVEFMGRVIKLSGQGERTSLPPA  134

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP R+G  D++ E HM+LF + + LL+  +++P +ID+LVVNCSGFCP PSL+S+++
Sbjct  135   LHYIPPRTGHLDSVEEAHMILFSVMEDLLAKTRVNPSEIDVLVVNCSGFCPSPSLSSMVM  194

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             ++F +R +VKTF+L GMGC A  +AVD+ + ++K      AV+LSTEI+STGWY GKE+ 
Sbjct  195   HRFKLRDNVKTFSLGGMGCGAGVIAVDVAQTLLKLCSGAQAVVLSTEIMSTGWYSGKERK  254

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+LNC+FRMGG+A LL +  +A   AKY+L   +RT     DR Y +A+R+EDSEG+TG
Sbjct  255   KLMLNCLFRMGGSAALLQSGPQAARVAKYQLRHMVRTHMGASDRGYFSAMREEDSEGITG  314

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D++ VAGE L+ +I  LG++ LP++E   +  S F ++F+D  TEIYVPNFK  I
Sbjct  315   VSLERDLMQVAGEILRMNIGALGSRVLPLSEKFWYSFSLFHKRFLDPKTEIYVPNFKLVI  374

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC P +GK+++RE  K L+L  +D+E ALMTL+RFGNQSS+SLWYELAY+EAK RVK+
Sbjct  375   HHFCIPPSGKALLRELGKGLRLKKVDLEPALMTLHRFGNQSSSSLWYELAYMEAKGRVKR  434

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPI-----LGEAQKGPWADCIHKYPIPL  228
             GD+VWQLG G+GPKCNS + +CI P+     +G    GPW DCI +YPI +
Sbjct  435   GDRVWQLGTGSGPKCNSAIWECISPVNPLAKVGSDPAGPWFDCIDEYPIAM  485



>gb|KHN02772.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=410

 Score =   459 bits (1182),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 300/404 (74%), Gaps = 33/404 (8%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C KPP+ CR+PF++FLE+  M+   FDS+ +AFM K+L+ SG SE+T LPP+
Sbjct  36    PIYLVDFSCLKPPSHCRVPFTTFLENASMLE-VFDSESIAFMAKVLHSSGQSEETCLPPS  94

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP  +   ++I E  ++L                                SL S ++
Sbjct  95    LHYIPPNTDHTESIKEWLLLLP-------------------------------SLTSTVI  123

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK++MR+D+K++N++GMGCSA+ L +D+ +N++  H   NAV+LSTEILSTGWY G EK+
Sbjct  124   NKYSMRSDIKSYNISGMGCSASALCIDLAQNLLSVHNNSNAVVLSTEILSTGWYSGNEKS  183

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L++NC+FRMG AA+LLSNK+ AK  AKY+L+ +LRTQ AFDD+ Y++AIR+EDS+G  G
Sbjct  184   KLLINCLFRMGSAAILLSNKKVAKKTAKYRLVRTLRTQRAFDDKAYSSAIREEDSDGKLG  243

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L  D+L VAGETL+ +I ILG++ LP++E   +  S  K++FI KS  IYVPNFK+ I
Sbjct  244   VTLKRDLLQVAGETLRENISILGSEILPLSEKFWYGVSVIKKRFI-KSEGIYVPNFKTVI  302

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             QHFC P +G+ V++E  K LKL + D+E ALMTL+RFGNQSS+SLWYELA+LEAKERV K
Sbjct  303   QHFCLPCSGRPVIKEIGKGLKLSERDIEPALMTLHRFGNQSSSSLWYELAHLEAKERVHK  362

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GDKVWQLGMG+GPKCNS+VL+CIRPI+GE +KGPWADCI++YPI
Sbjct  363   GDKVWQLGMGSGPKCNSVVLKCIRPIVGEYKKGPWADCINQYPI  406



>ref|XP_008812849.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Phoenix dactylifera]
Length=375

 Score =   454 bits (1169),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 205/372 (55%), Positives = 285/372 (77%), Gaps = 8/372 (2%)
 Frame = -2

Query  1346  FDSKGVAFMEKILNLSGLSEQTYLPPALHFIPARSGPQDAINEVHMVLFPIFQQLLSNNK  1167
             FD   VAFM KI+  SG+ ++T  PP+LH+IP     QD I EVHM LFP  + LL+   
Sbjct  4     FDDASVAFMTKIITTSGMGDETCFPPSLHYIPPSPTHQDCIEEVHMDLFPALEDLLAKTN  63

Query  1166  LSPKDIDILVVNCSGFCPDPSLASIIVNKFAMRADVKTFNLTGMGCSANTLAVDMVRNIM  987
             LSP+DID+LVVNCSGFCP PSL+SI+V++FAMR DVKTF ++GMGCSA  + +D+ + ++
Sbjct  64    LSPRDIDVLVVNCSGFCPSPSLSSIVVHRFAMRDDVKTFTISGMGCSAGAIGIDVAQRLL  123

Query  986   KTHRRCNAVILSTEILSTGWYPGKEKAFLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLW  807
             K HRR  AV+LSTEI+STGWY G+++  L+LNC FRMGG+AVLL+N+REAK  +KY+L+ 
Sbjct  124   KVHRRSYAVVLSTEIMSTGWYSGRDRRKLLLNCYFRMGGSAVLLTNRREAKGWSKYRLVR  183

Query  806   SLRTQGAFDDRRYNAAIRDEDSEGLTGMRLNGDVLFVAGETLQTHIPILGAKFLPITEIL  627
              +RTQ AFDD+ Y +AIR+EDSEG+TG  +  ++L V  ETL+++   +G   LP+ E L
Sbjct  184   LVRTQRAFDDKSYLSAIREEDSEGITGFSIERNLLTVVAETLRSNAVAVGTSILPLREKL  243

Query  626   RFLASAFKRKFIDKSTEIYVPNFKSAIQHFCFPATGKSVVRETAKRLKLGDIDMEAALMT  447
             R+       +  +K+     P+F++AI+H+CFP++GK+V++E  K L++G+ +ME  LMT
Sbjct  244   RYGVM----RLCNKAA---APDFRTAIKHYCFPSSGKAVMKEIGKGLRVGEREMEPGLMT  296

Query  446   LYRFGNQSSASLWYELAYLEAKERVKKGDKVWQLGMGTGPKCNSLVLQCIRPILG-EAQK  270
              +RFGNQSSAS+WY+LAY+EAK RV++G++VWQLGMGTGPKCNSLV +C+R ++  EA+K
Sbjct  297   FHRFGNQSSASMWYQLAYMEAKGRVERGERVWQLGMGTGPKCNSLVWECLRGVMAKEAEK  356

Query  269   GPWADCIHKYPI  234
             GPW DCIH+YP+
Sbjct  357   GPWEDCIHRYPV  368



>emb|CBI24529.3| unnamed protein product [Vitis vinifera]
Length=486

 Score =   441 bits (1135),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 213/401 (53%), Positives = 289/401 (72%), Gaps = 28/401 (7%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ CFKPPN CR+PFS FLEH  M+  F DSK + FM K+L  SG  EQT+L PAL
Sbjct  85    IYIVDFSCFKPPNCCRVPFSLFLEHASMIESF-DSKSIGFMAKLLKSSGQGEQTHLSPAL  143

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             ++IP  +  Q++I EVHM+LFP+ + LLS  KLSP+DIDIL+VNC+  C  PSL+SII+N
Sbjct  144   YYIPPITHLQESIKEVHMILFPVMEDLLSKTKLSPQDIDILIVNCTSLCSSPSLSSIIIN  203

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K++MR D+K+FNL+GMG                           TEI S GWY G +K+ 
Sbjct  204   KYSMRDDIKSFNLSGMG---------------------------TEITSAGWYAGNDKSK  236

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NCIFRMGGAA+LL+N+ E K  +KY+LL ++R Q AFDD+ Y + +R+EDS G  G+
Sbjct  237   LLSNCIFRMGGAAILLTNREEMKKTSKYRLLHTVRIQRAFDDKAYLSTVREEDSNGALGV  296

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
               + D++ V  ET++++I +LG+  LP+ E  R+ AS F++++I KS E+YVP+F+  IQ
Sbjct  297   TFSHDIVQVVSETVRSNITVLGSAILPLLEKFRYRASRFRKRYIQKSAEVYVPDFRRVIQ  356

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HF  PA+G+S++ +  K L LG+ + EA+LMTL RFGNQSS+S WY LAY+EAKERVKKG
Sbjct  357   HFVLPASGRSLIIDIGKGLNLGERETEASLMTLRRFGNQSSSSSWYVLAYMEAKERVKKG  416

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKY  240
             DKVWQLGMG+GPKC S V +C+RP++ E++KGPWADCI  Y
Sbjct  417   DKVWQLGMGSGPKCVSFVWECMRPMVEESKKGPWADCIASY  457



>ref|XP_010926125.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=497

 Score =   421 bits (1082),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 193/404 (48%), Positives = 283/404 (70%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PV++VDY CFKPP +CR+P +SF+EHI+++    D K V F  +IL  SGL E+TYLPPA
Sbjct  88    PVFLVDYACFKPPCYCRVPSASFMEHIRLLN-LDDPKSVQFQTRILERSGLGEETYLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              HFIP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++IV
Sbjct  147   NHFIPPNPTMEASRAEAQLVIFSAIDDLIRKTGLKPKDIDILVVNCSLFSPTPSLSAMIV  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +YPGK+++
Sbjct  207   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNALVISTEIITPNFYPGKQRS  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED +G +G
Sbjct  267   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYLCVYEEEDPQGHSG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP++E L F  +   RK I+   + Y+P+FK A 
Sbjct  327   ISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRKLINPKWKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+++
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C R I      GPWADCIH+YP+
Sbjct  447   GDRVWQIGFGSGFKCNSAVWKCNRTIKTPVD-GPWADCIHRYPV  489



>ref|XP_010916172.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=496

 Score =   420 bits (1080),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/404 (48%), Positives = 282/404 (70%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY CFKPPN CR+PF++F+EH +++  + D K V F  +IL  SGL E+T LPPA
Sbjct  88    PVYLVDYACFKPPNTCRVPFATFMEHTRLI--YSDPKSVQFQTRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E   V+F     L+    + PKDIDILVVNCS F P PSL+++IV
Sbjct  146   NHYIPPNPTMEASRAEAQFVIFSAIDDLIKKTGVKPKDIDILVVNCSLFSPTPSLSAMIV  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  L++D+ R++++ H   NA+++STEI++  +Y G ++A
Sbjct  206   NKYKLRSNIRSFNLSGMGCSAGLLSIDLARDLLQVHSNSNALVISTEIITPNFYSGNQRA  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+      AKY+L+  +RT    DDR Y     +ED+EG +G
Sbjct  266   MLLPNCLFRMGAAAILLSNRPREARRAKYRLVHVVRTHKGADDRAYRCIYEEEDAEGYSG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP++E L F  +   RK I+   + Y+P+FK A 
Sbjct  326   ISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRKLINMKWKPYIPDFKLAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+++
Sbjct  386   EHFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRR  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +CIR I      GPWADCIH+YP+
Sbjct  446   GDRVWQIGFGSGFKCNSAVWKCIRTIKTPVD-GPWADCIHRYPV  488



>ref|XP_010681548.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=492

 Score =   419 bits (1078),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/403 (48%), Positives = 279/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP+  R+PFSSF+EH  ++    + K V F  KIL  SGL E+T LPPA+
Sbjct  84    VYLVDYACYKPPSLLRVPFSSFMEHSNLI--VHNQKSVEFQMKILERSGLGEETCLPPAI  141

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A +E  +++F    +L +N +L  KD+DIL+VNCS F P PSL++++VN
Sbjct  142   HYIPPDPSMAAARHESEVIIFSCLDKLFANTRLKAKDVDILIVNCSLFSPTPSLSAMVVN  201

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ +++++ H   NA+++STEIL+  +Y G E+A 
Sbjct  202   KYKLRSNIKSFNLSGMGCSAGLISVDLAKDLLQAHANSNAIVVSTEILTPNYYRGSERAM  261

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAAVLLSNK   +  +KY+LL  +RT    DD+ +    + ED EG  G+
Sbjct  262   LLPNCLFRMGGAAVLLSNKVAYRRRSKYRLLHVVRTHKGSDDKAFKCVSQAEDKEGHVGI  321

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+T+I  +G   LP +E L FL S   RK I+   + Y+P+FK A +
Sbjct  322   SLSKDLMTIAGEALKTNITTMGPLVLPASEQLLFLLSLIGRKLINAKRKAYIPDFKQAFE  381

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+ KG
Sbjct  382   HFCIHAGGRAVIDELQKNLQLCAEHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMNKG  441

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C++ +    +  PW DCIHKYPI
Sbjct  442   DRVWQIAFGSGFKCNSAVWKCLKTVKTPIKDSPWLDCIHKYPI  484



>ref|XP_009390849.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   419 bits (1078),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 283/404 (70%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY CFKPP  CR+PFS+F+EH +++    D K V F  +IL  SGL E+T LPPA
Sbjct  88    PVYLVDYACFKPPTTCRVPFSTFMEHTRLISS--DEKSVRFQMRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP R   + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  146   NHYIPPRPTMEASRAETQLVIFSAIDDLVRKTGLRPKDIDILVVNCSLFSPTPSLSAMII  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R++V++FNL+GMGCSA  ++VD+ R++++ HR  NA+++STEI++  +Y G +++
Sbjct  206   NKYKLRSNVRSFNLSGMGCSAGLISVDLARDLLQVHRSSNALVVSTEIITPNFYAGNQRS  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y    ++ED+EG +G
Sbjct  266   MLLPNCLFRMGAAAILLSNRRRDARRAKYRLVHVVRTHKGADDRAYRCVYQEEDAEGHSG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP++E L F  +   RK I+   + Y+P+FK A 
Sbjct  326   ISLSKDLMAIAGEALKSNITTIGPLVLPMSEQLLFFLTLVGRKLINPKWKPYIPDFKLAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+++
Sbjct  386   EHFCIHAGGRAVIDELQKNLELSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMRR  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R +      GPW+DCI +YP+
Sbjct  446   GDRVWQIGFGSGFKCNSAVWKCLRTVKTPVD-GPWSDCIDRYPV  488



>gb|AIV98044.1| 3-ketoacyl-CoA synthase, partial [Malus domestica]
Length=415

 Score =   415 bits (1067),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 277/404 (69%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VDY CFKPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA
Sbjct  6     PIYLVDYACFKPPVMCRVPFSTFMEHSRLILSN-NPKSVEFQMRILERSGLGEETCLPPA  64

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP     + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++
Sbjct  65    IHYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVI  124

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A
Sbjct  125   NKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERA  184

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LLSN+R     AKY+L+  +RT    DD+ Y     +ED EG  G
Sbjct  185   MLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKEGKVG  244

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL +   RK ++   + Y+P+F+ A 
Sbjct  245   ISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLITLIGRKILNPKWKPYIPDFRQAF  304

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L     EA+ MTL+RFGN SS+SLWYEL Y+EAK R++K
Sbjct  305   EHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELGYIEAKGRMRK  364

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I   A  GPWADCI +YP+
Sbjct  365   GDRVWQIAFGSGFKCNSAVWKCNRAI-KTASDGPWADCIDRYPV  407



>ref|XP_002890689.1| hypothetical protein ARALYDRAFT_472828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66948.1| hypothetical protein ARALYDRAFT_472828 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   416 bits (1069),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 195/403 (48%), Positives = 280/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFSSF+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  84    VYLVDYSCYKPPVTCRVPFSSFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  MV+F   + L  N  L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  143   HYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA+ ++VD+VR++++ H   NAVI+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSYNLSGMGCSASLISVDVVRDLLQVHPNSNAVIISTEIITPNYYKGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN++  +  AKYKL   +RT    DD+ YN  +  ED  G  G+
Sbjct  263   LLPNCLFRMGGAAILLSNRKSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL+S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMTIAGEALKSNITTIGPLVLPASEQLLFLSSLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R+K+ 
Sbjct  383   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMKRS  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      G W+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGAWSDCIERYPV  484



>gb|AIE57499.1| KCS6 [Camelina sativa]
Length=492

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/403 (48%), Positives = 279/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFSSF+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  84    VYLVDYSCYKPPVTCRVPFSSFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P     + A NE  MV+F   + L     L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  143   HYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  ++VD+ R++++ H   NAVI+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAVIISTEIITPNYYKGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAAVLLSN+R  +  AKYKL   +RT    DD+ Y   + +ED EG  G+
Sbjct  263   LLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGADDKAYYCVMEEEDKEGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL+S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EA+ R+K+ 
Sbjct  383   HFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRN  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +CIR I      GPW+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCIRTI-KTPTDGPWSDCIERYPV  484



>gb|AAM67234.1| fatty acid condensing enzyme CUT1, putative [Arabidopsis thaliana]
Length=492

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 194/403 (48%), Positives = 278/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFSSF+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  84    VYLVDYSCYKPPVTCRVPFSSFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  MV+F   + L  N  L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  143   HYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA+ ++VD+ RN+++ H   NA+I+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSYNLSGMGCSASLISVDVARNLLQVHPNSNAIIISTEIITPNYYKGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKYKL   +RT    DD+ YN  +  ED  G  G+
Sbjct  263   LLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL+S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EA+ R+K+ 
Sbjct  383   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRN  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      G W+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGAWSDCIERYPV  484



>ref|XP_010499108.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Camelina sativa]
Length=492

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/403 (48%), Positives = 279/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFSSF+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  84    VYLVDYSCYKPPVTCRVPFSSFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P     + A NE  MV+F   + L     L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  143   HYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  ++VD+ R++++ H   NAVI+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAVIISTEIITPNYYKGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAAVLLSN+R  +  AKYKL   +RT    DD+ Y   + +ED EG  G+
Sbjct  263   LLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGADDKAYYCVMEEEDKEGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL+S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EA+ R+K+ 
Sbjct  383   HFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRS  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +CIR I      GPW+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCIRTI-KTPTDGPWSDCIERYPV  484



>ref|XP_010477925.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Camelina sativa]
Length=492

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/403 (48%), Positives = 279/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFSSF+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  84    VYLVDYSCYKPPVTCRVPFSSFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P     + A NE  MV+F   + L     L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  143   HYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  ++VD+ R++++ H   NAVI+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAVIISTEIITPNYYKGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAAVLLSN+R  +  AKYKL   +RT    DD+ Y   + +ED EG  G+
Sbjct  263   LLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGADDKAYYCVMEEEDKEGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL+S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EA+ R+K+ 
Sbjct  383   HFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRS  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +CIR I      GPW+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCIRTI-KTPTDGPWSDCIERYPV  484



>ref|XP_006307339.1| hypothetical protein CARUB_v10008957mg [Capsella rubella]
 gb|EOA40237.1| hypothetical protein CARUB_v10008957mg [Capsella rubella]
Length=492

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/403 (49%), Positives = 278/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFSSF+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  84    VYLVDYSCYKPPVTCRVPFSSFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  MV+F   + L     L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  143   HYIPPAPTMESARNEAQMVIFTAMEDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAVI+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSFNLSGMGCSAGLISVDVARDLLQVHPNSNAVIISTEIITPNYYKGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAAVLLSN+R  +  AKYKL   +RT    DD+ Y   + +ED EG  G+
Sbjct  263   LLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGADDKSYYCVMEEEDKEGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL+S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EA+ R+K+ 
Sbjct  383   HFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRS  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWSDCIDRYPV  484



>ref|XP_006841272.1| hypothetical protein AMTR_s00135p00117490 [Amborella trichopoda]
 gb|ERN02947.1| hypothetical protein AMTR_s00135p00117490 [Amborella trichopoda]
Length=498

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 193/404 (48%), Positives = 275/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VDY C+KPP  CR+PFS+FLEH +++   FDSK + F  +IL  SGL E T LPPA
Sbjct  89    PIYLVDYACYKPPVTCRVPFSTFLEHSRLLP-VFDSKSIEFQIRILERSGLGETTCLPPA  147

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+IP      DA  E  +V+F     L     + PKD+DIL+VNCS F P PSL++++V
Sbjct  148   LHYIPPDPTMADARAEAELVIFSAMDTLFKRTGIKPKDVDILIVNCSLFSPTPSLSAMVV  207

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR+++K+FNL+GMGCSA  +++D+ R++++ H    AV++STEI+S  WY G +++
Sbjct  208   NKYKMRSNIKSFNLSGMGCSAGVISIDLARDLLQVHANAYAVVVSTEIISPNWYAGNQRS  267

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LLSN+R     AKY L   +RT    DDR Y     +EDS+   G
Sbjct  268   MLLPNCLFRMGGAALLLSNRRRESRRAKYLLAHVVRTHRGADDRAYRCVYEEEDSQHNVG  327

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  328   IALSKDLMTIAGEALKSNITTMGPLVLPASEQLLFLLSLIGRKIFNPKWKPYIPDFKQAF  387

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++VV E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+E+K R+KK
Sbjct  388   EHFCIHAGGRAVVDELEKNLQLSAQHVEASRMTLHRFGNTSSSSLWYEMSYIESKGRMKK  447

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+  G+G KCNS + +C R I  E    PWADCI +YP+
Sbjct  448   GNRVWQIAFGSGFKCNSAIWKCNRSIKPETD-SPWADCIDQYPV  490



>gb|AGK29999.1| 3-ketoacyl-CoA synthase 13 [Gossypium raimondii]
Length=492

 Score =   414 bits (1065),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 279/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PF++F+EH ++     + K V F  +IL  SGL E+T LPPA+
Sbjct  84    IYLVDYACYKPPVTCRVPFATFMEHSRLNLSN-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  143   HYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y GKE+A 
Sbjct  203   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  263   LLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  323   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  383   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKKG  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I    + GPWADCIH+YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWADCIHRYPV  484



>ref|XP_009390357.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   414 bits (1064),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 281/404 (70%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+V+Y CFKPP+ CR+PFS+F+EH +++    D K V F  +IL  SGL E+T LPPA
Sbjct  88    PVYLVEYACFKPPSNCRVPFSTFMEHTRLINS--DEKSVQFQMRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  146   NHYIPPHPTMEASRAEAQLVIFSAIDDLIRKTGLKPKDIDILVVNCSLFSPTPSLSAMII  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G ++A
Sbjct  206   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPGSNALVISTEIITPNFYAGNQRA  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED+EG TG
Sbjct  266   MLLPNCLFRMGAAAILLSNRRRDAGRAKYRLVHVVRTHKGADDRAYRCVYEEEDAEGHTG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP++E L F  +   RK I+   + Y+P+FK A 
Sbjct  326   ISLSKDLMAIAGEALKSNITTIGPLVLPMSEQLLFFLTLVARKLINPKRKPYIPDFKKAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +H C  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+++
Sbjct  386   EHLCIHAGGRAVIDELQKNLELSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMRR  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R +      GPW++CIH+YP+
Sbjct  446   GDRVWQIGFGSGFKCNSAVWKCMRTV-KTPIDGPWSECIHRYPV  488



>ref|XP_009356268.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Pyrus x bretschneideri]
Length=496

 Score =   414 bits (1063),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/403 (48%), Positives = 276/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY CFKPP  CR+PFS+F+EH ++     + K V F  +IL  SGL E+T LPPA+
Sbjct  88    VYLVDYACFKPPVTCRVPFSTFMEHSRLNLSN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     +DA  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPNPTMEDARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R+I++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R     AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK ++   + Y+P+F+ A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKILNPKWKPYIPDFRLAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L     EA+ MTL+RFGN SS+SLWYEL Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELGYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I   +  GPWADCI KYP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTITTTSD-GPWADCIDKYPV  488



>ref|XP_008802438.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=497

 Score =   414 bits (1063),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 282/404 (70%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PV++VDY CFKPP+ CR+PF++F+EH +++    D K V F  +IL  SGL E+T LPPA
Sbjct  88    PVFLVDYACFKPPSSCRVPFATFMEHTRLLN-LDDPKSVQFQIRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              HFIP     + +  E  +V+F     L++   L PKDIDIL+VNCS F P PSL+++I+
Sbjct  147   NHFIPPNPTMEASRAEAQLVIFSAIDDLITKTGLKPKDIDILIVNCSLFSPTPSLSAMII  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G +++
Sbjct  207   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNALVISTEIITPNFYSGNQRS  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED++G +G
Sbjct  267   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYQCVYEEEDAQGHSG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP++E L F  +   RK I+   + Y+P+FK A 
Sbjct  327   ISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRKLINPKWKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+++
Sbjct  387   EHFCIHAGGRAVIDELQKNLHLSPEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+G G+G KCNS V +CIR I      GPWADCIH+YP+
Sbjct  447   GNRVWQIGFGSGFKCNSAVWKCIRTIKTPVD-GPWADCIHRYPV  489



>ref|NP_173916.1| 3-ketoacyl-CoA synthase 5 [Arabidopsis thaliana]
 sp|Q9C6L5.1|KCS5_ARATH RecName: Full=3-ketoacyl-CoA synthase 5; Short=KCS-5; AltName: 
Full=Very long-chain fatty acid condensing enzyme 5; Short=VLCFA 
condensing enzyme 5 [Arabidopsis thaliana]
 gb|AAG50800.1|AC079281_2 fatty acid condensing enzyme CUT1, putative [Arabidopsis thaliana]
 gb|AEE30626.1| 3-ketoacyl-CoA synthase 5 [Arabidopsis thaliana]
Length=492

 Score =   413 bits (1061),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 193/403 (48%), Positives = 278/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFSSF+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  84    VYLVDYSCYKPPVTCRVPFSSFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  MV+F   + L  N  L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  143   HYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA+ ++VD+ R++++ H   NA+I+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSYNLSGMGCSASLISVDVARDLLQVHPNSNAIIISTEIITPNYYKGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKYKL   +RT    DD+ YN  +  ED  G  G+
Sbjct  263   LLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL+S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EA+ R+K+ 
Sbjct  383   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRN  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      G W+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGAWSDCIERYPV  484



>ref|XP_009414779.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   413 bits (1061),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 279/404 (69%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY CFKPP+ CR+PF++F+EH +++    D K V F  +IL  SGL E+T LPPA
Sbjct  83    PVYLVDYACFKPPSTCRVPFATFMEHTRLINS--DKKSVQFQTRILERSGLGEETCLPPA  140

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDID+LVVNCS F P PSL+++I+
Sbjct  141   NHYIPPNPTMEASRAEAQLVIFSAIDDLMKKTGLRPKDIDVLVVNCSLFSPTPSLSAMII  200

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R++V++FNL+GMGCSA  +++D+ R+++  H R NA+++STEI++  +Y G +++
Sbjct  201   NKYKLRSNVRSFNLSGMGCSAGLISIDLARDLLLVHPRANALVVSTEIITPNFYAGNQRS  260

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L   +RT    DDR Y     +ED+EG +G
Sbjct  261   MLLPNCLFRMGAAAILLSNRRREAGRAKYRLAHVVRTHKGADDRAYRCVYEEEDAEGHSG  320

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP++E L F  +   RK I+   + Y+P+FK A 
Sbjct  321   ISLSKDLMAIAGEALKSNITTMGPLVLPMSEQLLFALNLVGRKLINPEWKPYIPDFKQAF  380

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+++
Sbjct  381   DHFCIHAGGRAVIDELQKSLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMRR  440

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+G G+G KCNS V +C+R I G    GPW DCI +YP+
Sbjct  441   GNRVWQIGFGSGFKCNSAVWKCLRTIKGPVD-GPWTDCIDRYPV  483



>ref|XP_009391408.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Musa acuminata subsp. malaccensis]
Length=499

 Score =   412 bits (1060),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 191/405 (47%), Positives = 282/405 (70%), Gaps = 3/405 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY CF+P   CR+PF++F EH ++M  FFD K V F  +IL  SGL E+T LPPA
Sbjct  88    PVYLVDYACFQPARNCRVPFATFFEHARLMP-FFDEKSVRFQVRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E H+V+F     L++   L PKDIDILVVNCS F P PSL+++I+
Sbjct  147   NHYIPPCPSMEASRAEAHLVIFSAIDDLIAKTGLKPKDIDILVVNCSLFSPTPSLSAMII  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++ +FNL+GMGCSA  ++VD+ R++++ H    A+++STEI++  +Y G E++
Sbjct  207   NKYKLRSNIMSFNLSGMGCSAGLISVDLARDLLQAHPNSYALVVSTEIITPNYYAGNERS  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AAVLLSN+R  ++ AKY+LL  +RT    DDR Y     +ED +G +G
Sbjct  267   MLLPNCLFRMGAAAVLLSNRRRERARAKYRLLHVVRTHKGADDRAYRCVYEEEDGDGNSG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFI-DKSTEIYVPNFKSA  549
             ++L+ D++ +AGE L+++I  +G   LP+TE LRFLAS   R+ +  +  + Y+P+FK A
Sbjct  327   IKLSKDLMAIAGEALRSNITDVGPLVLPVTEQLRFLASLVARRLLGSRGWKPYIPDFKRA  386

Query  548   IQHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVK  369
              +HFC  A G++V+ E    L+L    +EA+ M L+RFGN SS+SLWYELAY+EAK R++
Sbjct  387   FEHFCIHAGGRAVIDELQLNLRLSAAHVEASRMALHRFGNTSSSSLWYELAYIEAKGRMR  446

Query  368   KGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             +GD+VW +G G+G KCNS V + +R +      GPW+D IH+YP+
Sbjct  447   RGDRVWMIGFGSGFKCNSAVWRSLRTV-ATPVDGPWSDSIHRYPV  490



>gb|AGK30000.1| 3-ketoacyl-CoA synthase 5 [Gossypium raimondii]
Length=496

 Score =   412 bits (1060),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 279/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACYKPPVTCRVPFATFMEHSRLILSN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAEVVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DDR Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDRAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPGSEQLLFLLTLIGRKVFNPKWKPYIPDFKLAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++YLEAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYLEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C R I  +   GPW DCIH+YP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNRTI-KKPTDGPWEDCIHRYPV  488



>ref|XP_009356269.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Pyrus x bretschneideri]
Length=496

 Score =   412 bits (1058),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/403 (48%), Positives = 276/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY CFKPP  CR+PFS+F+EH ++     + K V F  +IL  SGL E+T LPPA+
Sbjct  88    VYLVDYACFKPPVTCRVPFSTFMEHSRLNLSN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPNPTMETARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y GKE+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN++     AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAALLLSNRKSEHRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK ++   + Y+P+F+ A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKILNPKWKPYIPDFREAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L     EA+ MTL+RFGN SS+SLWYEL Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELGYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I   +  GPWADCI KYP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTITTTSD-GPWADCIDKYPV  488



>ref|XP_008775195.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 6-like 
[Phoenix dactylifera]
Length=496

 Score =   412 bits (1058),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/406 (47%), Positives = 279/406 (69%), Gaps = 3/406 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY CFKPPN CR+P ++F+EH +++    D K V F  +IL  SGL E+T LPPA
Sbjct  88    PVYLVDYACFKPPNSCRVPXATFMEHTRLINS--DPKSVRFQTRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++IV
Sbjct  146   NHYIPPNPTMEASRAEARLVIFSAIDDLIKKTGLKPKDIDILVVNCSLFSPTPSLSAMIV  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G + +
Sbjct  206   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNALVVSTEIITPNFYSGNQPS  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+      AKY+L+  +RT    DDR Y     +ED+EG +G
Sbjct  266   MLLPNCLFRMGAAAILLSNRPREARRAKYRLVHVVRTHKGADDRAYFCVYEEEDAEGHSG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP++E L F  +   RK I+   + Y+P+FK A 
Sbjct  326   ISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRKLINSKWKPYIPDFKLAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+++
Sbjct  386   EHFCIHAGGRAVIDELQKSLQLSPEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMRR  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             GD+VWQ+G G+G KCNS V +CIR I      GPW DCIH YP+P+
Sbjct  446   GDRVWQIGFGSGFKCNSAVWKCIRTIKTPVD-GPWFDCIHHYPVPI  490



>ref|XP_008339680.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Malus domestica]
Length=496

 Score =   412 bits (1058),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/404 (47%), Positives = 276/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VDY CFKPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LP A
Sbjct  87    PIYLVDYACFKPPVMCRVPFSTFMEHSRLILSN-NPKSVEFQMRILERSGLGEETCLPXA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP     + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++
Sbjct  146   IHYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVI  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A
Sbjct  206   NKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERA  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LLSN+R     AKY+L+  +RT    DD+ Y     +ED EG  G
Sbjct  266   MLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKEGKVG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL +   RK ++   + Y+P+F+ A 
Sbjct  326   ISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLITLIGRKILNPKWKPYIPDFRQAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L     EA+ MTL+RFGN SS+SLWYEL Y+EAK R++K
Sbjct  386   EHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELGYIEAKGRMRK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I   A  GPWADCI +YP+
Sbjct  446   GDRVWQIAFGSGFKCNSAVWKCNRAI-KTASDGPWADCIDRYPV  488



>gb|KHN11421.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=460

 Score =   410 bits (1054),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  52    IYLVDYACFKPPVTCRVPFATFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  110

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L +   L PKDIDIL+VNCS F P PSL+++++N
Sbjct  111   HYIPPKPTMEAARGEAELVIFSAMDSLFTKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  170

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAV++STEI++  +Y GKE+A 
Sbjct  171   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAM  230

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+   +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  231   LLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGI  290

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  291   SLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  350

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+KKG
Sbjct  351   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKG  410

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPWADCI +YP+
Sbjct  411   DRVWQIAFGSGFKCNSAVWKCNRSIKTPVD-GPWADCIDRYPV  452



>ref|XP_009605061.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana tomentosiformis]
Length=530

 Score =   412 bits (1059),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 280/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY++DY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  122   VYLIDYSCYKPPVSCRVPFSTFMEHSRLILSS-EPKSVEFQMRILERSGLGEETCLPPAI  180

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  MV+F     L    ++ PKDIDIL+VNCS F P PSL+++++N
Sbjct  181   HYIPPAPNMESARKEAEMVIFSAMDSLFKKTRVKPKDIDILIVNCSLFSPTPSLSAMVIN  240

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR ++K+FNL+GMGCSA  +++D+ R++++ + + NAV++STEI++  +Y GK+++ 
Sbjct  241   KYKMRDNIKSFNLSGMGCSAGLISIDLARDLLQVYPKSNAVVVSTEIITPNYYRGKDRSM  300

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNK   +  AKYKLL  +RT    DD+ Y+     EDSEG  G+
Sbjct  301   LLPNCLFRMGGAAILLSNKWADQWRAKYKLLHVVRTHKGSDDKSYSCVFEVEDSEGKAGI  360

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL S   RK  +   + Y+P+FK A +
Sbjct  361   SLSKDLMAIAGEALKSNITTIGPLVLPPSEQLLFLFSLIGRKVFNLKLKPYIPDFKQAFE  420

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EA+ R+KKG
Sbjct  421   HFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELSYIEAEGRIKKG  480

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C + I      GPW+DCIHKYP+
Sbjct  481   DRIWQIAFGSGFKCNSAVWKCNKTI-KNLSDGPWSDCIHKYPV  522



>ref|XP_003555901.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
Length=496

 Score =   411 bits (1056),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACFKPPVTCRVPFATFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L +   L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDSLFTKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAV++STEI++  +Y GKE+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+   +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPWADCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRSIKTPVD-GPWADCIDRYPV  488



>gb|KHN05569.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=461

 Score =   409 bits (1052),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/405 (47%), Positives = 277/405 (68%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  53    IYLVDYACFKPPVTCRVPFATFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  111

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  112   HYIPPKPTMEAARGEAELVIFSAMDSLFDKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  171

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAV++STEI++  +Y GKE+A 
Sbjct  172   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAM  231

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+   +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  232   LLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDREGKVGI  291

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  292   SLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  351

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+KKG
Sbjct  352   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKG  411

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             D+VWQ+  G+G KCNS V +C R I      GPWADCI +YP+ +
Sbjct  412   DRVWQIAFGSGFKCNSAVWKCNRSIKTPVD-GPWADCIDRYPVDI  455



>ref|NP_001130497.1| uncharacterized protein LOC100191595 [Zea mays]
 gb|ACF78737.1| unknown [Zea mays]
Length=494

 Score =   410 bits (1055),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/404 (46%), Positives = 276/404 (68%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP  CR+PF++F+EH +++    D K V F  +IL  SGL E T LPPA
Sbjct  86    PVYLVDYACYKPPASCRVPFATFMEHTRLISD--DDKSVRFQTRILERSGLGEDTCLPPA  143

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  144   NHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  203

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  204   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNFYQGSRRD  263

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED +G +G
Sbjct  264   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGSDDRAYRCVYEEEDEQGFSG  323

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AG+ L+++I  +G   LP++E L F      RK ++K    Y+P+FK A 
Sbjct  324   ISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLVNKGWRPYIPDFKLAF  383

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+++
Sbjct  384   EHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRR  443

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R I      GPW DCIH+YP+
Sbjct  444   GDRVWQIGFGSGFKCNSAVWKCLRSI-KTPTNGPWDDCIHRYPV  486



>gb|EYU44641.1| hypothetical protein MIMGU_mgv1a005164mg [Erythranthe guttata]
Length=495

 Score =   410 bits (1054),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  87    IYLVDYSCYKPPVTCRVPFSTFMEHSRLILNQ-NPKSVDFQMRILERSGLGEETCLPPAI  145

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L+    + PKDIDIL+VNCS F P PSL++++VN
Sbjct  146   HYIPPTPTMEAARGEAELVIFSSIDSLMHKTGIKPKDIDILIVNCSLFSPTPSLSAMVVN  205

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G E+A 
Sbjct  206   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSNALVVSTEIITPNYYQGSERAM  265

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAAVLLSNKR   + AKY+L+  +RT    DD+ Y      ED +G  G+
Sbjct  266   LLPNCLFRMGGAAVLLSNKRRDAARAKYRLVHVVRTHKGADDKAYTCVYEQEDPQGKVGI  325

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  326   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKAYIPDFKLAFE  385

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  + L+L    +EA+ MTL+RFGN SS+SLWYEL Y+EAK R+KKG
Sbjct  386   HFCIHAGGRAVIDELQRNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGRMKKG  445

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I   A  GPW DCIH+YP+
Sbjct  446   DRVWQIAFGSGFKCNSAVWKCNRTIKTPAD-GPWTDCIHRYPV  487



>ref|XP_002465630.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
 gb|EER92628.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
Length=494

 Score =   410 bits (1054),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 186/404 (46%), Positives = 278/404 (69%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP  CR+PF++F+EH +++    D K V F  +IL  SGL E T LPPA
Sbjct  86    PVYLVDYACYKPPASCRVPFATFMEHTRLISD--DDKSVRFQTRILERSGLGEDTCLPPA  143

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  144   NHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  203

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  204   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNFYQGSRRD  263

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y    ++ED +G +G
Sbjct  264   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYQEEDDQGFSG  323

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AG+ L+++I  +G   LP++E L F      RK  +K+ + Y+P+FK A 
Sbjct  324   ISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLFNKAWKPYIPDFKLAF  383

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+++
Sbjct  384   EHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRR  443

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R I      GPW DCIH+YP+
Sbjct  444   GDRVWQIGFGSGFKCNSAVWKCLRSI-KTPTNGPWDDCIHRYPV  486



>ref|XP_008243224.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Prunus mume]
Length=496

 Score =   410 bits (1054),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             V++VDY CFKPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    VFLVDYACFKPPVTCRVPFSTFMEHSRLILSN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPNPTMDAARGEAELVIFSAMDALFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIRSFNLSGMGCSAGVISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAALLLSNRRSERRRAKYRLVHVVRTHKGSDDKAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK ++   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIVNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L     EA+ MTL+RFGN SS+SLWYEL Y+EAK R++KG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELGYIEAKGRMRKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I  +  +GPWADCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRSI-EKPSEGPWADCIDRYPV  488



>ref|XP_008668455.1| PREDICTED: uncharacterized protein LOC100191595 isoform X1 [Zea 
mays]
 gb|ACF87925.1| unknown [Zea mays]
 gb|ACN34702.1| unknown [Zea mays]
 tpg|DAA44124.1| TPA: hypothetical protein ZEAMMB73_292233 [Zea mays]
Length=494

 Score =   410 bits (1054),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 186/404 (46%), Positives = 276/404 (68%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP  CR+PF++F+EH +++    D K V F  +IL  SGL E T LPPA
Sbjct  86    PVYLVDYACYKPPASCRVPFATFMEHTRLISD--DDKSVRFQTRILERSGLGEDTCLPPA  143

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  144   NHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  203

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  204   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNFYQGSRRD  263

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED +G +G
Sbjct  264   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYEEEDEQGFSG  323

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AG+ L+++I  +G   LP++E L F      RK ++K    Y+P+FK A 
Sbjct  324   ISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLVNKGWRPYIPDFKLAF  383

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+++
Sbjct  384   EHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRR  443

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R I      GPW DCIH+YP+
Sbjct  444   GDRVWQIGFGSGFKCNSAVWKCLRSI-KTPTNGPWDDCIHRYPV  486



>ref|XP_003536684.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Glycine max]
Length=496

 Score =   410 bits (1054),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACFKPPVTCRVPFATFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L +   L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDSLFNKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAV++STEI++  +Y GKE+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+   +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDREGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPWADCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRSIKTPVD-GPWADCIDRYPV  488



>ref|XP_010910111.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=498

 Score =   410 bits (1054),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/404 (47%), Positives = 278/404 (69%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VDY CF+P   CR+PFS+F+EH + M  FFD K V F  +IL  SGL E+T LPPA
Sbjct  88    PIYLVDYACFRPSRTCRVPFSTFMEHARQMP-FFDEKSVRFQLRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP +S  + +  E  +V+F    +L +   L PKDIDILVVNCS F P PSL+++++
Sbjct  147   NHYIPPQSSMEASRAEASLVIFSAIDELFAKTGLKPKDIDILVVNCSLFSPTPSLSAMVI  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++ +FNL+GMGCSA  +++D+ R++++ HR   A+++STEI++  +Y G +++
Sbjct  207   NKYKLRSNILSFNLSGMGCSAGLISIDLARDLLQVHRNSYALVVSTEIITPNYYSGNQRS  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AAVLLSN+R  ++ AKY+L+  +RT    DDR Y     +ED EG  G
Sbjct  267   MLLPNCLFRMGAAAVLLSNRRRERARAKYRLVRIVRTHKGADDRSYRCVYEEEDDEGNAG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ VAG+ L+ +I  +G   LP +E L FL S   RK I  + + Y+P+FK A 
Sbjct  327   INLSKDLMAVAGDALKANITTIGPLVLPASEQLLFLLSLIGRKIIYPAWKPYIPDFKRAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L L    +EA+ M L+RFGN SS+SLWYEL Y+EAK R+++
Sbjct  387   EHFCIHAGGRAVIDELQKSLDLSAEHVEASRMALHRFGNTSSSSLWYELNYIEAKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VW +G G+G KCNS V +C+R I    + GPW+  IH+YP+
Sbjct  447   GDRVWMIGFGSGFKCNSAVWKCLRTIRTPVE-GPWSGSIHRYPV  489



>ref|XP_004299082.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   409 bits (1051),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 276/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +++VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IFLVDYACYKPPVTCRVPFSTFMEHSRLILSN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPQPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y GKE+A 
Sbjct  207   KYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R     AKY+L+  +RT    DD+ +     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRSESRRAKYRLVHVVRTHKGADDKAFRCVFEEEDREGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ +AGE L+++I  +G   LP +E L FL +   RK ++   + Y+P+FK A +
Sbjct  327   SLQKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKLVNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L     EA+ MTL+RFGN SS+SLWYEL Y+EAK R++KG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELGYIEAKGRMRKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPI-LGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I   E    PWADCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTIKTAENDDSPWADCIERYPV  490



>ref|XP_009380079.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   409 bits (1050),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 279/404 (69%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY CFKPP  CR+P ++F+EH  ++   +D K V F  +IL  SGL E+T LPPA
Sbjct  88    PVYLVDYACFKPPTTCRVPSATFMEHAWLIN--WDEKSVQFQTRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + A  E  +V+F     L     L PK+IDILVVNCS F P PSL+S+I+
Sbjct  146   SHYIPPNPTMEAARAEAQLVIFSAIDDLFKKTGLRPKNIDILVVNCSLFSPTPSLSSMII  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H R NA+++STEI++   Y G +++
Sbjct  206   NKYELRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPRSNALVISTEIITPNSYTGNQRS  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+LL  +RT    DDR Y    ++ED+EG TG
Sbjct  266   MLLPNCLFRMGAAAILLSNRRRDARRAKYRLLHVVRTHKGADDRAYRCVYQEEDAEGHTG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AGE L+++I  +G   LP++E L F  +   RK I+   + YVP+FK A 
Sbjct  326   ISLSKNLMAIAGEALKSNITTIGPLVLPMSEQLLFFLTLVGRKLINHKWKPYVPDFKLAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E    L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+++
Sbjct  386   EHFCIHAGGRAVIDELQNNLQLTAEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRR  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G +VWQ+G G+G KCNS V +C+R +      GPWADCI++YP+
Sbjct  446   GHRVWQIGFGSGFKCNSAVWKCLRTV-ETLVDGPWADCINRYPV  488



>ref|XP_008389290.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Malus domestica]
Length=496

 Score =   408 bits (1049),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 274/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PFS+F+EH ++     + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACFKPPVTCRVPFSTFMEHSRLNLSN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R     AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGNVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK ++   + Y+P+F+ A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKILNPKWKPYIPDFREAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L     EA+ MTL+RFGN SS+SLWYEL Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSXEHCEASRMTLHRFGNTSSSSLWYELGYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I   +  GPWADCI  YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTITTTSD-GPWADCIDNYPV  488



>ref|XP_004985167.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Setaria italica]
Length=494

 Score =   407 bits (1047),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 278/406 (68%), Gaps = 3/406 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP  CR+PF++F+EH +++    D K V F  +IL  SGL E T LPPA
Sbjct  86    PVYLVDYSCYKPPASCRVPFATFMEHTRLISD--DEKSVRFQTRILERSGLGEDTCLPPA  143

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  144   NHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  203

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  204   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNFYQGTRRD  263

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y    ++ED +G +G
Sbjct  264   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYQEEDDQGFSG  323

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AG+ L+++I  +G   LP++E L F      RK I+K  + Y+P+FK A 
Sbjct  324   ISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLINKKWKPYIPDFKLAF  383

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+++
Sbjct  384   EHFCIHAGGRAVIDELQKNLQLSARHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRR  443

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             GD+VWQ+G G+G KCNS V +C+R I      GPW DCI +YP+ +
Sbjct  444   GDRVWQIGFGSGFKCNSAVWKCLRSI-KTPTNGPWDDCIDRYPVDI  488



>gb|ACZ51240.1| 3-ketoacyl-CoA synthase [Arachis hypogaea]
Length=496

 Score =   407 bits (1047),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 276/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACFKPPVTCRVPFATFMEHSRLILKN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C + I      GPW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNKTI-KTPIDGPWTDCIDRYPV  488



>gb|ABA01490.1| 3-ketoacyl-CoA synthase [Gossypium hirsutum]
Length=492

 Score =   407 bits (1047),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 188/402 (47%), Positives = 276/402 (69%), Gaps = 2/402 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PF++F+EH ++     + K V F  +IL  SGL E+T LPPA+
Sbjct  84    IYLVDYACYKPPVTCRVPFATFMEHSRLNLSN-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L     L PKD+DIL+VNCS F P PSL+++++N
Sbjct  143   HYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y GKE+A 
Sbjct  203   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  263   LLPNCLFRMGGAAILLSNRRSERWRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  323   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  383   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKKG  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYP  237
             D+VWQ+  G+G KCNS V +C R I    + GPWADCI  YP
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWADCIQGYP  483



>ref|XP_010066726.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Eucalyptus grandis]
 gb|KCW64742.1| hypothetical protein EUGRSUZ_G02324 [Eucalyptus grandis]
Length=496

 Score =   407 bits (1047),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/404 (47%), Positives = 276/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             +++VDY C+KPP  CR+PFS+F+EH ++     D  K V F  +IL  SGL E+T LPPA
Sbjct  88    IFLVDYACYKPPVTCRVPFSTFMEHSRL--NLKDKPKSVEFQMRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP     + A  E  +V+F +   L     L PKDIDIL+VNCS F P PSL+++++
Sbjct  146   IHYIPPTPTMESARGEAELVIFSVMDSLFQKTGLKPKDIDILIVNCSLFSPTPSLSAMVI  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  +++D+ R+I++ H   NAVI+STEI++  +Y G E+A
Sbjct  206   NKYKLRSNIKSFNLSGMGCSAGLISLDLARDILQVHPNSNAVIVSTEIITPNYYQGNERA  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED EG  G
Sbjct  266   MLLPNCLFRMGGAAILLSNRRSDRRRAKYRLVHVVRTHKGADDKAYRCVYEEEDKEGKAG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A 
Sbjct  326   ISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+EAK R++K
Sbjct  386   EHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGRMRK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+  G+G KCNS V +C R I      GPWADCI +YP+
Sbjct  446   GNRVWQIAFGSGFKCNSAVWKCNRTI-KTPIDGPWADCIDRYPV  488



>ref|XP_009786212.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana sylvestris]
Length=496

 Score =   407 bits (1046),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+K P  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYSCYKAPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L+    L PKDIDIL+VNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMEAARGEAEVVIFSAIDDLMKKTGLKPKDIDILIVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSNALVVSTEIITPNYYKGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNKR  +  AKY+L+  +RTQ   DD+ +      ED +G  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKRRDRYRAKYRLMHVVRTQKGADDKAFKCVFEQEDPQGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RKF +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLLTLISRKFFNPKLKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWQDCIDRYPV  488



>ref|NP_001049406.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|ABF94686.1| very-long-chain fatty acid condensing enzyme, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11320.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|EAY89070.1| hypothetical protein OsI_10556 [Oryza sativa Indica Group]
 gb|EAZ26093.1| hypothetical protein OsJ_09950 [Oryza sativa Japonica Group]
 dbj|BAG90041.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96897.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97602.1| unnamed protein product [Oryza sativa Japonica Group]
Length=494

 Score =   407 bits (1046),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 279/406 (69%), Gaps = 3/406 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP  CR+PF++F+EH +++    D K V F  +IL  SGL E+T LPPA
Sbjct  86    PVYLVDYSCYKPPPSCRVPFATFMEHTRLITD--DEKSVRFQTRILERSGLGEETCLPPA  143

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  144   NHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  203

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  204   NKYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQVHPNSNALVVSTEIITPNFYWGTRRD  263

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              ++ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED +G +G
Sbjct  264   MMLPNCLFRMGAAAILLSNRRREARRAKYRLMHVVRTHKGADDRAYRCVYEEEDEQGHSG  323

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AG+ L+++I  +G   LP++E L F      RK I+K  + Y+P+FK A 
Sbjct  324   ISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLINKKWKPYIPDFKLAF  383

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+++
Sbjct  384   EHFCIHAGGRAVIDELQKNLDLSAQHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRR  443

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             GD+VWQ+G G+G KCNS V +C+R +   A  GPW DCIH+YP+ +
Sbjct  444   GDRVWQIGFGSGFKCNSAVWKCLRTVKTPAD-GPWDDCIHRYPVDI  488



>ref|XP_008446598.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Cucumis melo]
Length=496

 Score =   407 bits (1046),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 278/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +++VDY CFKPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IFLVDYACFKPPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDALFQKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     ++D EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEQDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+R+GN SS+SLWYELAY+EAK R++KG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRWGNTSSSSLWYELAYIEAKGRMRKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C + I      GPWADCI +YP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNKTIKTPVD-GPWADCIDRYPV  488



>gb|KDP29403.1| hypothetical protein JCGZ_18324 [Jatropha curcas]
Length=496

 Score =   407 bits (1046),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/404 (47%), Positives = 278/404 (69%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             +++VDY C+KPP  CR+PFS+F+EH +++    D  K V F  +IL  SGL E+T LPPA
Sbjct  88    IFLVDYACYKPPVTCRVPFSTFMEHSRLI--LKDKPKSVEFQMRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++I+
Sbjct  146   IHYIPPKPTMEAARGEAELVIFSAMDSLFQKTGLKPKDIDILIVNCSLFSPTPSLSAMII  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A
Sbjct  206   NKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERA  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED EG  G
Sbjct  266   MLLPNCLFRMGGAAILLSNRRSQQWRAKYRLVHVVRTHKGADDKAYRCVYEEEDKEGKVG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E + FL +   RK  +   + Y+P+FK A 
Sbjct  326   INLSKDLMAIAGEALKSNITTIGPLVLPASEQILFLFTLIGRKIFNPKWKPYIPDFKQAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+KK
Sbjct  386   EHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMKK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I      GPWADCI +YP+
Sbjct  446   GDRVWQIAFGSGFKCNSAVWKCNRSI-KTPLDGPWADCIDRYPV  488



>ref|XP_006344141.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=493

 Score =   407 bits (1045),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 278/404 (69%), Gaps = 3/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP   R+PFS F+EH +++    + K V F  KIL  SGL E T LPPA+
Sbjct  84    VYLVDYACYKPPLSLRVPFSIFMEHSRIILSS-EPKSVEFQLKILERSGLGEDTCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E  MV+F +   L    ++ PKDID L+VNCS F P PSL++++VN
Sbjct  143   HYIPPAPSMDTAREEAEMVIFSVMDSLFKKTQVKPKDIDFLIVNCSLFSPTPSLSAMVVN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR ++K++NL+GMGCSA  +++D+ R++++ H +  AV++STEI++  +Y GK+++ 
Sbjct  203   KYKMRDNIKSYNLSGMGCSAGLISIDLARDLLQVHPKSIAVVVSTEIITPNYYRGKDRSM  262

Query  902   LVLNCIFRMGGAAVLLSNKREA-KSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
             L+ NC+FRMGGAA+LLSNK  A +  AKYKLL ++RT    +D+ YN     EDSEG TG
Sbjct  263   LLPNCLFRMGGAAILLSNKWWADQRRAKYKLLHTVRTHKGSNDKSYNCVFETEDSEGKTG  322

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  LG   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  323   ISLSKDLMAIAGEALKSNITSLGPLVLPPSEQLLFLLSLIGRKVFNTKLKPYIPDFKQAF  382

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R+KK
Sbjct  383   EHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMKK  442

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD++WQ+  G+G KCNS V +C + I      GPW+DCIHKYP+
Sbjct  443   GDRIWQIAFGSGFKCNSAVWKCNKTI-KTPSDGPWSDCIHKYPV  485



>ref|XP_004135091.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159296.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
Length=450

 Score =   405 bits (1041),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +++VDY CFKPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  42    IFLVDYACFKPPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  100

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  101   HYIPPKPTMEAARGEAELVIFSAMDALFQKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  160

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  161   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  220

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     ++D EG  G+
Sbjct  221   LLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEQDKEGKVGI  280

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  281   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  340

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+R+GN SS+SLWYEL Y+EAK R+KKG
Sbjct  341   HFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRWGNTSSSSLWYELGYIEAKGRMKKG  400

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C + I      GPWADCI +YP+
Sbjct  401   DRIWQIAFGSGFKCNSAVWKCNKTI-KTPIDGPWADCIDRYPV  442



>ref|XP_002315942.1| ECERIFERUM 6 family protein [Populus trichocarpa]
 gb|ABK94727.1| unknown [Populus trichocarpa]
 gb|EEF02113.1| ECERIFERUM 6 family protein [Populus trichocarpa]
Length=496

 Score =   407 bits (1045),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACYKPPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R+I++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y      ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRSHRWLAKYRLVHVVRTHKGADDKAYRCVFEQEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+EAK R+++G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGRMRRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I       PWADCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDSPWADCIDRYPV  488



>ref|XP_007044356.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
 gb|EOY00188.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
Length=496

 Score =   406 bits (1043),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/403 (46%), Positives = 276/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACYKPPVTCRVPFATFMEHSRLILSN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYKGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRSERWRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ M L+RFGN SS+SLWYE++Y+EAK R+K+G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMALHRFGNTSSSSLWYEMSYIEAKGRMKRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C R I      GPWADCI +YP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWADCIDRYPV  488



>emb|CDP00616.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   406 bits (1043),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/404 (47%), Positives = 275/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP  CR+PFS F+EH +++    + K V F  +IL  SGL E+T LPPA
Sbjct  87    PVYLVDYACYKPPVTCRVPFSCFMEHSRLILST-EPKSVEFQMRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP     + A  E  MV+F     L     L  KD+DIL+VNCS F P PSL ++++
Sbjct  146   IHYIPPAPSMEAARKEAEMVIFSAVDTLFKKTGLEAKDVDILIVNCSLFSPTPSLTAMVI  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR D+K+FNL+GMGCSA  +++++ R++++++    AV++STEI++  +Y GKE++
Sbjct  206   NKYKMRGDIKSFNLSGMGCSAGMISINLARDLLQSYPNSIAVVVSTEIITPNYYQGKERS  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+ LSN+R     AKY+LL  +RT    DD+ Y     +ED EG +G
Sbjct  266   MLLPNCLFRMGGAAIFLSNRRSDSIRAKYRLLHVVRTHKGADDKAYRCVFEEEDPEGKSG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL S   RKF +   + Y+P+FK A 
Sbjct  326   ISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLISLMGRKFFNPKWKPYIPDFKQAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R++K
Sbjct  386   DHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMRK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+  G+G KCNS V +CI+ I      GPW+DCI +YP+
Sbjct  446   GNRVWQIAFGSGFKCNSAVWKCIKSI-EIPTDGPWSDCIDRYPV  488



>ref|XP_004497096.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Cicer arietinum]
Length=496

 Score =   406 bits (1043),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/403 (46%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACFKPPVTCRVPFATFMEHSRLILKN-NPKSVEFQMRILERSGLGEETSLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     LL+   L PKDIDIL++NCS F P PSL+++++N
Sbjct  147   HYIPPKPTMESARGEAELVIFSAMDSLLNKTGLKPKDIDILIINCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAIVVSTEIITPNYYKGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+      AKY+L+  +RT    DD+ +     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRGSESKRAKYRLVHVVRTHKGGDDKAFRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      G W+DCIH+YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTIKTPVD-GAWSDCIHRYPV  488



>ref|XP_004135090.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 ref|XP_004159295.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 gb|KGN52079.1| hypothetical protein Csa_5G609650 [Cucumis sativus]
Length=496

 Score =   405 bits (1042),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +++VDY CFKPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IFLVDYACFKPPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDALFQKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD+ Y     ++D EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEQDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+R+GN SS+SLWYEL Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRWGNTSSSSLWYELGYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C + I      GPWADCI +YP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNKTI-KTPIDGPWADCIDRYPV  488



>ref|XP_003614634.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES97592.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score =   405 bits (1042),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACFKPPITCRVPFATFMEHSRLILKN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   ++A  E  +V+F     L +   L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEEARREAELVIFSSMDTLFAKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ +   NAV++STEI++  +Y GKE+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVYPNSNAVVVSTEIITPNYYQGKERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNK+     AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKKAEHKRAKYRLMQVVRTHKGGDDKAYRCVFEEEDREGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ +AGE L+++I  +G   LP +E L FL +   +K  +   + Y+P+FK A +
Sbjct  327   SLQKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGKKIFNPKMKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+K+G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRSIKTPVN-GPWEDCIDRYPV  488



>ref|XP_008660394.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Zea mays]
 gb|AFW89171.1| hypothetical protein ZEAMMB73_058916 [Zea mays]
Length=494

 Score =   405 bits (1042),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 275/404 (68%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP  CR+PF++F+EH +++    D + V F  +IL  SGL E T LPPA
Sbjct  86    PVYLVDYACYKPPGSCRVPFATFMEHTRLISD--DDRSVRFQTRILERSGLGEDTCLPPA  143

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              HFIP     + +  E  +V+F     LL      PKD+DILVVNCS F P PSL++++V
Sbjct  144   NHFIPPNPSMEASRAEAQLVVFSAIDDLLRRTGTKPKDVDILVVNCSLFSPTPSLSAMVV  203

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++ +R++V++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  204   NRYKLRSNVRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNFYRGSRRD  263

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y    ++ED +G +G
Sbjct  264   MLLPNCLFRMGAAAILLSNRRREAPRAKYRLVHVVRTHKGADDRAYRCVYQEEDQQGFSG  323

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AG+ L+++I  +G   LP++E L F      RK ++   + Y+P+FK A 
Sbjct  324   ISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLLNGGWKPYIPDFKLAF  383

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+++
Sbjct  384   DHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRR  443

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R +      GPW DCIH+YP+
Sbjct  444   GDRVWQIGFGSGFKCNSAVWKCLRSV-NTPTSGPWDDCIHRYPV  486



>emb|CDP02779.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   405 bits (1041),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 276/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             VY+VDY C+KPP  CR+PFS+F+EH +++    DS K V F  +IL  SGL E+T LPPA
Sbjct  88    VYLVDYACYKPPVTCRVPFSTFMEHSRLI--LKDSPKSVDFQMRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP     +DA  E   V+F     L+    L PKDIDIL+VNCS F P PSL+++++
Sbjct  146   IHYIPPNPTMEDARAEAETVIFAAIDSLMKKTGLKPKDIDILIVNCSLFSPTPSLSAMVI  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  +++D+ R++++ +    A+++STEI++  +Y G E+A
Sbjct  206   NKYKLRSNIKSFNLSGMGCSAGIISIDLARDLLQVYPNSYALVVSTEIITPNYYKGNERA  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LLSNKR  KS AKY+L+  +RT    DD+ Y      ED +G  G
Sbjct  266   MLLPNCLFRMGGAAILLSNKRREKSRAKYRLVHVVRTHKGADDKAYRCVYEQEDPQGKVG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A 
Sbjct  326   INLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+EAK R+KK
Sbjct  386   EHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIEAKGRMKK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G +VWQ+  G+G KCNS V +C R I    + GPW DCI +YP+
Sbjct  446   GARVWQIAFGSGFKCNSAVWKCNRTIKAPME-GPWQDCIDRYPV  488



>ref|XP_003637444.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH44222.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score =   405 bits (1040),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/403 (46%), Positives = 274/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPP++
Sbjct  88    IYLVDYACFKPPVTCRVPFATFMEHSRLILKN-NPKSVEFQMRILERSGLGEETCLPPSI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMESARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA++LSN+   K  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAIMLSNRTTEKRRAKYRLVHVVRTHKGGDDKAYKCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLITLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRSI-KTPIDGPWTDCIDRYPV  488



>ref|XP_007153392.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
 gb|ESW25386.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
Length=543

 Score =   406 bits (1044),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 278/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             V++VDY CF+PP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  135   VFLVDYACFEPPVTCRVPFATFMEHSRLILKN-NPKSVEFQMRILERSGLGEETCLPPAI  193

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F   + L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  194   HYIPPKPTMEAARGEAQLVIFSAMESLFRKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  253

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  254   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQIHLNSNAVVVSTEIITPNYYQGNERAM  313

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN++   S AKY+L+  +RT    DD+ +     +ED EG  G+
Sbjct  314   LLPNCLFRMGGAAILLSNRKSESSRAKYRLVHVVRTHKGSDDKAFRCVFEEEDKEGKVGI  373

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  374   SLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLFTLIGRKIFNPRWKPYIPDFKQAFE  433

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+K+G
Sbjct  434   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKRG  493

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW+DCIH YP+
Sbjct  494   DRVWQIAFGSGFKCNSAVWKCNRSI-ETPFDGPWSDCIHSYPV  535



>gb|AAO42223.1| putative fatty acid condensing enzyme CUT1 [Arabidopsis thaliana]
Length=492

 Score =   404 bits (1039),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/403 (48%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFSSF+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  84    VYLVDYSCYKPPVTCRVPFSSFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  MV+F   + L  N  L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  143   HYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA+ ++VD+ R++++ H   NA+I+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSYNLSGMGCSASLISVDVARDLLQVHPNSNAIIISTEIITPNYYKGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKYKL   +RT    DD+ YN  +  ED  G  G+
Sbjct  263   LLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNGNVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L  L+S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMTIAGEALKANITTIGPLVLPASEQLLSLSSLIGRKIFNPKWKPYIPDFKQAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EA+ R+K+ 
Sbjct  383   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRN  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      G W+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGAWSDCIERYPV  484



>ref|XP_011099559.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Sesamum indicum]
Length=496

 Score =   405 bits (1040),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYSCYKPPVTCRVPFSTFMEHSRLILKD-NPKSVDFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L+    + PKDIDIL+VNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMEAARGEAEVVIFSTIDSLMEKTGIRPKDIDILIVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNALVISTEIITPNYYKGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+LLSNKR   + AKYKL+  +RT    DD+ Y      ED EG  G+
Sbjct  267   LLPNCLFRMGAAAILLSNKRRDSARAKYKLVHVVRTHKGADDKAYRCVYEQEDPEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKMFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWQDCIDRYPV  488



>ref|XP_006651174.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Oryza brachyantha]
Length=526

 Score =   405 bits (1042),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 277/404 (69%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP  CR+PF++F+EH +++    D K V F  +IL  SGL E+T LPPA
Sbjct  118   PVYLVDYSCYKPPPSCRVPFATFMEHTRLITD--DEKSVRFQTRILERSGLGEETCLPPA  175

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  176   NHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  235

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  236   NKYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQVHPNSNALVVSTEIITPNFYWGTRRD  295

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              ++ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED +G +G
Sbjct  296   MMLPNCLFRMGAAAILLSNRRREARRAKYRLMHVVRTHKGADDRAYRCVYEEEDEQGHSG  355

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AG+ L+++I  +G   LP++E L F      RK I+K  + Y+P+FK A 
Sbjct  356   ISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLINKKWKPYIPDFKLAF  415

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+++
Sbjct  416   EHFCIHAGGRAVIDELQKNLDLSAQHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRR  475

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R +      GPW DCIH+YP+
Sbjct  476   GDRVWQIGFGSGFKCNSAVWKCLRTVKAPT-GGPWDDCIHRYPV  518



>ref|XP_003558474.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Brachypodium distachyon]
Length=497

 Score =   404 bits (1038),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 277/404 (69%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KP    R+PF++F+EHI+++    + K + F  +IL  SGL E+T LPPA
Sbjct  89    PVYLVDYCCYKPSPSFRVPFTTFMEHIKLIAN--NEKSLRFQTRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  147   NHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  207   NRYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQVHPNSNALVISTEIITPNFYKGSRRD  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+LL  +RT    DDR Y     +ED EG +G
Sbjct  267   MLLPNCLFRMGAAAILLSNRRREAKRAKYRLLHVVRTHKGADDRAYRCVYEEEDDEGHSG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AGE L+++I  +G   LP++E L F      RK I+K  + Y+P+FK A 
Sbjct  327   ISLSKELMAIAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVINKRWKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+++
Sbjct  387   EHFCIHAGGRAVIDELQKNLELSSRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R +      GPW DCIH+YP+
Sbjct  447   GDRVWQIGFGSGFKCNSAVWKCLRTV-KTPTDGPWDDCIHRYPV  489



>ref|XP_006391129.1| hypothetical protein EUTSA_v10018446mg [Eutrema salsugineum]
 gb|ESQ28415.1| hypothetical protein EUTSA_v10018446mg [Eutrema salsugineum]
Length=497

 Score =   404 bits (1038),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/404 (47%), Positives = 275/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             VY+VDY C+KPP  CR+PF++F+EH +++    D  K V F  +IL  SGL E+T LPPA
Sbjct  89    VYLVDYSCYKPPVTCRVPFATFMEHSRLI--LKDKPKSVEFQMRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP     ++A +E  MV+F     L     L PKDIDIL+VNCS F P PSL+++++
Sbjct  147   IHYIPPTPTMEEARSEAQMVIFTAMDDLFKKTGLMPKDIDILIVNCSLFSPTPSLSAMVI  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A
Sbjct  207   NKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYKGNERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+L+SN+R  +  AKYKL   +RT    DD+ Y      ED EG  G
Sbjct  267   MLLPNCLFRMGSAAILMSNRRSDRWRAKYKLCHLVRTHRGADDKSYYCVYEQEDKEGNIG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  327   INLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIFNPKWKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R+++
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I      GPW+DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKCNRTI-KTTNDGPWSDCIDRYPV  489



>ref|XP_009598968.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana tomentosiformis]
Length=496

 Score =   404 bits (1037),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 278/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+K P  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYSCYKAPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L+   +L PKDIDIL+VNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMEAARGEAEVVIFSAVDDLMKKTRLKPKDIDILIVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSNALVVSTEIITPNYYKGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLS+KR  +  AKY+L+  +RT    DD+ +      ED +G  G+
Sbjct  267   LLPNCLFRMGGAAILLSSKRRDRYRAKYRLMHVVRTHKGADDKAFKCVFEQEDPQGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLLTLISRKIFNPKLKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K+L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKKLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I   +  GPW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTI-KTSTDGPWQDCIDRYPV  488



>gb|EPS61116.1| hypothetical protein M569_13682, partial [Genlisea aurea]
Length=504

 Score =   404 bits (1038),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  96    IYLVDYACYKPPVTCRVPFSTFMEHSRLILKD-NPKSVDFQMRILERSGLGEETCLPPAI  154

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L+    + PKDIDIL+VNCS F P PSL+++IVN
Sbjct  155   HYIPPKPNMEAARGEAEVVIFSSIDALMKKTGIKPKDIDILIVNCSLFSPTPSLSAMIVN  214

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++++FNL+GMGCSA  +++D+ R++++ H    A+++STEI++  +Y G E+A 
Sbjct  215   KYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSYALVISTEIITPNYYQGSERAM  274

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNKR     AKY+L+  +RT    DD+ Y      ED +G  G+
Sbjct  275   LLPNCLFRMGGAAILLSNKRRDGGRAKYRLVHVVRTHKGADDKAYKCVYEQEDPQGKVGI  334

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  335   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLVTLIGRKIFNPKWKPYIPDFKQAFE  394

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R+KKG
Sbjct  395   HFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSSSSLWYELAYVEAKNRMKKG  454

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C    +     GPW+DCI +YP+
Sbjct  455   DRVWQIAFGSGFKCNSAVWKC-NTTVKNPVDGPWSDCIERYPV  496



>gb|KDP38510.1| hypothetical protein JCGZ_04435 [Jatropha curcas]
Length=502

 Score =   404 bits (1038),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/406 (46%), Positives = 275/406 (68%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++ P+  + PF  F+EH ++ G F D   + F  KIL  SGL E+TY+P A
Sbjct  97    PVYLVDYACYRAPDHLKAPFDQFMEHSRLTGDF-DESSLEFQRKILERSGLGEETYVPEA  155

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A  E   V+F     L +N  ++PK+I ILVVNCS F P PSL+++IV
Sbjct  156   MHYIPPRPSMAAAREEAEQVMFGALDNLFANTNVNPKNIGILVVNCSLFNPTPSLSAMIV  215

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  216   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKS  275

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K+ +KYKL+  +RT    DDR +    +++D  G TG
Sbjct  276   MLIPNCLFRVGGSAVLLSNKSGDKNRSKYKLVHVVRTHRGADDRAFRCVYQEQDGAGKTG  335

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  LG   LPI+E L F A+   +K  +K  + Y+P+FK A 
Sbjct  336   VSLSKDLMAIAGEALKANITTLGPLVLPISEQLLFFATLVVKKLFNKKVKPYIPDFKLAF  395

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R++K
Sbjct  396   DHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYVEAKRRMRK  455

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V + +R +   A  GPW DCI KYP+ L
Sbjct  456   GNRVWQIAFGSGFKCNSAVWEALRNVKPSAN-GPWEDCIDKYPVTL  500



>gb|EYU26766.1| hypothetical protein MIMGU_mgv1a005018mg [Erythranthe guttata]
Length=500

 Score =   403 bits (1036),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/405 (47%), Positives = 274/405 (68%), Gaps = 2/405 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+  FKPP   R+ F+ F+EH +M   F + + V F  KIL  SGL EQT LPPA
Sbjct  89    PVYLVDHALFKPPASFRVSFAGFMEHARM-APFSEPRSVHFQMKILERSGLGEQTSLPPA  147

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             + +IP       A  E  +V+F     L+    + PKD+DILV+NCS F P PSL +++V
Sbjct  148   IRYIPPSPNMNLAREEAELVIFTCMDSLIRKTGVEPKDVDILVLNCSLFSPTPSLTAMVV  207

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR++VK+FNL+GMGCSA  +++D+ +++++ H   NAV++STEIL+   Y GKE+A
Sbjct  208   NKYGMRSNVKSFNLSGMGCSAGLISIDLAKDLLQHHPNSNAVVISTEILTPNSYMGKERA  267

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAAVLLSN+R  +  AKY+L   +RT    DD+ Y    ++EDSEG  G
Sbjct  268   MLLPNCLFRMGGAAVLLSNRRSDRRRAKYRLAHVVRTHKGADDKSYRCVSQEEDSEGNVG  327

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             ++LN D++ +AGE L+++I  +G   LP +E L F  S   RK I+   + Y+P+FK A 
Sbjct  328   IKLNIDLMAIAGEALKSNITTMGPLVLPASEQLLFALSFIGRKMINSKWKQYIPDFKQAF  387

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  + L+L    +EA+ M+L+RFGN SS+SLWYEL+Y+E+K R+K+
Sbjct  388   DHFCIHAGGRAVIDELQRSLRLTAEQVEASRMSLHRFGNTSSSSLWYELSYIESKGRMKR  447

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQK-GPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R +   A+  GPWADCI  YP+
Sbjct  448   GDRVWQIAFGSGFKCNSAVWKCNRTVDPTAEDGGPWADCIDNYPV  492



>ref|XP_002282526.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=496

 Score =   403 bits (1036),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/403 (46%), Positives = 276/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP   R+PF++F+EH +++      K V F  +IL  SGL E+T LP  +
Sbjct  88    IYLVDYACYKPPVMLRVPFATFMEHARLVLSS-QPKSVEFQTRILERSGLGEETCLPLTV  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP R   + A +E  +V+F     LL+   L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPRPTMEAARDEAQLVIFSAMDSLLNKTGLKPKDIDILIVNCSIFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++   Y G ++A 
Sbjct  207   KYKMRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNCYQGNQRAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             LV NC+FRMGGAA+LL+N+R     AKY+L+  +RT    DD+ Y   + +ED EG  G+
Sbjct  267   LVPNCLFRMGGAAILLTNRRWEHRRAKYRLVHVVRTHKGADDKAYRCVMEEEDPEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+T+I   G   LP +E L FL +   RK   ++ + Y+P+FK A +
Sbjct  327   SLSKDLMVIAGEALKTNITTTGPLVLPASEQLLFLLTLIGRKIFKQNWKPYIPDFKLAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  + L+L    +EA+ M L+RFGN SS+SLWYEL+Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQQNLQLSAEHVEASRMALHRFGNTSSSSLWYELSYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS + +C R I    + GPW DCIH+YP+
Sbjct  447   DRIWQIAFGSGFKCNSAIWKCNRSI-EPPRDGPWLDCIHRYPV  488



>ref|XP_006344142.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=494

 Score =   403 bits (1035),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 274/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CF PP  CRIPF+SF+EH  ++    + K V F  KIL  SGLSE+T LPPA+
Sbjct  84    IYLVDYACFLPPITCRIPFASFMEHAHLILSS-EPKSVRFQMKILERSGLSEETALPPAM  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E  +V+F     LL+   L PKDID+LVVNCS F P PSL+++++N
Sbjct  143   HYIPPTPTMDLAREEAELVIFSAMDSLLAKTGLKPKDIDVLVVNCSLFSPTPSLSAMVIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R+I++ +   NAV++STEIL+   Y GKE++ 
Sbjct  203   KYRLRSNIKSFNLSGMGCSAGVISIDLARDILQQYPNSNAVVISTEILTPNGYLGKERSM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN++  ++ AKY+L+  +RT    DD+ +    + ED EG  G+
Sbjct  263   LLTNCLFRMGGAAILLSNRKSDRARAKYRLVHIVRTHKGADDKSFRCVQQQEDPEGKVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ VAGE L+++I  +G   LP +E L FL +   RK      + Y+P+FK A +
Sbjct  323   NLCIDLMQVAGEALKSNITTIGPLVLPASEQLLFLLTLICRKLFKSKMKPYIPDFKLAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E    L+L    +EA+ M LYRFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  383   HFCIHAGGRAVIDELQNNLQLSAEHVEASRMALYRFGNTSSSSLWYEMSYIEAKGRMKKG  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPI-LGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C R I L      PWADCI +YP+
Sbjct  443   DRIWQIAFGSGFKCNSAVWKCNRTIKLPVDDHNPWADCIDRYPV  486



>ref|XP_011076851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score =   403 bits (1035),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 272/403 (67%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY  FKPP   R+ F+ F+EH ++   F + K V F  KIL  SGL E+T LPPA+
Sbjct  88    VYLVDYALFKPPRSLRVSFAGFMEHAKL-ALFTEPKSVHFQMKILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E   V+F     L     L PKD+DIL++NCS F P PSL ++++N
Sbjct  147   HYIPPSPNMAHAREEAEFVIFSCMDSLFQKTGLKPKDVDILILNCSLFSPTPSLTAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR+++K+FNL+GMGCSA  +++D+ +++++ H   NAV++STEIL+   Y GKE+A 
Sbjct  207   KYKMRSNIKSFNLSGMGCSAGLISIDLAKDLLQYHPNSNAVVISTEILTPNIYLGKERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L   +RT    DD+ Y    ++ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRADRRRAKYRLAHVVRTHKGADDKSYRCISQEEDPEGHVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
             +LN D++ +AGE L+++I  +G   LP +E + F  S   RK  +   + Y+P+FK A +
Sbjct  327   KLNIDLMAIAGEALKSNITTIGPLVLPASEQILFALSLIGRKIFNSKLKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L +  +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKSLQLTEEQVEASRMTLHRFGNTSSSSLWYELSYIESKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I    + GPWADCI KYP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTIKTPVE-GPWADCIDKYPV  488



>gb|EYU34398.1| hypothetical protein MIMGU_mgv1a005204mg [Erythranthe guttata]
Length=493

 Score =   402 bits (1033),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/405 (47%), Positives = 273/405 (67%), Gaps = 3/405 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP   R+PFS+F+EH ++     + K V F  +IL  SGL E+T LPPA+
Sbjct  82    IYLVDYACYKPPVTFRVPFSTFMEHSRL-NLKENPKSVDFQMRILERSGLGEETCLPPAI  140

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E  +V+F     L+    L PKDIDIL+VNCS F P PSL+++IVN
Sbjct  141   HYIPPTPTMDAARGEAELVIFSTIDSLMEKTNLKPKDIDILIVNCSLFSPTPSLSAMIVN  200

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H    A+I+STEI++  +Y G E+A 
Sbjct  201   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSRALIVSTEIITPNYYKGSERAM  260

Query  902   LVLNCIFRMGGAAVLLSNKREAKSG-AKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
             L+ NC+FRMGGAA+LLSNKR   +  +KYKL+  +RT    DD+ Y      ED EG  G
Sbjct  261   LLPNCLFRMGGAAILLSNKRRRDAARSKYKLVHVVRTHKGADDKAYKCVYEQEDPEGKVG  320

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A 
Sbjct  321   INLSKDLMLIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAF  380

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+EAK R+KK
Sbjct  381   EHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGRMKK  440

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPI-LGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R + +     GPW DCIH+YP+
Sbjct  441   GDRVWQIAFGSGFKCNSAVWKCNRTVRIDSDGDGPWQDCIHRYPV  485



>ref|XP_009115318.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Brassica rapa]
Length=497

 Score =   402 bits (1033),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 275/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             +Y+VDY CFKPP  CR+PF++F+EH ++     DS K V F  +IL  SGL E+T LPPA
Sbjct  89    IYLVDYSCFKPPVTCRVPFATFMEHSRL--NLIDSPKSVEFQMRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP       A +E  +V+F     L     L PKDIDIL+VNCS F P PSL+++I+
Sbjct  147   IHYIPPTPTMDAARSEAELVIFTAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMII  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+ NL+GMGCSA+ ++VD+ R++++ H   NAVI+STEI++  +Y GKE+A
Sbjct  207   NKYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAVIVSTEIITPNYYQGKERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R  +  AKYKL   +RT    +D+ Y    + ED E   G
Sbjct  267   MLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGAEDKSYYCVYQQEDDESHVG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + LN D++ +AGE L+++I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  327   INLNKDLMAIAGEALKSNITTIGPLVLPASEQLLFLTSLIGRKIFNAKWKPYIPDFKMAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK ++K+
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGKMKR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +  R I     +GPW+DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKSNRTI-KTPTEGPWSDCIDRYPV  489



>emb|CDY04232.1| BnaC06g25830D [Brassica napus]
Length=497

 Score =   402 bits (1033),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 275/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             VY+VDY C+KPP  CR+PF++F+EH +++    DS K V F  +IL  SGL E+T LPPA
Sbjct  89    VYLVDYSCYKPPVTCRVPFATFMEHSRLI--LKDSPKSVEFQMRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP      +A +E  MV+F     L     L PKDIDIL+VNCS F P PSL+++++
Sbjct  147   IHYIPPTPTMDEARSEAQMVIFTAMDDLFKKTGLLPKDIDILIVNCSLFSPTPSLSAMVI  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAVI+STEI++  +Y G E+A
Sbjct  207   NKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEIITPNYYKGNERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+L+SN+R  +  AKYKL   +RT    DD+ Y      ED EG  G
Sbjct  267   MLLPNCLFRMGSAAILMSNRRSDRWRAKYKLCHLVRTHRGADDKSYYCVYEQEDREGKIG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  327   INLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIFNLKWKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+++
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELCYIESKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  489



>ref|XP_008801160.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Phoenix dactylifera]
Length=528

 Score =   403 bits (1035),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 278/404 (69%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VDY CF+P   CR+PFS+F+EH + +  FFD K V F  +IL  SGL E+T LPPA
Sbjct  118   PIYLVDYACFRPSQTCRVPFSTFMEHARQIP-FFDEKSVRFQLRILERSGLGEETCLPPA  176

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP +   + +  E  +V+F    +L +   L+PKDIDILVVNCS F P PSL+++++
Sbjct  177   NHYIPPQGSMEASRAEASLVIFSAVDELFAKTGLNPKDIDILVVNCSLFSPTPSLSAMVI  236

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++ +FNL+GMGCSA  +++D+ R++++  R   A+++STEI++  +Y G  ++
Sbjct  237   NKYKLRSNIVSFNLSGMGCSAGLISIDLARDLLQVRRNSYALVVSTEIITPNYYMGNRRS  296

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG +AVLLSN+R  ++ AKY+L+  +RT    DDR Y+    +ED E  +G
Sbjct  297   MLLPNCLFRMGCSAVLLSNRRRERARAKYRLVRVVRTHKGADDRSYHCVYEEEDDECNSG  356

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ VAG+ L+ +I  +G   LP +E LRFL S   RK I+ + + Y+P+FK A 
Sbjct  357   INLSKDLMAVAGDALKDNITTIGPLVLPASEQLRFLLSLIGRKIINPAFKPYIPDFKRAF  416

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L L    +EA+ M L+RFGN SS+SLWYEL Y+EAK R+++
Sbjct  417   EHFCIHAGGRAVIDELQKSLDLSAEHVEASRMALHRFGNTSSSSLWYELNYIEAKGRMRR  476

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VW +G G+G KCNS V +C+R I      GPW+  IH+YP+
Sbjct  477   GDRVWMIGFGSGFKCNSAVWKCLRTITTPVD-GPWSSSIHRYPV  519



>ref|XP_011097190.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score =   402 bits (1032),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 272/403 (67%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+K P  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACYKAPVTCRVPFSTFMEHSRLILKD-NPKSVHFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L+    + PKDIDIL+VNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMEAARGEAEVVIFSCIDSLMQKTGIKPKDIDILIVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSNALVISTEIITPNYYKGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNK      AKYKL+  +RT    DD+ Y      ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKSRDSRRAKYKLVHVVRTHKGADDKAYKCVYEQEDPEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMLIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTIKTPVD-GPWVDCIERYPV  488



>ref|XP_006842379.1| hypothetical protein AMTR_s00079p00192440 [Amborella trichopoda]
 gb|ERN04054.1| hypothetical protein AMTR_s00079p00192440 [Amborella trichopoda]
Length=462

 Score =   400 bits (1029),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/404 (46%), Positives = 273/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VDY C+KPP   R+P S FLEH+++   F D + V F  +IL  SGL E+T +PPA
Sbjct  51    PIYLVDYTCYKPPGTYRVPRSFFLEHLKLSPSF-DPESVKFQFRILERSGLGERTCVPPA  109

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH+I       DA  E  +V+F     L     + P+D+D L+VNCS F P PSL+ +++
Sbjct  110   LHYIAPDPTMADARAEAELVIFSAMDALFERTGIKPQDVDFLIVNCSMFSPTPSLSDMVI  169

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR+++K+FNL+GMGCS + ++V++ R++++ H    AV++STEI++  WY G +++
Sbjct  170   NKYKMRSNIKSFNLSGMGCSPSPISVNIARDLLQVHANAYAVVVSTEIVTPNWYTGNQRS  229

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG A +LLSN+R     AKY+L+  +RT    DDR Y+   ++ED +   G
Sbjct  230   MLLPNCLFRMGAATLLLSNRRRESRRAKYRLMHVVRTHRGADDRAYHCVFQEEDVQRNVG  289

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL S F RK  +   + Y+P+FK A 
Sbjct  290   ISLSKDLMGIAGEALKSNITTMGPLVLPASEQLLFLLSLFARKIFNLKLKPYIPDFKQAF  349

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE+ Y+EAK R+KK
Sbjct  350   EHFCIHAGGRAVIDELEKNLQLSPEHVEASRMTLHRFGNTSSSSLWYEMNYIEAKGRMKK  409

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+ WQ+G G+G KCNSLV +C R I  EA  GPWADCI +YP+
Sbjct  410   GDRSWQIGFGSGFKCNSLVWKCNRSIKAEAD-GPWADCIDQYPV  452



>ref|XP_007142908.1| hypothetical protein PHAVU_007G027100g [Phaseolus vulgaris]
 gb|ESW14902.1| hypothetical protein PHAVU_007G027100g [Phaseolus vulgaris]
Length=496

 Score =   402 bits (1032),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPP++
Sbjct  88    IYLVDYACFKPPVTCRVPFATFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPSI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L +   L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDSLFTKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+   +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRSNERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+K+G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      G W+DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRNIKTPVD-GAWSDCIDRYPV  488



>emb|CDY42109.1| BnaA09g28510D [Brassica napus]
Length=497

 Score =   402 bits (1032),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 275/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             +Y+VDY CFKPP  CR+PF++F+EH ++     DS K V F  +IL  SGL E+T LPPA
Sbjct  89    IYLVDYSCFKPPVTCRVPFATFMEHSRL--NLIDSPKSVEFQMRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP       A +E  +V+F     L     L PKDIDIL+VNCS F P PSL+++I+
Sbjct  147   IHYIPPTPTMDAARSEAELVIFTAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMII  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+ NL+GMGCSA+ ++VD+ R++++ H   NAVI+STEI++  +Y GKE+A
Sbjct  207   NKYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAVIVSTEIITPNYYQGKERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R  +  AKYKL   +RT    +D+ Y    + ED E   G
Sbjct  267   MLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGAEDKSYYCVYQQEDDESHVG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + LN D++ +AGE L+++I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  327   INLNKDLMAIAGEALKSNITTIGPLVLPASEQLLFLTSLIGRKIYNAKWKPYIPDFKMAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK ++K+
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGKMKR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +  R I     +GPW+DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKSNRTI-KTPTEGPWSDCIDRYPV  489



>ref|XP_009762000.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana sylvestris]
Length=498

 Score =   402 bits (1032),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 277/403 (69%), Gaps = 1/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CF+PPN  R P +SF+EH Q++    + K V F  K+L  SGL E+T LPPA+
Sbjct  89    IYLVDYACFRPPNMFRAPSASFVEHAQLILPT-EPKSVRFQMKMLERSGLGEETALPPAI  147

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E  +V+F I   LL   +L+PK IDIL+VNCS F P PSL+++++N
Sbjct  148   HYIPPTPTMVLAREEAELVIFSIMDSLLEKTRLNPKFIDILIVNCSLFSPTPSLSAMLIN  207

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ +   NAV++STEI++   Y GKE++ 
Sbjct  208   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQHYPNSNAVVISTEIITPNSYLGKERSM  267

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+ LSN++  +  AKY+L+  +RT    DD+ +    + ED EG  G+
Sbjct  268   LLPNCLFRMGGAAIFLSNRKSDQRRAKYRLVHVVRTHKGADDKSFRCVQQQEDPEGKVGI  327

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ VAGE L+++I  +G   LP +E L FL +  +RK   K+++ YVP+FK A +
Sbjct  328   NLCIDLMQVAGEALKSNITTIGPLVLPASEQLLFLLTFIRRKIFKKNSKPYVPDFKLAFE  387

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTLYRFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  388   HFCIHAGGRAVIDELQKSLQLSAEHVEASRMTLYRFGNTSSSSLWYEMSYIEAKGRMKKG  447

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C R I       PWADCI +YP+
Sbjct  448   DRIWQIAFGSGFKCNSAVWKCNRTIKTPVTHSPWADCIDRYPV  490



>ref|XP_004238923.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=494

 Score =   401 bits (1031),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 275/404 (68%), Gaps = 3/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP   R+ FS F+EH +++    + K V F  KIL  S L E T LPPA+
Sbjct  85    VYLVDYACYKPPLSLRVSFSIFMEHSRIILSS-EPKSVEFQLKILERSCLGEDTCLPPAI  143

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E  MV+F +   L    +L PKDIDIL+VNCS F P PSL++++VN
Sbjct  144   HYIPPAPSLDTAREEAQMVIFSVMDSLFKKTELKPKDIDILIVNCSLFSPTPSLSAMVVN  203

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR +VK++NL+GMGCSA  +++D+ R++++ H +  AV++STEI++  +Y GK+++ 
Sbjct  204   KYKMRDNVKSYNLSGMGCSAGLISIDLARDLLRVHPKSIAVVVSTEIITPNYYRGKDRSM  263

Query  902   LVLNCIFRMGGAAVLLSNKREAK-SGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
             L+ NC+FRMGGAA+LLSNK       AKYKLL ++RT    +D+ YN     EDSEG TG
Sbjct  264   LLPNCLFRMGGAAILLSNKWWIDLRRAKYKLLHTVRTHKGSNDKSYNCVYETEDSEGKTG  323

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  LG   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  324   ISLSKDLMAIAGEALKSNITSLGPLVLPPSEQLLFLLSLIGRKVFNTKLKPYIPDFKQAF  383

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R+KK
Sbjct  384   EHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMKK  443

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD++WQ+  G+G KCNS V +C + I      GPW+DCIHKYP+
Sbjct  444   GDRIWQIAFGSGFKCNSAVWKCNKTI-ETPTDGPWSDCIHKYPV  486



>ref|XP_009597817.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana tomentosiformis]
Length=496

 Score =   401 bits (1031),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 276/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+K P  CR+PFS+F+EH +++    + + V F  +IL  SGL E+T LPPA 
Sbjct  88    IYLVDYSCYKAPVTCRVPFSTFMEHSRLILKD-NPESVKFQMRILERSGLGEETCLPPAC  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  +V+F     L+    L PKDIDIL+VNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMESARNEAEVVIFSAIDNLMKKTGLKPKDIDILIVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++     +A+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSSALVVSTEIITPNYYQGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNKR+  S AKY+L+  +RT    DD+ Y      ED +G  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKRKDSSRAKYRLMHVVRTHKGADDKAYRCVFEQEDPQGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L D  +EA+ MTL+RFGN SS+SLWYE++Y+EAK R++KG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSDEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMRKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNRTI-KTGTDGPWEDCIDRYPV  488



>ref|XP_009356710.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Pyrus x bretschneideri]
Length=496

 Score =   401 bits (1031),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 272/404 (67%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VDY CFKPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E    PPA
Sbjct  87    PIYLVDYACFKPPVTCRVPFSTFMEHSRLILSN-NPKSVEFQMRILERSGLGESPCPPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP     +DA  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++
Sbjct  146   IHYIPPNPTMEDARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSAMVI  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  +++D+ R+I++ H   NAV++STEI++  +Y G E+A
Sbjct  206   NKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNAVVVSTEIITPNYYQGNERA  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LLSN+R     AKY+L+  +RT    DD+ Y     +ED EG  G
Sbjct  266   MLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKEGKVG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL +   RK ++   + Y+P+F+ A 
Sbjct  326   ISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKILNPKWKPYIPDFRLAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L     EA+ MTL+RFGN SS+SLWYEL Y+EAK R++K
Sbjct  386   EHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELGYIEAKGRMRK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +    I   A  GPW DCI +YP+
Sbjct  446   GDRVWQIAFGSGFKCNSAVWKGNGAI-KTASDGPWVDCIDRYPV  488



>ref|XP_010692961.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score =   401 bits (1030),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/405 (47%), Positives = 278/405 (69%), Gaps = 4/405 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQM-MGGFFDSKGVAFMEKILNLSGLSEQTYLPP  1269
             PVY+VDY  FKPP   R+PF++F+EH ++ + G  D K V F  +IL  SGL E+T LPP
Sbjct  81    PVYLVDYALFKPPYIFRVPFATFMEHNRLNLKG--DQKAVEFQMRILERSGLGEETCLPP  138

Query  1268  ALHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASII  1089
             A+H++      + A NE  MV+F     LL    +  KDIDIL+VNCS F P PSL++++
Sbjct  139   AIHYLNPNPTMEAARNEAEMVIFSAVDDLLKKTGVKTKDIDILIVNCSLFSPTPSLSAMV  198

Query  1088  VNKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEK  909
             VNK+ +R+++K+FNL+GMGCS + ++VD+ R++++ H    A+++STEI++  +Y GKE+
Sbjct  199   VNKYKLRSNIKSFNLSGMGCSCSPISVDLARDLLQVHPNSYALVISTEIITPNYYQGKER  258

Query  908   AFLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLT  729
             A L+ NC+FRMG AA+LLSNKR+ K  +KY+LL  +RT    DD+ +    ++ED EG  
Sbjct  259   AMLLPNCLFRMGCAAMLLSNKRKEKKRSKYQLLHVIRTHKGADDKAFKVVYQEEDPEGKV  318

Query  728   GMRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSA  549
             G+ L  D++ +AG+ L+++I  +G   LP +E + FL S   RK  +   + Y+P+FK A
Sbjct  319   GISLQKDLMAIAGDALKSNITTMGPLVLPTSEQVLFLFSLIGRKIFNPKWKPYIPDFKQA  378

Query  548   IQHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVK  369
              +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R+K
Sbjct  379   FEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMK  438

Query  368   KGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             KGD+VWQ+  G+G KCNS + +C R I    + GPW DCIH+YP+
Sbjct  439   KGDRVWQIAFGSGFKCNSAIWKCNRTIKAPTE-GPWDDCIHRYPV  482



>ref|XP_009105040.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Brassica rapa]
 emb|CDY07381.1| BnaA07g24600D [Brassica napus]
Length=497

 Score =   400 bits (1029),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/404 (47%), Positives = 275/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             VY+VDY C+KPP  CR+PF++F+EH +++    DS K V F  +IL  SGL E+T LPPA
Sbjct  89    VYLVDYSCYKPPVTCRVPFATFMEHSRLI--LKDSPKSVEFQMRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP      +A +E  MV+F     L     L PKDIDIL+VNCS F P PSL+++++
Sbjct  147   IHYIPPTPTMDEARSEAQMVIFTAMDDLFKKTGLLPKDIDILIVNCSLFSPTPSLSAMVI  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAVI+STEI++  +Y G E+A
Sbjct  207   NKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEIITPNYYKGNERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+L+SN+R  +  AKYKL   +RT    DD+ +      ED EG  G
Sbjct  267   MLLPNCLFRMGSAAILMSNRRSDRWRAKYKLCHLVRTHRGADDKSFYCVYEQEDREGKIG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  327   INLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIFNLKWKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+++
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELCYIESKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  489



>ref|XP_008800778.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=414

 Score =   397 bits (1021),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 265/404 (66%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+KPP   R PFS F+ H +     F+   + F  KIL  SGL E T LPPA
Sbjct  6     PVYLVDFACYKPPASSRFPFSKFMNHSKQ-NEVFEPSSIEFQRKILERSGLGEDTSLPPA  64

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H IP       +  E  +V+F +   L    K+ P+DIDILVVNCS F P PSL+++IV
Sbjct  65    HHVIPFAPTMAKSREESELVIFSVVDSLFRKTKVKPRDIDILVVNCSLFSPTPSLSAMIV  124

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR+++++FNL+GMGCSA  +++D+ R+ +  H   NA++++TEI++  WY G  ++
Sbjct  125   NKYKMRSNIRSFNLSGMGCSAGIISIDLARDELLVHANSNALVVTTEIITEHWYIGNRRS  184

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              LV NC+FRMGGAAVLLSNKR+ K  AKY+LL  +RT    DDR Y    ++ED E   G
Sbjct  185   MLVANCLFRMGGAAVLLSNKRQKKRKAKYELLHLVRTHRGADDRAYRCVYQEEDGEK-KG  243

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D+  +AG  L+ +I  LG   LP++E + F  +   R+F +     YVP+F  A 
Sbjct  244   VSLSKDLTAIAGSALKANIAALGPLVLPLSEQILFFLNMVGRRFANPKWRPYVPDFTKAF  303

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A GK+V+ E   +L+L +   EA+ MTL+RFGN SS+S WYEL Y+EAK R++K
Sbjct  304   DHFCIHAGGKAVIEEMGTKLRLSEEQTEASRMTLHRFGNTSSSSPWYELGYVEAKGRMRK  363

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G+G+G KCNS V +C R + G  ++G WADCI +YP+
Sbjct  364   GDRVWQMGLGSGFKCNSAVWRCRRSV-GREEEGAWADCIDQYPV  406



>ref|XP_009627040.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nicotiana tomentosiformis]
Length=516

 Score =   401 bits (1031),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 275/406 (68%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+K P+  + P+  F++H ++ G F D   + F  KIL  SGL ++TY+P A
Sbjct  111   PVYLVDYSCYKAPDELKAPYERFMQHSRLTGDF-DESSLEFQRKILERSGLGDETYVPEA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H++P +   Q A  E   V+F     L +N  + PKDI +LVVNCS F P PSL+++IV
Sbjct  170   MHYLPPQPSMQAARGEAEQVMFGALDNLFANTSVKPKDIGVLVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  230   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAAVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG
Sbjct  290   MLIPNCLFRVGGAAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K  +K  + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLIIKKICNKHVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R++K
Sbjct  410   DHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRK  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G+KVWQ+  G+G KCNS V Q +R +   +QKGPW DCI +YP+ +
Sbjct  470   GNKVWQIAFGSGFKCNSAVWQALRNV-KPSQKGPWEDCIDRYPVKV  514



>ref|XP_006415873.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
 gb|ESQ34226.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
Length=496

 Score =   400 bits (1029),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/404 (47%), Positives = 276/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             VY+VDY C+KPP  CR+PF++F+EH ++     D+ K V F  +IL  SGL E+T LPPA
Sbjct  88    VYLVDYSCYKPPVTCRVPFATFMEHSRL--NLKDNPKSVEFQMRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP     + A +E  MV+F     L     L PKDIDIL+VNCS F P PSL+++++
Sbjct  146   IHYIPPIPTMESARSEAEMVIFTAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVI  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+ NL+GMGCSA  ++VD+ R++++ H   NAVI+STEI++  +Y GKE+A
Sbjct  206   NKYKLRSNIKSLNLSGMGCSAGLISVDVARDLLQVHPNSNAVIVSTEIITPNYYQGKERA  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R  +  AKYKL   +RT    +D+ +      +D EG  G
Sbjct  266   MLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHKGAEDKSFYCVYEQQDKEGHVG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG+ L+++I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  326   INLSKDLMAIAGDALKSNITTIGPLVLPASEQLLFLTSLIGRKIFNPKWKPYIPDFKMAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R+K+
Sbjct  386   EHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMKR  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  446   GDRVWQIAFGSGFKCNSAVWKCNRTIKSPTE-GPWSDCIDRYPV  488



>gb|AHX25585.1| 3-ketoacyl-CoA synthase 6 [Nicotiana tabacum]
Length=497

 Score =   400 bits (1028),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 276/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CF+PPN  R P +SF+EH Q++    + K V F  K+L  SGL E+T LPPA+
Sbjct  89    IYLVDYACFRPPNMFRAPSASFVEHAQLILPT-EPKSVRFQMKMLERSGLGEETALPPAI  147

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E  +V+F I   LL   +L+PK IDIL+VNCS F P PSL+++++N
Sbjct  148   HYIPPTPTMVLAREEAELVIFSIMDSLLEKTRLNPKFIDILIVNCSLFSPTPSLSAMLIN  207

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ +   NAV++STEI++   Y GKE++ 
Sbjct  208   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQHYPNSNAVVISTEIITPNSYLGKERSM  267

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNKR+  S AKY+L+  +RT    DD+ Y      ED +G  G+
Sbjct  268   LLPNCLFRMGGAAILLSNKRKDSSRAKYRLMHVVRTHKGADDKAYRCVFEQEDPQGKVGI  327

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  328   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFE  387

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L D  +EA+ MTL+RFGN SS+SLWYE++ +EAK R++KG
Sbjct  388   HFCIHAGGRAVIDELRKNLQLSDEHVEASRMTLHRFGNTSSSSLWYEMSCMEAKGRMRKG  447

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  448   DRVWQIAFGSGFKCNSAVWKCNRTI-KTGTDGPWEDCIDRYPV  489



>ref|XP_002311457.1| hypothetical protein POPTR_0008s11920g [Populus trichocarpa]
 gb|EEE88824.1| hypothetical protein POPTR_0008s11920g [Populus trichocarpa]
Length=496

 Score =   400 bits (1028),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 182/403 (45%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPP++
Sbjct  88    IYLVDYACYKPPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPSI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     + PKDIDIL+VNCS F P PSL+++I+N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDSLFKKTGIKPKDIDILIVNCSLFSPTPSLSAMIIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNANAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGG+A+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGSAILLSNRRSHRWSAKYRLVHVVRTHKGVDDKAYRCVFEEEDREGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + ++P+FK A +
Sbjct  327   NLSKDLMTIAGEALKSNITTIGPLVLPASEQLLFLLTLVGRKIFNPKWKPFIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E K R+++G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEEKGRMRRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             ++VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   NRVWQIAFGSGFKCNSAVWKCNRTIKTPVD-GPWVDCIDRYPV  488



>ref|XP_011007926.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Populus euphratica]
Length=495

 Score =   400 bits (1027),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 272/403 (67%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  ++L  SGL E+T LPPA+
Sbjct  88    IYLVDYACYKPPVTCRVPFSTFMEHSRLILKD-NPKSVDFQMRVLERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R+I++ H   N V++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNVVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +  AKY+L+  +RT    DD  Y      ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRSHRWFAKYRLVHVVRTHKGADDIAYRCVYEQEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +E + MTL+RFGN SS+SLWYEL Y+EAK R+++G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEPSRMTLHRFGNTSSSSLWYELGYIEAKGRMRRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I       PWADCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDSPWADCIDRYPV  488



>ref|XP_009784659.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana sylvestris]
Length=496

 Score =   400 bits (1027),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+K P  CR+PFS+F+EH +++    + + V F  +IL  SGL E+T LPPA 
Sbjct  88    IYLVDYSCYKAPVTCRVPFSTFMEHSRLILKD-NPESVKFQMRILERSGLGEETCLPPAC  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     L+    L PKDIDIL+VNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMESARTEAEVVIFSAIDNLMKKTGLKPKDIDILIVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++     +A+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSSALVVSTEIITPNYYQGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNKR+  S AKY+L+  +RT    DD+ Y      ED +G  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKRKDSSRAKYRLMHVVRTHKGADDKAYRCVFEQEDPQGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L D  +EA+ MTL+RFGN SS+SLWYE++Y+EAK R++KG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSDEHVEASRMTLHRFGNTSSSSLWYEMSYMEAKGRMRKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTI-KTGTDGPWEDCIDRYPV  488



>ref|XP_003531926.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
 gb|KHN14249.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=496

 Score =   400 bits (1027),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +++VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IFLVDYACFKPPVTCRVPFATFMEHSRLILKN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E   V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAEHVVFSAVDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAVI+STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVIVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+++ +  AKY+L+  +RT    +++ +     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRKQERKRAKYRLVHVVRTHKGSNEKAFRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITSMGPLVLPASEQLLFLLTLIGRKIFNPRWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL Y+E+K R+K+G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPWADCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWRCNRSI-QTPFDGPWADCIDRYPV  488



>ref|XP_006829706.1| hypothetical protein AMTR_s00126p00068780 [Amborella trichopoda]
 gb|ERM97122.1| hypothetical protein AMTR_s00126p00068780 [Amborella trichopoda]
Length=451

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/403 (46%), Positives = 273/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY++D+ C++PP+  RIP S+F+EH  ++   +DS  + F EK+L  SGL  +T +PP +
Sbjct  43    VYLIDFCCYRPPDMYRIPMSTFMEHT-VLNEAWDSASIEFQEKVLERSGLGYETCMPPTI  101

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
               +PA       + E+ MV FPI +++L++N++SPK IDILV NCS +C  PS ++++VN
Sbjct  102   SHLPADHSVTGGLEELKMVAFPIIEEVLTSNRVSPKCIDILVTNCSLYCHTPSFSAMVVN  161

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             +F MR++VKTF+L GMGCSA  L++ + R+++  H    A+++S EILS+  Y GKEK+ 
Sbjct  162   RFGMRSNVKTFSLAGMGCSAGLLSISLARDLLGVHTNSLALVVSMEILSSNGYTGKEKSM  221

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             LV NC+FRMGGAA+LLSN+R+ +  AKYKL   +RT    DDR Y+   +D D+EG  G+
Sbjct  222   LVTNCLFRMGGAAILLSNRRQNRPSAKYKLQHLVRTHMGADDRAYHCVFQDTDTEGAVGV  281

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+  +  VA   L+T+I  LG   LP+TE  R+  SA ++      +++Y+PNF SA Q
Sbjct  282   ALSRGLPHVAANALRTNIATLGPLVLPLTEQARYALSAARKALWAAKSQLYIPNFGSAFQ  341

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+    + LKL    +EA+ MTL+RFGN SS+S+WYEL YLEAK +VK+G
Sbjct  342   HFCIHAGGRAVIDAIEENLKLSKEQVEASKMTLFRFGNTSSSSIWYELCYLEAKGKVKRG  401

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DK+WQ+  G+G KCNS V +CI  + G  +   W+D I +YP+
Sbjct  402   DKIWQIAFGSGFKCNSAVWKCISDLEGRPENA-WSDRIDRYPV  443



>ref|XP_008800772.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=488

 Score =   399 bits (1026),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/407 (46%), Positives = 266/407 (65%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C+KPP  CR PFS F+ H       F+   + F  KIL  SGL E T LPPA
Sbjct  78    PIYLVDFACYKPPASCRFPFSKFMNH-STKNEVFEPSSIEFQRKILERSGLGEDTSLPPA  136

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H IP       +  E  +VLF +   L    K+ P+DIDILVVNCS F P PSL+++IV
Sbjct  137   HHVIPFTPTMAKSREESELVLFSVVDSLFRKTKVKPRDIDILVVNCSLFSPTPSLSAMIV  196

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR ++++FNL+GMGCSA  +++D+ R+ +  H   NA++++TEI++  WY G  ++
Sbjct  197   NKYKMRGNIRSFNLSGMGCSAGIISIDLARDELLVHANSNALVVTTEIITEQWYTGNRRS  256

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAAVLLSNKR+ K  AKY+LL  +RT    DDR Y    ++ED E   G
Sbjct  257   MLLANCLFRMGGAAVLLSNKRQEKRKAKYELLHVVRTHHGADDRAYRCVYQEEDDEKKIG  316

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D+  +AG  L+ +I  LG   LP++E + F  +   R+F +     YVP+F+ A 
Sbjct  317   VSLSRDLTAIAGAALKANIAALGPLVLPLSEQVLFFLNTLGRRFANPKWRPYVPDFRKAF  376

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A GK+V+ +   +L+L +   EA+ MTL+RFGN SS+S WYEL Y+EAK R++K
Sbjct  377   DHFCIHAGGKAVILDMGTKLRLSEEQTEASRMTLHRFGNTSSSSPWYELGYVEAKGRMRK  436

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             GD+VWQ+G+G+G KCNS V +C R + G  ++  WADCI +YP+ ++
Sbjct  437   GDRVWQIGLGSGFKCNSAVWRCRRSV-GREEEEAWADCIDQYPVQVA  482



>ref|XP_006416504.1| hypothetical protein EUTSA_v10007370mg [Eutrema salsugineum]
 gb|ESQ34857.1| hypothetical protein EUTSA_v10007370mg [Eutrema salsugineum]
Length=520

 Score =   400 bits (1028),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/407 (45%), Positives = 278/407 (68%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ PP+  + PF+ F++H ++ G F DS  + F  KIL  SGL E TY+P A
Sbjct  115   PVYLVDFSCYLPPDHLKAPFTRFMDHSRLTGDFDDS-ALEFQRKILERSGLGEDTYVPEA  173

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H++P R     A  E   V+F     L +N  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  174   MHYVPPRISMAAAREEAEQVMFGALDNLFANTNVNPKDIGILVVNCSLFNPTPSLSAMIV  233

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR+  AV++STE ++  WY G +K+
Sbjct  234   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRKTYAVVVSTENITQNWYFGNKKS  293

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  AKY+L+  +RT    DD+ +    +++D  G TG
Sbjct  294   MLIPNCLFRVGGSAVLLSNKSRDKRRAKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  353

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  354   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVAKKLFNGKVKPYIPDFKLAF  413

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  414   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  473

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS + + +R +   ++K PW DCI KYP+ LS
Sbjct  474   GNRVWQIAFGSGFKCNSAIWEALRNV-KPSKKSPWEDCIDKYPVKLS  519



>ref|XP_009777704.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana sylvestris]
Length=496

 Score =   399 bits (1026),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY++DY C KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    VYLIDYSCDKPPVSCRVPFSTFMEHSRLILSS-EPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  MV+F     L     + PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPAPNMESARKEAEMVIFSAMDSLFKKTGVKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR ++K+FNL+GMGCSA  +++D+ R++++ + +  AV+++TEI++  +Y GK+++ 
Sbjct  207   KYKMRDNIKSFNLSGMGCSAGLISIDLARDLLQVYPKSKAVVVNTEIITPNYYRGKDRSM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNK   +  AKYKLL  +RT    DD+ Y      EDSEG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKWADQWRAKYKLLHVVRTHKGADDKSYRCVFEVEDSEGKAGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL S   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPPSEQLLFLFSLIGRKVFNLKLKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWY L+Y+EAK R+K+G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYVLSYIEAKGRMKEG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C + I      GPW+DCIHKYP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNKTI-KNLSDGPWSDCIHKYPV  488



>ref|XP_002510394.1| acyltransferase, putative [Ricinus communis]
 gb|EEF52581.1| acyltransferase, putative [Ricinus communis]
Length=502

 Score =   399 bits (1026),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/406 (46%), Positives = 273/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++ P+  + PF  F+EH ++ G F D   + F  KIL  SGL E TY+P A
Sbjct  97    PVYLVDYSCYRAPDHLKAPFGRFMEHSKLTGDF-DESSLEFQRKILERSGLGEDTYVPEA  155

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A  E   V+F     L +N  ++PK+I ILVVNCS F P PSL++IIV
Sbjct  156   MHYIPPRPSMAAAREEAEQVMFGALDNLFANTNVNPKNIGILVVNCSLFNPTPSLSAIIV  215

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  216   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKS  275

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAAVLLSN+   +  AKYKL+  +RT    DD+ +    +++D  G TG
Sbjct  276   MLIPNCLFRVGGAAVLLSNRSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTG  335

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  LG   LPI+E L F A+   +K  +K  + Y+P+FK A 
Sbjct  336   VSLSKDLMAIAGEALKANITTLGPLVLPISEQLLFFATLVVKKLFNKKMKPYIPDFKLAF  395

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R++K
Sbjct  396   DHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYVEAKRRMRK  455

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V + +R +   +  GPW DCI KYP+ L
Sbjct  456   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSPNGPWEDCIDKYPVKL  500



>ref|XP_006302169.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
 gb|EOA35067.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
Length=498

 Score =   399 bits (1025),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 273/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PF++F+EH +++      K V F  +IL  SGL E+T LPPA+
Sbjct  90    IYLVDYSCYKPPVTCRVPFATFMEHSRLILKD-KPKSVEFQMRILERSGLGEETCLPPAI  148

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A +E  MV+F     L     L PKD+DIL+VNCS F P PSL+++++N
Sbjct  149   HYIPPTPTMDAARSEAQMVIFTAMDDLFEKTGLKPKDVDILIVNCSLFSPTPSLSAMVIN  208

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A 
Sbjct  209   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERAM  268

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+L+SN+R  +  AKYKL   +RT    DD+ +      ED EG  G+
Sbjct  269   LLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGADDKSFFCVYEQEDREGHVGI  328

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A +
Sbjct  329   NLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIFNPKLKPYIPDFKLAFE  388

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R+++G
Sbjct  389   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMRRG  448

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  449   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  490



>gb|ABG35744.1| putative very long chain fatty acid condensing enzyme CUT1;3 
[Hordeum vulgare]
Length=501

 Score =   399 bits (1025),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 276/404 (68%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PV++VDY C+KP    R+PF++F+EHI+++    + K + F  +IL  SGL E+T LPPA
Sbjct  93    PVFLVDYCCYKPSPSFRVPFTTFMEHIKLISN--NDKSLRFQTRILERSGLGEETCLPPA  150

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    + PKDIDILVVNCS F P PSL+++I+
Sbjct  151   NHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGIKPKDIDILVVNCSLFSPTPSLSAMII  210

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  211   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVISTEIITPNFYHGSRRD  270

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED EG +G
Sbjct  271   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYEEEDDEGHSG  330

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AGE L+++I  +G   LP++E L F      RK I+K  + Y+P+FK A 
Sbjct  331   ISLSKELMAIAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVINKKWKPYIPDFKLAF  390

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R++K
Sbjct  391   EHFCIHAGGRAVIDELQKNLELSPRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRK  450

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R +      GPW DCI +YP+
Sbjct  451   GDRVWQIGFGSGFKCNSAVWKCLRTV-NTPTDGPWDDCIQRYPV  493



>ref|XP_010104374.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
 gb|EXB99937.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
Length=513

 Score =   399 bits (1026),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/404 (46%), Positives = 272/404 (67%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++ P+  + PF  F+ H ++ G F DS  + F  KIL  SGL E+TY+P A
Sbjct  108   PVYLVDYSCYRAPDNLKAPFDRFMTHSELTGDFDDS-SLEFQRKILERSGLGEETYVPEA  166

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +HFIP R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  167   MHFIPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIV  226

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  227   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKS  286

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAAVLLSNK   +  AKY+L+  +RT    DD+ +    +++D  G TG
Sbjct  287   MLIPNCLFRVGGAAVLLSNKSMDRRRAKYRLVHVVRTHKGADDKAFRCVYQEQDDAGKTG  346

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +KF +   + Y+P+FK A 
Sbjct  347   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVVKKFFNADVKPYIPDFKLAF  406

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EA+ R+++
Sbjct  407   DHFCIHAGGRAVIDELEKNLQLSQVHVEASRMTLHRFGNTSSSSIWYELAYTEAQGRMRR  466

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+  G+G KCNS V Q +R +   ++ GPW DCI KYP+
Sbjct  467   GNRVWQIAFGSGFKCNSAVWQALRNV-KPSRNGPWEDCIDKYPV  509



>ref|XP_009336207.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Pyrus x bretschneideri]
Length=446

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 275/406 (68%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  + P+  F+EH ++   F DS  + F  KIL  SGL E+TY+P A
Sbjct  41    PVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDS-SLEFQRKILVRSGLGEETYVPEA  99

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A +E   V++     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  100   MHYIPPRPSMAAARDEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFNPTPSLSAMIV  159

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  160   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENITQNWYFGNKKS  219

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D +G TG
Sbjct  220   MLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDKGKTG  279

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F +S    K    + + Y+P+FK A 
Sbjct  280   VSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSIVVNKLFKSNVKPYIPDFKLAF  339

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R++K
Sbjct  340   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRMRK  399

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V + +R +   ++ GPW DCI KYP+ L
Sbjct  400   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSRNGPWEDCIDKYPVKL  444



>gb|KFK41273.1| hypothetical protein AALP_AA2G108700 [Arabis alpina]
Length=497

 Score =   399 bits (1024),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 273/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PF++F+EH +++      K V F  +IL  SGL E+T LPPA+
Sbjct  89    VYLVDYSCYKPPVTCRVPFATFMEHSRLILKD-KPKSVEFQMRILERSGLGEETCLPPAI  147

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP      +A +E  MV+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  148   HYIPPTPTMDEARSEAQMVIFTAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  207

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A 
Sbjct  208   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYKGNERAM  267

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+ +SN+   +  AKYKL   +RT    DD+ Y      ED EG  G+
Sbjct  268   LLPNCLFRMGAAAIHMSNRNSDRWRAKYKLCHLVRTHRGADDKSYYCVYEQEDKEGHVGI  327

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL+S   RK  +   + Y+P+FK A +
Sbjct  328   NLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIFNPKWKPYIPDFKLAFE  387

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+++G
Sbjct  388   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRG  447

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  448   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  489



>ref|XP_009760261.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nicotiana sylvestris]
Length=516

 Score =   399 bits (1025),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 273/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+K P+  + P+  F++H ++ G F D   + F  KIL  SGL ++TY+P A
Sbjct  111   PVYLVDYSCYKAPDELKAPYERFMQHSRLTGDF-DESSLEFQRKILERSGLGDETYVPEA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P +   Q A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  170   MHHLPPQPSMQAAREEAEQVMFGALDNLFANTSVKPKDIGILVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  230   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAAVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG
Sbjct  290   MLIPNCLFRVGGAAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K  +K  + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLIIKKICNKHVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R++K
Sbjct  410   DHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRK  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G+KVWQ+  G+G KCNS V Q +R +   +Q GPW DCI +YP+ +
Sbjct  470   GNKVWQIAFGSGFKCNSAVWQALRNV-KPSQNGPWEDCIDRYPVKV  514



>ref|XP_011083903.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Sesamum indicum]
Length=522

 Score =   399 bits (1024),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 274/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+    PF  F+EH ++ G F D   + F  KIL  SGL ++TY+P A
Sbjct  117   PVYLVDYSCYRPPDSLMAPFDRFMEHSRLQGDF-DESSLEFQRKILERSGLGDETYVPEA  175

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +HFIP R   Q A  E   V+F     L +N  + PK+I +LVVNCS F P PSL+++IV
Sbjct  176   MHFIPPRPSMQAAREEAEQVMFGALDNLFANTNVKPKEIGVLVVNCSLFNPTPSLSAMIV  235

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++S E ++  WY G +K+
Sbjct  236   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSMENITQNWYFGNKKS  295

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAAVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG
Sbjct  296   MLIPNCLFRVGGAAVLLSNKAGDRRRAKYKLVHVVRTHKGADDKAFRCVYQEQDDAGKTG  355

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K  +K+ + Y+P+FK A 
Sbjct  356   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVIKKLFNKNVKPYIPDFKLAF  415

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  416   DHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  475

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+  G+G KCNS V + +R +   ++ GPW DCI +YP+
Sbjct  476   GNRVWQIAFGSGFKCNSAVWEALRSV-KPSRNGPWHDCIDRYPV  518



>ref|XP_002531630.1| acyltransferase, putative [Ricinus communis]
 gb|EEF30758.1| acyltransferase, putative [Ricinus communis]
Length=488

 Score =   397 bits (1020),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 274/403 (68%), Gaps = 10/403 (2%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYACYKPPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + A  E  +V+F     L     L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LL+N+R  +S AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLTNRRSHRSRAKYRLVHVVRTHKGADDKAYRCVYEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G           FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMAIAGEALKSNITTIGPX--------XFLFTLIGRKIFNPKWKPYIPDFKQAFE  378

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL++FGN SS+SLWYEL+Y+EAK R+KKG
Sbjct  379   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHKFGNTSSSSLWYELSYIEAKGRMKKG  438

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C + I      GPWADCI +YP+
Sbjct  439   DRVWQIAFGSGFKCNSAVWKCNKTI-KTPTDGPWADCIDRYPV  480



>emb|CDP07508.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   398 bits (1023),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 271/404 (67%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++ P+  + PF SF+EH ++ G F D   + F  KIL  SGL ++TY+P A
Sbjct  113   PVYLVDYFCYRAPDELKAPFESFMEHSRLTGDF-DESSLQFQRKILERSGLGDETYVPEA  171

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +HF+P R   Q A  E   V+F     L +N K+  KDI ILVVNCS F P PSL+++IV
Sbjct  172   MHFVPPRPSMQAAREEAEQVMFGALDNLFANTKVKAKDIGILVVNCSLFNPTPSLSAMIV  231

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +KA
Sbjct  232   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKA  291

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAAVLLSNK   +  AKY+L+  +RT    DD+ +    +++D  G TG
Sbjct  292   MLIPNCLFRVGGAAVLLSNKSVDRRRAKYRLVHVVRTHRGSDDKAFRCVYQEQDDAGKTG  351

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K   K+ + Y+P+FK A 
Sbjct  352   VTLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVLKKLFQKNIKPYIPDFKLAF  411

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+S+WYELAY EAK R+++
Sbjct  412   DHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRIRR  471

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G ++WQ+  G+G KCNS V Q +R +   A  GPW DCI +YP+
Sbjct  472   GQRIWQIAFGSGFKCNSAVWQALRHV-KPAPNGPWEDCIDRYPV  514



>gb|EMT20723.1| 3-ketoacyl-CoA synthase 6 [Aegilops tauschii]
Length=496

 Score =   397 bits (1021),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 275/404 (68%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PV++VDY C+KP    R+PF++F+EHI+++    + K + F  +IL  SGL E+T LPPA
Sbjct  88    PVFLVDYCCYKPSPSFRVPFTTFMEHIKLISN--NDKSLRFQTRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  146   NHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  206   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVISTEIITPNFYHGSRRD  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED EG +G
Sbjct  266   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYEEEDDEGHSG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AGE L+++I  +G   LP++E L F      RK I+   + Y+P+FK A 
Sbjct  326   ISLSKELMAIAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVINSKWKPYIPDFKLAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R++K
Sbjct  386   EHFCIHAGGRAVIDELQKNLELSPRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R +      GPW DCI +YP+
Sbjct  446   GDRVWQIGFGSGFKCNSAVWKCLRTV-KTPTDGPWDDCIQRYPV  488



>gb|ABY82171.2| 3-ketoacyl-CoA synthase I [Triticum aestivum]
Length=496

 Score =   397 bits (1020),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 275/404 (68%), Gaps = 3/404 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PV++VDY C+KP    R+PF++F+EHI+++    + K + F  +IL  SGL E+T LPPA
Sbjct  88    PVFLVDYCCYKPSPSFRVPFTTFMEHIKLISN--NDKSLRFQTRILERSGLGEETCLPPA  145

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
              H+IP     + +  E  +V+F     L+    L PKDIDILVVNCS F P PSL+++I+
Sbjct  146   NHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSAMII  205

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++++FNL+GMGCSA  +++D+ R++++ H   NA+++STEI++  +Y G  + 
Sbjct  206   NKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVISTEIITPNFYHGSRRD  265

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSN+R     AKY+L+  +RT    DDR Y     +ED EG +G
Sbjct  266   MLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYEEEDDEGHSG  325

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AGE L+++I  +G   LP++E L F      RK I+   + Y+P+FK A 
Sbjct  326   ISLSKELMAIAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVINNKWKPYIPDFKLAF  385

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R++K
Sbjct  386   EHFCIRAGGRAVIDELHKNLELSPRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRK  445

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G G+G KCNS V +C+R +      GPW DCI +YP+
Sbjct  446   GDRVWQIGFGSGFKCNSAVWKCLRTV-KTPTDGPWDDCIQRYPV  488



>ref|XP_010527537.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Tarenaya hassleriana]
Length=494

 Score =   397 bits (1020),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 275/403 (68%), Gaps = 4/403 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    VYLVDYSCYKPPLTCRVPFATFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  MV+F     L     L+P+D+DIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPTM--EAARGEAQMVVFSAMDDLFKKTGLNPRDVDILIVNCSLFSPTPSLSAMVIN  204

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAVI+STEIL+  +Y G ++A 
Sbjct  205   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEILTPNYYKGNDRAM  264

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+LLSN+R  +  AKY+L   +RT    DD+ Y      ED +G  G+
Sbjct  265   LLPNCLFRMGAAAILLSNRRTDRWRAKYRLCHVVRTHRGADDKSYCCVYEKEDKDGKVGI  324

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  LG   LP +E + FL S   RK  +   + Y+P+F+ A +
Sbjct  325   NLSKDLMAIAGEALKSNITTLGPLVLPASEQILFLLSLIGRKIFNPKWKPYIPDFRLAFE  384

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R++ G
Sbjct  385   HFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMRHG  444

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS+V +C R I G    GPW DCI +YP+
Sbjct  445   DRVWQIAFGSGFKCNSVVWKCNRTIKG-LTDGPWTDCIDRYPV  486



>ref|XP_010539905.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Tarenaya hassleriana]
Length=514

 Score =   397 bits (1021),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/407 (46%), Positives = 274/407 (67%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  + PF+ F+EH ++ G F +S  + F  KIL  SGL E+TY+P A
Sbjct  109   PVYLVDYSCYRPPDHLKAPFNRFMEHSRLTGDFEES-ALEFQRKILERSGLGEETYVPEA  167

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H IP R     A  E   V+F     L SN  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  168   MHCIPPRPSMAAAREEAEQVMFGALDNLFSNTNVNPKDIGILVVNCSLFNPTPSLSAMIV  227

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +KA
Sbjct  228   NKYKLRGNIRSFNLGGMGCSAGIIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKA  287

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKY+L+  +RT    DD+ +    +++D  G TG
Sbjct  288   MLIPNCLFRVGGSAVLLSNKSRDRRRAKYQLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  347

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E L F  +   +K      + Y+P+FK A 
Sbjct  348   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQLLFFVTLIMKKLSKGKVKPYIPDFKLAF  407

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R+++
Sbjct  408   DHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRR  467

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS V + +R +   ++   W DCIH YP+ L+
Sbjct  468   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSKNSAWEDCIHNYPVALN  513



>ref|XP_010263663.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=497

 Score =   397 bits (1019),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR PFS+F+EH +++ G  ++K V F  +IL  SGL E+T LPPA+
Sbjct  89    IYLVDYSCFKPPVTCRAPFSTFMEHSRLINGS-NTKVVDFEMRILERSGLGEETCLPPAI  147

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP      D   E  +V+F     LL    + PKDIDIL++NCS F P PSL ++IVN
Sbjct  148   HYIPPTPTMADCRAEAELVIFSAIDSLLKKTGIKPKDIDILILNCSMFSPTPSLTAMIVN  207

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR ++++FNL+GMGCSA  +++D+ R++++ H    A+++STEI++  +Y G +++ 
Sbjct  208   KYKMRGNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSYALVVSTEIITPSYYSGSQRSM  267

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+LLSN+R+    AKY+L   +RT    DDR Y     +ED +G+ G+
Sbjct  268   LLPNCLFRMGSAAILLSNRRKDSWRAKYRLAHVVRTHKGADDRAYRCVYEEEDPQGIRGV  327

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ +++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  328   SLSKELMVIAGEALKSNITTIGPLVLPASEQLLFLFTLVGRKLFNPKWKPYIPDFKQAFE  387

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+KKG
Sbjct  388   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMKKG  447

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I  + +  PW DCI++YP+
Sbjct  448   DRVWQIAFGSGFKCNSAVWKCNRTIKPDPE-SPWFDCINRYPV  489



>gb|AAM65060.1| very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
Length=492

 Score =   396 bits (1018),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 272/403 (67%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PF++F+EH +++      K V F  +IL  SGL E+T LPPA+
Sbjct  84    IYLVDYSCYKPPVTCRVPFATFMEHSRLILKD-KPKSVEFQMRILERSGLGEETCLPPAI  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A +E  MV+F     L     L PKD+DIL+VNCS F P PSL+++++N
Sbjct  143   HYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A 
Sbjct  203   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+ +SN+R  +  AKYKL   +RT    DD+ +      ED EG  G+
Sbjct  263   LLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A +
Sbjct  323   NLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIFNPKWKPYIPDFKLAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+++G
Sbjct  383   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRG  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  443   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  484



>gb|AAL50069.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
 gb|AAM16230.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
Length=497

 Score =   396 bits (1018),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 272/403 (67%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PF++F+EH +++      K V F  +IL  SGL E+T LPPA+
Sbjct  89    IYLVDYSCYKPPVTCRVPFATFMEHSRLILKD-KPKSVEFQMRILERSGLGEETCLPPAI  147

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A +E  MV+F     L     L PKD+DIL+VNCS F P PSL+++++N
Sbjct  148   HYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVIN  207

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A 
Sbjct  208   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERAM  267

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+ +SN+R  +  AKYKL   +RT    DD+ +      ED EG  G+
Sbjct  268   LLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVGI  327

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A +
Sbjct  328   NLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIFNPKWKPYIPDFKLAFE  387

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+++G
Sbjct  388   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRG  447

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  448   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  489



>ref|XP_009364915.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score =   397 bits (1020),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 275/406 (68%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  + P+  F+EH ++   F DS  + F  KIL  SGL E+TY+P A
Sbjct  111   PVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDS-SLEFQRKILERSGLGEETYVPEA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A +E   V++     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  170   MHYIPPRPSMAAARDEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  230   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENITQNWYFGNKKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D +G TG
Sbjct  290   MLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDKGKTG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F +S    K    + + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSIVVNKLFKSNVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R++K
Sbjct  410   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRMRK  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V + +R +   ++ GPW DCI KYP+ L
Sbjct  470   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSRNGPWEDCIDKYPVKL  514



>ref|XP_008388058.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=516

 Score =   397 bits (1020),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 274/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  + P+  F+EH ++   F DS  + F  KIL  SGL E+TY+P A
Sbjct  111   PVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDS-SLEFQRKILERSGLGEETYVPEA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A +E   V++     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  170   MHYIPPRPSMAAARDEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  230   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENITQNWYFGNKKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D +G TG
Sbjct  290   MLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDEKGKTG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F +S    K    + + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSIVVNKLFKSNVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R++K
Sbjct  410   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRMRK  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+  G+G KCNS V + +R +   ++ GPW DCI KYP+
Sbjct  470   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSRNGPWEDCIDKYPV  512



>ref|XP_004238922.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=494

 Score =   396 bits (1018),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/404 (47%), Positives = 273/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CF PP   RIPF+SF+EH  ++    + K V F  KIL  SGLSE+T LPP +
Sbjct  84    IYLVDYACFLPPITNRIPFASFMEHAHLILST-EPKSVRFQMKILERSGLSEETALPPPM  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E  +V+F     LL+   L PKDID+LVVNCS F P PSL+++++N
Sbjct  143   HYIPPTPTMDLAREEAELVIFSAMDSLLAKTGLKPKDIDVLVVNCSLFSPTPSLSAMVIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R+I++ +   NAV++STEIL+   Y GKE++ 
Sbjct  203   KYKLRSNIKSFNLSGMGCSAGVISIDLARDILQQYPNSNAVVISTEILTPNGYLGKERSM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNK+  +  +KY+LL  +RT    DD+ +    + ED EG  G+
Sbjct  263   LLTNCLFRMGGAAILLSNKKSDRGRSKYRLLHIVRTLKGGDDKSFRCVQQQEDPEGKVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L  D++ VAGE L+++I  +G   LP +E L FL +   RK    + + Y+P+FK A +
Sbjct  323   NLCIDLMQVAGEALKSNITTIGPLVLPASEQLLFLLTLICRKLFKSNMKPYIPDFKLAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E    L+L    +EA+ MTLYRFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  383   HFCIHAGGRAVIDELQNNLQLSTEHVEASRMTLYRFGNTSSSSLWYEMSYIEAKGRMKKG  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPI-LGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C + I L      PWADCI +YP+
Sbjct  443   DRIWQIAFGSGFKCNSAVWKCNKTIKLPVDDHNPWADCIDRYPV  486



>ref|NP_177020.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
 sp|Q9XF43.1|KCS6_ARATH RecName: Full=3-ketoacyl-CoA synthase 6; Short=KCS-6; AltName: 
Full=Cuticular protein 1; AltName: Full=Very long-chain fatty 
acid condensing enzyme 6; Short=VLCFA condensing enzyme 
6 [Arabidopsis thaliana]
 gb|AAD37122.1|AF129511_1 very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
 gb|AAG52390.1|AC011915_4 very-long-chain fatty acid condensing enzyme (CUT1); 56079-54227 
[Arabidopsis thaliana]
 gb|AEE34804.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
Length=497

 Score =   396 bits (1018),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 272/403 (67%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PF++F+EH +++      K V F  +IL  SGL E+T LPPA+
Sbjct  89    IYLVDYSCYKPPVTCRVPFATFMEHSRLILKD-KPKSVEFQMRILERSGLGEETCLPPAI  147

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A +E  MV+F     L     L PKD+DIL+VNCS F P PSL+++++N
Sbjct  148   HYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVIN  207

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A 
Sbjct  208   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERAM  267

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+ +SN+R  +  AKYKL   +RT    DD+ +      ED EG  G+
Sbjct  268   LLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVGI  327

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A +
Sbjct  328   NLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIFNPKWKPYIPDFKLAFE  387

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+++G
Sbjct  388   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRG  447

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  448   DRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  489



>ref|XP_004232364.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=496

 Score =   395 bits (1016),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 276/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+K P  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYSCYKAPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  +V+F     L+    L PKDIDILVVNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMETARNEAEVVIFSAIDDLMKKTGLKPKDIDILVVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++      A+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSCALVVSTEIITPNYYQGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNKR+  + AKY+L+  +RT    DD+ +    + ED +G  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKRKDSARAKYRLMHVVRTHKGADDKAFKCVFQQEDPQGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL++FGN SS+SLWYE++Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHKFGNTSSSSLWYEMSYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWDDCIDRYPV  488



>gb|KFK44525.1| hypothetical protein AALP_AA1G267900 [Arabis alpina]
Length=495

 Score =   395 bits (1016),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 274/403 (68%), Gaps = 3/403 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY CFKPP  CR+PF++F+EH +++    + K V F  ++L  SGL E+T LPPA+
Sbjct  88    VYLVDYSCFKPPVTCRVPFATFMEHSRLILKD-NPKSVEFQMRMLERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A +E  MV+F     L     L PKDIDIL+VNCS F P PSL+++I+N
Sbjct  147   HYIPPTPTMESARSEAQMVIFSAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSAMIIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+ NL+GMGCSA+ ++VD+ R++++ H   NAVI+STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAVIISTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+LLSN+R  +  AKYKL   +RT    DD+ +      ED +G  G+
Sbjct  267   LLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSFYCVHEQEDKDGNVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+ +I  +G   LP +E L FL+S   R+  +   + Y+P+FK A +
Sbjct  327   NLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLSSLIGRRIFNPKWKPYIPDFKMAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R+K+G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMKRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             ++VWQ+  G+G KCNS V +C R I  +     W+DCI +YP+
Sbjct  447   ERVWQIAFGSGFKCNSAVWKCNRTI--KPSTNAWSDCIDRYPV  487



>ref|XP_009399728.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=494

 Score =   395 bits (1016),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 187/405 (46%), Positives = 272/405 (67%), Gaps = 3/405 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ CF+PP   R+PF++F EH  ++  FFD K V F  + L  SGL E+T LP A
Sbjct  83    PVYLVDHACFRPPRSFRVPFATFFEHASLVP-FFDEKSVRFQVRFLESSGLGEETCLPLA  141

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
               +IP     + A  E  +V+F    +L++   L P+D+DILVVNCS F P PSL+++IV
Sbjct  142   NRYIPPCPSMEAACAEARLVIFSAIDELIAKTDLKPRDVDILVVNCSLFSPTPSLSAMIV  201

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR+++ +FNL+GMGCSA  +++D+ R++++ H    A+++STEI++  +Y G E++
Sbjct  202   NKYKMRSNIMSFNLSGMGCSAGLISIDLARSLLQAHPNSYALVVSTEIITPNFYAGNERS  261

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AAVLLSN R  +  AKY+LL  +RT    DDR Y     +ED EG +G
Sbjct  262   MLLPNCLFRMGAAAVLLSNSRREEDRAKYRLLHVVRTHEGADDRAYRCVYEEEDGEGNSG  321

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFID-KSTEIYVPNFKSA  549
             + L+ ++  V GE L+ +I  +G   LP+TE LRFLAS   R+ +  +  + Y+P+FK A
Sbjct  322   INLSKELTTVTGEALRANITAVGPLVLPVTEQLRFLASLVARRLLGARGGKPYIPDFKRA  381

Query  548   IQHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVK  369
               H C  A G++V+ E  + L L    +EA+ MTL+RFGN SS+SLWYELAY+EAK R++
Sbjct  382   FDHLCIHAGGRAVIDELQRSLGLPAALVEASRMTLHRFGNTSSSSLWYELAYIEAKSRMR  441

Query  368   KGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             +GD+VW +G G+G KCNS V +C+R        GPW+DCIH+YP+
Sbjct  442   RGDRVWMIGFGSGFKCNSAVWRCLRAPKAPVD-GPWSDCIHRYPV  485



>ref|XP_004233492.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=496

 Score =   395 bits (1015),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 182/403 (45%), Positives = 273/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LP + 
Sbjct  88    IYLVDYSCYKPPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPHST  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A  E   V+F     L++   L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPTPTMDAARGEAEEVIFTSIDDLMNKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++ H    A+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSYALVISTEIITPNYYRGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNK+  +  AKY+L+  +RT    DD+ +      EDS+G  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKKRDQYRAKYRLMHVVRTHKGADDKAFKCVFEQEDSQGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+K+G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKRRMKRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW DCI KYP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTI-NTPNDGPWQDCIDKYPV  488



>ref|XP_010415473.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
 ref|XP_010470803.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
Length=497

 Score =   395 bits (1015),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 273/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             +Y+VDY C+KPP  CR+PF++F+EH +++    D  K V F  +IL  SGL E+T LPPA
Sbjct  89    IYLVDYSCYKPPVTCRVPFATFMEHSRLI--LKDKPKSVEFQMRILERSGLGEETSLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP       A +E  +V+F     L     L PKD+DIL+VNCS F P PSL+++++
Sbjct  147   IHYIPPTPTMDAARSEAQLVIFTAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVI  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+ NL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A
Sbjct  207   NKYKLRSNIKSVNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+L+SN+R  +  AKYKL   +RT    DD+ +      ED EG  G
Sbjct  267   MLLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  327   INLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIFNPKLKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+++
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  489



>ref|XP_009365554.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score =   396 bits (1017),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/404 (45%), Positives = 274/404 (68%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  + P+  F+EH ++   F DS  + F  KIL  SGL E+TY+P A
Sbjct  111   PVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDS-SLEFQRKILERSGLGEETYVPEA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A  E   V++     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  170   MHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  230   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENITQNWYFGNKKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D +G TG
Sbjct  290   MLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDKGKTG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F +S   +K  + + + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLVVKKLFNSNVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  410   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRIRR  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G+++WQ+  G+G KCNS V + +R +   ++ GPW DCI  YP+
Sbjct  470   GNRIWQIAFGSGFKCNSAVWEALRNV-KASRNGPWEDCIDTYPV  512



>ref|XP_010028602.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Eucalyptus grandis]
Length=513

 Score =   395 bits (1016),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 186/405 (46%), Positives = 269/405 (66%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP   ++ F  F+EH ++ G F D   + F  KIL  SGL E+TY+P A+
Sbjct  109   VYLVDYSCYKPPEHLQVKFHQFMEHSKLTGDF-DESSLEFQRKILARSGLGEETYVPEAM  167

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P R     A  E   V++     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  168   HYLPPRPSMAAAREESEQVMYGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVN  227

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++K+FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  228   KYKLRGNIKSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  287

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAAVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  288   LIPNCLFRVGGAAVLLSNKSSDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDVGKTGV  347

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +KF +   + Y+P+FK A  
Sbjct  348   SLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKFFNAKVKPYIPDFKLAFD  407

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ M L+RFGN SS+S+WYELAY EAK R+++G
Sbjct  408   HFCIHAGGRAVIDELEKNLQLLPSHVEASRMALHRFGNTSSSSIWYELAYTEAKGRMRRG  467

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             ++VWQ+  G+G KCNS V Q +R +   +   PW DCIHKYP+ L
Sbjct  468   NRVWQIAFGSGFKCNSAVWQALRNVT-PSPSSPWEDCIHKYPVQL  511



>ref|XP_007136167.1| hypothetical protein PHAVU_009G023600g [Phaseolus vulgaris]
 gb|ESW08161.1| hypothetical protein PHAVU_009G023600g [Phaseolus vulgaris]
Length=512

 Score =   395 bits (1016),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 187/405 (46%), Positives = 267/405 (66%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y++DY C++PP+  R+ F  FL H  + G F  S  + F  KIL  SGL E+TYLP A+
Sbjct  109   IYLIDYSCYRPPHHLRVHFQKFLHHSTLTGDFLPS-SLDFQRKILQRSGLGEETYLPEAM  167

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP R     A  E   V+F     L +N ++ PKDI ILVVNCS F P PSL+++IVN
Sbjct  168   HSIPPRPSMDAAREEAEQVMFGALDNLFANTRVKPKDIGILVVNCSLFNPTPSLSAMIVN  227

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R +VK+FNL GMGCSA  +A+D+ +++++ HR    V++STE ++  WY G  KA 
Sbjct  228   KYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYVVVVSTENITQNWYFGNNKAM  287

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAA+LLSNK   K  AKYKLL  +RT    DD+ +    +++D  G TG+
Sbjct  288   LIPNCLFRVGGAAILLSNKSSDKRRAKYKLLHVVRTHKGADDKAFRCVYQEQDDIGKTGV  347

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LPI+E L F  +   +K  +   + Y+P+FK A  
Sbjct  348   SLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFLTLVLKKLFNAKMKPYIPDFKLAFD  407

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R++KG
Sbjct  408   HFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRKG  467

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             ++VWQ+  G+G KCNS V + +R +   + K PW DCIHKYP+ +
Sbjct  468   NRVWQIAFGSGFKCNSAVWEALRHV-NPSPKSPWEDCIHKYPVQI  511



>ref|XP_010511851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Camelina sativa]
Length=497

 Score =   395 bits (1015),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 273/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             +Y+VDY C+KPP  CR+PF++F+EH +++    D  K V F  +IL  SGL E+T LPPA
Sbjct  89    IYLVDYSCYKPPVTCRVPFATFMEHSRLI--LKDKPKSVEFQMRILERSGLGEETSLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP       A +E  +V+F     L     L PKD+DIL+VNCS F P PSL+++++
Sbjct  147   IHYIPPTPTMDAARSEAQLVIFTAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVI  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+ NL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A
Sbjct  207   NKYKLRSNIKSVNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+L+SN+R  +  AKYKL   +RT    DD+ +      ED EG  G
Sbjct  267   MLLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGSDDKSFYCVYEQEDKEGHVG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  327   INLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIFNPKLKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+++
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  489



>ref|XP_006304681.1| hypothetical protein CARUB_v10011929mg [Capsella rubella]
 gb|EOA37579.1| hypothetical protein CARUB_v10011929mg [Capsella rubella]
Length=512

 Score =   395 bits (1016),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 276/407 (68%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ PP+  + P+S F+EH ++ G F DS  + F  KIL  SGL E TY+P A
Sbjct  107   PVYLVDFSCYLPPDHLKAPYSRFMEHSKLTGDFDDSS-LEFQRKILERSGLGEDTYVPEA  165

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H++P R     A  E   V+F     L ++  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  166   MHYVPPRISMAAARKEAEQVMFGALDNLFADTNVNPKDIGILVVNCSLFNPTPSLSAMIV  225

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +K+
Sbjct  226   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKS  285

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK + K  +KY+L+  +RT    DD+ +    +++D  G TG
Sbjct  286   MLIPNCLFRVGGSAVLLSNKSKDKRRSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  345

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  346   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFVTLVVKKLFNGKVKPYIPDFKLAF  405

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  406   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  465

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS + + +R +   +   PW DCI KYP+ LS
Sbjct  466   GNRVWQIAFGSGFKCNSAIWEALRHV-KPSNNSPWEDCIDKYPVTLS  511



>gb|KFK44079.1| hypothetical protein AALP_AA1G213300 [Arabis alpina]
Length=515

 Score =   395 bits (1016),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 183/407 (45%), Positives = 274/407 (67%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ P +  + PF+ F+EH ++ G F DS  + F  KIL  SGL E TYLP A
Sbjct  110   PVYLVDFSCYLPQDHLKAPFTRFMEHSRLTGDFDDS-ALEFQRKILERSGLGEHTYLPEA  168

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P +     A  E   V+F     L +N  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  169   MHHVPPKISMAAAREEAEQVMFGALDNLFANTNVNPKDIGILVVNCSLFNPTPSLSAMIV  228

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +K+
Sbjct  229   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKS  288

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  AKY+L+  +RT    DD+ +    +++D  G TG
Sbjct  289   MLIPNCLFRVGGSAVLLSNKSRDKRRAKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  348

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  349   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAF  408

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  409   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  468

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS + + +R +   ++  PW DCI KYP+ LS
Sbjct  469   GNRVWQIAFGSGFKCNSAIWEALRNV-KPSKNSPWEDCIEKYPVTLS  514



>ref|XP_002888670.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64929.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score =   395 bits (1014),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 273/404 (68%), Gaps = 4/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDS-KGVAFMEKILNLSGLSEQTYLPPA  1266
             +Y+VDY C+KPP  CR+PF++F+EH ++     D+ K V F  +IL  SGL E+T LPPA
Sbjct  89    IYLVDYSCYKPPVTCRVPFATFMEHSRL--NLKDNPKSVEFQMRILERSGLGEETCLPPA  146

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP       A +E  MV+F     L     L PKD+DIL+VNCS F P PSL+++++
Sbjct  147   IHYIPPTPTMDAARSEAQMVIFTAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVI  206

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NA+I+STEI++  +Y G E+A
Sbjct  207   NKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+ +SN+R  +  AKYKL   +RT    DD+ +      ED EG  G
Sbjct  267   MLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  +G   LP +E L FL S   RK  +   + Y+P+FK A 
Sbjct  327   INLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIFNPKWKPYIPDFKLAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K ++++
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGKMRR  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I    + GPW+DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKCNRTI-KTPKDGPWSDCIDRYPV  489



>ref|XP_006363119.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
 gb|ACF17125.1| CER6 [Solanum tuberosum]
Length=496

 Score =   395 bits (1014),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/403 (45%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+K P  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYSCYKAPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  +V+F     L+    L PKDIDIL+VNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMETARNEAEVVIFSAIDDLMQKTGLKPKDIDILIVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++      A+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVVPNSCALVVSTEIITPNYYQGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNKR+    AKY+L+  +RT    DD+ +    + ED +G  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKRKDSRRAKYRLMHVVRTHKGADDKAFKCVFQQEDPQGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL++FGN SS+SLWYE++Y+EAK R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHKFGNTSSSSLWYEMSYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWDDCIDRYPV  488



>ref|XP_011048431.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score =   395 bits (1014),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/405 (45%), Positives = 272/405 (67%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +++VDY C+KPP+  ++ F  F+EH  + G F DS  + F  KIL  SGL E+TY+P A+
Sbjct  106   LFLVDYACYKPPSNLQVKFEQFMEHSNLTGDFDDS-SLEFQRKILERSGLGEETYVPEAM  164

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  165   HYIPPRPSMAAAREEAQQVMFGALNVLFANTNIKPKDIGILVVNCSLFNPTPSLSAMIVN  224

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  225   KYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  284

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+AVLLSNK + K  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  285   LIPNCLFRVGGSAVLLSNKAKDKRRAKYKLVHVVRTHKGADDKAFKCVYQEQDDAGKTGV  344

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ +++ +AG  L+T+I  LG   LPI+E L F ++   +K  +   + Y+P+FK A  
Sbjct  345   SLSKELMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKKLFNAKVKPYIPDFKLAFD  404

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY EAKERV++G
Sbjct  405   HFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYTEAKERVRRG  464

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             D+VWQ+  G+G KCNS + + +R +   +   PW DCI +YP+ +
Sbjct  465   DRVWQIAFGSGFKCNSAIWEALRHV-KPSSSNPWQDCIDRYPVQI  508



>ref|XP_002890341.1| hypothetical protein ARALYDRAFT_472173 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66600.1| hypothetical protein ARALYDRAFT_472173 [Arabidopsis lyrata subsp. 
lyrata]
Length=515

 Score =   395 bits (1014),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 274/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ PP+  + P++ F+EH ++ G F DS  + F  KIL  SGL E TY+P A
Sbjct  110   PVYLVDFSCYLPPDHLKAPYARFIEHSRLTGDFDDS-ALEFQRKILERSGLGEDTYVPEA  168

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +HF+P R     A  E   V+F     L +N  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  169   MHFVPPRISMAAAREEAEQVMFGALDNLFANTSVNPKDIGILVVNCSLFNPTPSLSAMIV  228

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +K+
Sbjct  229   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKS  288

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  +KY+L+  +RT    DD+ +    +++D  G TG
Sbjct  289   MLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  348

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  349   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAF  408

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  409   EHFCVHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  468

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS + + +R +   +   PW DCI KYP+ L
Sbjct  469   GNRVWQIAFGSGFKCNSAIWEALRHV-KPSNNSPWEDCIDKYPVTL  513



>ref|XP_009149432.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brassica rapa]
Length=506

 Score =   394 bits (1013),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/407 (45%), Positives = 271/407 (67%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ PP+  + PFS F+ H ++ G F DS  + F  KIL  SGL E TY+P  
Sbjct  101   PVYLVDFSCYLPPDHLKAPFSRFMAHSRLTGDFDDS-ALEFQRKILQRSGLGEDTYVPEG  159

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P R     A  E   V+F     L  N  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  160   MHHVPPRISMAAAREEAEQVMFGALDSLFENTNINPKDIGILVVNCSLFNPTPSLSAMIV  219

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR+  AV++STE ++  WY G  KA
Sbjct  220   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRKTYAVVVSTENITQNWYFGNNKA  279

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  +KY+L   +RT    DD+ +    +++D  G TG
Sbjct  280   MLIPNCLFRVGGSAVLLSNKSSDKRRSKYRLSHVVRTHRGADDKAFRCVYQEQDDTGRTG  339

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  340   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFTTLVVKKLFNGKVKPYIPDFKLAF  399

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  400   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  459

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS V + +R +   ++  PW DCI KYP+ LS
Sbjct  460   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSKNSPWEDCIDKYPVTLS  505



>ref|XP_002313793.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
 gb|EEE87748.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
Length=510

 Score =   394 bits (1013),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/405 (45%), Positives = 272/405 (67%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +++VDY C+KPP+  ++ F  F+EH  + G F DS  + F  KIL  SGL E+TY+P A+
Sbjct  106   LFLVDYACYKPPSNLQVKFEQFMEHSSLTGDFDDS-SLEFQRKILERSGLGEETYVPEAM  164

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  165   HYIPPRPSMAAAREEAQQVMFGALDVLFANTNIKPKDIGILVVNCSLFNPTPSLSAMIVN  224

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  225   KYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  284

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+AVLLSNK + K  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  285   LIPNCLFRVGGSAVLLSNKAKDKRRAKYKLVHVVRTHKGADDKAFKCVYQEQDDAGKTGV  344

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ +++ +AG  L+T+I  LG   LPI+E L F ++   +K  +   + Y+P+FK A  
Sbjct  345   SLSKELMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKKLFNAKVKPYIPDFKLAFD  404

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY EAKERV++G
Sbjct  405   HFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYTEAKERVRRG  464

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             D++WQ+  G+G KCNS + + +R I   +   PW DCI +YP+ +
Sbjct  465   DRIWQIAFGSGFKCNSAIWEALRHI-KPSSNNPWQDCIDRYPVQI  508



>ref|NP_173376.1| 3-ketoacyl-CoA synthase 4 [Arabidopsis thaliana]
 sp|Q9LN49.1|KCS4_ARATH RecName: Full=3-ketoacyl-CoA synthase 4; Short=KCS-4; AltName: 
Full=Very long-chain fatty acid condensing enzyme 4; Short=VLCFA 
condensing enzyme 4 [Arabidopsis thaliana]
 gb|AAF79428.1|AC025808_10 F18O14.21 [Arabidopsis thaliana]
 gb|ACE79746.1| At1g19440 [Arabidopsis thaliana]
 gb|AEE29852.1| 3-ketoacyl-CoA synthase 4 [Arabidopsis thaliana]
Length=516

 Score =   394 bits (1013),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 274/407 (67%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ PP+  + P++ F+EH ++ G F DS  + F  KIL  SGL E TY+P A
Sbjct  111   PVYLVDFSCYLPPDHLKAPYARFMEHSRLTGDFDDS-ALEFQRKILERSGLGEDTYVPEA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H++P R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  170   MHYVPPRISMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +K+
Sbjct  230   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  +KY+L+  +RT    DD+ +    +++D  G TG
Sbjct  290   MLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  410   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS + + +R +   +   PW DCI KYP+ LS
Sbjct  470   GNRVWQIAFGSGFKCNSAIWEALRHV-KPSNNSPWEDCIDKYPVTLS  515



>ref|XP_010459615.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Camelina sativa]
Length=518

 Score =   394 bits (1013),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/407 (45%), Positives = 274/407 (67%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ PP+  + P+S F+EH ++ G F DS  + F  KIL  SGL E TY+P A
Sbjct  113   PVYLVDFSCYLPPDHLKAPYSRFMEHSRLTGDFDDS-ALEFQRKILERSGLGEDTYVPEA  171

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +PAR     A  E   V+F     L +N  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  172   MHHVPARISMAAAREEAEQVMFGALDNLFANANVNPKDIGILVVNCSLFNPTPSLSAMIV  231

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +K+
Sbjct  232   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENMTQNWYFGNKKS  291

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  +KY+L+  +RT    DD+ +    +++D  G TG
Sbjct  292   MLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  351

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  352   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAF  411

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  412   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  471

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS + + +R +   +   PW  CI KYP+ LS
Sbjct  472   GNRVWQIAFGSGFKCNSAIWEALRHV-KPSNNSPWEHCIDKYPVTLS  517



>ref|XP_006341948.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Solanum tuberosum]
Length=519

 Score =   394 bits (1012),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 271/404 (67%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+K P   + P+  F++H ++ G F D   + F  KIL  SGL ++TY+P A
Sbjct  114   PVYLVDYSCYKAPEHLKAPYERFMQHSRLTGDF-DESSLEFQRKILERSGLGDETYVPEA  172

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P +   Q A  E   V+F    +L +N  + PK I +LVVNCS F P PSL+++IV
Sbjct  173   MHQLPPQPSMQAAREEAEQVMFGALDKLFANTSVKPKKIGVLVVNCSLFNPTPSLSAMIV  232

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  233   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKS  292

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+ ++RT    DD+ +    +++D  G TG
Sbjct  293   MLIPNCLFRVGGSAVLLSNKSMDRRRAKYKLVHAVRTHRGADDKAFRCVYQEQDDAGKTG  352

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F  S   +K  +K  + Y+P+FK A 
Sbjct  353   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFGSLIIKKIFNKHIKPYIPDFKLAF  412

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+KK
Sbjct  413   DHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMKK  472

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G+KVWQ+  G+G KCNS V Q +R +   +  GPW DCI +YP+
Sbjct  473   GNKVWQIAFGSGFKCNSAVWQALRNV-KPSPDGPWEDCIDRYPV  515



>ref|XP_003631663.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Vitis vinifera]
Length=504

 Score =   393 bits (1010),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/405 (45%), Positives = 274/405 (68%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C++PP+  ++ +  F+EH ++ G F D   + F  KIL  SGL E+TY+P A+
Sbjct  100   IYLVDYACYRPPSHLQVRYHQFMEHSRLTGDF-DESALEFQRKILERSGLGEETYVPEAM  158

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +     A  E   V+F    +L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  159   HYIPPQPSMAAAREEAEQVMFGSLDKLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVN  218

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  219   KYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  278

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAAVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  279   LIPNCLFRVGGAAVLLSNKSGDRRRAKYKLVHLVRTHRGADDKAFRCVYQEQDDAGKTGV  338

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K  +   + Y+P+FK A +
Sbjct  339   SLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLFNAKVKPYIPDFKLAFE  398

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+S+WYEL+Y+EAK R++KG
Sbjct  399   HFCIHAGGRAVIDELEKNLQLLPSHVEASRMTLHRFGNTSSSSIWYELSYIEAKGRMRKG  458

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             ++VWQ+  G+G KCNS V Q +R +   +  GPW DCI+KYP+ +
Sbjct  459   NRVWQIAFGSGFKCNSAVWQALRNV-NPSPNGPWEDCINKYPVEV  502



>ref|XP_010265151.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=496

 Score =   393 bits (1009),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/403 (45%), Positives = 275/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR PFS+F+EH +++ G  ++K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYSCFKPPVTCRAPFSTFMEHSRLINGA-NTKVVDFEMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +    D   E  +V+F     LL    + PKD+DIL++NCS F P PS+ ++IVN
Sbjct  147   HYIPPKPTMADCRAEAELVIFSSIDSLLKKTGIKPKDVDILILNCSMFSPTPSMTAMIVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR ++K+FNL+GMGCSA  +++D+ R++++ H    A+++STEI++  +Y G +++ 
Sbjct  207   KYKMRGNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSYALVVSTEIITPSFYGGSQRSM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+LLSN+R+    AKY+L   +RT    DD+ Y     +ED +G+ G+
Sbjct  267   LLPNCLFRMGSAAILLSNRRKDGWRAKYRLAHVVRTHKGADDKAYRCVYEEEDPQGIRGV  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ +++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKELMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKLFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+E+K R+K+G
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMKRG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I  + +  PW DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNRTIKADPE-SPWFDCIDRYPV  488



>ref|XP_011037520.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score =   393 bits (1010),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/405 (45%), Positives = 271/405 (67%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP   ++ +  F+EH ++ G F DS  + F  +IL  SGL E+TY+P A+
Sbjct  106   VYLVDYACYKPPAKLQVKYEQFMEHSKLTGDFDDS-SLEFQRRILERSGLGEETYVPEAM  164

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP R     A  E   V+F     L +N  + PKDI +LVVNCS F P PSL+++IVN
Sbjct  165   HYIPPRPSMAAAREEAEQVMFGALDILFANTNIKPKDIGVLVVNCSLFNPTPSLSAMIVN  224

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R +++TFNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  225   KYKLRGNIRTFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVVVSTENITQNWYFGNKKSM  284

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+AVLLSNK + +  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  285   LIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADDKAFKCVYQEQDDAGKTGV  344

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LPI+E L F ++   +K  +   + Y+P+FK A  
Sbjct  345   SLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKKLFNAKVKPYIPDFKLAFD  404

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY EAK RV++G
Sbjct  405   HFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRVRRG  464

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             D+VWQ+  G+G KCNS V + +R +   +   PW DCI KYP+ +
Sbjct  465   DRVWQIAFGSGFKCNSAVWEALRYV-KPSTSNPWEDCIDKYPVQI  508



>ref|XP_009389417.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   394 bits (1011),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 187/406 (46%), Positives = 267/406 (66%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP   + PF  F+EH Q+ GGF +S  + F  +IL  SGL + T LP A
Sbjct  105   PVYLVDYACYRPPPELKAPFHRFMEHSQLCGGFNES-ALEFQRRILERSGLGQDTCLPVA  163

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH++P R     A  E   V+F     L +N  + PKD+ +LVVNCS F P PSL+++IV
Sbjct  164   LHYLPPRPSMAAAREEAEQVMFGALDTLFNNTGVKPKDVGVLVVNCSLFNPTPSLSAMIV  223

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++ +R ++K+FNL GMGCSA  LAVD+ R++++ HR   AV++STE ++  WY G  KA
Sbjct  224   NRYKLRGNIKSFNLGGMGCSAGVLAVDLARDLLQVHRATYAVVVSTENITQNWYFGNRKA  283

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+G AA+LLSN+   +  AKYKL+  +RT    DDR +    +++D  G  G
Sbjct  284   MLIPNCLFRVGAAALLLSNRAADRRRAKYKLVHIVRTHRGADDRAFRCVYQEQDEVGKVG  343

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  LG   LPI+E L F A+   +K  +   + Y+P+FK A 
Sbjct  344   VSLSKDLMAIAGEALKINITTLGPLVLPISEQLLFFATLVAKKLFNGKVKPYIPDFKLAF  403

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY EAK R++K
Sbjct  404   DHFCIHAGGRAVIDELEKNLQLRPIHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRK  463

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G +VWQ+  G+G KCNS V Q +R +   +  GPW DCIH YP+ +
Sbjct  464   GHRVWQIAFGSGFKCNSAVWQALRNV-KPSHDGPWEDCIHGYPVEI  508



>gb|KDO69954.1| hypothetical protein CISIN_1g011007mg [Citrus sinensis]
Length=496

 Score =   393 bits (1009),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    VYLVDYACYKPPVTCRVPFATFMEHSRLILKN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     LL    L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPTPTMEAARGEAELVIFSAMDSLLQKTGLKPKDIDILIVNCSLFSPTPSLSAMVIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +S AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRRNRSRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLMTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+E K R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYIEEKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C + I       PW+DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNKTI-KTTTDNPWSDCIDRYPV  488



>ref|XP_010477163.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Camelina sativa]
Length=517

 Score =   394 bits (1011),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 182/407 (45%), Positives = 273/407 (67%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ PP+  + P+S F+EH ++ G F DS  + F  KIL  SGL E TY+P A
Sbjct  112   PVYLVDFSCYLPPDHLKAPYSRFMEHSKLTGDFDDS-ALEFQRKILERSGLGEDTYVPEA  170

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P R     A  E   V+F     L +N  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  171   MHHVPPRISMAAAREEAEQVMFGALDNLFANANVNPKDIGILVVNCSLFNPTPSLSAMIV  230

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +K+
Sbjct  231   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKS  290

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  +KYKL+  +RT    DD+ +    +++D  G TG
Sbjct  291   MLIPNCLFRVGGSAVLLSNKSRDKRRSKYKLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  350

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  351   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNSKVKPYIPDFKLAF  410

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  411   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  470

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS + + +R +   +   PW  CI KYP+ LS
Sbjct  471   GNRVWQIAFGSGFKCNSAIWEALRHV-KPSNNSPWEHCIDKYPVTLS  516



>ref|XP_010925903.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Elaeis guineensis]
Length=465

 Score =   391 bits (1005),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 270/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  ++ + SF+EH ++ G F +   + F  KIL  SGL E+TY+P A
Sbjct  51    PVYLVDYACYRPPDRLQVRYRSFMEHSRLCGEF-NEDALEFQRKILERSGLGEETYVPEA  109

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +HF+P R    +A  E   V+F     L  N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  110   MHFLPPRPSMANAREEAQQVMFGALDALFRNTGVKPKDISILVVNCSLFNPTPSLSAMIV  169

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N + +R+++K+FNL GMGCSA  +AVD+ R++++ HR   AV++STE ++  WY G  K+
Sbjct  170   NHYKLRSNIKSFNLGGMGCSAGVIAVDLARDLLQAHRSTYAVVVSTENITQNWYFGNRKS  229

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAAVLLSN+   +  +KY+L+  +RT    DDR +    +++D +G  G
Sbjct  230   MLIPNCLFRVGGAAVLLSNRSADRRRSKYRLVHVVRTHRGADDRAFRCVYQEQDDQGKVG  289

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K  +   + Y+P+FK A 
Sbjct  290   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLFNAKVKPYIPDFKLAF  349

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +E + MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  350   DHFCIHAGGRAVIDELEKNLQLTPVHVEPSRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  409

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G +VWQ+  G+G KCNS V Q +R +   +   PW DCI +YP+ L
Sbjct  410   GHRVWQIAFGSGFKCNSAVWQALRNV-KPSPNSPWEDCIDRYPVQL  454



>ref|XP_010498362.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Camelina sativa]
Length=516

 Score =   393 bits (1009),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 274/407 (67%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+ PP+  + P++ F+EH ++ G F DS  + F  KIL  SGL E TY+P A
Sbjct  111   PVYLVDFSCYLPPDHLKAPYARFMEHSRLTGDFDDS-ALEFQRKILERSGLGEDTYVPEA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +PAR     A  E   V+F     L +N  ++PKDI ILVVNCS F P PSL+++IV
Sbjct  170   MHHVPARISMAAAREEAEQVMFGALDNLFANANVNPKDIGILVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +K+
Sbjct  230   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENMTQNWYFGNKKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  +KY+L+  +RT    DD+ +    +++D  G TG
Sbjct  290   MLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  410   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS + + +R +   +   PW  CI KYP+ LS
Sbjct  470   GNRVWQIAFGSGFKCNSAIWEALRHV-KPSNNSPWEHCIDKYPVTLS  515



>ref|XP_011099560.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=497

 Score =   392 bits (1007),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 273/404 (68%), Gaps = 3/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ C KPP  CR+PFS F+EH +++    ++K + F  +IL  SGL E+T +PPA+
Sbjct  88    IYLVDFSCCKPPVTCRVPFSKFMEHSRLIHKG-NTKSIDFQMRILERSGLGEETCVPPAM  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP       A +E   V+F     L+    + PK+IDIL+VNCS F P PSL++++VN
Sbjct  147   HYIPPTPTTGAARDEAEAVIFSAIDSLMEKTGIRPKNIDILIVNCSVFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILST-GWYPGKEKA  906
             K+ +R+++K+FNL+GMGCSA  +++D+ R++++ H    A+++STEIL++  +Y G E+A
Sbjct  207   KYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHHNSYALVISTEILTSPNYYKGSERA  266

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMG AA+LLSNK    + AKYKLL  +RT    DD+ Y      ED+EG  G
Sbjct  267   MLLPNCLFRMGAAAILLSNKWRDSARAKYKLLHVVRTHKGADDKAYRCVYEQEDNEGKVG  326

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A 
Sbjct  327   INLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKMFNPKWKPYIPDFKQAF  386

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+KK
Sbjct  387   EHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKK  446

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   GDRVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWQDCIDRYPV  489



>ref|XP_008357196.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=516

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/404 (45%), Positives = 272/404 (67%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  + P+  F+EH ++   F DS  + F  KIL  SGL E+TY+P A
Sbjct  111   PVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDS-SLEFQRKILERSGLGEETYVPEA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A  E   V++     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  170   MHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  230   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENITQNWYFGNKKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D +G TG
Sbjct  290   MLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDKGKTG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F +S   +K    + + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLVVKKLFKSNVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  410   DHFCIHAGGRAVIDELEKNLQLLPXHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRIRR  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G+++WQ+  G+G KCNS V + +R +   +  GPW DCI KYP+
Sbjct  470   GNRIWQIAFGSGFKCNSAVWEALRNV-KPSCNGPWEDCIDKYPV  512



>ref|XP_004238271.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Solanum lycopersicum]
Length=517

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/406 (45%), Positives = 271/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY++DY C+K P   + P+  F++H ++ G F D   + F  KIL  SGL ++TY+P A
Sbjct  112   PVYLIDYSCYKAPEHLKAPYERFMQHSRLTGDF-DESSLEFQRKILERSGLGDETYVPEA  170

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P +   Q A  E   V+F    +L +N  + PK I +LVVNCS F P PSL+++IV
Sbjct  171   MHQLPPQPSMQAAREEAEQVMFGALDKLFANTSVKPKKIGVLVVNCSLFNPTPSLSAMIV  230

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  231   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKS  290

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG
Sbjct  291   MLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTG  350

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F  S   +K  +K  + Y+P+FK A 
Sbjct  351   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFGSLIIKKIFNKHIKPYIPDFKLAF  410

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+KK
Sbjct  411   DHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMKK  470

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G+KVWQ+  G+G KCNS V Q +R +   +  GPW DCI +YP+ +
Sbjct  471   GNKVWQIAFGSGFKCNSAVWQALRNV-KPSPDGPWEDCIDRYPVKV  515



>ref|XP_007222865.1| hypothetical protein PRUPE_ppa004284mg [Prunus persica]
 ref|XP_008220808.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Prunus mume]
 gb|EMJ24064.1| hypothetical protein PRUPE_ppa004284mg [Prunus persica]
Length=518

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 273/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  + P+  F+EH ++   F DS  + F  KIL  SGL E+TY+P A
Sbjct  113   PVYLVDYACYRPPDHLKAPYHRFMEHSRLTQDFDDS-SLEFQRKILERSGLGEETYVPEA  171

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A  E   V++     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  172   MHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFNPTPSLSAMIV  231

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +A D+ +++++ HR   A+++STE ++  WY G +K+
Sbjct  232   NKYKLRGNIRSFNLGGMGCSAGVIAADLAKDLLQIHRNTYAIVVSTENITQNWYFGNKKS  291

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+G +AVLLSNK      AKYKL+  +RT    DD+ +    +++D +G TG
Sbjct  292   MLIPNCLFRVGCSAVLLSNKSADWRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDKGKTG  351

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F +S   +K  + + + Y+P+FK A 
Sbjct  352   VSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLVVKKLFNANVKPYIPDFKLAF  411

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R++K
Sbjct  412   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRIRK  471

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V + +R +   ++ GPW DCI KYP+ L
Sbjct  472   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSRNGPWEDCIDKYPVKL  516



>ref|XP_006437664.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
 ref|XP_006484467.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Citrus sinensis]
 gb|ESR50904.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
Length=496

 Score =   391 bits (1004),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 277/403 (69%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    VYLVDYACYKPPVTCRVPFATFMEHSRLILKN-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  +V+F     LL    L PKDIDIL+VNCS F P PSL+++++N
Sbjct  147   HYIPPTPTMEAARGEAELVIFSAMDSLLQKTGLKPKDIDILIVNCSLFSPTPSLSAMLIN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             ++ +R+++K+FNL+GMGCSA  +++D+ R++++ H   NAV++STEI++  +Y G E+A 
Sbjct  207   QYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSN+R  +S AKY+L+  +RT    DD+ Y     +ED EG  G+
Sbjct  267   LLPNCLFRMGGAAILLSNRRRNRSRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   SLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLMTLIGRKIFNPKWKPYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+E K R+KKG
Sbjct  387   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMSYIEEKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C + I       PW+DCI +YP+
Sbjct  447   DRVWQIAFGSGFKCNSAVWKCNKTI-KTTTDNPWSDCIDRYPV  488



>ref|XP_010932594.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Elaeis guineensis]
Length=491

 Score =   390 bits (1002),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/403 (45%), Positives = 264/403 (66%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ C+KPP  CR P S F+ H + +  F +   + F  KIL  SGL E T LPPA 
Sbjct  80    IYLVDFACYKPPTSCRFPISKFMNHSKQIEDF-EPSSIEFQRKILERSGLGEDTSLPPAH  138

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP       +  E  +V+F I   L    K+ P+DIDILVVNCS F P PSL+++IVN
Sbjct  139   HAIPFTPTMAKSREESELVIFSIVDSLFQKTKVKPRDIDILVVNCSLFAPTPSLSAMIVN  198

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR++++++NL+GMGCSA  +++D+ R+ +  H    A++++TEI++  WY G  ++ 
Sbjct  199   KYKMRSNIRSYNLSGMGCSAGIISIDLARDELLVHANSYALVVTTEIITEHWYTGNRRSM  258

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAAVLLSNKR   + AKY+LL  +RT    DDR Y    ++ED E   G+
Sbjct  259   LLANCLFRMGGAAVLLSNKRREATRAKYELLHVVRTHKGADDRAYRCVYQEEDGEKKIGV  318

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D+  +AG  L+ +I  +G   LP++E + F  +   R+F +     YVP+F  A +
Sbjct  319   SLSRDLTEIAGGALKANITTIGPLVLPLSEQVLFFVNKVGRRFANPKWRPYVPDFTKAFE  378

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E   +L+L +   EA+ MTL+RFGN SS+S WYEL Y+EAK R++KG
Sbjct  379   HFCIHAGGRAVIEELGTKLRLSEEQTEASRMTLHRFGNTSSSSPWYELGYVEAKGRMRKG  438

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+G+G+G KCNS V +C R + G  ++G WADCI +YP+
Sbjct  439   DRVWQIGLGSGFKCNSAVWRCRRSV-GREEEGVWADCIDEYPV  480



>gb|KDP46259.1| hypothetical protein JCGZ_10099 [Jatropha curcas]
Length=510

 Score =   391 bits (1004),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 185/405 (46%), Positives = 268/405 (66%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP   ++ F  F+EH ++ G F D   + F  KIL  SGL E+TY+P A+
Sbjct  106   VYLVDYACYKPPPKLQVKFHQFMEHSKLTGDF-DESSLEFQRKILERSGLGEETYVPEAM  164

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++I+N
Sbjct  165   HHIPPRPSMAAAREEAEQVMFGALDILFANTNIKPKDIGILVVNCSLFNPTPSLSAMIIN  224

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++ +FNL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  225   KYKLRGNILSFNLGGMGCSAGVIAIDLTKDLLQIHRNSYAVVVSTENITQNWYFGNKKSM  284

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAAVLLSNK   +  AKYKL+  +RT    DD+ +    +++D EG TG+
Sbjct  285   LIPNCLFRVGGAAVLLSNKSTDRRRAKYKLVHLVRTHRGADDKAFRCVYQEQDDEGKTGV  344

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K  +   + Y+P+FK A  
Sbjct  345   SLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLFNAKVKPYIPDFKLAFD  404

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R+++G
Sbjct  405   HFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRRG  464

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             ++VWQ+  G+G KCNS V Q +R I   +   PW DCI +YP+ L
Sbjct  465   NRVWQIAFGSGFKCNSAVWQALRNI-KPSTNNPWEDCIDRYPVQL  508



>ref|XP_002963631.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
 gb|EFJ35502.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
Length=534

 Score =   391 bits (1005),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/405 (44%), Positives = 273/405 (67%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             V++VDY C KP    R+PF+SF+EH ++ G F D K + F  +IL  SGL EQT LPPA+
Sbjct  125   VFLVDYACHKPSPNIRVPFASFMEHSKLSGSF-DDKSLEFQRRILERSGLGEQTALPPAM  183

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P R     A  E   V+F    +L     + PKD+ ILVVNCS F P PSL+++IVN
Sbjct  184   HYLPPRPSMDAARQEAETVMFSALDELFHKTGVKPKDVGILVVNCSLFNPTPSLSAMIVN  243

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR +++++NL GMGCSA  +A+D+ +++++ H    A+++STE ++  WY G  ++ 
Sbjct  244   KYKMRGNIRSYNLGGMGCSAGVIAIDLAKDMLQVHGNDYAIVVSTENITQNWYFGNRRSM  303

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAA+LLSN+R  +  AKY+LL ++RT    DD+ +    ++ED     G+
Sbjct  304   LIPNCLFRVGGAAMLLSNRRSDRRRAKYELLHTVRTHKGADDKSFRCVYQEEDENSKMGV  363

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG+ L+T+I  +G   LP++E + F +    RK   ++ + Y+P+F+ A  
Sbjct  364   SLSKDLMAIAGQALKTNITTMGPLVLPLSEQIIFFSFLVARKVFKRAVKPYIPDFRLAFH  423

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTLYRFGN SS+S+WYELAY+EAK R++KG
Sbjct  424   HFCIHAGGRAVIDELEKNLQLTAEHVEASRMTLYRFGNTSSSSIWYELAYIEAKGRMRKG  483

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             ++VWQ+  G+G KCNS V + +R I   ++KGPWADCI ++P+ +
Sbjct  484   NRVWQIAFGSGFKCNSAVWRALRTI-KASEKGPWADCIDQFPVAI  527



>ref|XP_002321310.2| very-long-chain fatty acid condensing enzyme family protein [Populus 
trichocarpa]
 gb|EEE99625.2| very-long-chain fatty acid condensing enzyme family protein [Populus 
trichocarpa]
Length=539

 Score =   392 bits (1006),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 273/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY++DY C++ P+  + PF+ F+EH ++ G F D   + F  KIL  SGL E+TY+P A
Sbjct  134   PVYLIDYSCYRAPDHLKAPFNQFMEHSRLTGDF-DDTSLEFQRKILERSGLGEETYVPEA  192

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H+IP R     A  E   V+F     L +N +++PK I ILVVNCS F P PSL+++IV
Sbjct  193   MHYIPPRPSMAAAREEAEQVMFGALDNLFTNTQVNPKSIGILVVNCSLFNPTPSLSAMIV  252

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  253   NKYRLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKS  312

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSN+   K   KYKL+  +RT    DD+ +    +++D  G TG
Sbjct  313   MLIPNCLFRVGGSAVLLSNESADKRKGKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTG  372

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K ++K    Y+P+FK A 
Sbjct  373   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVVKKLLNKKMMPYIPDFKLAF  432

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK+R++K
Sbjct  433   DHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKQRMQK  492

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V + +R +   +   PW DCI  YP+ L
Sbjct  493   GNRVWQIAFGSGFKCNSAVWEALRDV-KPSCNSPWEDCIDMYPVKL  537



>gb|ACT21783.1| CER6 [Solanum lycopersicum]
Length=496

 Score =   390 bits (1002),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/403 (45%), Positives = 274/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+K P  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LPPA+
Sbjct  88    IYLVDYSCYKAPVTCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPPAI  146

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A NE  +V+F     L+    L PKDIDILVVNCS F P PSL++++VN
Sbjct  147   HYIPPTPTMETARNEAEVVIFSAIDDLMKKTGLKPKDIDILVVNCSLFSPTPSLSAMVVN  206

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K++NL+GMGCSA  +++D+ R++++      A+++STEI++  +Y G E+A 
Sbjct  207   KYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSCALVVSTEIITPNYYQGSERAM  266

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGGAA+LLSNKR+  + AKY+L+  +RT    DD+ +    + ED +G  G+
Sbjct  267   LLPNCLFRMGGAAILLSNKRKDSARAKYRLMHVVRTHKGADDKAFKCVFQQEDPQGKVGI  326

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  327   NLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFE  386

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             H C  A G++V+ E  K L+L    +EA+ MTL++FGN S +SLWYE++Y+EAK R+KKG
Sbjct  387   HSCIHAGGRAVIDELQKNLQLSAEHVEASKMTLHKFGNTSPSSLWYEMSYIEAKGRMKKG  446

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D++WQ+  G+G KCNS V +C R I      GPW DCI +YP+
Sbjct  447   DRIWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWDDCIDRYPV  488



>ref|XP_002974719.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
 gb|EFJ24239.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
Length=534

 Score =   391 bits (1005),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/405 (44%), Positives = 273/405 (67%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             V++VDY C KP    R+PF+SF+EH ++ G F D K + F  +IL  SGL EQT LPPA+
Sbjct  125   VFLVDYACHKPSPNIRVPFASFMEHSKLSGSF-DDKSLEFQRRILERSGLGEQTALPPAM  183

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P R     A  E   V+F    +L     + PKD+ ILVVNCS F P PSL+++IVN
Sbjct  184   HYLPPRPSMDAARQEAETVMFSALDELFHKTGVKPKDVGILVVNCSLFNPTPSLSAMIVN  243

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR +++++NL GMGCSA  +A+D+ +++++ H    A+++STE ++  WY G  ++ 
Sbjct  244   KYKMRGNIRSYNLGGMGCSAGVIAIDLAKDMLQVHGNDYAIVVSTENITQNWYFGNRRSM  303

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAA+LLSN+R  +  AKY+LL ++RT    DD+ +    ++ED     G+
Sbjct  304   LIPNCLFRVGGAAMLLSNRRSDRRRAKYELLHTVRTHKGADDKSFRCVYQEEDENAKMGV  363

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG+ L+T+I  +G   LP++E + F +    RK   ++ + Y+P+F+ A  
Sbjct  364   SLSKDLMAIAGQALKTNITTMGPLVLPLSEQIIFFSFLVARKVFKRAVKPYIPDFRLAFH  423

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTLYRFGN SS+S+WYELAY+EAK R++KG
Sbjct  424   HFCIHAGGRAVIDELEKNLQLTAEHVEASRMTLYRFGNTSSSSIWYELAYIEAKGRMRKG  483

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             ++VWQ+  G+G KCNS V + +R I   ++KGPWADCI ++P+ +
Sbjct  484   NRVWQIAFGSGFKCNSAVWRALRTI-KASEKGPWADCIDQFPVAI  527



>gb|AGK30005.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=515

 Score =   390 bits (1003),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 186/407 (46%), Positives = 269/407 (66%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  + P+  FLEH ++ G F D   + F  KIL  SGL E+TY+P A
Sbjct  110   PVYLVDYSCYRPPDHLKAPYGRFLEHSRLTGDF-DESSLEFQRKILERSGLGEETYVPKA  168

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H IP       A  E   V+F     L  N  +SPKDI ILVVNCS F P PSL+++IV
Sbjct  169   MHSIPPTPSMAAAREEAEEVMFGALDTLFRNTNVSPKDIGILVVNCSLFNPTPSLSAMIV  228

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G  K+
Sbjct  229   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNNKS  288

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG
Sbjct  289   MLIPNCLFRVGGSAVLLSNKSNDRRRAKYKLIHVVRTHRGADDKAFRCVYQEQDDAGKTG  348

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F  +   +K  + S + Y+P+FK A 
Sbjct  349   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFTTLAVKKLFNASVKPYIPDFKLAF  408

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R++ 
Sbjct  409   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRIRN  468

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
              +++WQ+  G+G KCNS V Q +R +   +  GPW DCI KYP+ +S
Sbjct  469   RNRIWQIAFGSGFKCNSAVWQALRNV-KPSSNGPWEDCIDKYPVKIS  514



>ref|XP_008444712.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis melo]
Length=514

 Score =   390 bits (1002),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 271/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++P +  + PF  F+EH ++ G F DS  + F  KIL  SGL E+TY+P A
Sbjct  109   PVYLVDYSCYRPADDLKAPFHRFMEHSRLTGDFDDSS-LEFQRKILERSGLGEETYVPEA  167

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H IP       A  E   V+F    +L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  168   MHCIPPTPSMAAAREEAEQVMFGALDKLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIV  227

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  228   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTLAVVVSTENITQNWYFGNKKS  287

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKY+L+  +RT    DD+ +    +++D  G TG
Sbjct  288   MLIPNCLFRVGGSAVLLSNKSADRRRAKYRLIHIVRTHRGADDKAFRCVYQEQDDVGKTG  347

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +KF + + + Y+P+FK A 
Sbjct  348   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKKFFNGNVKPYIPDFKLAF  407

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY EAK R+ K
Sbjct  408   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMHK  467

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V + +R +   +Q  PW DCI  YP+ L
Sbjct  468   GNRVWQIAFGSGFKCNSAVWEALRNV-RPSQSSPWEDCIDNYPVKL  512



>ref|XP_006346917.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=496

 Score =   389 bits (1000),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 181/402 (45%), Positives = 270/402 (67%), Gaps = 2/402 (0%)
 Frame = -2

Query  1439  YVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPALH  1260
             Y+VDY C+KPP  CR+PFS+F+EH +++    + K V F  +IL  SGL E+T LP  +H
Sbjct  89    YLVDYSCYKPPVVCRVPFSTFMEHSRLILKD-NPKSVEFQMRILERSGLGEETCLPRPIH  147

Query  1259  FIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVNK  1080
             +IP     + A  E   V+F     L++   L PKDIDIL+VNCS F P PSL++++VNK
Sbjct  148   YIPPTPTMEAARGEAEEVIFTTIDDLMNKTGLKPKDIDILIVNCSLFSPTPSLSAMVVNK  207

Query  1079  FAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAFL  900
             + +R+++K++NL+GMGCSA  +++D+ R++++ H    A+++STEI++  +Y G E+A L
Sbjct  208   YKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSYALVISTEIITPNYYKGSERAML  267

Query  899   VLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGMR  720
             + NC+FRMGGAA+LLSNKR  +  AKY+L+  +RT    DD+ +      ED +G  G+ 
Sbjct  268   LPNCLFRMGGAAILLSNKRRDRYRAKYRLMHVVRTHKGADDKAFKCVFEQEDPQGKVGVN  327

Query  719   LNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQH  540
             L+ D++ +AGE L+++I  +G   LP +E L F  +   RK  +   + Y+P+FK A +H
Sbjct  328   LSKDLMVIAGEALKSNITTIGPLVLPASEQLLFQLTLIGRKIFNPKWKPYIPDFKQAFEH  387

Query  539   FCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKGD  360
             FC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+K+GD
Sbjct  388   FCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKRGD  447

Query  359   KVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             +VWQ+  G+G KCNS V +C R I      GPW  CI KYP+
Sbjct  448   RVWQIAFGSGFKCNSAVWKCNRTI-KTPTDGPWQHCIDKYPV  488



>ref|XP_002305431.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
 gb|EEE85942.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
Length=510

 Score =   390 bits (1001),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 183/405 (45%), Positives = 270/405 (67%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP   ++ +  F+EH ++ G F DS  + F  +IL  SGL E+TY P A+
Sbjct  106   VYLVDYACYKPPAKLQVKYEQFMEHSKLTGDFDDS-SLEFQRRILERSGLGEETYAPEAM  164

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP R     A  E   V+F     L +N  + PKDI +LVVNCS F P PSL+++IVN
Sbjct  165   HYIPPRPSMAAAREEAEQVMFGALDVLFANTNIKPKDIGVLVVNCSLFNPTPSLSAMIVN  224

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R +++TFNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  225   KYKLRGNIRTFNLGGMGCSAGVIAVDLAKDMLQIHRNTCAVVVSTENITQNWYFGNKKSM  284

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+AVLLSNK + +  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  285   LIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADDKAFKCVYQEQDDAGKTGV  344

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LPI+E L F ++   +K  +   + Y+P+FK A  
Sbjct  345   SLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKKLFNAKVKPYIPDFKLAFD  404

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY EAK RV++G
Sbjct  405   HFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRVRRG  464

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             ++VWQ+  G+G KCNS V + +R +   +   PW DCI KYP+ +
Sbjct  465   NRVWQIAFGSGFKCNSAVWEALRYV-KPSTSNPWEDCIDKYPVQI  508



>emb|CDX68323.1| BnaA07g23630D [Brassica napus]
Length=451

 Score =   387 bits (995),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 269/403 (67%), Gaps = 3/403 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y++D+ C++PP+F R P ++F+EH+ +  G FD + +   +KIL  SG+ +   +P  +
Sbjct  46    IYLIDFSCYQPPDFLRSPIANFIEHLNL-SGIFDRECLDLQQKILERSGIGDDACVPVTV  104

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP  S    A  E H +LF + Q L S +K+ PK IDILV NCS FCP PS+ SII+N
Sbjct  105   HEIPPHSSLSAAREETHDILFTVVQDLFSKHKIDPKSIDILVSNCSLFCPSPSITSIIIN  164

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             +F MR++VK+F+L+GMGCSA  L++++V+++MK H    A++LS E +S   Y GK K+ 
Sbjct  165   RFGMRSNVKSFSLSGMGCSAGLLSINLVKDLMKIHGGSLALVLSMEAVSPNGYKGKCKSM  224

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ N IFRMGGAA+LLSN+ + K  AKYKL   +RT    DD  Y + +++ D EGL G+
Sbjct  225   LIANTIFRMGGAAILLSNRDQDKDKAKYKLQHLIRTHLGSDDESYESVMQEVDEEGLVGV  284

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+  ++ VA + L+ ++  LG + LP +E L+++ S  KRK+  K  E+Y PNFK A +
Sbjct  285   ALSKQLVKVASKALKINVVELGPRVLPYSEQLKYIISFIKRKW-GKQNEMYTPNFKKAFE  343

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++++    K LKLG  D EA+  TLYR+GN SS+SLWYE+ YLEAK R+KKG
Sbjct  344   HFCIHAGGRAIIEGVEKHLKLGKEDGEASRTTLYRYGNTSSSSLWYEMQYLEAKGRMKKG  403

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+G G+G K NS V +CI  I     K  W+D IH YP+
Sbjct  404   DRVWQIGFGSGFKANSAVWKCITKI-DSRDKNAWSDRIHLYPV  445



>ref|XP_002283730.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
 emb|CAN74750.1| hypothetical protein VITISV_023219 [Vitis vinifera]
Length=492

 Score =   389 bits (998),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/403 (44%), Positives = 274/403 (68%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY CFKPP  CR+PF++F+EH +++    + K V F  +IL  SGL E+T LP A 
Sbjct  84    IYLVDYACFKPPVTCRVPFATFMEHSRLINSD-NPKSVEFQMRILERSGLGEETCLPAAN  142

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP +   + +  E  +V+F     LL    +  KDIDIL+VNCS F P PSL+++++N
Sbjct  143   HYIPPKPTMEASRGEAELVIFSAIDDLLKKTGIKTKDIDILIVNCSLFSPTPSLSAMVIN  202

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++++FNL+GMGCSA  +++D+ R++++ H    A+++STEI++  +Y G ++A 
Sbjct  203   KYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSYALVISTEIITPNYYSGNQRAM  262

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+LLSN+R  +  AKY+L+  +RT    DD+ Y     +ED +G  G+
Sbjct  263   LLPNCLFRMGAAAILLSNRRRERRRAKYRLVHLVRTHKGADDKAYRCVYEEEDPQGKVGI  322

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  +G   LP +E L FL +   RK  +   + Y+P+FK A +
Sbjct  323   SLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKEAFE  382

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYE++Y+EAK R+KKG
Sbjct  383   HFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKKG  442

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             ++VWQ+  G+G KCNS V +C R I      GPWADCI +YP+
Sbjct  443   NRVWQIAFGSGFKCNSAVWKCNRTITTPTD-GPWADCIDRYPV  484



>gb|ACQ41892.1| 3-ketoacyl-CoA synthase [Camellia oleifera]
Length=525

 Score =   389 bits (1000),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 269/406 (66%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++ P+  +   S FLEH ++ G F D   + F  KIL  SGL E+TY P +
Sbjct  120   PVYLVDYACYRAPDHLKASSSRFLEHSRLTGDF-DESSLEFQRKILERSGLGEETYAPES  178

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H IP R     A  E  MV++     L +N  + PKDI +LVVNCS F P PSL+++I+
Sbjct  179   MHCIPPRPSMAAAREEAEMVMYGALDNLFANTSIKPKDIGVLVVNCSLFNPTPSLSAMII  238

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +A+D+ ++++  HR   AV++STE ++  WY G +K+
Sbjct  239   NKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLLVHRNTLAVVVSTENMTQNWYFGNKKS  298

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG
Sbjct  299   MLIPNCLFRVGGSAVLLSNKYADRRRAKYKLVHVVRTHKGADDKAFRCVYQEQDDAGKTG  358

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K  +K+ + Y+P+F  A 
Sbjct  359   VSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFATLVVKKLFNKNIKPYIPDFTLAF  418

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R++K
Sbjct  419   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRIRK  478

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G +VWQ+  G+G KCNS V + +R +    + GPW DCI KYP+ L
Sbjct  479   GHQVWQIAFGSGFKCNSAVWKALRNV-KHPRNGPWEDCIDKYPVEL  523



>ref|XP_009104926.1| PREDICTED: 3-ketoacyl-CoA synthase 7-like [Brassica rapa]
Length=451

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 269/403 (67%), Gaps = 3/403 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y++D+ C++PP+F R P ++F+EH+ +  G FD + +   +KIL  SG+ +   +P  +
Sbjct  46    IYLIDFSCYQPPDFLRSPIANFIEHLNL-SGIFDRECLDLQQKILERSGIGDDACVPVTV  104

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP  S    A  E H +LF + Q L S +K+ PK IDILV NCS FCP PS+ SII+N
Sbjct  105   HEIPPHSSLSAAREETHDILFTVVQDLFSKHKIDPKSIDILVSNCSLFCPSPSITSIIIN  164

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             KF MR++VK+F+L+GMGCSA  L++++V+++MK H    A++LS E +S   Y GK K+ 
Sbjct  165   KFGMRSNVKSFSLSGMGCSAGLLSINLVKDLMKIHGGSLALVLSMEAVSPNGYKGKCKSM  224

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ N IFRMGGAA+LLSN+ + K  AKYKL   +RT    DD  Y + +++ D EGL G+
Sbjct  225   LIANTIFRMGGAAILLSNREQDKDKAKYKLQHLVRTHLGSDDESYESVMQEVDEEGLVGV  284

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+  ++ VA + L+ ++  LG + LP +E L+++ S  KRK+  K  E+Y PNFK A +
Sbjct  285   ALSKQLVKVASKALKINVVELGPRVLPYSEQLKYIISFIKRKW-GKQNEMYTPNFKKAFE  343

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++++    K LKL   D EA+  TLYR+GN SS+SLWYE+ YLEAK R+KKG
Sbjct  344   HFCIHAGGRAIIEGVEKHLKLEKEDGEASRTTLYRYGNTSSSSLWYEMQYLEAKGRMKKG  403

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+G G+G K NS V +CI  I    +K  W+D IH YP+
Sbjct  404   DRVWQIGFGSGFKANSAVWKCITKI-DSREKNAWSDRIHLYPV  445



>ref|XP_004507452.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cicer arietinum]
Length=505

 Score =   389 bits (998),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/405 (44%), Positives = 271/405 (67%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VD+ C+KPP+   + F+ F+EH ++ G F D   + F  KIL  SGL E+TYLP A+
Sbjct  101   VYLVDFSCYKPPSNLSVKFTKFVEHSRLKGDF-DESSLEFQRKILERSGLGEETYLPEAM  159

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP       A  E   V++     L +N K+ PKDI ILVVNCS F P PSL+++IVN
Sbjct  160   HQIPPTPSMASAREEAEQVMYGALDNLFANTKIKPKDIGILVVNCSLFNPTPSLSAMIVN  219

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  220   KYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  279

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAAVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  280   LIPNCLFRVGGAAVLLSNKGSDRRRAKYKLVHVVRTHKGADDKAFKCVYQEQDDVGKTGV  339

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LP++E L F  +   +K  +   + Y+P+FK A +
Sbjct  340   SLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFTTLVVKKLFNAKAKPYIPDFKLAFE  399

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R++KG
Sbjct  400   HFCIHAGGRAVIDELEKNLQLLPMHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRKG  459

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             +++WQ+  G+G KCNS V Q ++ +   + K PW DCI +YP+ +
Sbjct  460   NRIWQIAFGSGFKCNSAVWQAMKHVRASS-KSPWEDCIDRYPVEI  503



>emb|CDY49219.1| BnaCnng17080D [Brassica napus]
Length=453

 Score =   386 bits (992),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 186/404 (46%), Positives = 269/404 (67%), Gaps = 3/404 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y++D+ C++PP+F R P ++F+EH+ +  G FD + +   +KIL  SG+ +   +P  +
Sbjct  46    IYLIDFSCYQPPDFLRSPIANFIEHLNL-SGIFDRECLDLQQKILERSGIGDDACVPVTV  104

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP  S    A  E H +LF + Q L S +K+ PK IDILV NCS FCP PS+ SII+N
Sbjct  105   HEIPPHSSLSAAREETHDILFTVVQDLFSKHKIDPKSIDILVSNCSLFCPSPSITSIIIN  164

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             KF MR++VK+F+L+GMGCSA  L++++V+++MK H    A++LS E +S   Y GK K+ 
Sbjct  165   KFGMRSNVKSFSLSGMGCSAGLLSINLVKDLMKIHSGSLALVLSMEAVSPNGYKGKCKSM  224

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ N IFRMGGAA+LLSN+   K  AKYKL   +RT    DD  Y + +++ D EGL G+
Sbjct  225   LIANTIFRMGGAAILLSNRERDKDKAKYKLQHLIRTHLGSDDESYESVMQEVDEEGLVGV  284

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFID-KSTEIYVPNFKSAI  546
              L+  ++ VA + L+ ++  LG + LP +E L+++ S  KRK+ + K  E+Y PNFK A 
Sbjct  285   ALSKQLVKVASKALKINVVELGPRVLPYSEQLKYIISFIKRKWRNHKEKEVYTPNFKKAF  344

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++++    K LKL   D EA+  TLYR+GN SS+SLWYE+ YLEAK R+KK
Sbjct  345   EHFCIHAGGRAIIEGVEKHLKLEKEDGEASRTTLYRYGNTSSSSLWYEMQYLEAKGRMKK  404

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             GD+VWQ+G+G+G K NS V +C+  I     K  W+D IH YP+
Sbjct  405   GDRVWQIGLGSGFKANSAVWKCVSEI-DSRDKNAWSDRIHLYPV  447



>ref|XP_004959613.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Setaria italica]
Length=573

 Score =   390 bits (1002),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 261/408 (64%), Gaps = 7/408 (2%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             + +VD+ C KPP   RIP +  LEH +++G  FD   V FM K++  SG+  +TY PP+L
Sbjct  64    IGLVDFSCLKPPRRLRIPVAGLLEHFRLIG-CFDDGSVEFMTKVIEASGMGNETYFPPSL  122

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP  +   DA+ E HM+ FP    L +   + P  +  LVVNCSGFCP PSLA+II N
Sbjct  123   HYIPPAATHADAVQEAHMLFFPALDDLFAKTGVPPSAVGALVVNCSGFCPAPSLAAIIAN  182

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             ++ MR DVKTFNL+GMGC+A  + VD+ R ++ TH    A+++S EI++ GWY GK++  
Sbjct  183   RYRMRDDVKTFNLSGMGCAAGVVGVDVARRLLLTHAMPYAIVVSAEIVTVGWYSGKDQGK  242

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+LNC FR G +A L++N R A    KY+L    RT    +DR Y +  RDED EG+TG 
Sbjct  243   LLLNCYFRTGCSAALVTNGRGAAP-VKYRLASLTRTNQIANDRSYRSGYRDEDDEGITGF  301

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTE-----IYVPNF  558
              L   V  +  E L+ H+  LG   LP  E LR+  +  +      S++     + +P+F
Sbjct  302   TLGQGVGRMVSELLRAHLVTLGLSILPWREKLRYALALLRSSRDGDSSKLPRGAVPLPDF  361

Query  557   KSAIQHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKE  378
             ++A +HFC P++G+ ++    + L LG+ +MEAALMT +RFGNQS+ASLWY+LAYLEAK 
Sbjct  362   RAAAEHFCLPSSGRPMIWRLGQGLGLGEREMEAALMTFHRFGNQSAASLWYQLAYLEAKG  421

Query  377   RVKKGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             RV+ GD VWQLG+G+G K NSLV + +    GE + GPW  CIHKY +
Sbjct  422   RVRAGDTVWQLGIGSGLKANSLVWERVAGSDGERELGPWVGCIHKYAV  469



>ref|XP_004152699.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis sativus]
 gb|KGN62598.1| hypothetical protein Csa_2G361630 [Cucumis sativus]
Length=514

 Score =   388 bits (996),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 185/406 (46%), Positives = 271/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++P +  + PF  F+EH ++ G F DS  + F  KIL  SGL E+TY+P A
Sbjct  109   PVYLVDYSCYRPADDLKAPFHRFMEHSRLTGDFDDSS-LEFQRKILERSGLGEETYVPEA  167

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H IP       A  E   V+F    +L ++  + PKDI ILVVNCS F P PSL+++IV
Sbjct  168   MHCIPPTPSMAAAREEAEQVMFGALDKLFASTNVKPKDIGILVVNCSLFNPTPSLSAMIV  227

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  228   NKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTLAVVVSTENITQNWYFGNKKS  287

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKY+L+  +RT    DD+ +    +++D  G TG
Sbjct  288   MLIPNCLFRVGGSAVLLSNKSADRRRAKYRLIHIVRTHRGADDKAFRCVYQEQDDVGKTG  347

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +KF + + + Y+P+FK A 
Sbjct  348   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKKFFNGNVKPYIPDFKLAF  407

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY EAK R+ K
Sbjct  408   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMHK  467

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V + +R +   +Q  PW DCI  YP+ L
Sbjct  468   GNRVWQIAFGSGFKCNSAVWEALRNV-RPSQSSPWEDCIDNYPVKL  512



>ref|XP_002979460.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii]
 gb|EFJ19349.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii]
Length=510

 Score =   387 bits (995),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 274/406 (67%), Gaps = 4/406 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PV+++D+ C+ PP    + F  F+EH ++  G FD + + F  KIL+ +GL E+TYLP A
Sbjct  99    PVFLLDFSCYLPPPHLEVKFQRFMEHSRL-SGHFDDRSLDFQRKILSRAGLGEETYLPAA  157

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH +P+R+    A  E   V+F    +LL    + PKDI +LVVNCS F P PSL+++I+
Sbjct  158   LHELPSRACMATARLEAEEVMFGAVDELLQRTGIRPKDIGVLVVNCSLFNPTPSLSAMII  217

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++ MR +VK++NL GMGCSA  +AVD+ R+I++  RR  A+++STE ++  WY G +++
Sbjct  218   NRYKMRGNVKSYNLGGMGCSAGVIAVDLARDILQVERRTYALVVSTENVTQNWYSGNQRS  277

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LL+N+R  +  AKY+L+ ++RT    DD+ Y    +++D +G  G
Sbjct  278   MLIPNCLFRMGGAALLLTNRRAKRHRAKYELVHTVRTHKGADDKCYGCVYQEQDGDGKMG  337

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKST--EIYVPNFKS  552
             + L+ +++ +AG+ L+T+I  LG   LP++E + F      RK   +    + Y+P+FK 
Sbjct  338   VSLSKELMAIAGDALKTNITTLGPLVLPLSEQIIFFVVLVLRKLTKRKNRFKTYIPDFKL  397

Query  551   AIQHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERV  372
             A +HFC  A G++V+ E  K L+L +  +EA+ MTL+RFGN SS+S+WYELAYLEAK RV
Sbjct  398   AFEHFCIHAGGRAVIDELEKNLQLTERHVEASRMTLHRFGNTSSSSIWYELAYLEAKGRV  457

Query  371   KKGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             K+GD+VWQ+  G+G KCNS V + +R I   +  GPW DCI KYP+
Sbjct  458   KRGDRVWQIAFGSGFKCNSAVWRALRSIKPPSH-GPWEDCIDKYPV  502



>ref|XP_009782317.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nicotiana sylvestris]
Length=518

 Score =   387 bits (995),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 184/405 (45%), Positives = 263/405 (65%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VDY C+ PP   ++ FS F+ H ++ G F +S  + F  KIL  SGL E+TYLP AL
Sbjct  114   IYLVDYSCYHPPEHLKVKFSKFMGHSRLSGDFNES-SLEFQRKILERSGLGEETYLPEAL  172

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H +P R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  173   HDVPPRPSMATAREEAEQVMFGALDNLFNNTNVKPKDIGILVVNCSLFNPTPSLSAMIVN  232

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ MR ++K+FNL GMGCSA  +A+D+ +++++ HR   AV++S E ++   Y G  KA 
Sbjct  233   KYKMRGNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSMENITQNRYFGNNKAM  292

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAA+LLSNK   K  AKYK++  +RT    DD  +    +++D  G TG+
Sbjct  293   LIPNCLFRVGGAAILLSNKSGDKRRAKYKVVHVVRTHKGADDTAFKCVYQEQDDNGKTGV  352

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LPI+E L F  S   RK      + Y+P+FK A +
Sbjct  353   SLSKDLMSIAGNALKTNITTLGPLVLPISEQLLFFMSLVARKLFHAKIKPYIPDFKMAFE  412

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R++KG
Sbjct  413   HFCIHAGGRAVIDELEKNLQLSPLHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRIRKG  472

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
              ++WQ+  G+G KCNS V Q +  +   +   PW DCIH+YP+ L
Sbjct  473   HRIWQIAFGSGFKCNSAVWQALTNV-KPSPNSPWEDCIHRYPVQL  516



>gb|AGH32920.1| ketoacyl-CoA synthase [Camellia chekiangoleosa]
Length=517

 Score =   387 bits (995),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 268/406 (66%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++ P+  +  +  F+ H ++ G F D   + F  KIL  SGL E+TY P A
Sbjct  112   PVYLVDYACYRAPDHLKASYHKFMNHSRLTGDF-DESSLEFQRKILERSGLGEETYFPEA  170

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H IP R     A +E   V+F     L +N  +  KDI +LVVNCS F P PSL+++IV
Sbjct  171   MHSIPPRPSMAAARDEAEQVMFGALDNLFANTNVKSKDIGVLVVNCSLFNPTPSLSAMIV  230

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +V++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G  K+
Sbjct  231   NKYKLRGNVRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTCAVVVSTENITQNWYFGNNKS  290

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG
Sbjct  291   MLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHKGADDKAFRCVYQEQDDVGKTG  350

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K  +K+ + Y+P+F  A 
Sbjct  351   VSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFATLVVKKLFNKNIKPYIPDFTLAF  410

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R++K
Sbjct  411   DHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRK  470

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G +VWQ+  G+G KCNS V + +R +  + + GPW DCI KYP+ L
Sbjct  471   GHRVWQIAFGSGFKCNSAVWKALRNV-KQPRNGPWEDCIDKYPVEL  515



>ref|XP_007200967.1| hypothetical protein PRUPE_ppa004500mg [Prunus persica]
 gb|EMJ02166.1| hypothetical protein PRUPE_ppa004500mg [Prunus persica]
Length=506

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/406 (45%), Positives = 269/406 (66%), Gaps = 8/406 (2%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP+  ++ F  F+EH ++ G F D   + F  KIL  SGL E+TY+P A+
Sbjct  102   VYLVDYSCYKPPSHLQVRFQQFMEHSKLTGDF-DESSLEFQRKILERSGLGEETYVPEAM  160

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  161   HYLPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVN  220

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +AVD+ + +++ H    AV++STE ++  WY G +K+ 
Sbjct  221   KYKLRGNIRSFNLGGMGCSAGVIAVDLAKEMLQVHGNAYAVVVSTENITQNWYFGNKKSM  280

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAAVLLSNK   +  AKYKL+  +RT    DD+ +    +++D+ G TG+
Sbjct  281   LIPNCLFRVGGAAVLLSNKSLDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDNTGKTGV  340

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LP++E L F A+   +K  +   + Y+P+FK A  
Sbjct  341   SLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLFNAKVKPYIPDFKLAFD  400

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R++KG
Sbjct  401   HFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMQKG  460

Query  362   DKVWQLGMGTGPKCNSLV---LQCIRPILGEAQKGPWADCIHKYPI  234
             ++VWQ+  G+G KCNS V   LQ ++P L      PW DCI +YP+
Sbjct  461   NRVWQIAFGSGFKCNSAVWEALQNVKPSL----HSPWEDCIDRYPV  502



>ref|XP_002977865.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii]
 gb|EFJ21203.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii]
Length=510

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 274/406 (67%), Gaps = 4/406 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PV+++D+ C+ PP    + F  F+EH ++  G FD + + F  KIL+ +GL E+TYLP A
Sbjct  99    PVFLLDFSCYLPPPHLEVKFQRFMEHSRL-SGHFDDRSLDFQRKILSRAGLGEETYLPAA  157

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH +P+R+    A  E   V+F    +LL    + PKDI +LVVNCS F P PSL+++I+
Sbjct  158   LHELPSRACMATARLEAEEVMFGAVDELLQRTGIRPKDIGVLVVNCSLFNPTPSLSAMII  217

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++ MR ++K++NL GMGCSA  +AVD+ R+I++  RR  A+++STE ++  WY G +++
Sbjct  218   NRYKMRGNIKSYNLGGMGCSAGVIAVDLARDILQVERRTYALVVSTENITQNWYSGNQRS  277

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FRMGGAA+LL+N+R  +  AKY+L+ ++RT    DD+ Y    +++D +G  G
Sbjct  278   MLIPNCLFRMGGAALLLTNRRAKRHRAKYELVHTVRTHKGADDKCYGCVYQEQDGDGKMG  337

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKST--EIYVPNFKS  552
             + L+ +++ +AG+ L+T+I  LG   LP++E + F      RK   +    + Y+P+FK 
Sbjct  338   VSLSKELMAIAGDALKTNITTLGPLVLPLSEQIIFFVVLVLRKLTKRKNRFKTYIPDFKL  397

Query  551   AIQHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERV  372
             A +HFC  A G++V+ E  K L+L +  +EA+ MTL+RFGN SS+S+WYELAYLEAK RV
Sbjct  398   AFEHFCIHAGGRAVIDELEKNLQLTERHVEASRMTLHRFGNTSSSSIWYELAYLEAKGRV  457

Query  371   KKGDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             K+GD+VWQ+  G+G KCNS V + +R I   +  GPW DCI KYP+
Sbjct  458   KRGDRVWQIAFGSGFKCNSAVWRALRSIKPPSH-GPWEDCIDKYPV  502



>ref|XP_009378513.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=506

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 182/406 (45%), Positives = 268/406 (66%), Gaps = 8/406 (2%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP+  ++ +  F+EH ++ G F D   + F  KIL  SGL E+TY+P A+
Sbjct  102   VYLVDYSCYKPPSHLQVRYQQFMEHSKLTGDF-DESSLEFQRKILERSGLGEETYVPEAM  160

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP R     A  E   V+F     L +N  + PKD  ILVVNCS F P PSL+++IVN
Sbjct  161   HYIPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDFGILVVNCSLFNPTPSLSAMIVN  220

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  221   KYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVVVSTENITQNWYFGNKKSM  280

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  281   LIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHCGADDKAFRCVYQEQDDAGKTGV  340

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LP++E L F  +   +K  +   + Y+P+FK A  
Sbjct  341   SLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFVTLVAKKLFNAKVKPYIPDFKLAFD  400

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R++KG
Sbjct  401   HFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMQKG  460

Query  362   DKVWQLGMGTGPKCNSLV---LQCIRPILGEAQKGPWADCIHKYPI  234
             ++VWQ+  G+G KCNS V   LQ ++P    +   PW DCIH YP+
Sbjct  461   NRVWQIAFGSGFKCNSAVWEALQSVKP----SPHSPWEDCIHGYPV  502



>ref|XP_009594431.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 4-like 
[Nicotiana tomentosiformis]
Length=513

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 264/406 (65%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+ +VDY C+ PP   ++ FS F+ H ++ G F D   + F  KIL  SGL E+TYLP A
Sbjct  108   PICLVDYSCYHPPEHLKVKFSKFMGHSRLTGDF-DESSLEFQRKILERSGLGEETYLPEA  166

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH +P R     A  E   V+F     L +N  + PKDI+ILVVNCS F P PSL+++IV
Sbjct  167   LHDVPPRPSMATAREEAEQVMFGALDNLFNNTNVKPKDIEILVVNCSLFNPTPSLSAMIV  226

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++K+FNL GMGCSA  +A+D+ +++++ HR   AV++S E ++  WY G +KA
Sbjct  227   NKYKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQFHRNTYAVVVSMENITQNWYFGNKKA  286

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAA+LLSNK   K  AKYK++  +RT    DD  +    +++D  G TG
Sbjct  287   MLIPNCLFRVGGAAILLSNKAGDKRRAKYKVVHVVRTHKGADDTAFKCVYQEQDDNGKTG  346

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ + G  L+T+I  LG   LPI++ L F  S   RK      + Y+P+FK A 
Sbjct  347   VSLSKDLMAITGNALKTNITTLGPLXLPISKQLLFFMSLVARKLFHAKIKPYIPDFKLAF  406

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  407   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRIRR  466

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G ++WQ+  G+G KCNS V Q +  +   +   PW DCIH+YP+ L
Sbjct  467   GHRIWQIAFGSGFKCNSAVWQALTNV-KPSPNSPWEDCIHRYPVEL  511



>gb|KDO49072.1| hypothetical protein CISIN_1g010687mg [Citrus sinensis]
Length=504

 Score =   387 bits (993),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/403 (44%), Positives = 269/403 (67%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ C++PP+  ++ F  F+EH ++ G F D   + F  KIL  SGL E+TY+P A+
Sbjct  100   IYLVDFSCYRPPSHLQVKFHQFMEHSRLTGDF-DESSLEFQRKILERSGLGEETYVPDAM  158

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  159   HYLPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVN  218

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  219   KYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  278

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+AVLLSNK + +  AKYKL+  +RT    DD  +    +++D+ G TG+
Sbjct  279   LIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADDNAFKCVYQEQDNAGKTGV  338

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+ +I  LG   LPI+E L F A+   +KF +   + Y+P+FK A  
Sbjct  339   SLSKDLMAIAGMALKANITTLGPLVLPISEQLLFFATLVAKKFSNAKVKPYIPDFKLAFD  398

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+S+WYELAY EAK R+++G
Sbjct  399   HFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRRG  458

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             ++VWQ+  G+G KCNS V Q +R +   +   PW DCI KYP+
Sbjct  459   NRVWQIAFGSGFKCNSAVWQALRNV-KPSPNSPWEDCIDKYPV  500



>ref|XP_010551269.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Tarenaya hassleriana]
Length=490

 Score =   385 bits (990),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 265/403 (66%), Gaps = 8/403 (2%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP  CR+PFS  +          + K V F  +IL  SGL E+T LPPA+
Sbjct  88    VYLVDYACYKPPVTCRVPFSRLILKD-------NPKSVEFQMRILERSGLGEETCLPPAI  140

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP     + A  E  MV+F     L     L P+DIDIL+VNCS F P PSL+++++N
Sbjct  141   HYIPPNPTMESARGEAQMVIFTAMDDLFKKTGLKPRDIDILIVNCSLFSPTPSLSAMVIN  200

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R+++K+FNL+GMGCSA  ++VD+ R++++ H   NAVI+STEI++  +Y G ++A 
Sbjct  201   KYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEIITPNYYKGNDRAM  260

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMG AA+LLSN+R  +  AKY+L   +RT    DD+ Y      ED +G  G+
Sbjct  261   LLPNCLFRMGAAAILLSNRRSDRWRAKYRLCHVVRTHRGADDKSYYCVYEQEDKDGNVGI  320

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AGE L+++I  LG   LP +E + FL S   RK  +   + Y+P+FK A +
Sbjct  321   NLSKDLMAIAGEALKSNITTLGPLVLPASEQILFLLSLIGRKIFNPKWKPYIPDFKLAFE  380

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+SLWYEL+Y+EAK R++ G
Sbjct  381   HFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELSYIEAKGRMRHG  440

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             D+VWQ+  G+G KCNS V +C R I      GPW+D I +YP+
Sbjct  441   DRVWQIAFGSGFKCNSAVWKCNRTI-KVPTDGPWSDSIDRYPV  482



>ref|XP_002282403.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Vitis vinifera]
Length=509

 Score =   386 bits (991),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 272/404 (67%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PV++VDY C++PP+  ++ F  F++H ++ G F +S  + F  KIL  SGL E+TY+P A
Sbjct  104   PVFLVDYACYRPPDHLQVRFHQFMDHSKLTGDFTEST-LEFQRKILERSGLGEETYVPQA  162

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H++P R     A  E   V+F     L S+  + PKDI ILVVNCS F P PSL+++IV
Sbjct  163   MHYLPPRPSMSAAREEAEQVMFGALDALFSDTCIKPKDIGILVVNCSLFNPTPSLSAMIV  222

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++++FNL GMGCSA  +A+D+  ++++ HR   AV++STE ++  WY G +++
Sbjct  223   NKYKLRGNIRSFNLGGMGCSAGVIAIDLASDLLQVHRNTYAVVVSTENITQNWYFGNDRS  282

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAA+LLSN+   +  AKY+L+  +RT    DD+ ++   + +D  G TG
Sbjct  283   MLIPNCLFRVGGAAILLSNRSRDRRRAKYRLVHVVRTHRGADDKAFSCVYQKQDDVGKTG  342

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F A+   +K +  + + Y+P+FK A 
Sbjct  343   VSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKKLLKSNAKPYIPDFKLAF  402

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+S+WYELAY EAK R++K
Sbjct  403   NHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRK  462

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+  G+G KCNS V + +R +   ++ GPW DCI KYP+
Sbjct  463   GNRVWQIAFGSGFKCNSAVWEALRHV-QPSRNGPWEDCIDKYPV  505



>ref|XP_003567862.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brachypodium distachyon]
Length=518

 Score =   386 bits (992),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 263/406 (65%), Gaps = 3/406 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C+KPP   ++ F  FL H  + G  F    + F  KIL  SGLSE+TY P  
Sbjct  104   PVYLVDFACYKPPPHLKVSFQEFLRHSGLCG--FSDDALDFQRKILERSGLSEETYCPEG  161

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H IP      +A  E   V+F     L S   + PKD+ ILVVNCS F P PSL+++IV
Sbjct  162   MHAIPPEPTMANARAEAESVMFGALDNLFSATGVKPKDVGILVVNCSLFNPTPSLSAMIV  221

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++ +R +V++FNL GMGCSA  +A+D+ R++++ HR   AV++STE ++  WY G  K+
Sbjct  222   NRYKLRGNVRSFNLGGMGCSAGVIAIDLARDMLQVHRSTYAVVVSTENITQNWYFGNRKS  281

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSN+   +  AKY L   +RT    DD+ +N   +++D+EG TG
Sbjct  282   MLIPNCLFRVGGSAVLLSNRGADRRRAKYSLRHVVRTHKGADDKAFNCVYQEQDAEGKTG  341

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LP +E L F A+   +K  +   + Y+P+FK A 
Sbjct  342   VSLSKDLMAIAGGALKTNITTLGPLVLPFSEQLLFFATLVSKKLFNAKVKPYIPDFKLAF  401

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK RV++
Sbjct  402   EHFCIHAGGRAVIDELEKNLHLSPVHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRVRR  461

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             GD++WQ+  G+G KCNS V   +R +   A   PW DCI +YP+ L
Sbjct  462   GDRIWQIAFGSGFKCNSAVWHALRNV-KPAANSPWEDCIDRYPVEL  506



>ref|XP_010548056.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Tarenaya hassleriana]
Length=509

 Score =   386 bits (991),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 271/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C+KPP+   + F  F+ H +++  F DS  + F  KI+  SGL E+T+LP A
Sbjct  104   PVYLVDYSCYKPPSNLVVNFQKFMNHSRLIEDFDDS-SLEFQRKIIQRSGLGEETHLPEA  162

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             L  IP  S    A  E   V+F     LL N K+SP+DI ILVVNCS F P PSL+++IV
Sbjct  163   LQCIPPNSTMAAAREEAEQVMFGALDNLLENTKISPRDIGILVVNCSLFNPTPSLSAMIV  222

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R ++K++NL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  223   NKYKLRGNIKSYNLGGMGCSAGVIAIDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKS  282

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+A+LLSNK   +  +KYKL+ ++RT    DD+ +    +++D +G TG
Sbjct  283   MLIPNCLFRVGGSAILLSNKPSDRRHSKYKLIHTVRTHKGADDKAFKCVHQEQDGKGKTG  342

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  343   VSLSKDLMAIAGEALKTNITTLGPLVLPISEQIIFFMTLVAKKLFNAKIKPYIPDFKLAF  402

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L D  +EA+ MTL+RFGN SS+S+WYELAY EAK R++K
Sbjct  403   EHFCVHAGGRAVIDELEKNLQLSDTHVEASKMTLHRFGNISSSSIWYELAYTEAKGRMRK  462

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G++VWQ+  G+G KCNS V   +R +       PW DCI +YP+ +
Sbjct  463   GNRVWQIAFGSGFKCNSAVWMALRNVRPSVN-SPWDDCIGRYPVKI  507



>ref|XP_011088406.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Sesamum indicum]
Length=498

 Score =   385 bits (989),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 181/405 (45%), Positives = 264/405 (65%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C++PP+  R+ F  F+ H ++ G F DS  + F  KIL  SGL E+TYLP  L
Sbjct  94    VYLVDYACYRPPDHLRVDFHKFMHHSRLTGDFDDS-SLEFQRKILERSGLGEETYLPEPL  152

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP +     A  E   V+F     L     + PKDI +LVVNCS F P PSL+++I+N
Sbjct  153   HQIPPQPSMAKAREEAEQVMFGALDNLFKATGVKPKDIGVLVVNCSLFNPTPSLSAMIIN  212

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++K+FNL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  213   KYKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQLHRNTYAVVVSTENITENWYFGNKKSM  272

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FRMGG+AVLLSN+   K  +KYK++  +RT     D  +    +++D  G TG+
Sbjct  273   LIPNCLFRMGGSAVLLSNRASDKRRSKYKMMHVVRTHIGSQDTAFRCVYQEQDERGKTGV  332

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LP++E L F  +   RK I+   + Y+P+FK A  
Sbjct  333   SLSKDLMAIAGNALKTNITTLGPLVLPVSEQLLFFVTLVARKLINPKIKPYIPDFKLAFD  392

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  I +EA+ MTL+RFGN SS+S+WYELAY+EAK R++KG
Sbjct  393   HFCIHAGGRAVIDELEKNLRLEPIQVEASRMTLHRFGNTSSSSIWYELAYIEAKGRIRKG  452

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
              +VWQ+  G+G KCNS V Q +R +   A   PW DCI +YP+ +
Sbjct  453   QRVWQIAFGSGFKCNSAVWQALRNVKPSAN-SPWLDCIDRYPVKI  496



>ref|XP_009117539.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brassica rapa]
Length=511

 Score =   386 bits (991),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/407 (44%), Positives = 269/407 (66%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C+ PP+  ++P S F+ H  + G F D   + F  KIL  SGL E TYLP A
Sbjct  106   PIYLVDFSCYLPPDHLKVPVSRFMNHSTLTGDF-DESSLEFQRKILERSGLGEDTYLPEA  164

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P       A  E   V+F    +L +N  +  KDI +LVVNCS F P PSL+++IV
Sbjct  165   MHHVPPTISMAAAREEAEQVMFGALDKLFANTNVKAKDIGVLVVNCSLFNPTPSLSAMIV  224

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +KA
Sbjct  225   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKA  284

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  +KY+L   +RT    DD+ +    +++D  G TG
Sbjct  285   MLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLSHVVRTHRGADDKAFRCVYQEQDDTGRTG  344

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  345   VSLSKELMAIAGETLKTNITTLGPLVLPISEQILFFVTLVVKKLFNGKVKPYIPDFKLAF  404

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  405   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  464

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS V + +R +   ++  PW DCI KYP+ LS
Sbjct  465   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSKDSPWEDCIDKYPVTLS  510



>emb|CDY21665.1| BnaA09g44160D [Brassica napus]
Length=510

 Score =   386 bits (991),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/407 (44%), Positives = 269/407 (66%), Gaps = 2/407 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             P+Y+VD+ C+ PP+  ++P S F+ H  + G F D   + F  KIL  SGL E TYLP A
Sbjct  105   PIYLVDFSCYLPPDHLKVPVSRFMNHSTLTGDF-DESSLEFQRKILERSGLGEDTYLPEA  163

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P       A  E   V+F    +L +N  +  KDI +LVVNCS F P PSL+++IV
Sbjct  164   MHHVPPTISMAAAREEAEQVMFGALDKLFANTNVKAKDIGVLVVNCSLFNPTPSLSAMIV  223

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +AVD+ ++++  HR   AV++STE ++  WY G +KA
Sbjct  224   NKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKA  283

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   K  +KY+L   +RT    DD+ +    +++D  G TG
Sbjct  284   MLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLSHVVRTHRGADDKAFRCVYQEQDDTGRTG  343

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ +++ +AGETL+T+I  LG   LPI+E + F  +   +K  +   + Y+P+FK A 
Sbjct  344   VSLSKELMAIAGETLKTNITTLGPLVLPISEQILFFVTLVVKKLFNGKVKPYIPDFKLAF  403

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++
Sbjct  404   EHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRR  463

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
             G++VWQ+  G+G KCNS V + +R +   ++  PW DCI KYP+ LS
Sbjct  464   GNRVWQIAFGSGFKCNSAVWEALRNV-KPSKDSPWEDCIDKYPVTLS  509



>ref|XP_010690872.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Beta vulgaris subsp. vulgaris]
Length=508

 Score =   385 bits (990),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 273/406 (67%), Gaps = 2/406 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+  + PPN  ++ FS F+EH ++ G F +S  + F  KIL  SGL E+T +P A+
Sbjct  104   IYLVDFSLYYPPNKFKVKFSDFVEHSRLTGDFEES-SLDFQRKILERSGLGEETVVPEAM  162

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP R   Q A  E   V+F   + LLS+  +  KDI ILVVNCS F P PSL+++IVN
Sbjct  163   HSIPPRPSMQAAREESEQVMFSALENLLSHTGIKTKDIGILVVNCSLFNPTPSLSAMIVN  222

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             KF +R ++K+FNL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  223   KFKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  282

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+ VLLSNK   ++ AKY+L+  +RT    DD+ +    +++D  G TG+
Sbjct  283   LIPNCLFRVGGSVVLLSNKSIDRARAKYRLVHVVRTHRGADDKAFKCVYQEQDDVGKTGV  342

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG+ L+T+I  LG   LPI+E L F  +   RKF +   + Y+P+FK A +
Sbjct  343   SLSKDLMAIAGDALKTNITTLGPLVLPISEQLLFFFTLVVRKFFNVKVKPYIPDFKLAFE  402

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYEL Y+EAK R+KKG
Sbjct  403   HFCIHAGGRAVIDELEKNLELSSVHVEASRMTLHRFGNTSSSSIWYELGYIEAKGRMKKG  462

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPLS  225
              +VWQ+  G+G KCNS V Q +R +   + K PW DCI +YP+ ++
Sbjct  463   HRVWQIAFGSGFKCNSAVWQALRNV-KPSPKSPWLDCIDRYPVEIN  507



>gb|ABS18382.1| 3-ketoacyl-CoA synthase [Eranthis hyemalis]
Length=514

 Score =   385 bits (990),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/404 (44%), Positives = 269/404 (67%), Gaps = 2/404 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP+  R+ +  F+EH ++ G F D   + F  KIL  SGL E+TY+P A
Sbjct  109   PVYLVDYACYRPPSHLRVKYDQFMEHSRLTGDF-DESSLEFQRKILERSGLGEETYVPEA  167

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H IP +     A  E   V++     L +N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  168   MHCIPPKPSMATAREEAEQVMYGALDNLFANTSVKPKDIGILVVNCSLFNPTPSLSAMIV  227

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ +R +++++NL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+
Sbjct  228   NKYKLRGNIRSYNLGGMGCSAGVIAIDLAKDLLQIHRNTYAVVVSTENITQNWYFGNKKS  287

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GG+AVLLSNK   +  AKY+L+  +RT    D++ +    +++D  G  G
Sbjct  288   MLIPNCLFRVGGSAVLLSNKSVERRRAKYRLVHVVRTHRGSDEKAFRCVYQEQDDAGKVG  347

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LPI+E L F ++   +K  +   + Y+P+FK A 
Sbjct  348   VTLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVIKKLFNTKIKPYIPDFKLAF  407

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R++K
Sbjct  408   DHFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRK  467

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             G++VWQ+  G+G KCNS V + +R +   + K PW DCI KYP+
Sbjct  468   GNRVWQIAFGSGFKCNSAVWEALRYV-KPSSKSPWEDCISKYPV  510



>gb|EPS60765.1| hypothetical protein M569_14036, partial [Genlisea aurea]
Length=503

 Score =   385 bits (989),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/405 (44%), Positives = 270/405 (67%), Gaps = 2/405 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C++ P   +  +  F+EH ++ G F DS  + F  KIL  SGL ++TY+P A+
Sbjct  100   VYLVDYSCYRAPESLKASYRQFMEHSRLTGDFDDSS-LEFQRKILERSGLGDETYVPEAM  158

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HF+P R   Q A  E   V+F     L +N  L PK+I IL+VNCS F P PSL+++IVN
Sbjct  159   HFVPPRPSMQAAREEAEQVMFGALDNLFANTNLRPKEIGILIVNCSLFNPTPSLSAMIVN  218

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++K+FNL GMGCSA  +AVD+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  219   KYKLRGNIKSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENITQNWYFGNKKSM  278

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAA+LLSNK   +  +KYKL+  +RT    DD+ ++   +++D  G TG+
Sbjct  279   LIPNCLFRVGGAALLLSNKAADRRRSKYKLVHVVRTHKGADDKAFHCVYQEQDENGKTGV  338

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LPI+E L F  +   +K    +   Y+P+FK A  
Sbjct  339   SLSKDLMAIAGGALKTNITTLGPVVLPISEQLIFFMTLVIKKVFKYNLRPYIPDFKLAFD  398

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY+EAK R+++G
Sbjct  399   HFCIHAGGRAVIDEVEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRRG  458

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             +KVWQ+  G+G KCNS V   +R +   ++ GPW DCI +YP+ +
Sbjct  459   NKVWQIAFGSGFKCNSAVWVALRSV-APSKNGPWDDCIDRYPVKV  502



>ref|XP_009416553.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   386 bits (991),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 182/406 (45%), Positives = 266/406 (66%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C++PP   R PF  F++H Q+ G F +S  + F  +IL  SGL ++TYLP A
Sbjct  111   PVYLVDYACYRPPPNLRAPFPRFMKHSQLCGEFNES-ALEFQRRILERSGLGQETYLPSA  169

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH++P R     A  E   V+F     L  N  + PKDI ILVVNCS F P PSL+++IV
Sbjct  170   LHYLPPRPSMASAREEAEEVMFGALDALFRNTGVKPKDIGILVVNCSLFNPTPSLSAMIV  229

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++  R ++K+FNL GMGCSA  +++D+ R++++ HR   AV++STE ++  WY G  K+
Sbjct  230   NRYKFRGNIKSFNLGGMGCSAGVISIDLARDLLQIHRSTYAVVVSTENITQNWYFGNRKS  289

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+G AA+LLSN+   +  +KYKL+  +RT    DDR +    +++D  G  G
Sbjct  290   MLIPNCLFRVGAAAMLLSNRSADRWRSKYKLVHVVRTHSGADDRAFRCVYQEQDDAGKVG  349

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AGE L+ +I  LG   LPI+E L F A+   +K  +   + Y+P+FK A 
Sbjct  350   VSLSKDLMAIAGEALKINITTLGPLVLPISEQLLFFATLVAKKLFNGKVKPYIPDFKLAF  409

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+S+WYELAY EAK R++K
Sbjct  410   EHFCIHAGGRAVIDELEKNLQLRPDHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRK  469

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G +VWQ+  G+G KCNS V Q +  +   +  GPW DCIH+YP+ +
Sbjct  470   GHRVWQIAFGSGFKCNSAVWQALCNV-KPSPDGPWEDCIHRYPVEI  514



>ref|XP_006423278.1| hypothetical protein CICLE_v10028243mg [Citrus clementina]
 ref|XP_006469151.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Citrus sinensis]
 gb|ESR36518.1| hypothetical protein CICLE_v10028243mg [Citrus clementina]
Length=504

 Score =   385 bits (989),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 179/403 (44%), Positives = 268/403 (67%), Gaps = 2/403 (0%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y+VD+ C++PP   ++ F  F+EH ++ G F D   + F  KIL  SGL E+TY+P A+
Sbjct  100   IYLVDFSCYRPPCHLQVKFHQFMEHSRLTGDF-DESSLEFQRKILERSGLGEETYVPDAM  158

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H++P R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  159   HYLPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVN  218

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  219   KYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  278

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+AVLLSNK + +  AKYKL+  +RT    DD  +    +++D+ G TG+
Sbjct  279   LIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADDNAFKCVYQEQDNAGKTGV  338

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+ +I  LG   LPI+E L F A+   +KF +   + Y+P+FK A  
Sbjct  339   SLSKDLMAIAGMALKANITTLGPLVLPISEQLLFFATLVAKKFSNAKVKPYIPDFKLAFD  398

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+S+WYELAY EAK R+++G
Sbjct  399   HFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRRG  458

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             ++VWQ+  G+G KCNS V Q +R +   +   PW DCI KYP+
Sbjct  459   NRVWQIAFGSGFKCNSAVWQALRNV-KPSPNSPWEDCIDKYPV  500



>gb|AAP74371.1| FAE1 [Marchantia polymorpha]
Length=527

 Score =   385 bits (990),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 266/406 (66%), Gaps = 2/406 (0%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VDY C  P    R+ FS F++H +   GFFD + + F  KIL  SGL E+T+LP +
Sbjct  118   PVYLVDYACHLPAENTRVKFSLFMDHSEK-SGFFDERALEFQRKILERSGLGEETHLPVS  176

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             LH +PA +   +A NE   V+F    +L    K+ PKDI ILVVNCS F P PSL+++IV
Sbjct  177   LHRLPANANMAEARNEAEEVMFGALDELFEKTKVKPKDIGILVVNCSLFNPTPSLSAMIV  236

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             NK+ MR +++T+NL GMGCSA  +++D+ +++++ H    A+++STE ++  WY G  ++
Sbjct  237   NKYHMRGNIRTYNLGGMGCSAGVISIDLAKDMLQVHGGTYAIVVSTENITQNWYYGNRRS  296

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAA+LLSNKR  K  AKY+L+ ++RT    DD+ +    ++ED +   G
Sbjct  297   MLIPNCLFRVGGAAILLSNKRSEKRRAKYQLVHTVRTHKGADDKCFRCVYQEEDEKNFMG  356

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG+ L+T+I  LG   LP++E L F      RK  +   + Y+P+FK A 
Sbjct  357   VSLSKDLMAIAGDALKTNITTLGPLVLPLSEQLLFFGILVARKVFNMKVKPYIPDFKLAF  416

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
              HFC  A G++V+ E  K L+L    +E + MTL+RFGN SS+S+WYEL Y+E+K R+KK
Sbjct  417   DHFCIHAGGRAVIDELEKNLQLTKDHVEPSRMTLHRFGNTSSSSIWYELNYIESKGRMKK  476

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             GD+VWQ+  G+G KCNS V Q +R  L    +GPW  CI  YP+ +
Sbjct  477   GDRVWQIAFGSGFKCNSAVWQAVR-TLKPPARGPWTHCIDSYPVKI  521



>ref|XP_010427942.1| PREDICTED: 3-ketoacyl-CoA synthase 7 [Camelina sativa]
Length=461

 Score =   383 bits (983),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 182/403 (45%), Positives = 269/403 (67%), Gaps = 3/403 (1%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             +Y++D+ C++PP+F R P S+F+EH+  + G FD + +   +K+L  SG+S+   +P ++
Sbjct  48    IYLIDFSCYQPPDFLRAPVSNFIEHL-TISGVFDQESLDLQQKVLERSGISDDASVPASV  106

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H IP  +    A  E H +LF I + L S +++ P+ IDILV NCS FCP PS+ S+I+N
Sbjct  107   HEIPPNASLPAAREETHEILFTIVEDLFSKHEIDPRSIDILVSNCSLFCPSPSITSMIIN  166

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             +F MR+D+K+F+L+GMGCSA  L+V++V+++MK H    A++LS E +S   Y GK K+ 
Sbjct  167   RFGMRSDIKSFSLSGMGCSAGILSVNLVKDLMKIHGDSLALVLSMEAVSPNGYRGKSKSM  226

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ N IFRMGGAA+LLSNK++    AKYKL   +RT    D+  Y + ++  D EG  G+
Sbjct  227   LIANTIFRMGGAAILLSNKKQDMHKAKYKLQHLIRTHVGSDNESYESVMQKVDEEGKVGV  286

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+  ++ VA + L+ ++  LG + LP +E L+++ S  +RK+  +  EIY PNFK A +
Sbjct  287   ALSKQLVRVASKALKINVVELGPRVLPYSEQLKYIISFLQRKW-GRHKEIYTPNFKKAFE  345

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++++    K LKL   D+EA+  TLYR+GN SS+SLWYEL YLEAK R+KKG
Sbjct  346   HFCIHAGGRAIIEGVEKHLKLDKEDVEASRSTLYRYGNTSSSSLWYELQYLEAKGRMKKG  405

Query  362   DKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPI  234
             DKVWQ+G G+G K NS V +CI  I     +  W+D IH YP+
Sbjct  406   DKVWQIGFGSGFKANSAVWKCISEI-DSRDRNAWSDRIHLYPV  447



>ref|XP_004289669.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/408 (44%), Positives = 270/408 (66%), Gaps = 8/408 (2%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+K P+  ++ +  F++H ++ G F D   + F  KIL  SGL E+TYLP A+
Sbjct  105   VYLVDYSCYKAPDHLKVKYQKFMDHSRLTGDF-DESSLEFQRKILERSGLGEETYLPEAM  163

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             HFIP R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  164   HFIPPRPTMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVN  223

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +A+D+ +++++ HR   AV++STE ++  WY G +K+ 
Sbjct  224   KYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSM  283

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GG+AVLLSNK   +  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  284   LIPNCLFRVGGSAVLLSNKSLDRRRAKYKLVHVVRTHKGADDKAFRCVYQEQDDIGKTGV  343

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ +++ +AG  L+T+I  LG   LP++E L F A+   +K  +   + Y+P+FK A  
Sbjct  344   SLSKELMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLFNAKVKPYIPDFKLAFD  403

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +E++ MTL+RFGN SS+S+WYELAY EAK R++KG
Sbjct  404   HFCIHAGGRAVIDELEKNLQLLPVHVESSRMTLHRFGNTSSSSIWYELAYTEAKGRMQKG  463

Query  362   DKVWQLGMGTGPKCNSLV---LQCIRPILGEAQKGPWADCIHKYPIPL  228
             ++VWQ+  G+G KCNS V   LQ ++P    +  GPW DCI  YP+ +
Sbjct  464   NRVWQIAFGSGFKCNSAVWEALQNVKP----SPSGPWEDCIDSYPVQI  507



>ref|XP_008236905.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Prunus mume]
Length=506

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/406 (45%), Positives = 267/406 (66%), Gaps = 8/406 (2%)
 Frame = -2

Query  1442  VYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPAL  1263
             VY+VDY C+KPP+  ++ F  F+EH ++ G F D   + F  KIL  SGL E+TY+P A+
Sbjct  102   VYLVDYSCYKPPSHLQVRFQQFMEHSKLTGDF-DESSLEFQRKILERSGLGEETYVPEAM  160

Query  1262  HFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIVN  1083
             H+IP R     A  E   V+F     L +N  + PKDI ILVVNCS F P PSL+++IVN
Sbjct  161   HYIPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVN  220

Query  1082  KFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKAF  903
             K+ +R ++++FNL GMGCSA  +AVD+ + +++ H    AV++STE ++  WY G +K+ 
Sbjct  221   KYKLRGNIRSFNLGGMGCSAGVIAVDLAKEMLQVHGNTYAVVVSTENITQNWYFGNKKSM  280

Query  902   LVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTGM  723
             L+ NC+FR+GGAAVLLSN+   +  AKYKL+  +RT    DD+ +    +++D  G TG+
Sbjct  281   LIPNCLFRVGGAAVLLSNRSLDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTGV  340

Query  722   RLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAIQ  543
              L+ D++ +AG  L+T+I  LG   LP++E L F A+   +K  +   + Y+P+FK A  
Sbjct  341   SLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLFNAKVKPYIPDFKLAFD  400

Query  542   HFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKKG  363
             HFC  A G++V+ E  K L+L  + +EA+ MTL+RFGN SS+S+WYELAY EAK R++KG
Sbjct  401   HFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMQKG  460

Query  362   DKVWQLGMGTGPKCNSLV---LQCIRPILGEAQKGPWADCIHKYPI  234
             ++VWQ+  G+G KCNS V   LQ ++P L      PW DCI  YP+
Sbjct  461   NRVWQIAFGSGFKCNSAVWEALQNVKPSL----HSPWEDCIDWYPV  502



>gb|AFW81175.1| acyltransferase [Zea mays]
Length=505

 Score =   384 bits (985),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/406 (44%), Positives = 266/406 (66%), Gaps = 3/406 (1%)
 Frame = -2

Query  1445  PVYVVDYVCFKPPNFCRIPFSSFLEHIQMMGGFFDSKGVAFMEKILNLSGLSEQTYLPPA  1266
             PVY+VD+ C++PP   R+ F  F+ H ++ G  F    + F  KIL  SGLSE+TY+P A
Sbjct  95    PVYLVDFACYRPPAHLRVRFDQFMRHSRLCG--FSDDALEFQRKILERSGLSEETYVPEA  152

Query  1265  LHFIPARSGPQDAINEVHMVLFPIFQQLLSNNKLSPKDIDILVVNCSGFCPDPSLASIIV  1086
             +H +P +    +A  E   V+F     L  +  + PKD+ +LVVNCS F P PSL++++V
Sbjct  153   MHALPPQPTMANARAEAEAVMFGALDALFRSTGVKPKDVGVLVVNCSLFNPTPSLSAMVV  212

Query  1085  NKFAMRADVKTFNLTGMGCSANTLAVDMVRNIMKTHRRCNAVILSTEILSTGWYPGKEKA  906
             N++ +R +V++FNL GMGCSA  +AVD+ R++++ HR   AV++STE ++  WY G  K+
Sbjct  213   NRYRLRGNVRSFNLGGMGCSAGVIAVDLARDMLQVHRATYAVVVSTENITQNWYFGNRKS  272

Query  905   FLVLNCIFRMGGAAVLLSNKREAKSGAKYKLLWSLRTQGAFDDRRYNAAIRDEDSEGLTG  726
              L+ NC+FR+GGAAVLLSN+   +  AKY L   +RT    DDR +    +++D EG TG
Sbjct  273   MLIPNCLFRVGGAAVLLSNRGADRRRAKYVLRHVVRTHKGADDRAFGCVYQEQDGEGKTG  332

Query  725   MRLNGDVLFVAGETLQTHIPILGAKFLPITEILRFLASAFKRKFIDKSTEIYVPNFKSAI  546
             + L+ D++ +AG  L+T+I  LG   LP++E L F A+   +K +   T+ Y+P+FK A 
Sbjct  333   VSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLLSAKTKPYIPDFKLAF  392

Query  545   QHFCFPATGKSVVRETAKRLKLGDIDMEAALMTLYRFGNQSSASLWYELAYLEAKERVKK  366
             +HFC  A G++V+ E  K L+L    +EA+ MTL+RFGN SS+S+WYELAY+EAK RV++
Sbjct  393   EHFCIHAGGRAVIDELEKNLQLSPAHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRVRR  452

Query  365   GDKVWQLGMGTGPKCNSLVLQCIRPILGEAQKGPWADCIHKYPIPL  228
             G +VWQ+  G+G KCNS V   +R +   +   PW DCI +YP+ L
Sbjct  453   GHRVWQIAFGSGFKCNSAVWHALRNV-KPSPDSPWEDCIDRYPVEL  497



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5494404044712