BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16164_g1_i1 len=1006 path=[1:0-419 2333:420-422 424:423-1005]

Length=1006
                                                                      Score     E

ref|XP_009798761.1|  PREDICTED: transcription factor TGA5               344   8e-115   
ref|XP_004244373.1|  PREDICTED: transcription factor TGA5               336   1e-111   
ref|XP_009618663.1|  PREDICTED: transcription factor TGA1-like          335   3e-111   
ref|XP_006348396.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    333   8e-111   
ref|XP_009629955.1|  PREDICTED: transcription factor TGA1-like          306   4e-100   
ref|XP_011082768.1|  PREDICTED: transcription factor TGA1               303   6e-99    
ref|XP_009789761.1|  PREDICTED: transcription factor TGA2-like          302   2e-98    
ref|XP_008386261.1|  PREDICTED: transcription factor TGA5-like          295   9e-96    
ref|XP_007212919.1|  hypothetical protein PRUPE_ppa022280mg             290   1e-93    
ref|XP_006442481.1|  hypothetical protein CICLE_v10022056mg             287   2e-92    
ref|XP_006477767.1|  PREDICTED: transcription factor TGA1-like          285   1e-91    
ref|XP_010086637.1|  hypothetical protein L484_004349                   282   2e-90    
gb|EYU45030.1|  hypothetical protein MIMGU_mgv1a018123mg                284   4e-88    
ref|XP_007021794.1|  Uncharacterized protein TCM_031867                 263   1e-82    
ref|XP_008463763.1|  PREDICTED: transcription factor TGA5               260   5e-82    
ref|XP_004146086.1|  PREDICTED: transcription factor TGA5-like          259   1e-81    
ref|XP_010062825.1|  PREDICTED: transcription factor HBP-1b(c38)-...    256   3e-80    
gb|KDP34795.1|  hypothetical protein JCGZ_10575                         254   8e-80    
ref|XP_010313918.1|  PREDICTED: transcription factor TGA5-like          254   1e-79    
ref|XP_011007917.1|  PREDICTED: transcription factor HBP-1b(c38)        251   2e-78    
gb|KHG25856.1|  Transcription factor TGA1 -like protein                 251   3e-78    
emb|CAN72574.1|  hypothetical protein VITISV_036367                     250   3e-78    Vitis vinifera
ref|XP_006370140.1|  DNA-binding family protein                         250   4e-78    
ref|XP_002283108.1|  PREDICTED: transcription factor HBP-1b(c1)-like    250   5e-78    Vitis vinifera
ref|XP_003596341.1|  Transcription factor TGA5                          246   1e-76    
ref|XP_010276977.1|  PREDICTED: transcription factor TGA2               245   5e-76    
ref|XP_004489078.1|  PREDICTED: transcription factor HBP-1b(c38)-...    240   2e-74    
ref|NP_001237999.1|  bZIP transcription factor bZIP132                  236   2e-72    
emb|CDX97614.1|  BnaA05g24650D                                          235   4e-72    
ref|XP_010465409.1|  PREDICTED: transcription factor HBP-1b(c38)-...    233   2e-71    
ref|XP_010487302.1|  PREDICTED: transcription factor HBP-1b(c38)-...    233   3e-71    
emb|CDY70896.1|  BnaCnng70220D                                          233   3e-71    
ref|XP_010502264.1|  PREDICTED: transcription factor HBP-1b(c38)-...    232   7e-71    
ref|NP_001118628.1|  uncharacterized protein                            231   9e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882899.1|  hypothetical protein ARALYDRAFT_341612             229   8e-70    
ref|XP_010695960.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    229   1e-69    
ref|XP_006593493.1|  PREDICTED: bZIP transcription factor bZIP132...    229   2e-69    
ref|XP_006300241.1|  hypothetical protein CARUB_v10016481mg             228   3e-69    
ref|XP_009146508.1|  PREDICTED: uncharacterized protein LOC103870151    228   3e-69    
ref|XP_010465408.1|  PREDICTED: transcription factor HBP-1b(c38)-...    226   1e-68    
ref|XP_010487301.1|  PREDICTED: transcription factor HBP-1b(c38)-...    226   2e-68    
ref|XP_003634664.1|  PREDICTED: transcription factor HBP-1b(c38)        225   4e-68    
ref|XP_010502256.1|  PREDICTED: transcription factor HBP-1b(c38)-...    225   4e-68    
ref|XP_010502248.1|  PREDICTED: transcription factor HBP-1b(c38)-...    225   4e-68    
ref|XP_006407035.1|  hypothetical protein EUTSA_v10022387mg             224   6e-68    
ref|NP_188106.2|  uncharacterized protein                               224   7e-68    Arabidopsis thaliana [mouse-ear cress]
gb|KHN36891.1|  Transcription factor TGA1                               219   2e-66    
ref|XP_007149576.1|  hypothetical protein PHAVU_005G081900g             219   2e-66    
ref|XP_010552125.1|  PREDICTED: transcription factor TGA7               178   4e-50    
gb|ABI84260.1|  tumor-related protein-like                              172   7e-48    Arachis hypogaea [goober]
gb|EPS59924.1|  hypothetical protein M569_14883                         169   1e-47    
ref|XP_002273632.1|  PREDICTED: transcription factor TGA2               150   2e-39    Vitis vinifera
ref|XP_010920869.1|  PREDICTED: transcription factor TGA3-like          150   4e-39    
ref|XP_002524536.1|  conserved hypothetical protein                     146   4e-39    Ricinus communis
ref|XP_008382157.1|  PREDICTED: uncharacterized protein LOC103444967    146   6e-39    
ref|XP_008226586.1|  PREDICTED: uncharacterized protein LOC103326167    144   4e-38    
gb|EYU35712.1|  hypothetical protein MIMGU_mgv1a011847mg                145   3e-37    
ref|XP_009405272.1|  PREDICTED: transcription factor HBP-1b(c1)-like    142   2e-36    
ref|XP_006432080.1|  hypothetical protein CICLE_v10002078mg             143   3e-36    
ref|XP_006830264.1|  hypothetical protein AMTR_s00130p00113960          141   1e-35    
ref|XP_008793320.1|  PREDICTED: transcription factor HBP-1b(c38)-...    139   7e-35    
ref|XP_003630355.1|  Transcription factor HBP-1b(c1)                    138   1e-34    
ref|XP_010674364.1|  PREDICTED: transcription factor TGA6-like          137   4e-34    
ref|XP_011100139.1|  PREDICTED: transcription factor TGA1-like          136   8e-34    
ref|XP_010025725.1|  PREDICTED: transcription factor TGA2-like          136   9e-34    
ref|XP_011075022.1|  PREDICTED: transcription factor TGA5-like          134   3e-33    
ref|XP_004503896.1|  PREDICTED: transcription factor HBP-1b(c38)-...    134   6e-33    
ref|XP_009799260.1|  PREDICTED: transcription factor TGA6-like          134   8e-33    
ref|XP_004288481.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    133   9e-33    
gb|EYU23876.1|  hypothetical protein MIMGU_mgv11b017687mg               133   1e-32    
ref|XP_009594445.1|  PREDICTED: transcription factor TGA6-like          133   1e-32    
ref|XP_004289493.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    132   2e-32    
dbj|BAA05470.1|  tumor-related protein                                  132   4e-32    Nicotiana glauca x Nicotiana langsdorffii
ref|XP_003524316.1|  PREDICTED: transcription factor TGA4-like          131   5e-32    
gb|EYU20609.1|  hypothetical protein MIMGU_mgv1a010868mg                131   9e-32    
gb|EYU23355.1|  hypothetical protein MIMGU_mgv1a023684mg                129   3e-31    
ref|XP_011022856.1|  PREDICTED: transcription factor TGA2-like          129   3e-31    
emb|CDP10926.1|  unnamed protein product                                130   3e-31    
gb|KHN17404.1|  Transcription factor TGA4                               131   4e-31    
ref|XP_002528014.1|  conserved hypothetical protein                     128   6e-31    Ricinus communis
ref|XP_009402767.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    128   6e-31    
ref|XP_009757325.1|  PREDICTED: transcription factor TGA5-like          128   6e-31    
ref|XP_011097086.1|  PREDICTED: transcription factor TGA2-like          126   6e-30    
ref|XP_002310543.2|  hypothetical protein POPTR_0007s04840g             125   9e-30    Populus trichocarpa [western balsam poplar]
ref|XP_006345765.1|  PREDICTED: transcription factor TGA1-like          125   1e-29    
ref|XP_004239641.1|  PREDICTED: transcription factor TGA6-like          124   1e-29    
gb|EAY99001.1|  hypothetical protein OsI_20960                          123   2e-29    Oryza sativa Indica Group [Indian rice]
ref|XP_007159878.1|  hypothetical protein PHAVU_002G275400g             124   2e-29    
ref|XP_004961243.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    122   3e-29    
gb|EYU23360.1|  hypothetical protein MIMGU_mgv1a019261mg                124   4e-29    
ref|XP_008442175.1|  PREDICTED: transcription factor TGA2-like is...    123   4e-29    
ref|XP_002985809.1|  hypothetical protein SELMODRAFT_123200             122   5e-29    
ref|XP_004156023.1|  PREDICTED: transcription factor TGA6-like          122   6e-29    
ref|XP_002441508.1|  hypothetical protein SORBIDRAFT_09g028290          122   6e-29    Sorghum bicolor [broomcorn]
ref|XP_008806140.1|  PREDICTED: transcription factor TGA7-like          122   9e-29    
ref|XP_007048544.1|  TGACG-sequence-specific DNA-binding protein ...    122   9e-29    
ref|XP_008227573.1|  PREDICTED: transcription factor TGA2-like          122   1e-28    
ref|XP_006380400.1|  hypothetical protein POPTR_0007s04840g             122   1e-28    
gb|EYU23363.1|  hypothetical protein MIMGU_mgv1a023034mg                122   1e-28    
ref|XP_007214751.1|  hypothetical protein PRUPE_ppa024940mg             121   2e-28    
ref|XP_002984747.1|  hypothetical protein SELMODRAFT_181239             120   3e-28    
ref|NP_001152723.1|  tumor-related protein-like                         120   3e-28    Zea mays [maize]
ref|NP_001056306.1|  Os05g0560200                                       118   1e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008442174.1|  PREDICTED: transcription factor TGA2-like is...    119   2e-27    
gb|EYU45430.1|  hypothetical protein MIMGU_mgv1a012463mg                116   7e-27    
ref|XP_008807787.1|  PREDICTED: transcription factor HBP-1b(c38)-...    115   9e-27    
ref|XP_010922993.1|  PREDICTED: uncharacterized protein LOC105046169    120   9e-27    
ref|XP_010093103.1|  hypothetical protein L484_007912                   117   1e-26    
ref|XP_010104546.1|  hypothetical protein L484_025521                   115   1e-26    
ref|XP_009379553.1|  PREDICTED: transcription factor TGA6-like          115   3e-26    
gb|EYU43340.1|  hypothetical protein MIMGU_mgv1a020768mg                114   5e-26    
ref|XP_009792490.1|  PREDICTED: uncharacterized protein LOC104239538    114   5e-26    
dbj|BAJ05339.1|  hypothetical protein                                   114   7e-26    
ref|XP_009758860.1|  PREDICTED: transcription factor TGA3-like          113   2e-25    
ref|XP_011085982.1|  PREDICTED: transcription factor HBP-1b(c38)-...    112   4e-25    
ref|XP_008337157.1|  PREDICTED: transcription factor HBP-1b(c38)-...    112   5e-25    
gb|EYU31233.1|  hypothetical protein MIMGU_mgv1a023634mg                110   7e-25    
gb|EEE64671.1|  hypothetical protein OsJ_19526                          108   2e-24    Oryza sativa Japonica Group [Japonica rice]
emb|CDM81542.1|  unnamed protein product                                109   3e-24    
ref|XP_010274492.1|  PREDICTED: transcription factor TGA5-like          109   3e-24    
ref|XP_010277052.1|  PREDICTED: transcription factor HBP-1b(c38)-...    108   4e-24    
ref|XP_010920258.1|  PREDICTED: transcription factor TGA2               108   5e-24    
ref|XP_009589153.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    108   7e-24    
ref|XP_009762839.1|  PREDICTED: transcription factor HBP-1b(c38)-...    108   9e-24    
gb|EYU20277.1|  hypothetical protein MIMGU_mgv1a018018mg                108   1e-23    
ref|XP_009599896.1|  PREDICTED: transcription factor TGA3-like          107   1e-23    
ref|XP_010667750.1|  PREDICTED: transcription factor HBP-1b(c38)-...    107   2e-23    
ref|NP_001042081.1|  Os01g0159000                                       106   5e-23    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643777.1|  PREDICTED: transcription factor TGA6-like          105   6e-23    
gb|EAY72627.1|  hypothetical protein OsI_00493                          105   1e-22    Oryza sativa Indica Group [Indian rice]
ref|XP_008358379.1|  PREDICTED: uncharacterized protein LOC103422122    100   1e-22    
ref|XP_010316826.1|  PREDICTED: transcription factor TGA5-like          105   2e-22    
ref|XP_010231035.1|  PREDICTED: uncharacterized protein LOC104582592    104   2e-22    
ref|XP_004148432.1|  PREDICTED: transcription factor TGA4-like          103   2e-22    
gb|KGN62783.1|  Transcription factor HBP-1b                             103   2e-22    
ref|XP_010277360.1|  PREDICTED: transcription factor HBP-1b(c38)-...    104   3e-22    
ref|XP_004978119.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    103   3e-22    
ref|XP_004293959.1|  PREDICTED: uncharacterized protein LOC101299272    103   5e-22    
gb|EYU43339.1|  hypothetical protein MIMGU_mgv1a024141mg                101   8e-22    
gb|KDP41541.1|  hypothetical protein JCGZ_15948                         102   9e-22    
ref|XP_009619619.1|  PREDICTED: transcription factor TGA2-like          102   1e-21    
ref|XP_010905699.1|  PREDICTED: transcription factor HBP-1b(c38)-...    100   1e-21    
ref|XP_006358130.1|  PREDICTED: transcription factor TGA1-like          102   2e-21    
ref|XP_010089698.1|  hypothetical protein L484_006320                   100   2e-21    
ref|XP_010316820.1|  PREDICTED: transcription factor HBP-1b(c38)-...    100   4e-21    
ref|XP_002272336.1|  PREDICTED: transcription factor TGA5-like          100   4e-21    Vitis vinifera
ref|XP_011074300.1|  PREDICTED: transcription factor TGA1               100   5e-21    
ref|XP_007159877.1|  hypothetical protein PHAVU_002G275400g           99.0    6e-21    
dbj|BAJ05340.1|  hypothetical protein                                 99.8    8e-21    
ref|XP_008444975.1|  PREDICTED: transcription factor TGA4             98.6    1e-20    
ref|XP_007213175.1|  hypothetical protein PRUPE_ppa027008mg           98.6    1e-20    
ref|XP_008442399.1|  PREDICTED: transcription factor HBP-1b(c38)      98.6    1e-20    
ref|XP_007025355.1|  Delay of germination 1, putative                   100   2e-20    
ref|XP_004968271.1|  PREDICTED: transcription factor TGA6-like        98.2    4e-20    
ref|XP_011101404.1|  PREDICTED: transcription factor TGA6-like        97.1    6e-20    
ref|XP_010037696.1|  PREDICTED: transcription factor HBP-1b(c38)-...  96.7    7e-20    
ref|XP_007026666.1|  Response to aba and salt 1, putative             96.7    7e-20    
ref|XP_009339278.1|  PREDICTED: transcription factor TGA5             96.3    7e-20    
ref|XP_009132082.1|  PREDICTED: uncharacterized protein LOC103856...  96.7    9e-20    
ref|XP_004137901.1|  PREDICTED: transcription factor TGA7-like        95.9    1e-19    
ref|XP_008345524.1|  PREDICTED: transcription factor TGA4-like        96.3    1e-19    
ref|XP_010277361.1|  PREDICTED: transcription factor HBP-1b(c38)-...  96.3    1e-19    
ref|XP_008366197.1|  PREDICTED: transcription factor TGA5-like        95.5    1e-19    
ref|XP_011079057.1|  PREDICTED: transcription factor TGA5-like        95.9    1e-19    
ref|XP_010439827.1|  PREDICTED: transcription factor TGA6-like        95.5    1e-19    
ref|XP_010414743.1|  PREDICTED: transcription factor TGA4-like        95.1    2e-19    
emb|CDX99446.1|  BnaC01g11060D                                        95.5    2e-19    
ref|XP_004305124.1|  PREDICTED: transcription factor TGA4-like        94.7    2e-19    
ref|XP_006472990.1|  PREDICTED: transcription factor TGA5-like        95.9    3e-19    
ref|XP_003634633.1|  PREDICTED: transcription factor TGA4-like        95.1    3e-19    
ref|XP_010052186.1|  PREDICTED: transcription factor HBP-1b(c38)      94.7    3e-19    
ref|XP_002263705.1|  PREDICTED: transcription factor TGA2-like        94.4    3e-19    Vitis vinifera
emb|CDO96811.1|  unnamed protein product                              94.7    4e-19    
ref|XP_011101398.1|  PREDICTED: transcription factor TGA5-like        94.4    4e-19    
ref|XP_006282688.1|  hypothetical protein CARUB_v10005444mg           95.1    4e-19    
ref|XP_010449483.1|  PREDICTED: uncharacterized protein LOC104731...  95.1    4e-19    
ref|XP_007206845.1|  hypothetical protein PRUPE_ppa027068mg           94.4    5e-19    
ref|XP_006301016.1|  hypothetical protein CARUB_v10021407mg           94.0    5e-19    
ref|XP_010064898.1|  PREDICTED: transcription factor HBP-1b(c38)-...  94.7    5e-19    
ref|XP_009789465.1|  PREDICTED: uncharacterized protein LOC104237085  94.4    6e-19    
ref|XP_009132069.1|  PREDICTED: uncharacterized protein LOC103856700  94.0    6e-19    
ref|XP_008219160.1|  PREDICTED: transcription factor HBP-1b(c38)      93.6    6e-19    
ref|XP_009395216.1|  PREDICTED: transcription factor TGA2-like        94.0    6e-19    
ref|XP_011098215.1|  PREDICTED: transcription factor TGA6-like        94.0    7e-19    
ref|XP_009764515.1|  PREDICTED: transcription factor TGA6             92.8    1e-18    
ref|XP_004238547.1|  PREDICTED: transcription factor HBP-1b(c38)      93.2    1e-18    
ref|XP_010518808.1|  PREDICTED: uncharacterized protein LOC104798429  93.6    1e-18    
emb|CBI30697.3|  unnamed protein product                              92.0    2e-18    
gb|AHA62826.1|  delay of germination 1 B                              92.8    2e-18    
ref|XP_008443347.1|  PREDICTED: uncharacterized protein LOC103486954  93.2    2e-18    
ref|XP_006356862.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  92.0    2e-18    
gb|AAT64037.1|  predicted protein                                     92.0    3e-18    Gossypium hirsutum [American cotton]
ref|XP_010511109.1|  PREDICTED: transcription factor TGA4-like        91.7    3e-18    
ref|XP_010317335.1|  PREDICTED: transcription factor HBP-1b(c38)-...  92.0    3e-18    
ref|XP_002266016.2|  PREDICTED: transcription factor TGA2             91.7    3e-18    Vitis vinifera
ref|XP_011082771.1|  PREDICTED: transcription factor HBP-1b(c38)-...  93.2    4e-18    
gb|ACD56655.1|  predicted protein                                     91.7    4e-18    Gossypioides kirkii
gb|EYU36422.1|  hypothetical protein MIMGU_mgv1a025661mg              91.7    4e-18    
ref|XP_007140269.1|  hypothetical protein PHAVU_008G097900g           91.3    4e-18    
emb|CDY23102.1|  BnaC09g18560D                                        92.0    4e-18    
ref|XP_004234088.1|  PREDICTED: transcription factor TGA6-like        91.7    4e-18    
ref|XP_008243515.1|  PREDICTED: transcription factor TGA4-like        91.3    5e-18    
ref|XP_004161213.1|  PREDICTED: uncharacterized LOC101207776          92.0    5e-18    
ref|XP_009792613.1|  PREDICTED: transcription factor TGA6-like        91.3    6e-18    
emb|CDP06021.1|  unnamed protein product                              87.8    7e-18    
ref|XP_010434503.1|  PREDICTED: transcription factor TGA6-like is...  90.5    7e-18    
ref|XP_004150221.1|  PREDICTED: uncharacterized protein LOC101207776  91.3    9e-18    
ref|XP_011082770.1|  PREDICTED: transcription factor HBP-1b(c38)-...  92.0    1e-17    
ref|XP_011101452.1|  PREDICTED: transcription factor TGA5-like        90.1    1e-17    
gb|EYU28097.1|  hypothetical protein MIMGU_mgv1a017794mg              90.1    1e-17    
ref|XP_006366944.1|  PREDICTED: transcription factor HBP-1b(c38)-...  89.7    1e-17    
ref|XP_002888220.1|  hypothetical protein ARALYDRAFT_893661           89.7    1e-17    
gb|KEH23189.1|  transcription factor TGA5-like protein                89.7    2e-17    
ref|XP_002272259.1|  PREDICTED: transcription factor TGA3-like        89.7    2e-17    Vitis vinifera
ref|XP_010439826.1|  PREDICTED: uncharacterized protein LOC104723193  90.1    2e-17    
ref|XP_010434502.1|  PREDICTED: uncharacterized protein LOC104718448  90.1    2e-17    
ref|XP_002534284.1|  conserved hypothetical protein                   89.4    2e-17    Ricinus communis
ref|XP_002863451.1|  hypothetical protein ARALYDRAFT_330831           89.7    3e-17    
ref|XP_002870028.1|  hypothetical protein ARALYDRAFT_492991           89.0    3e-17    
gb|ACV41800.1|  delay of germination 1                                89.4    3e-17    Lepidium sativum
ref|XP_009802153.1|  PREDICTED: transcription factor HBP-1b(c38)-...  89.0    3e-17    
ref|XP_009607760.1|  PREDICTED: transcription factor TGA6-like        89.0    3e-17    
gb|EEC71515.1|  hypothetical protein OsI_03809                        89.7    3e-17    Oryza sativa Indica Group [Indian rice]
gb|KDP24433.1|  hypothetical protein JCGZ_24997                       87.8    6e-17    
ref|XP_011081582.1|  PREDICTED: transcription factor HBP-1b(c38)-...  88.2    6e-17    
ref|XP_009623095.1|  PREDICTED: transcription factor HBP-1b(c38)-...  88.2    6e-17    
emb|CAB37450.1|  putative protein                                     87.8    7e-17    Arabidopsis thaliana [mouse-ear cress]
gb|AJE25535.1|  DOG1-like protein                                     88.6    7e-17    
emb|CDY61468.1|  BnaCnng37860D                                        88.6    7e-17    
gb|ACV41802.1|  delay of germination 1                                88.2    7e-17    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_006414073.1|  hypothetical protein EUTSA_v10027388mg           87.8    8e-17    
ref|XP_009769468.1|  PREDICTED: transcription factor TGA6-like        88.2    8e-17    
ref|NP_193600.2|  transcription factor-related protein                87.4    8e-17    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009377744.1|  PREDICTED: transcription factor TGA4-like        87.8    9e-17    
ref|XP_009101563.1|  PREDICTED: transcription factor HBP-1b(c38)      87.8    1e-16    
gb|EMT22752.1|  hypothetical protein F775_12222                       88.2    1e-16    
gb|AJE25537.1|  DOG1-like protein                                     87.4    2e-16    
gb|AGG09198.1|  delay of germination 1a                               87.4    2e-16    
ref|XP_009613589.1|  PREDICTED: transcription factor TGA6             86.7    2e-16    
gb|KFK31508.1|  hypothetical protein AALP_AA6G121700                  87.4    2e-16    
ref|XP_007025357.1|  Transcription factor-related, putative           87.0    2e-16    
gb|KCW69957.1|  hypothetical protein EUGRSUZ_F03275                   86.7    2e-16    
ref|XP_006281774.1|  hypothetical protein CARUB_v10027949mg           87.4    2e-16    
emb|CDY52216.1|  BnaAnng11390D                                        87.4    2e-16    
emb|CDY58051.1|  BnaA06g40200D                                        87.0    2e-16    
ref|XP_009114387.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  87.0    2e-16    
ref|XP_004486274.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  86.3    2e-16    
ref|XP_010316825.1|  PREDICTED: transcription factor TGA6             85.9    3e-16    
ref|XP_006285421.1|  hypothetical protein CARUB_v10006838mg           86.7    3e-16    
dbj|BAH30346.1|  hypothetical protein                                 85.9    3e-16    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530288.1|  PREDICTED: transcription factor HBP-1b(c38)-...  85.9    3e-16    
ref|XP_002510006.1|  Transcription factor HBP-1b, putative            85.1    3e-16    Ricinus communis
ref|XP_004514219.1|  PREDICTED: uncharacterized protein LOC101514340  85.5    4e-16    
ref|NP_564730.1|  protein ZW2                                         85.5    4e-16    Arabidopsis thaliana [mouse-ear cress]
gb|AIN76390.1|  DOG1                                                  86.3    4e-16    
ref|XP_002972738.1|  hypothetical protein SELMODRAFT_173073           86.3    5e-16    
ref|XP_003541699.1|  PREDICTED: transcription factor HBP-1b(c38)-...  85.5    5e-16    
gb|AGG09199.1|  delay of germination 1c                               85.9    6e-16    
ref|XP_010686461.1|  PREDICTED: transcription factor HBP-1b(c38)      85.1    6e-16    
ref|XP_004134926.1|  PREDICTED: transcription factor TGA1-like        85.5    6e-16    
ref|XP_009606302.1|  PREDICTED: transcription factor TGA7-like        85.1    6e-16    
ref|XP_002537773.1|  conserved hypothetical protein                   85.1    7e-16    Ricinus communis
ref|XP_008439732.1|  PREDICTED: transcription factor TGA5             85.1    8e-16    
ref|XP_010104255.1|  hypothetical protein L484_016398                 84.3    8e-16    
ref|XP_009617985.1|  PREDICTED: transcription factor TGA5-like        84.7    9e-16    
gb|KDO56688.1|  hypothetical protein CISIN_1g047612mg                 84.7    9e-16    
emb|CDY70293.1|  BnaCnng67640D                                        84.7    9e-16    
gb|KDP21107.1|  hypothetical protein JCGZ_21578                       84.7    1e-15    
ref|XP_006384064.1|  hypothetical protein POPTR_0004s05690g           84.3    1e-15    
ref|XP_002867982.1|  hypothetical protein ARALYDRAFT_354881           84.3    1e-15    
emb|CDP06468.1|  unnamed protein product                              84.3    1e-15    
emb|CDM84316.1|  unnamed protein product                              85.1    1e-15    
emb|CDY66844.1|  BnaC07g50150D                                        84.7    1e-15    
ref|XP_002870027.1|  hypothetical protein ARALYDRAFT_492990           84.7    1e-15    
dbj|BAO79416.1|  wheat delay of dormancy 1                            85.1    1e-15    
ref|XP_009136952.1|  PREDICTED: uncharacterized protein LOC103861007  84.7    1e-15    
ref|XP_006338981.1|  PREDICTED: transcription factor TGA6-like        84.3    1e-15    
ref|XP_006429421.1|  hypothetical protein CICLE_v10012620mg           84.0    1e-15    
ref|XP_010253822.1|  PREDICTED: uncharacterized protein LOC104594963  85.9    2e-15    
ref|XP_008349608.1|  PREDICTED: transcription factor TGA5-like        82.8    2e-15    
ref|XP_006285198.1|  hypothetical protein CARUB_v10006552mg           84.0    2e-15    
ref|XP_010449481.1|  PREDICTED: uncharacterized protein LOC104731707  84.3    2e-15    
ref|NP_193603.1|  uncharacterized protein                             83.6    2e-15    
ref|XP_006602670.1|  PREDICTED: transcription factor HBP-1b(c38)-...  83.6    2e-15    
ref|XP_006362387.1|  PREDICTED: transcription factor TGA4-like        83.2    2e-15    
ref|XP_010089699.1|  hypothetical protein L484_006321                 83.6    2e-15    
ref|XP_006414070.1|  hypothetical protein EUTSA_v10027258mg           84.0    2e-15    
gb|EYU43338.1|  hypothetical protein MIMGU_mgv1a023322mg              83.6    2e-15    
ref|XP_006467638.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  83.6    2e-15    
ref|XP_010439824.1|  PREDICTED: uncharacterized protein LOC104723191  83.6    3e-15    
ref|XP_003636790.1|  Transcription factor TGA5                        82.8    3e-15    
ref|XP_009118288.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  82.4    5e-15    
ref|XP_002532112.1|  Transcription factor HBP-1b, putative            82.4    5e-15    
ref|XP_010490486.1|  PREDICTED: transcription factor TGA4-like        82.4    6e-15    
gb|KFK28541.1|  hypothetical protein AALP_AA7G010100                  82.8    6e-15    
ref|XP_010999748.1|  PREDICTED: transcription factor TGA6             82.0    7e-15    
ref|NP_193604.2|  uncharacterized protein                             82.8    7e-15    
ref|XP_010434499.1|  PREDICTED: uncharacterized protein LOC104718445  82.8    8e-15    
ref|XP_008351209.1|  PREDICTED: transcription factor TGA7-like        82.8    1e-14    
ref|XP_004289492.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  79.7    1e-14    
ref|XP_010676762.1|  PREDICTED: transcription factor TGA4-like        81.6    1e-14    
ref|XP_011085984.1|  PREDICTED: transcription factor TGA5-like        82.8    1e-14    
ref|XP_010458320.1|  PREDICTED: transcription factor TGA4-like        81.3    1e-14    
gb|KFK28540.1|  hypothetical protein AALP_AA7G010000                  82.0    1e-14    
emb|CAB37454.1|  putative protein                                     82.8    2e-14    
ref|XP_003565204.1|  PREDICTED: transcription factor TGA2-like        80.9    3e-14    
ref|XP_006414069.1|  hypothetical protein EUTSA_v10025925mg           80.9    3e-14    
gb|KDO77874.1|  hypothetical protein CISIN_1g046619mg                 80.1    4e-14    
ref|XP_006449514.1|  hypothetical protein CICLE_v10017869mg           79.7    4e-14    
ref|XP_006398268.1|  hypothetical protein EUTSA_v10001138mg           80.5    5e-14    
ref|XP_007148035.1|  hypothetical protein PHAVU_006G175000g           80.5    7e-14    
ref|XP_004246934.1|  PREDICTED: transcription factor TGA2-like        79.0    8e-14    
ref|XP_010462116.1|  PREDICTED: transcription factor TGA1-like is...  80.9    8e-14    
ref|XP_010064245.1|  PREDICTED: transcription factor TGA1-like        79.3    9e-14    
ref|XP_010462108.1|  PREDICTED: transcription factor TGA1-like is...  80.9    1e-13    
emb|CDY22613.1|  BnaC08g42470D                                        78.6    1e-13    
ref|XP_006303181.1|  hypothetical protein CARUB_v10010176mg           78.6    1e-13    
emb|CDX94928.1|  BnaC05g07430D                                        78.6    1e-13    
ref|XP_008371485.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  78.2    2e-13    
ref|XP_002455164.1|  hypothetical protein SORBIDRAFT_03g005300        79.7    2e-13    
ref|XP_011085128.1|  PREDICTED: transcription factor TGA5-like        78.2    2e-13    
gb|KFK28539.1|  hypothetical protein AALP_AA7G009900                  78.6    2e-13    
ref|NP_001078800.1|  transcription factor TGA1                        78.6    2e-13    
gb|KFK22875.1|  hypothetical protein AALP_AAs39777U000200             78.6    3e-13    
ref|XP_002272378.1|  PREDICTED: transcription factor TGA5-like        77.4    3e-13    
ref|XP_009768149.1|  PREDICTED: transcription factor TGA7-like        77.4    3e-13    
ref|XP_008804507.1|  PREDICTED: transcription factor TGA4-like is...  78.6    3e-13    
ref|XP_004249821.1|  PREDICTED: transcription factor HBP-1b(c38)-...  77.4    4e-13    
ref|XP_006280664.1|  hypothetical protein CARUB_v10026623mg           79.0    4e-13    
ref|XP_008351887.1|  PREDICTED: transcription factor TGA4-like        76.3    4e-13    
gb|AAM64610.1|  DNA binding protein TGA1a homolog                     78.2    6e-13    
ref|XP_009350852.1|  PREDICTED: transcription factor TGA6             76.6    6e-13    
ref|NP_201324.1|  transcription factor TGA1                           78.2    7e-13    
ref|XP_008804505.1|  PREDICTED: transcription factor TGA1-like is...  78.2    8e-13    
ref|XP_010519876.1|  PREDICTED: transcription factor TGA1-like is...  78.2    9e-13    
ref|XP_003547173.2|  PREDICTED: transcription factor TGA5-like        77.0    9e-13    
ref|XP_010519867.1|  PREDICTED: transcription factor TGA1-like is...  78.2    1e-12    
emb|CDX93460.1|  BnaA06g05880D                                        75.9    1e-12    
ref|XP_010484330.1|  PREDICTED: transcription factor TGA1             77.8    1e-12    
ref|XP_010519860.1|  PREDICTED: transcription factor TGA1-like is...  77.8    1e-12    
ref|XP_006433711.1|  hypothetical protein CICLE_v10003662mg           75.5    1e-12    
ref|XP_010519853.1|  PREDICTED: transcription factor TGA1-like is...  77.8    1e-12    
ref|XP_010546397.1|  PREDICTED: transcription factor TGA1             77.4    1e-12    
ref|XP_009148314.1|  PREDICTED: transcription factor TGA1-like        75.5    2e-12    
ref|XP_002864946.1|  predicted protein                                77.0    2e-12    
ref|XP_002892539.1|  hypothetical protein ARALYDRAFT_471106           74.7    3e-12    
ref|XP_004293958.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  74.7    3e-12    
ref|XP_004972183.1|  PREDICTED: transcription factor HBP-1b(c38)-...  75.5    3e-12    
gb|EYU26796.1|  hypothetical protein MIMGU_mgv1a026861mg              74.7    3e-12    
ref|XP_010494735.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  75.5    3e-12    
ref|XP_009338174.1|  PREDICTED: transcription factor TGA2-like        74.3    4e-12    
ref|XP_009405145.1|  PREDICTED: transcription factor HBP-1b(c38)-...  73.6    6e-12    
ref|XP_006288172.1|  hypothetical protein CARUB_v10001409mg           75.1    6e-12    
emb|CDO96810.1|  unnamed protein product                              73.6    7e-12    
ref|XP_010695448.1|  PREDICTED: transcription factor HBP-1b(c38)      72.8    7e-12    
dbj|BAH20132.1|  AT5G65210                                            75.5    7e-12    
ref|XP_010905949.1|  PREDICTED: transcription factor TGA4-like is...  75.5    7e-12    
ref|XP_006394063.1|  hypothetical protein EUTSA_v10004438mg           75.5    7e-12    
dbj|BAO45899.1|  basic leucine zipper protein                         75.5    8e-12    
ref|XP_010905948.1|  PREDICTED: transcription factor TGA4-like is...  75.5    9e-12    
emb|CDX76507.1|  BnaA08g08930D                                        73.6    9e-12    
ref|NP_172466.1|  response to ABA and salt 1                          72.8    1e-11    
ref|XP_001765151.1|  predicted protein                                75.1    2e-11    
emb|CAA48189.1|  transcription factor                                 74.3    2e-11    
ref|XP_002980439.1|  hypothetical protein SELMODRAFT_112221           72.0    2e-11    
ref|XP_010939598.1|  PREDICTED: transcription factor TGA1-like is...  73.9    2e-11    
gb|AAD34570.1|AF143442_1  NPR1-interactor protein 1                   72.4    2e-11    
ref|XP_010939597.1|  PREDICTED: transcription factor TGA1-like is...  73.9    2e-11    
gb|AHF20186.1|  transcription factor tga1                             73.9    3e-11    
ref|XP_009401076.1|  PREDICTED: transcription factor TGA1-like is...  73.9    3e-11    
ref|XP_010916941.1|  PREDICTED: transcription factor TGA4             73.6    3e-11    
ref|XP_009401075.1|  PREDICTED: transcription factor TGA4-like is...  73.6    3e-11    
ref|XP_004309443.1|  PREDICTED: transcription factor HBP-1b(c1)-like  73.9    3e-11    
ref|XP_009146628.1|  PREDICTED: transcription factor TGA6 isoform X2  72.8    3e-11    
gb|EAY98526.1|  hypothetical protein OsI_20438                        73.2    4e-11    
ref|XP_004515653.1|  PREDICTED: transcription factor TGA3-like is...  73.2    4e-11    
ref|XP_004515651.1|  PREDICTED: transcription factor TGA3-like is...  73.2    4e-11    
emb|CBI21482.3|  unnamed protein product                              72.8    5e-11    
ref|XP_008804825.1|  PREDICTED: transcription factor TGA2             72.4    5e-11    
ref|XP_009146627.1|  PREDICTED: transcription factor TGA6 isoform X1  72.4    5e-11    
gb|EYU29539.1|  hypothetical protein MIMGU_mgv1a023140mg              71.2    5e-11    
ref|XP_010673023.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  72.4    6e-11    
ref|XP_009367344.1|  PREDICTED: transcription factor TGA7 isoform X3  72.8    6e-11    
ref|XP_009367342.1|  PREDICTED: transcription factor TGA7 isoform X1  72.8    6e-11    
ref|XP_010652847.1|  PREDICTED: transcription factor TGA1 isoform X1  72.8    6e-11    
ref|XP_010652849.1|  PREDICTED: transcription factor TGA1 isoform X2  72.8    6e-11    
ref|XP_009367343.1|  PREDICTED: transcription factor TGA7 isoform X2  72.8    6e-11    
ref|XP_006487952.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  72.8    7e-11    
gb|KDO58071.1|  hypothetical protein CISIN_1g036039mg                 72.8    7e-11    
ref|XP_004300665.1|  PREDICTED: transcription factor TGA7-like        72.4    7e-11    
ref|XP_003566099.1|  PREDICTED: transcription factor HBP-1b(c1)-like  72.0    8e-11    
ref|XP_006428094.1|  hypothetical protein CICLE_v10025940mg           72.4    8e-11    
ref|XP_006487951.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  72.8    8e-11    
ref|XP_006487948.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  72.8    8e-11    
ref|XP_006487950.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  72.8    9e-11    
gb|ABK92477.1|  unknown                                               70.5    9e-11    
ref|XP_010932613.1|  PREDICTED: transcription factor TGA2-like        72.4    9e-11    
ref|XP_006655440.1|  PREDICTED: transcription factor HBP-1b(c1)-like  72.0    9e-11    
ref|XP_010261147.1|  PREDICTED: transcription factor TGA1-like is...  72.0    1e-10    
ref|XP_010673021.1|  PREDICTED: transcription factor HBP-1b(c38)-...  72.4    1e-10    
ref|XP_008225304.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  70.5    1e-10    
ref|XP_010673022.1|  PREDICTED: transcription factor HBP-1b(c38)-...  72.0    1e-10    
ref|XP_010230791.1|  PREDICTED: transcription factor HBP-1b(c38)      71.6    1e-10    
gb|AFO63289.1|  bZIP10                                                72.0    1e-10    
gb|ABK81209.1|  DOG1 alpha splice variant                             70.9    1e-10    
ref|XP_009132089.1|  PREDICTED: uncharacterized protein LOC103856...  68.6    1e-10    
ref|XP_004249310.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  72.0    1e-10    
ref|XP_006351371.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  72.0    1e-10    
gb|AGT17167.1|  hypothetical protein SHCRBa_238_G09_F_100             71.2    1e-10    
ref|XP_002310607.2|  hypothetical protein POPTR_0007s06710g           69.3    2e-10    
gb|ABK81207.1|  DOG1 alpha splice variant                             70.5    2e-10    
gb|AGT17454.1|  hypothetical protein SHCRBa_258_F08_R_30              71.2    2e-10    
ref|XP_009130499.1|  PREDICTED: transcription factor TGA1-like        71.2    2e-10    
ref|XP_008378518.1|  PREDICTED: transcription factor TGA7-like        71.2    2e-10    
ref|XP_002975942.1|  hypothetical protein SELMODRAFT_232668           70.9    2e-10    
gb|AGT16544.1|  TGACG motif-biding factor 6                           70.9    2e-10    
ref|XP_010031515.1|  PREDICTED: transcription factor HBP-1b(c38) ...  71.6    2e-10    
gb|ABK81206.1|  DOG1 alpha splice variant                             70.5    2e-10    
ref|XP_006424250.1|  hypothetical protein CICLE_v100284281mg          71.6    2e-10    
ref|XP_007048077.1|  BZIP transcription factor family protein iso...  71.2    2e-10    
emb|CDY08443.1|  BnaA05g26790D                                        70.9    2e-10    
gb|AGT17377.1|  bZIP transcription factor                             70.9    2e-10    
dbj|BAG91889.1|  unnamed protein product                              68.6    2e-10    
gb|ABK81211.1|  DOG1 alpha splice variant                             70.1    2e-10    
emb|CDY37811.1|  BnaAnng04720D                                        70.9    2e-10    
gb|AGT16289.1|  Basic-leucine zipper domain                           70.9    2e-10    
ref|XP_010031514.1|  PREDICTED: transcription factor HBP-1b(c38) ...  71.2    2e-10    
ref|XP_002306598.1|  Transcription factor TGA7 family protein         70.9    3e-10    
ref|XP_007222089.1|  hypothetical protein PRUPE_ppa007593mg           70.9    3e-10    
emb|CDY33975.1|  BnaC02g43620D                                        70.9    3e-10    
dbj|BAK01043.1|  predicted protein                                    68.6    3e-10    
dbj|BAB09311.1|  tumor-related protein-like                           69.7    3e-10    
ref|XP_004173916.1|  PREDICTED: transcription factor TGA4-like        68.9    3e-10    
ref|XP_004967673.1|  PREDICTED: transcription factor HBP-1b(c38)-...  70.5    3e-10    
ref|XP_006434079.1|  hypothetical protein CICLE_v10004036mg           70.9    3e-10    
ref|XP_006417512.1|  hypothetical protein EUTSA_v10008665mg           68.9    3e-10    
ref|XP_002968543.1|  hypothetical protein SELMODRAFT_231160           69.7    3e-10    
ref|XP_009150603.1|  PREDICTED: transcription factor TGA1             70.5    3e-10    
ref|XP_010063316.1|  PREDICTED: transcription factor TGA1-like is...  70.5    3e-10    
ref|XP_006299748.1|  hypothetical protein CARUB_v10015943mg           69.7    3e-10    
ref|XP_003567594.2|  PREDICTED: uncharacterized protein LOC100833996  69.3    3e-10    
gb|ACV53508.1|  leucine zipper transcription factor TGA               70.9    4e-10    
ref|XP_010063319.1|  PREDICTED: transcription factor TGA1-like is...  70.5    4e-10    
ref|XP_009759888.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  70.9    4e-10    
ref|XP_009135220.1|  PREDICTED: transcription factor TGA6-like        70.1    4e-10    
ref|XP_006472677.1|  PREDICTED: transcription factor TGA7-like is...  70.5    4e-10    
emb|CAA49525.1|  ocs-element binding factor 5                         70.1    4e-10    
gb|KDO80846.1|  hypothetical protein CISIN_1g036441mg                 70.5    4e-10    
emb|CDY00762.1|  BnaC03g37460D                                        70.1    4e-10    
emb|CDY34053.1|  BnaC03g62790D                                        70.1    4e-10    
ref|XP_002970901.1|  hypothetical protein SELMODRAFT_231689           69.7    4e-10    
ref|XP_002310002.2|  TGA-type basic leucine zipper protein TGA1.1     70.1    4e-10    
ref|XP_006407351.1|  hypothetical protein EUTSA_v10021187mg           69.7    4e-10    
ref|XP_008338872.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  68.2    4e-10    
ref|XP_010491292.1|  PREDICTED: transcription factor TGA5             69.7    4e-10    
gb|KHN08426.1|  TGACG-sequence-specific DNA-binding protein TGA-2.1   68.2    4e-10    
ref|XP_008808847.1|  PREDICTED: transcription factor TGA4-like        70.1    4e-10    
ref|NP_001132337.1|  putative bZIP transcription factor superfami...  69.7    5e-10    
ref|XP_008786823.1|  PREDICTED: transcription factor TGA2-like is...  70.5    5e-10    
emb|CDY14552.1|  BnaC03g49070D                                        70.1    5e-10    
ref|XP_008786824.1|  PREDICTED: transcription factor TGA2-like is...  70.5    5e-10    
ref|XP_006407352.1|  hypothetical protein EUTSA_v10021187mg           69.7    5e-10    
ref|XP_008673687.1|  PREDICTED: transcription factor TGA6-like        68.9    5e-10    
emb|CDY40074.1|  BnaC02g00560D                                        70.1    5e-10    
ref|NP_196313.1|  OCS-element binding factor 5                        69.7    5e-10    
ref|XP_010907586.1|  PREDICTED: transcription factor TGA2-like        70.5    5e-10    
gb|KDP32726.1|  hypothetical protein JCGZ_12018                       69.7    5e-10    
ref|XP_002871243.1|  ocs-element binding factor 5                     69.7    5e-10    
emb|CDX88399.1|  BnaC06g38430D                                        70.1    6e-10    
ref|XP_002969636.1|  hypothetical protein SELMODRAFT_231344           69.3    6e-10    
dbj|BAF00554.1|  tumor-related protein-like                           68.9    6e-10    
ref|XP_010449484.1|  PREDICTED: uncharacterized protein LOC104731...  67.0    6e-10    
ref|NP_196312.1|  transcription factor TGA2                           69.3    7e-10    
ref|XP_002457410.1|  hypothetical protein SORBIDRAFT_03g006790        69.3    7e-10    
gb|ABR46137.1|  bZIP transcription factor TGA2                        69.3    7e-10    
ref|XP_009125333.1|  PREDICTED: transcription factor TGA4 isoform X2  69.7    7e-10    
ref|NP_001078141.1|  transcription factor TGA6                        68.9    7e-10    
ref|NP_199395.2|  protein DELAY OF GERMINATION 1                      68.9    7e-10    
ref|XP_011006864.1|  PREDICTED: transcription factor TGA7-like is...  69.7    7e-10    
ref|XP_008234522.1|  PREDICTED: transcription factor TGA1 isoform X2  69.7    7e-10    
ref|XP_002871242.1|  bZIP transcription factor TGA2                   69.3    7e-10    
ref|XP_007205406.1|  hypothetical protein PRUPE_ppa007578mg           69.7    7e-10    
ref|XP_010067716.1|  PREDICTED: transcription factor TGA2             69.3    7e-10    
ref|XP_011021894.1|  PREDICTED: transcription factor TGA1-like        69.7    7e-10    
gb|AFK39309.1|  unknown                                               67.8    8e-10    
ref|XP_009125331.1|  PREDICTED: transcription factor TGA4 isoform X1  69.3    8e-10    
ref|XP_002513852.1|  Transcription factor TGA7, putative              69.3    8e-10    
ref|XP_010317336.1|  PREDICTED: uncharacterized protein LOC104646038  67.4    8e-10    
ref|NP_566415.3|  transcription factor TGA6                           68.9    9e-10    
ref|XP_009120767.1|  PREDICTED: transcription factor TGA6-like is...  68.6    9e-10    
dbj|BAB03134.1|  leucine zipper transcription factor HBP-1b           68.9    9e-10    
ref|NP_974293.1|  transcription factor TGA6                           68.9    9e-10    
ref|XP_010464986.1|  PREDICTED: transcription factor TGA6 isoform X4  68.6    1e-09    
ref|XP_007018900.1|  BZIP transcription factor family protein         68.9    1e-09    
ref|XP_007132428.1|  hypothetical protein PHAVU_011G0937001g          67.0    1e-09    
ref|XP_010498795.1|  PREDICTED: transcription factor TGA6-like is...  68.6    1e-09    
ref|XP_004149145.1|  PREDICTED: transcription factor TGA1-like        68.9    1e-09    
gb|ABS01351.1|  basic leucine zipper protein                          69.3    1e-09    
ref|XP_009120759.1|  PREDICTED: transcription factor TGA6-like is...  68.9    1e-09    
ref|XP_011077152.1|  PREDICTED: transcription factor HBP-1b(c38)-...  69.3    1e-09    



>ref|XP_009798761.1| PREDICTED: transcription factor TGA5 [Nicotiana sylvestris]
Length=226

 Score =   344 bits (882),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MSFQ F+ETWFEQL+ +V QLGQAPRPAT   HH+L Q++VQKVMSH  EYYRVKS+AAK
Sbjct  1    MSFQLFYETWFEQLKGMVHQLGQAPRPATNDQHHELHQQLVQKVMSHYSEYYRVKSLAAK  60

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             DIL VF+APW TSLERSLHWI GWRPTT FHLIYTESS+LFESHI+DILRGLR GDLGD
Sbjct  61   NDILSVFSAPWCTSLERSLHWISGWRPTTAFHLIYTESSVLFESHIIDILRGLRYGDLGD  120

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKAD  335
            L+P QLRRVSELQC+ VQEEN IAD+LSDWQDG S++IG+M G +DAKME L  ILE+AD
Sbjct  121  LSPDQLRRVSELQCQAVQEENAIADELSDWQDGASEVIGLM-GDIDAKMEGLVSILERAD  179

Query  334  QLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            +LRMKTI NLV+LL+ QQAVEFLIAAA L FGIRRWGINHDRQR N
Sbjct  180  KLRMKTIENLVQLLSPQQAVEFLIAAAHLQFGIRRWGINHDRQRGN  225



>ref|XP_004244373.1| PREDICTED: transcription factor TGA5 [Solanum lycopersicum]
Length=226

 Score =   336 bits (861),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MSFQ F+ETWF+QL+++V+QL Q PRPAT+  H +L Q +VQKV+SH +EYYRVKS+AAK
Sbjct  1    MSFQRFYETWFDQLKEIVRQLNQVPRPATSDHHRELHQLLVQKVVSHIYEYYRVKSLAAK  60

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             DIL VF+APW+TSLERSLHWI GWRPTT FHLIYTESSILFESHI+DILRGLR GDLGD
Sbjct  61   NDILSVFSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGD  120

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKAD  335
            L+P QL RVSE QCETV EEN I D+L+DWQDG S+IIG+M G ++ KMEKL EILEKAD
Sbjct  121  LSPEQLARVSEFQCETVHEENSITDELNDWQDGASEIIGLM-GDIEEKMEKLVEILEKAD  179

Query  334  QLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            +LRMKTI NLV+LLT QQAVEFLIA+A L FGIR+WGINHDRQREN
Sbjct  180  KLRMKTIENLVQLLTPQQAVEFLIASAHLQFGIRKWGINHDRQREN  225



>ref|XP_009618663.1| PREDICTED: transcription factor TGA1-like [Nicotiana tomentosiformis]
Length=228

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 195/229 (85%), Gaps = 1/229 (0%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MSFQ F++ WFEQL+ +V QL Q PRPAT+  HH+L +++VQKVMSH +EYYRVKS+AAK
Sbjct  1    MSFQRFYDAWFEQLKGMVHQLNQVPRPATSDQHHELHKQLVQKVMSHYYEYYRVKSLAAK  60

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             DI  VF+APW+TSLERSLHWI GWRPTT FHLIYTESSILFESHI+DILRGLR GDLGD
Sbjct  61   NDIFSVFSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGD  120

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKAD  335
            L+P QL RVSELQCE VQEEN IAD+LSDWQDG S++IG ++G +D KME L  ILE+AD
Sbjct  121  LSPDQLHRVSELQCEAVQEENAIADELSDWQDGASEVIG-LTGDIDVKMEGLVSILERAD  179

Query  334  QLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNVS  188
            +LRMKTI NLV+LL+ QQAVEFLIAAA L FGIRRWGINHDRQR N  S
Sbjct  180  KLRMKTIENLVQLLSPQQAVEFLIAAAHLQFGIRRWGINHDRQRGNPAS  228



>ref|XP_006348396.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Solanum tuberosum]
Length=226

 Score =   333 bits (855),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MSFQ F++TWF+QL+++V+QL Q PRPAT+  H +L Q++VQKV+SH +EYYRVKS+AAK
Sbjct  1    MSFQRFYDTWFDQLKEIVRQLSQVPRPATSEQHRELHQQLVQKVVSHIYEYYRVKSLAAK  60

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             DIL V++APW+TSLERSLHWI GWRPTT FHLIYTESSILFESHI+DILRGLR GDLGD
Sbjct  61   NDILSVYSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGD  120

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKAD  335
            L+P QL RVSELQCE VQEEN I D+ +DWQD  S+I+G+M G ++ KMEKL EILEKAD
Sbjct  121  LSPDQLARVSELQCEAVQEENSITDEFNDWQDSASEILGLM-GDIEGKMEKLVEILEKAD  179

Query  334  QLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            +LR+KTI NLVELLT QQA+EFLIA+A L FGIRRWGINHDRQREN
Sbjct  180  KLRLKTIENLVELLTPQQAIEFLIASAHLQFGIRRWGINHDRQREN  225



>ref|XP_009629955.1| PREDICTED: transcription factor TGA1-like [Nicotiana tomentosiformis]
Length=227

 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 183/223 (82%), Gaps = 1/223 (0%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F  FHE W EQLR++ QQL ++PRPAT  + H+L  +++QK  SH +EYYRVKS+AAK 
Sbjct  3    GFHQFHEAWHEQLREIAQQLKKSPRPATNQEQHELHTQLIQKFTSHYYEYYRVKSMAAKN  62

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            DIL +FTAPW+ SLERSL+WI GWRPTT FH+ YTESSILFES I+DILRG RNGDL DL
Sbjct  63   DILHIFTAPWSNSLERSLYWIAGWRPTTAFHIFYTESSILFESQIVDILRGFRNGDLVDL  122

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P QL R SELQ ETVQ+EN I +QLSDWQD  +D+IG M G +D KME+L EILEKADQ
Sbjct  123  SPNQLSRFSELQYETVQQENAITEQLSDWQDSANDMIGTM-GDVDRKMERLVEILEKADQ  181

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            LRMKTI NL++LLTAQQAVEFLIAAA L+FGIR WG+NHDRQR
Sbjct  182  LRMKTIENLLQLLTAQQAVEFLIAAAHLLFGIRGWGVNHDRQR  224



>ref|XP_011082768.1| PREDICTED: transcription factor TGA1 [Sesamum indicum]
Length=227

 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            M FQ F++TWFEQLRQLVQQL +AP P TT +HH   +++V K MSH  EYYR KS AAK
Sbjct  1    MLFQRFYDTWFEQLRQLVQQLSEAPIPPTTEEHHLQLRQLVHKAMSHYAEYYRAKSAAAK  60

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             D+L  F+APW TSLERSLHWIGGWRPTT FHL+YTESSILFESH++DILRG   GDLGD
Sbjct  61   HDVLAFFSAPWTTSLERSLHWIGGWRPTTAFHLVYTESSILFESHVVDILRGFHTGDLGD  120

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKAD  335
            L+P Q RRVSELQ ETVQ+EN I D+LSDWQD  +DI+G   G  D KMEKLA+ILE+AD
Sbjct  121  LSPGQFRRVSELQIETVQQENDITDELSDWQDDTTDILGTKYGDGDRKMEKLAKILERAD  180

Query  334  QLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
            QLR+KTI  LVELLT QQA EFL+AAA+L FG+R WGI  DR+R ++
Sbjct  181  QLRLKTIETLVELLTPQQAAEFLVAAAELHFGVRGWGIRVDRERGSS  227



>ref|XP_009789761.1| PREDICTED: transcription factor TGA2-like [Nicotiana sylvestris]
Length=234

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 182/226 (81%), Gaps = 1/226 (0%)
 Frame = -1

Query  880  KKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            K   F  FHE W EQLR+LVQQL +APRPAT  + H+L   +VQK  SH +EYYRVKS+A
Sbjct  7    KLSGFHQFHEEWHEQLRELVQQLKKAPRPATNQEQHELHTHLVQKFTSHYYEYYRVKSMA  66

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            AK DIL +F+APW+ SLERSL+WI GWRPTT FH+IYT+SSILFES I+DILRG  NGDL
Sbjct  67   AKNDILHIFSAPWSNSLERSLYWIAGWRPTTAFHIIYTKSSILFESPIVDILRGFGNGDL  126

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEK  341
            GDL+P QL R+SE Q ETVQ+EN I +QLSDWQD G+ IIG M G +D KM +L EILEK
Sbjct  127  GDLSPNQLSRLSEFQYETVQQENAITEQLSDWQDSGNAIIGTM-GDVDGKMGRLVEILEK  185

Query  340  ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            ADQLRMKTI NL++LLTAQQA EFLI AA L+FGIR WG+NHDRQR
Sbjct  186  ADQLRMKTIENLLQLLTAQQAAEFLILAAHLLFGIRGWGVNHDRQR  231



>ref|XP_008386261.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=227

 Score =   295 bits (756),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 181/225 (80%), Gaps = 1/225 (0%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF SF+ETWFEQL  LV QL   PRP TT DHH     +VQKVM+H  EYYRVKS+AA+R
Sbjct  3    SFTSFYETWFEQLHHLVHQLSTCPRPPTTPDHHHQLLHVVQKVMAHYAEYYRVKSLAAER  62

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D L VF APWAT+LERSLHWIGGWRPTT FHL+Y+ESSI FE+HI+DILRG R GDLGDL
Sbjct  63   DALSVFVAPWATTLERSLHWIGGWRPTTAFHLVYSESSIHFEAHIVDILRGYRTGDLGDL  122

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            TP+Q RRVS+LQCETV+EEN I+D+LS+WQDG  +++G  +  L+  M  L  +L+KAD+
Sbjct  123  TPSQFRRVSDLQCETVKEENAISDELSEWQDGACELMGEYT-NLETNMGLLVSVLKKADE  181

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            LR+KT+  +VELLT QQAVEFLIAAA+L FG+R WG+N DR+R N
Sbjct  182  LRLKTLRKVVELLTPQQAVEFLIAAAELQFGVRGWGLNQDRRRRN  226



>ref|XP_007212919.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica]
 gb|EMJ14118.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica]
Length=229

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 181/225 (80%), Gaps = 1/225 (0%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF SF+ETWFEQL  LV QL   PRP TT DHH     +VQKVMSH  EYYRVK++AA+R
Sbjct  5    SFTSFYETWFEQLHNLVHQLSTCPRPPTTPDHHHHLLHVVQKVMSHYDEYYRVKALAAER  64

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D L VF APWAT+LERSLHWI GWRPTT FHL+Y+ESSI FE+HI+DILRG   GDLGDL
Sbjct  65   DALAVFVAPWATTLERSLHWIAGWRPTTAFHLVYSESSIHFEAHIVDILRGFSTGDLGDL  124

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P+Q RRVSELQCETV+EEN I+++LS+WQ+G S+++G  +  LD KM +L  +L+KAD 
Sbjct  125  SPSQFRRVSELQCETVKEENAISEELSEWQEGASELMGACT-NLDMKMGRLVTVLKKADN  183

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            LR++T+  +VELLT QQAVEFLIAAA+L FG+R WG+N DRQR N
Sbjct  184  LRLRTVRKVVELLTPQQAVEFLIAAAELQFGVRGWGMNQDRQRGN  228



>ref|XP_006442481.1| hypothetical protein CICLE_v10022056mg [Citrus clementina]
 gb|ESR55721.1| hypothetical protein CICLE_v10022056mg [Citrus clementina]
Length=231

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = -1

Query  850  TWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFT  671
            TWFEQL QLVQQL  APRP TT D HQ  +++V K ++H  EYY+VKS  A+RD+  VF 
Sbjct  12   TWFEQLNQLVQQLSAAPRPPTTHDQHQDLEKLVAKTLTHYTEYYKVKSAEAQRDVFNVFA  71

Query  670  APWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQLRR  491
            APWA+SLERSLHWI GWRPTTVFHL+YTESS LFESHI+DILRGLR GDLGDL+P+Q RR
Sbjct  72   APWASSLERSLHWIAGWRPTTVFHLVYTESSTLFESHIVDILRGLRTGDLGDLSPSQFRR  131

Query  490  VSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTIT  311
            VSELQCETV+EEN I D+LS+WQDG S+++G  S  +D K+  L  I++KAD LR++T+ 
Sbjct  132  VSELQCETVKEENAITDELSEWQDGASELVGDCSASVDEKIRLLVSIVQKADDLRLRTVR  191

Query  310  NLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
             +V+LLT QQAVEFLIAAA+L FG+R+WG++ DR+R
Sbjct  192  RVVDLLTTQQAVEFLIAAAELQFGVRKWGLDQDRRR  227



>ref|XP_006477767.1| PREDICTED: transcription factor TGA1-like [Citrus sinensis]
 gb|KDO35852.1| hypothetical protein CISIN_1g040790mg [Citrus sinensis]
Length=231

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 176/216 (81%), Gaps = 0/216 (0%)
 Frame = -1

Query  850  TWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFT  671
            TWFEQL QLVQQL  A RP TT D HQ  +++V K ++H  EYY+VKS  A+RD+  VF 
Sbjct  12   TWFEQLNQLVQQLSAAARPPTTYDQHQDLEKLVAKTLTHYTEYYKVKSAEAQRDVFNVFA  71

Query  670  APWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQLRR  491
            APWA+SLERSLHWI GWRPTTVFHL+YTESS LFESHI+DILRGLR GDLGDL+P+Q RR
Sbjct  72   APWASSLERSLHWIAGWRPTTVFHLVYTESSTLFESHIVDILRGLRTGDLGDLSPSQFRR  131

Query  490  VSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTIT  311
            VSELQCETV+EEN I D+LS+WQDG S+++G  S  +D K+  L  I++KAD LR++T+ 
Sbjct  132  VSELQCETVKEENAITDELSEWQDGASELVGDCSASVDEKIRLLVSIVQKADDLRLRTVR  191

Query  310  NLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
             +V+LLT QQAVEFLIAAA+L FG+R+WG++ DR+R
Sbjct  192  RVVDLLTTQQAVEFLIAAAELQFGVRKWGLDQDRRR  227



>ref|XP_010086637.1| hypothetical protein L484_004349 [Morus notabilis]
 gb|EXB22356.1| hypothetical protein L484_004349 [Morus notabilis]
Length=232

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 178/226 (79%), Gaps = 1/226 (0%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F +F+ETW EQL  LV+QL  APRP TT DHH     +V KVMSH  EYYRVKS+AA+R
Sbjct  8    GFCNFYETWLEQLHHLVRQLTAAPRPPTTPDHHYDLDVLVGKVMSHYAEYYRVKSVAAER  67

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D L VF APWA++LERSLHWI GWRPTTVFHL+Y+ESSILFESHI+DILRGLR GDLGDL
Sbjct  68   DTLSVFAAPWASALERSLHWIAGWRPTTVFHLVYSESSILFESHIIDILRGLRTGDLGDL  127

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P+Q RRVSELQC+TV+EEN I ++ S+WQD  S+++   +  L  K+ +L  +L KAD 
Sbjct  128  SPSQFRRVSELQCDTVREENAITEEFSEWQDSASELVNARA-DLKEKIGRLVSVLRKADD  186

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
            LR++T  ++V+LLT QQA EFLIAAA+L FG+R WG+NHDR R N+
Sbjct  187  LRLRTFQSVVDLLTPQQAAEFLIAAAELQFGVRGWGVNHDRLRGNH  232



>gb|EYU45030.1| hypothetical protein MIMGU_mgv1a018123mg [Erythranthe guttata]
Length=467

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -1

Query  880  KKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            K + FQ +++TWF QLRQLVQQL Q+P P TT +HH   ++++ K MSH  +YY  KS++
Sbjct  239  KMVGFQCYYDTWFSQLRQLVQQLSQSPNPPTTDEHHHQLRQLINKAMSHYADYYAAKSVS  298

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            AK D+L  F+ PW T+LERSLHWIGGWRPTT FHL+YTESSILFESH++DILRG   GDL
Sbjct  299  AKHDVLEFFSPPWTTALERSLHWIGGWRPTTAFHLVYTESSILFESHVIDILRGFHTGDL  358

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEK  341
            GDL+P Q  RVSELQ +TV EEN I D LSDWQD  SD+   + G +  KMEKL  ILE+
Sbjct  359  GDLSPAQFARVSELQIQTVHEENDITDDLSDWQDEASDLAAAIYGDVGRKMEKLVGILER  418

Query  340  ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
            ADQLR++T+ +LVELLT QQ  EFL+AAA+L FGI  WG+  DR R NN
Sbjct  419  ADQLRLRTMKSLVELLTLQQGAEFLVAAAELQFGIHGWGLQQDRHRGNN  467


 Score = 82.4 bits (202),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 115/222 (52%), Gaps = 20/222 (9%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F S    W +Q    + +L      A  +D  Q ++ +V+K + H  EY   +++ A+ D
Sbjct  11   FHSCFNDWIDQQNHDLHEL----VAADISDGAQTKR-LVEKGVQHFEEYCGKRAVMAQHD  65

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
             + + +  W TSLE +  W+GG RP+    L+Y+      +  + + LRG+R G+L +++
Sbjct  66   AISLMSPAWCTSLENAALWVGGCRPSLSIRLVYSVCGSELDEQLEEFLRGVRKGNLAEIS  125

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQD-----------GGSDIIGMMSGKL----DA  374
              QL  ++ L C  V+EE+ I+ +++  Q+            G++ +G  S  +    +A
Sbjct  126  GQQLHMINALHCRIVKEEDKISARIATLQEEIADKPLAVIAKGAERVGEWSRDVERAANA  185

Query  373  KMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQL  248
                LA IL +AD+LR+ T   L+ +LT  QA++ LIA  +L
Sbjct  186  HSLSLAGILVEADRLRLSTFKELMAILTPSQALDLLIATKKL  227



>ref|XP_007021794.1| Uncharacterized protein TCM_031867 [Theobroma cacao]
 gb|EOY13319.1| Uncharacterized protein TCM_031867 [Theobroma cacao]
Length=261

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = -1

Query  862  SFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDIL  683
            +F+ TW +QL  L++QL  AP+P T  DH      +V K++SH  EYYRVK+ AA+RD+ 
Sbjct  43   AFYNTWSDQLHHLLRQLCSAPKPPTMQDHLHHLNHLVTKLLSHYSEYYRVKAAAAERDVF  102

Query  682  GVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPT  503
             +F APWA+SLE+SLHWI GWRPTTVFHL+YTESSILFESHI+DILRG+R GDLGDL+P+
Sbjct  103  DIFAAPWASSLEKSLHWIAGWRPTTVFHLVYTESSILFESHIVDILRGVRTGDLGDLSPS  162

Query  502  QLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRM  323
            Q RRVSELQCETV+EEN I D+LS+WQ   +D++G  +   +  + +L  I++KAD LR+
Sbjct  163  QFRRVSELQCETVKEENAITDELSEWQHSVTDLVGSFTDA-EQMIGRLVSIVQKADDLRL  221

Query  322  KTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            +T+  +V+LLT QQAVEFLIAAA+L FGIR WG+N DRQ
Sbjct  222  RTLKRVVDLLTPQQAVEFLIAAAELQFGIREWGLNQDRQ  260



>ref|XP_008463763.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
Length=235

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 178/231 (77%), Gaps = 8/231 (3%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPR----PATTADHHQLQQEMVQKVMSHCHEYYRVKS  707
             +F SF+ TWF+QL +LV QL    +     ++ ADH      +VQ VMSH  +YYRVKS
Sbjct  6    FNFTSFYATWFDQLHRLVDQLSSTAKDNHNSSSAADH---LARLVQTVMSHYCDYYRVKS  62

Query  706  IAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrng  527
            +AA+RD L VF+APWATSLERSLHWI GWRPTT FHLIY+ESSILFES I+DILRGL  G
Sbjct  63   MAAERDPLSVFSAPWATSLERSLHWIAGWRPTTTFHLIYSESSILFESRIVDILRGLHTG  122

Query  526  dlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEIL  347
            DLGDL+P+Q+RRVSELQCETV+EEN I ++LS+WQD  S+++G  + ++  + E L  I+
Sbjct  123  DLGDLSPSQIRRVSELQCETVEEENAITEELSEWQDDVSELMGTRT-EVTGRFEDLVNII  181

Query  346  EKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
            +KAD LR++T+  +VELLT +QAVEF IAAA+L FG+R WG++ DRQR N+
Sbjct  182  KKADALRLRTVQKVVELLTPKQAVEFFIAAAELQFGVRGWGLDQDRQRGND  232



>ref|XP_004146086.1| PREDICTED: transcription factor TGA5-like [Cucumis sativus]
 ref|XP_004173947.1| PREDICTED: transcription factor TGA5-like [Cucumis sativus]
 gb|KGN55047.1| hypothetical protein Csa_4G625020 [Cucumis sativus]
Length=232

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 176/230 (77%), Gaps = 9/230 (4%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQ---LQQEMVQKVMSHCHEYYRVKSI  704
             +F SF+ TWF+ L +LV QL      +T  D+H        +VQ VMSH  +YYRVKS+
Sbjct  6    FNFTSFYATWFDHLHRLVDQLS-----STAKDNHNSSSAPDHLVQTVMSHYSDYYRVKSM  60

Query  703  AAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngd  524
            AA+RD L VF+APWATSLERSLHWI GWRPTT FHLIYTESSILFES I DILRGL  GD
Sbjct  61   AAERDPLSVFSAPWATSLERSLHWIAGWRPTTTFHLIYTESSILFESRIFDILRGLHTGD  120

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILE  344
            LGDL+P+Q+RRVSELQCETV+EEN I ++LS+WQD  S+++G  + ++  ++E L  I++
Sbjct  121  LGDLSPSQIRRVSELQCETVEEENAITEELSEWQDDVSELLGTRT-EVTGRVEGLVNIIK  179

Query  343  KADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
            KAD LR++T+  +VELLT +QAVEF IAAA+L FG+R WG++ DRQR N+
Sbjct  180  KADALRLRTVQKVVELLTPKQAVEFFIAAAELQFGVRGWGLDQDRQRGND  229



>ref|XP_010062825.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW69956.1| hypothetical protein EUGRSUZ_F03274 [Eucalyptus grandis]
Length=234

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 171/229 (75%), Gaps = 2/229 (1%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F+  W EQLR LV QL  AP+P  + DHH     +V K M H  EY+R K++   R
Sbjct  3    SFDRFYGGWQEQLRHLVDQLAAAPKPPISPDHHHQLHHLVSKFMDHYAEYHRTKALEVDR  62

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L V  APW T+LERSL WIGG RPTTVFHL+YTESSILFESH++DILRG R GDLGDL
Sbjct  63   DVLSVLAAPWITALERSLQWIGGCRPTTVFHLVYTESSILFESHMIDILRGYRTGDLGDL  122

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P+Q R VSELQC+TV+EEN I ++LS+WQDG SD++ + S  L+ K+ KL  I++KAD 
Sbjct  123  SPSQFRGVSELQCDTVREENAITEELSEWQDGMSDLM-VASSNLEEKIGKLGAIVKKADD  181

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNVSQ  185
            LR+KT+  +VELLT QQAVEFLI+A++L FGIR WG+N  +   NN++Q
Sbjct  182  LRLKTVRRVVELLTPQQAVEFLISASELQFGIRGWGLNLGKS-PNNLTQ  229



>gb|KDP34795.1| hypothetical protein JCGZ_10575 [Jatropha curcas]
Length=229

 Score =   254 bits (650),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 169/226 (75%), Gaps = 3/226 (1%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F+ETWF+QL  +V QL +  +P    D        V K+M+H  EYYRVKS AA+R
Sbjct  6    SFGRFYETWFDQLHHMVNQLRKTSKPPPNQDAAAHLSHFVDKLMNHYAEYYRVKSAAAER  65

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L VFTAPWA+SLERSLHWI GWRPTT+FHL+YTESSILFESHI+DILRGLR GDLGDL
Sbjct  66   DVLSVFTAPWASSLERSLHWIAGWRPTTLFHLMYTESSILFESHIVDILRGLRTGDLGDL  125

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSG-KLDAKMEKLAEILEKAD  335
            +PTQ  RVSELQCETV+EEN + DQLS+WQDG S++ G  SG  +D K+ +L  I+ +AD
Sbjct  126  SPTQ--RVSELQCETVKEENALTDQLSEWQDGASELAGSTSGTDVDEKIGRLVSIVHRAD  183

Query  334  QLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
             LR++T+  +V++LT  QA EFL+A A L FGI   G N DR R+N
Sbjct  184  DLRLRTVRMIVDMLTPYQAAEFLVAVADLQFGIHIRGRNQDRLRQN  229



>ref|XP_010313918.1| PREDICTED: transcription factor TGA5-like [Solanum lycopersicum]
Length=232

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 165/222 (74%), Gaps = 4/222 (2%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            FQ FHE W   LR+LVQQ+ + P+  TT    Q  + ++QKV+SH +EYYRVKS+AAK D
Sbjct  4    FQKFHEEWHGHLRELVQQMSKLPKFCTTNQDEQNTKLLIQKVISHINEYYRVKSLAAKND  63

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            IL +F+APW+ SLERSL+WI GWRPTT FH+IY+E  I  ESHI +IL G RNGDL DL+
Sbjct  64   ILYIFSAPWSNSLERSLYWIAGWRPTTAFHIIYSECGIQLESHITNILNGFRNGDLADLS  123

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQL  329
            P QL R SELQCET+Q+EN I +QLS+WQD  +DII      +D KME L  IL++AD++
Sbjct  124  PDQLTRFSELQCETIQQENNITEQLSNWQDSVNDII----ENIDKKMETLLGILKRADEV  179

Query  328  RMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            R+ T+ NLV LLT QQ +EF IAA+ L+F IR WGIN+D QR
Sbjct  180  RLNTLHNLVHLLTPQQLLEFFIAASNLLFEIRSWGINYDNQR  221



>ref|XP_011007917.1| PREDICTED: transcription factor HBP-1b(c38) [Populus euphratica]
Length=232

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 163/220 (74%), Gaps = 0/220 (0%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F++TWF+QL QL++QL  AP+P ++ D       + QK++SH  E+YR+KS+A + 
Sbjct  6    SFTRFYDTWFDQLNQLLEQLRTAPKPPSSQDDRSHLSSLAQKIVSHYAEFYRMKSMAIES  65

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L VFTAPWA+  ERSLHWI GWRPTT+FHL+YTESSILFE HI DIL+G   GDLGDL
Sbjct  66   DVLSVFTAPWASCFERSLHWIAGWRPTTLFHLVYTESSILFEFHIADILKGRSTGDLGDL  125

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P Q RRVSELQCETV+EEN I  +LSDWQD  ++++      L  K+ +L  +++KAD 
Sbjct  126  SPNQFRRVSELQCETVKEENAITGELSDWQDSANEVMLGSFTNLGDKVGRLVSVVKKADD  185

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            LR++TI  +VELLT QQAVEFL+AA +L FG+  WG   D
Sbjct  186  LRLRTIRRVVELLTTQQAVEFLVAAGELHFGVYGWGRKFD  225



>gb|KHG25856.1| Transcription factor TGA1 -like protein [Gossypium arboreum]
Length=226

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F +F+  W +QL+QL++QL  AP+P TT DH      +V KV+SH  EYYRVK+ AA+R
Sbjct  3    TFTAFYTAWSDQLQQLLRQLCSAPKPPTTQDHLHHLNHLVNKVLSHYAEYYRVKAAAAER  62

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L +F APWA++ E+SLHWI GWRPTTVFHL+YTESSILFESHI+DILRG+R GDLGDL
Sbjct  63   DVLDIFAAPWASAFEKSLHWIAGWRPTTVFHLVYTESSILFESHIVDILRGVRTGDLGDL  122

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +PTQ RRVSELQCETV+EEN I D+LS+WQ   SD++G  +  +D  +E+L  ++ KAD 
Sbjct  123  SPTQFRRVSELQCETVKEENAITDELSEWQHSVSDLMG-ATPDVDKMIERLVTVVRKADD  181

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            LR++T+  +V+LLT QQA+EFLIAA +L  GIR WG+N DR+
Sbjct  182  LRLRTLKRVVDLLTPQQALEFLIAAVELQQGIREWGMNQDRE  223



>emb|CAN72574.1| hypothetical protein VITISV_036367 [Vitis vinifera]
Length=227

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MSF  F+ +WF+ L  LV QL  AP+P T  D+  L Q +VQKV+SH  +YYR KS+AA+
Sbjct  1    MSFHRFYASWFDHLNXLVHQLTLAPKPTTPQDNPALLQ-LVQKVISHYSQYYRAKSVAAQ  59

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             D + +F APW++SLERSLHW+ GWRPT VFHLIYTE+S  FESHI DIL G+R GDLGD
Sbjct  60   NDAVSLFAAPWSSSLERSLHWVAGWRPTIVFHLIYTETSARFESHIADILHGVRTGDLGD  119

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDII-GMMSGKLDAKMEKLAEILEKA  338
            L+  QL RVSELQCETV+EEN I  +L+ WQ+G  +++     G ++ K+  L  +L KA
Sbjct  120  LSTAQLHRVSELQCETVREENEITSELAKWQEGAVELVEAGGDGNVEEKIGGLMSVLVKA  179

Query  337  DQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            D+LRM+TI  + E+LT QQAVEFLIAAA+L FG+R  G+NHD QREN
Sbjct  180  DELRMRTIWRVAEMLTPQQAVEFLIAAAELQFGVRVLGLNHDNQREN  226



>ref|XP_006370140.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP66709.1| DNA-binding family protein [Populus trichocarpa]
Length=232

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 163/220 (74%), Gaps = 0/220 (0%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F++TWF+QL QL++QL  AP+P ++ D       + QK++SH  E+YRVKS+A + 
Sbjct  6    SFTRFYDTWFDQLNQLLEQLRTAPKPPSSQDDRSHLSSLAQKIVSHYAEFYRVKSMAIES  65

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L VFTAPWA+  ERSLHWI GWRPTT+FHL+YTESSILFE HI DIL+G   GDLGDL
Sbjct  66   DVLSVFTAPWASCFERSLHWIAGWRPTTLFHLVYTESSILFEFHIADILKGRSTGDLGDL  125

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P Q RRVSELQCETV+EEN I  +LS+WQD  ++++      L  K+ +L  +++KAD 
Sbjct  126  SPNQFRRVSELQCETVKEENAITGELSEWQDSANEVMLGSFTDLGDKVGRLVSVVKKADD  185

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            LR++TI  +VELLT QQAVEFL+AA +L FG+  WG   D
Sbjct  186  LRLRTIKRVVELLTTQQAVEFLVAAGELQFGVYGWGRKLD  225



>ref|XP_002283108.1| PREDICTED: transcription factor HBP-1b(c1)-like [Vitis vinifera]
Length=227

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MSF  F+ +WF+ L  LV QL  AP+P T  D+  L Q +VQKV+SH  +YYR KS+AA+
Sbjct  1    MSFHRFYASWFDHLNHLVHQLTLAPKPTTPQDNPALLQ-LVQKVISHYSQYYRAKSVAAQ  59

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             D + +F APW++SLERSLHW+ GWRPT VFHLIYTE+S  FESHI DIL G+R GDLGD
Sbjct  60   NDAVSLFAAPWSSSLERSLHWVAGWRPTIVFHLIYTETSARFESHIADILHGVRTGDLGD  119

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDII-GMMSGKLDAKMEKLAEILEKA  338
            L+  QL RVSELQCETV+EEN I  +L+ WQ+G  +++     G ++ K+  L  +L KA
Sbjct  120  LSTAQLHRVSELQCETVREENEITRELAKWQEGAVELVEAGGDGNVEEKIGGLMSVLVKA  179

Query  337  DQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            D+LRM+TI  + E+LT QQAVEFLIAAA+L FG+R  G+NHD QREN
Sbjct  180  DELRMRTIWRVAEMLTPQQAVEFLIAAAELQFGVRVLGLNHDNQREN  226



>ref|XP_003596341.1| Transcription factor TGA5 [Medicago truncatula]
 gb|ABD32966.1| tumor-related protein-like, putative [Medicago truncatula]
 gb|AES66592.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=222

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 169/223 (76%), Gaps = 7/223 (3%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F  F+E+W  Q   L+ QL  +    T +      +E++QKV+SH  +YY  KS+AA++
Sbjct  3    NFAQFYESWHTQFNNLIHQLKLSTSTQTDS------EELIQKVLSHHQDYYNAKSMAAEK  56

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D L V  +PWAT+LERSLHWI GWRPTT FHLIYTESS+LFESHI+DILRG R GDLGDL
Sbjct  57   DPLHVLASPWATTLERSLHWIAGWRPTTAFHLIYTESSLLFESHIIDILRGFRTGDLGDL  116

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P Q RRVS+LQC+TV+EEN I ++LS+WQD  SD++G     ++ K+E+L  I++KAD 
Sbjct  117  SPNQFRRVSDLQCDTVKEENAITEELSEWQDSASDMMG-SEADINDKIERLVSIIKKADD  175

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            LR++T+ ++VE L+ QQAVEFLIA+A+L+ GIR WG+NHDR R
Sbjct  176  LRLRTLRSVVEFLSPQQAVEFLIASAELVVGIRGWGLNHDRSR  218



>ref|XP_010276977.1| PREDICTED: transcription factor TGA2 [Nelumbo nucifera]
Length=232

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 170/227 (75%), Gaps = 2/227 (1%)
 Frame = -1

Query  877  KMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            K  F+ FH TW + L  L+ QL  AP+P +  DH  L Q +  +VM+H  +YYR+KS AA
Sbjct  7    KTFFERFHNTWLQHLHLLLSQLSAAPKPTSPEDHRYLSQ-LADRVMTHYEDYYRIKSHAA  65

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            K D+L +F+APW TSLE SLHWI GWRPTTVFH++YTESS+ FE+ I+D+LRG R GDLG
Sbjct  66   KHDVLAMFSAPWTTSLESSLHWIAGWRPTTVFHIVYTESSVRFEAQIVDLLRGHRTGDLG  125

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKA  338
            DLTP QL RVSELQC+TV+EEN I ++LS WQ+   D++   S  ++A +E+L E+LEKA
Sbjct  126  DLTPRQLTRVSELQCQTVREENEITEELSQWQNNSCDLVS-PSANMEANIERLVEVLEKA  184

Query  337  DQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            D LR+KT+  +VE+LT QQAVEFLIA A++  GIR WG+  DR+RE+
Sbjct  185  DDLRLKTLRRVVEILTPQQAVEFLIATAEVQLGIRGWGLEKDRKRES  231



>ref|XP_004489078.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cicer arietinum]
Length=223

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 171/223 (77%), Gaps = 9/223 (4%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F  F+++WF+Q   LVQQL     P  T       +E+++KVMSH  +YY  KS+AA++
Sbjct  6    TFAQFYDSWFDQFHCLVQQLNT---PNQTD-----AEELIRKVMSHHEDYYNAKSMAAEK  57

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D L V  +PWAT+LERSL+WI GWRPTT FHLIYTESS+LFESHI+DILRGLR GDLGDL
Sbjct  58   DPLHVLASPWATTLERSLYWIAGWRPTTAFHLIYTESSLLFESHIIDILRGLRTGDLGDL  117

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +PTQ RRVS+LQC+TV+EEN I ++LS+WQD  S+++G     ++  + +L  I++KAD 
Sbjct  118  SPTQFRRVSDLQCDTVKEENAITEELSEWQDNASELMG-SEDDINENIGRLVCIIKKADD  176

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            LR++T+ ++VE L+ QQA+EFLIA+A+L+ GIR WG+NHDR R
Sbjct  177  LRLRTLRSVVEFLSPQQAIEFLIASAELLVGIRGWGLNHDRSR  219



>ref|NP_001237999.1| bZIP transcription factor bZIP132 [Glycine max]
 gb|ABI34670.1| bZIP transcription factor bZIP132 [Glycine max]
Length=225

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 171/223 (77%), Gaps = 11/223 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F  F+E WFE+L+ L+QQL    R          ++E+++KVM H   YY  KS AA++
Sbjct  12   AFADFYEQWFEELQSLMQQLRGEGR----------KEEVMEKVMWHHQNYYVAKSAAAEK  61

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D L VF +PWAT+LERSLHWI GWRPTT FHLIYTESS++FESHI+DIL+GLR GDLGDL
Sbjct  62   DPLNVFLSPWATTLERSLHWITGWRPTTAFHLIYTESSLMFESHIIDILQGLRTGDLGDL  121

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P+Q RRVS++QC+TV+EEN I ++LS+WQD  S+++G     ++ K+ +L  I++KAD 
Sbjct  122  SPSQFRRVSDIQCDTVKEENAITEELSEWQDSVSEMMG-PGANINDKIGRLVCIIKKADD  180

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            LR++T+ ++V LL+ QQA+EFLIA+A+L+ GIR WG+NHDR R
Sbjct  181  LRLRTLRSVVGLLSPQQAIEFLIASAELLVGIRGWGLNHDRPR  223



>emb|CDX97614.1| BnaA05g24650D [Brassica napus]
Length=237

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 165/230 (72%), Gaps = 4/230 (2%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F  TW  QL+  +  L       R + T D  +L+ E VQ+VM  C EY+R K   
Sbjct  9    SFKKFQHTWIGQLQHHLNHLRSVQNHHRNSATGDEERLR-EAVQRVMELCREYHRAKLAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV  APW+++LERSLHW+G WRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVVGVMAAPWSSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEK  341
             DL+P+Q R+VSELQCETV+EEN I ++LS+WQD  S+++      LD ++ +LAEI+ +
Sbjct  128  SDLSPSQFRKVSELQCETVKEENAITEELSEWQDDASELVMGTVSNLDQRIRRLAEIVHR  187

Query  340  ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            AD LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R  NV
Sbjct  188  ADDLRLRTITGVVELLSPLQQAEFLIAAAELRRGVSGWGSSHDRRRSANV  237



>ref|XP_010465409.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=237

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 168/230 (73%), Gaps = 4/230 (2%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQL+  +  L  A    R + T D  +L+ E V++VM H  EY+R K   
Sbjct  9    SFKKFQQSWIEQLQHHLNHLRSAQNHHRNSVTGDVERLR-EAVERVMEHFREYHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV  APW+++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVVGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEK  341
             DL+P+Q R VSELQCETV+EEN I ++LS+WQD  S+++   S   + ++ +L+EI+ +
Sbjct  128  SDLSPSQFRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLSEIVHR  187

Query  340  ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
             D LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R +NV
Sbjct  188  TDDLRLRTITRVVELLSPLQQAEFLIAAAELRTGVAGWGTSHDRRRSSNV  237



>ref|XP_010487302.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=237

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 167/230 (73%), Gaps = 4/230 (2%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQL+  +  L  A    R + T D  +L+ E V++VM H  EY+R K   
Sbjct  9    SFKKFQQSWIEQLQHHLNHLRSAQNHHRNSVTGDEERLR-EAVERVMEHFREYHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV  APW+++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVVGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEK  341
             DL+P+Q R VSELQCETV+EEN I ++LS+WQD  S+++   S   + ++ +LA I+ +
Sbjct  128  SDLSPSQFRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLAGIVHR  187

Query  340  ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
             D LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R +NV
Sbjct  188  TDDLRLRTITRVVELLSPLQQAEFLIAAAELRTGVAGWGTSHDRRRSSNV  237



>emb|CDY70896.1| BnaCnng70220D [Brassica napus]
 emb|CDX98510.1| BnaC05g38650D [Brassica napus]
Length=237

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 164/230 (71%), Gaps = 4/230 (2%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F  TW EQL+  +  L       R + T D  +L+ E V++VM  C EY+R K   
Sbjct  9    SFKKFQHTWVEQLQHHLNHLRSVQNHHRNSATGDEERLR-EAVERVMELCREYHRAKLAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++G+  APW+++LERSLHW+G WRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVVGLMAAPWSSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEK  341
             DL+P+Q R VSELQCETV+EEN I + LS+WQD  S+++      LD ++ +LAEI+ +
Sbjct  128  SDLSPSQFRTVSELQCETVKEENAITEDLSEWQDDASELVMGTVSNLDQRIRRLAEIVHR  187

Query  340  ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            AD LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R  NV
Sbjct  188  ADDLRLRTITGVVELLSPLQQAEFLIAAAELRRGVSGWGSSHDRRRSANV  237



>ref|XP_010502264.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Camelina 
sativa]
Length=237

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 167/230 (73%), Gaps = 4/230 (2%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQL+  +  L  A    R + T D  +L+ E V++VM H  E++R K   
Sbjct  9    SFKKFQQSWIEQLQHHLNYLRSAQNHHRNSVTGDEERLR-EAVERVMKHFREFHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             + D++GV  APW+++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TETDVVGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEK  341
             DL+P+Q R VSELQCETV+EEN I ++LS+WQD  S+++   S   + ++ +LAEI+ +
Sbjct  128  SDLSPSQFRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLAEIVHR  187

Query  340  ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
             D LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R +NV
Sbjct  188  TDDLRLRTITRVVELLSPLQQAEFLIAAAELRAGVAGWGTSHDRRRSSNV  237



>ref|NP_001118628.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY78741.1| DNA-binding protein-related [Arabidopsis thaliana]
 gb|AEE75583.1| uncharacterized protein AT3G14880 [Arabidopsis thaliana]
Length=237

 Score =   231 bits (590),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 164/230 (71%), Gaps = 4/230 (2%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQLR  +  L  A    R + T D  +L+ E V +VM H  EY+R K  A
Sbjct  9    SFKKFQQSWIEQLRNHLNHLRSAQNHHRNSATGDEERLR-EAVDRVMEHFREYHRAKWAA  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
              +D++ V  +PWA++LERSL W+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TDKDVIEVMASPWASALERSLQWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEK  341
             DL+P+Q R VSELQCETV+EEN I ++LS+WQD  SD++   S   D ++ +LAEI+ +
Sbjct  128  SDLSPSQFRTVSELQCETVKEENAITEELSEWQDDASDLVMGTSSDPDQRIRRLAEIVHR  187

Query  340  ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
             D LR++TIT +VE+L+  Q  EFL+AAA+L  G+  WG +HDR+R + V
Sbjct  188  TDDLRLRTITRVVEVLSPLQQAEFLVAAAELRTGVAGWGTSHDRRRSSEV  237



>ref|XP_002882899.1| hypothetical protein ARALYDRAFT_341612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59158.1| hypothetical protein ARALYDRAFT_341612 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 164/237 (69%), Gaps = 11/237 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F E+W +QLR  +  L       R + T D  +L+ E V++VM H  EY+R K   
Sbjct  9    SFKKFQESWIDQLRNHLNHLRSVQNHHRNSATGDEERLR-EAVERVMEHFREYHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV   PWA++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVIGVMATPWASALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLR-------RVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEK  362
             DL+P+Q R        VSELQCETV EEN I D+LS+WQD  SD++   S   + ++ +
Sbjct  128  SDLSPSQFRVKFVKGRTVSELQCETVNEENAITDELSEWQDDASDLVMGTSSDPEQRIRR  187

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            LAEI+ + D LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R + V
Sbjct  188  LAEIVHRTDDLRLRTITRVVELLSPLQQAEFLIAAAELRTGVAGWGTSHDRRRSSEV  244



>ref|XP_010695960.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor TGA5 [Beta 
vulgaris subsp. vulgaris]
Length=242

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 166/240 (69%), Gaps = 11/240 (5%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAP--RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            MSF  FHE+W ++L +L+ +L   P  RP +++DH  ++  +V KV++H  +YY  K+  
Sbjct  2    MSFHRFHESWTDKLNKLITELASTPTPRPTSSSDHQHIRH-LVDKVVTHYAQYYEKKAAT  60

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            A  D+L +F APWA++LERSL+W+ G+RPTT+FHLIYTESSI FESH+ DILRG R GDL
Sbjct  61   AXTDVLSLFAAPWASALERSLNWVAGFRPTTLFHLIYTESSIRFESHVADILRGCRTGDL  120

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGG-------SDIIGMMSGKLDAKMEK  362
            G+LTP QL RVSELQC TVQ+EN I D+L  WQ+         S + G     L+  + K
Sbjct  121  GELTPGQLARVSELQCLTVQDENQIGDELGTWQEEVARSEPEWSGLCGNGPDGLNRLLAK  180

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGIN-HDRQRENNVSQ  185
            L  ++ KAD LRMKTI  +VELLT QQA EFLIAAA+L  GIRRWG++  DR R +   +
Sbjct  181  LGTVVAKADDLRMKTIRQVVELLTPQQAAEFLIAAAELQLGIRRWGLHLQDRTRSDETEE  240



>ref|XP_006593493.1| PREDICTED: bZIP transcription factor bZIP132 isoform X1 [Glycine 
max]
Length=266

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 169/223 (76%), Gaps = 13/223 (6%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F  F+E WFE+L+ L+QQL    R          ++E+++KVM H   YY  KS AA++
Sbjct  55   AFADFYEQWFEELQSLMQQLRGEGR----------KEEVMEKVMWHHQNYYVAKSAAAEK  104

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D L VF +PWAT+LERSLHWI GWRPTT FHLIYTESS++FESHI+DIL+GLR GDLGDL
Sbjct  105  DPLNVFLSPWATTLERSLHWITGWRPTTAFHLIYTESSLMFESHIIDILQGLRTGDLGDL  164

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            +P+Q RRVS++QC+T  EEN I ++LS+WQD  S+++G     ++ K+ +L  I++KAD 
Sbjct  165  SPSQFRRVSDIQCDT--EENAITEELSEWQDSVSEMMG-PGANINDKIGRLVCIIKKADD  221

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            LR++T+ ++V LL+ QQA+EFLIA+A+L+ GIR WG+NHDR R
Sbjct  222  LRLRTLRSVVGLLSPQQAIEFLIASAELLVGIRGWGLNHDRPR  264



>ref|XP_006300241.1| hypothetical protein CARUB_v10016481mg [Capsella rubella]
 gb|EOA33139.1| hypothetical protein CARUB_v10016481mg [Capsella rubella]
Length=244

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 165/237 (70%), Gaps = 11/237 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            +F+ F E+W E LR  +  L  A    R + T D  +L+ E V+ VM H   Y+R K   
Sbjct  9    NFKKFQESWIEALRHHLNHLRSAQNHHRNSATGDEERLR-EAVESVMEHFRAYHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV  APW+++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVIGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLR-------RVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEK  362
             DL+P+Q R        VSE+QCETV+EEN I ++LS+WQD  S+++   S   D ++ +
Sbjct  128  SDLSPSQFRIKFVKGRTVSEIQCETVKEENAITEELSEWQDDASELVMGTSSDSDQRIRR  187

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            LAEI+ + D LRM+TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R +NV
Sbjct  188  LAEIVHQTDDLRMRTITRVVELLSPLQQAEFLIAAAELRMGVAGWGTSHDRRRSSNV  244



>ref|XP_009146508.1| PREDICTED: uncharacterized protein LOC103870151 [Brassica rapa]
Length=244

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 165/237 (70%), Gaps = 11/237 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F  TW  QL+  +  L       R + T D  +L+ E VQ+VM  C EY+R K   
Sbjct  9    SFKKFQHTWIGQLQHHLNHLRSVQNHHRNSATGDEERLR-EAVQRVMELCREYHRAKLAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV  APW+++LERSLHW+G WRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVVGVMAAPWSSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLR-------RVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEK  362
             DL+P+Q R       +VSELQCETV+EEN I ++LS+WQD  S+++      LD ++ +
Sbjct  128  SDLSPSQFRFKFVKGRKVSELQCETVKEENAITEELSEWQDDASELVMGTVSNLDQRIRR  187

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            LAEI+ +AD LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R  NV
Sbjct  188  LAEIVHRADDLRLRTITGVVELLSPLQQAEFLIAAAELRRGVSGWGSSHDRRRSANV  244



>ref|XP_010465408.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
Length=244

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 168/237 (71%), Gaps = 11/237 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQL+  +  L  A    R + T D  +L+ E V++VM H  EY+R K   
Sbjct  9    SFKKFQQSWIEQLQHHLNHLRSAQNHHRNSVTGDVERLR-EAVERVMEHFREYHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV  APW+++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVVGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQL-------RRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEK  362
             DL+P+Q        R VSELQCETV+EEN I ++LS+WQD  S+++   S   + ++ +
Sbjct  128  SDLSPSQFRIKFVKGRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRR  187

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            L+EI+ + D LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R +NV
Sbjct  188  LSEIVHRTDDLRLRTITRVVELLSPLQQAEFLIAAAELRTGVAGWGTSHDRRRSSNV  244



>ref|XP_010487301.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
Length=244

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 167/237 (70%), Gaps = 11/237 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQL+  +  L  A    R + T D  +L+ E V++VM H  EY+R K   
Sbjct  9    SFKKFQQSWIEQLQHHLNHLRSAQNHHRNSVTGDEERLR-EAVERVMEHFREYHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV  APW+++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVVGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQL-------RRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEK  362
             DL+P+Q        R VSELQCETV+EEN I ++LS+WQD  S+++   S   + ++ +
Sbjct  128  SDLSPSQFRIKFVKGRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRR  187

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            LA I+ + D LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R +NV
Sbjct  188  LAGIVHRTDDLRLRTITRVVELLSPLQQAEFLIAAAELRTGVAGWGTSHDRRRSSNV  244



>ref|XP_003634664.1| PREDICTED: transcription factor HBP-1b(c38) [Vitis vinifera]
Length=231

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 164/226 (73%), Gaps = 2/226 (1%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MSF+SF+E WF+ L  L+QQL  AP+ AT  D  +   ++V KV +H  +YYR  S  A+
Sbjct  1    MSFESFNEAWFDHLHDLLQQLRLAPK-ATAPDRDRALLDLVHKVRTHYSQYYRAMSYTAR  59

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             D++ +F APW++SLERSLHW+ GWRPT  FHLIYT SSILFE+HI+DILRG  NGDLGD
Sbjct  60   HDVVSLFAAPWSSSLERSLHWVAGWRPTIAFHLIYTHSSILFETHIVDILRGAHNGDLGD  119

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKAD  335
            L+P QL+RVSELQC+TV EEN I  +LS+  +  S ++G +   ++  +E+L  ++E+A+
Sbjct  120  LSPAQLQRVSELQCQTVGEENEITAELSECFNSVSGLVGAVFDPVE-NVERLRNVVERAE  178

Query  334  QLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
             LR +TI ++VE+L  QQAVEFL+A  +L F +R  G+ HDR REN
Sbjct  179  NLRFRTICSVVEILNPQQAVEFLVAVMELQFWVRGMGLCHDRVREN  224



>ref|XP_010502256.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=244

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 167/237 (70%), Gaps = 11/237 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQL+  +  L  A    R + T D  +L+ E V++VM H  E++R K   
Sbjct  9    SFKKFQQSWIEQLQHHLNYLRSAQNHHRNSVTGDEERLR-EAVERVMKHFREFHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             + D++GV  APW+++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TETDVVGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLR-------RVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEK  362
             DL+P+Q R        VSELQCETV+EEN I ++LS+WQD  S+++   S   + ++ +
Sbjct  128  SDLSPSQFRIKFVKGRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRR  187

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            LAEI+ + D LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R +NV
Sbjct  188  LAEIVHRTDDLRLRTITRVVELLSPLQQAEFLIAAAELRAGVAGWGTSHDRRRSSNV  244



>ref|XP_010502248.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
Length=245

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 167/238 (70%), Gaps = 12/238 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQL+  +  L  A    R + T D  +L+ E V++VM H  E++R K   
Sbjct  9    SFKKFQQSWIEQLQHHLNYLRSAQNHHRNSVTGDEERLR-EAVERVMKHFREFHRAKWAT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             + D++GV  APW+++LERSLHW+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TETDVVGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLRR--------VSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKME  365
             DL+P+Q  R        VSELQCETV+EEN I ++LS+WQD  S+++   S   + ++ 
Sbjct  128  SDLSPSQFSRIKFVKGRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIR  187

Query  364  KLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            +LAEI+ + D LR++TIT +VELL+  Q  EFLIAAA+L  G+  WG +HDR+R +NV
Sbjct  188  RLAEIVHRTDDLRLRTITRVVELLSPLQQAEFLIAAAELRAGVAGWGTSHDRRRSSNV  245



>ref|XP_006407035.1| hypothetical protein EUTSA_v10022387mg [Eutrema salsugineum]
 gb|ESQ48488.1| hypothetical protein EUTSA_v10022387mg [Eutrema salsugineum]
Length=244

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 170/238 (71%), Gaps = 13/238 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQL+  +  L  A    R +   D  +L+ E  ++VM HC EY+RV+   
Sbjct  9    SFKKFQQSWIEQLQLHLNHLRSAQNHHRNSVEGDEDRLR-EAAERVMEHCREYHRVQWTT  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D++GV  APW ++LERSLHW+GGWRPTT+FHLIYTESSILFES I+DILRG R GDL
Sbjct  68   TEKDVIGVMAAPWLSALERSLHWVGGWRPTTLFHLIYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQL-------RRVSELQCETVQEENYIADQLSDWQDGGSDII-GMMSGKLDAKME  365
             DL+P+Q        R+VSELQCETV+EEN I ++LS+WQD  S+++ G M+ + D ++ 
Sbjct  128  SDLSPSQFRVKFVKGRKVSELQCETVKEENAITEELSEWQDDASELVMGTMTDR-DQRIR  186

Query  364  KLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            +L EI+ +AD LR++T+T +VELL   Q  EFLIAAA+L  G+  WG +HDR+R +++
Sbjct  187  RLTEIVHRADDLRLRTVTGVVELLRPLQQAEFLIAAAELRTGVSGWGTSHDRRRTSDI  244



>ref|NP_188106.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97051.1| tumor-related protein-like [Arabidopsis thaliana]
 gb|ABE65942.1| DNA-binding protein-like protein [Arabidopsis thaliana]
 dbj|BAH30453.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75582.1| uncharacterized protein AT3G14880 [Arabidopsis thaliana]
Length=244

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 164/237 (69%), Gaps = 11/237 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAP---RPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF+ F ++W EQLR  +  L  A    R + T D  +L+ E V +VM H  EY+R K  A
Sbjct  9    SFKKFQQSWIEQLRNHLNHLRSAQNHHRNSATGDEERLR-EAVDRVMEHFREYHRAKWAA  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
              +D++ V  +PWA++LERSL W+GGWRPTT+FHL+YTESSILFES I+DILRG R GDL
Sbjct  68   TDKDVIEVMASPWASALERSLQWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDL  127

Query  520  gdLTPTQLR-------RVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEK  362
             DL+P+Q R        VSELQCETV+EEN I ++LS+WQD  SD++   S   D ++ +
Sbjct  128  SDLSPSQFRVPFVKGRTVSELQCETVKEENAITEELSEWQDDASDLVMGTSSDPDQRIRR  187

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNV  191
            LAEI+ + D LR++TIT +VE+L+  Q  EFL+AAA+L  G+  WG +HDR+R + V
Sbjct  188  LAEIVHRTDDLRLRTITRVVEVLSPLQQAEFLVAAAELRTGVAGWGTSHDRRRSSEV  244



>gb|KHN36891.1| Transcription factor TGA1 [Glycine soja]
Length=198

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = -1

Query  766  QQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYT  587
            ++E+++KVM H   YY  KS AA++D L VF +PWAT+LERSLHWI GWRPTT FHLIYT
Sbjct  10   KEEVMEKVMWHHQNYYVAKSAAAEKDPLNVFLSPWATTLERSLHWITGWRPTTAFHLIYT  69

Query  586  ESSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD  407
            ESS++FESHI+DIL+GLR GDLGDL+P+Q RRVS++QC+TV+EEN I ++LS+WQD  S+
Sbjct  70   ESSLMFESHIIDILQGLRTGDLGDLSPSQFRRVSDIQCDTVKEENAITEELSEWQDSVSE  129

Query  406  IIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
            ++G     ++ K+ +L  I++KAD LR++T+ ++V LL+ QQA+EFLIA+A+L+ GIR W
Sbjct  130  MMG-PGANINDKIGRLVCIIKKADDLRLRTLRSVVGLLSPQQAIEFLIASAELLVGIRGW  188

Query  226  GINHDRQR  203
            G+NHDR R
Sbjct  189  GLNHDRPR  196



>ref|XP_007149576.1| hypothetical protein PHAVU_005G081900g [Phaseolus vulgaris]
 gb|ESW21570.1| hypothetical protein PHAVU_005G081900g [Phaseolus vulgaris]
Length=215

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 160/220 (73%), Gaps = 12/220 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F+  WFEQL+++VQ+L          D H   +E++ KVM    +YYR K  A ++
Sbjct  4    SFAKFYRRWFEQLQEMVQRL---------KDEHN--EEVMDKVMRQHQDYYRAKWAAVEK  52

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D L VF +PW T+LERSLHWI GWRPTT FHLIYTESS+LFESHI+DIL GLR GDLGDL
Sbjct  53   DPLCVFLSPWTTTLERSLHWITGWRPTTAFHLIYTESSLLFESHIIDILHGLRTGDLGDL  112

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQ  332
            TP+Q R VS+LQC+TV+EEN I ++LS+WQD  S+ +G     ++ K+ +L  I++KAD 
Sbjct  113  TPSQFRHVSDLQCDTVKEENAIQEELSEWQDSASE-MGDPDMDMNEKIIQLVPIIKKADD  171

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            LR+ T+ ++V LL+ QQA+EFLIA+ +L+ GIR WG+N D
Sbjct  172  LRLTTLRSVVRLLSTQQAIEFLIASGELLIGIRSWGMNQD  211



>ref|XP_010552125.1| PREDICTED: transcription factor TGA7 [Tarenaya hassleriana]
Length=238

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 139/227 (61%), Gaps = 11/227 (5%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEM-------VQKVMSHCHEYYRV  713
            +F  FHE W +QL+ L++ L  A +   +A     +          V++VM HC +YY  
Sbjct  8    TFDKFHEAWSKQLQGLLRHLRSAQKNFRSAAGESSEAVAEEELHGAVKRVMVHCSDYYSA  67

Query  712  KSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglr  533
            +    + D+  +  +PW++ LER+L W+GGWRPT  FHL+YTES + FES I+      R
Sbjct  68   RRSVTEADVASMVASPWSSQLERALQWVGGWRPTAAFHLVYTESDVHFESRIVG----DR  123

Query  532  ngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAE  353
             GDL DL+P QLRRVS LQC+TV+EEN I ++ SDWQD  S ++      LD  +  L++
Sbjct  124  IGDLSDLSPLQLRRVSVLQCKTVKEENDITEEASDWQDNASLLVPGTVDNLDDHILGLSD  183

Query  352  ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            I++ AD LR+ TIT +V +L   QA EFL AAA+L+ G+  WG+  D
Sbjct  184  IVQMADNLRLATITGVVAMLNPFQAAEFLTAAAKLLTGVHCWGMIRD  230



>gb|ABI84260.1| tumor-related protein-like [Arachis hypogaea]
Length=219

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 125/189 (66%), Gaps = 12/189 (6%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLG-----------QAPRPATTADHHQLQQEMVQKVMSHCH  728
            ++F  F+E WF+ L  LV QL            +   P   A   +   +++ KVM H  
Sbjct  4    LAFSQFYEKWFDLLHHLVNQLSDFASSIANSKEEYISPLVAAKQEEKLAQLIGKVMLHHE  63

Query  727  EYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDI  548
            EY+R KS+  + D L V  +PWAT+LERSLHW+ GWRPTT FHL+YTESS+LFESHI DI
Sbjct  64   EYFRAKSLITENDPLSVVASPWATTLERSLHWVTGWRPTTAFHLVYTESSVLFESHIGDI  123

Query  547  lrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKM  368
            LRG+  GDLGDL+PTQ RRVSELQC+TV+EEN I D+LSDWQD  S ++G  +   + ++
Sbjct  124  LRGVNTGDLGDLSPTQFRRVSELQCDTVKEENQITDELSDWQDTASHLMGPRAESKE-RI  182

Query  367  EKLAEILEK  341
            E+L  I  K
Sbjct  183  ERLICITRK  191



>gb|EPS59924.1| hypothetical protein M569_14883, partial [Genlisea aurea]
Length=163

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 124/182 (68%), Gaps = 26/182 (14%)
 Frame = -1

Query  757  MVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESS  578
            +V K + H  EYYR KS+AA+ D+L  F AP AT LERSL WIGG+RPTT FHL YT+  
Sbjct  8    LVNKAIEHYREYYRAKSVAAENDLLVFFLAPCATKLERSLSWIGGFRPTTAFHLAYTKIG  67

Query  577  ILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIG  398
            ++FES +M ILRG+R GD GD++P QL+++SELQ ETV EEN                  
Sbjct  68   MMFESGVMHILRGIRTGDFGDISPPQLQKISELQIETVDEEN------------------  109

Query  397  MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGIN  218
                    ++++L++IL KAD LR+KTI +LV+LLT QQ+ EFLIAAA+L FGIR WG+ 
Sbjct  110  --------RLKELSKILGKADLLRLKTIESLVQLLTPQQSAEFLIAAAELQFGIRIWGVG  161

Query  217  HD  212
            HD
Sbjct  162  HD  163



>ref|XP_002273632.1| PREDICTED: transcription factor TGA2 [Vitis vinifera]
 emb|CBI21619.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 142/242 (59%), Gaps = 20/242 (8%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPAT-TADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            F  F E+W  +  Q +Q+L  A R    T D  Q+   +V++V+SH H YY  KS++ + 
Sbjct  11   FHKFFESWLTEQNQHLQELISASRNNQHTDDSDQILCPLVERVVSHYHNYYHAKSLSTRD  70

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            +IL + T PW + LE +  W+GGWRP+  FHL+Y++S + FES + D++RGL  GDLGD+
Sbjct  71   NILSMLTPPWRSLLEDAFLWVGGWRPSVAFHLLYSKSGLQFESGLADLIRGLSTGDLGDM  130

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-------------------IIGMMS  389
            +  QL RV ELQ +T++EE  + + ++  Q+  +D                   +   + 
Sbjct  131  SHEQLCRVDELQRKTIREEREMTENMARIQETVADSKMVELSEAATEEGGGGDDLGERVE  190

Query  388  GKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDR  209
              L  K E LAE+L KAD LR++T+  ++++LT  Q V FLIAAA+L   + +WG N D 
Sbjct  191  SALKHKEEGLAEMLLKADDLRLRTLKGVLDILTPMQCVHFLIAAAELHLRLHKWGKNKDE  250

Query  208  QR  203
            Q+
Sbjct  251  QQ  252



>ref|XP_010920869.1| PREDICTED: transcription factor TGA3-like [Elaeis guineensis]
Length=260

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 137/246 (56%), Gaps = 24/246 (10%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQL---GQAPRPATTADHHQLQQEM---VQKVMSHCHEYYRVKS  707
            F   +E W  +    +Q L     APRP T  +  +  + +   V++V+ HC  YYR K+
Sbjct  9    FDRLYECWLAEKHSDLQALRAAASAPRPKTPEEEAEEDRRLKLPVERVLGHCENYYRAKA  68

Query  706  IAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrng  527
              A RD+  +F+  W +S E    W+GGWRP+  FHL+Y++S +  E+ + +++RG+   
Sbjct  69   ACATRDVTPMFSPTWTSSTENLFLWVGGWRPSVAFHLLYSKSGLQLEAQLGEVIRGVPTR  128

Query  526  dlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI------------------I  401
            DL DL+  QL+R++ELQC T+++E  I+++ +  Q+G +D                    
Sbjct  129  DLADLSLEQLQRINELQCRTIRKEKEISEEEARTQEGVADTQMVELSHVLSETGGTAEAA  188

Query  400  GMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
             MM   +  K E +  +LEKAD+LR++T+  +VE+L   QAV FLIAAA+L   +  +G 
Sbjct  189  EMMETAMQEKREGMGRVLEKADELRLETLKGVVEILRPMQAVHFLIAAAELQLWLHEYGT  248

Query  220  NHDRQR  203
              D +R
Sbjct  249  KKDAER  254



>ref|XP_002524536.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37863.1| conserved hypothetical protein [Ricinus communis]
Length=136

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F+ETWF+QL +L  QL +AP+P T+         +V K+M H  EYYRVKS A +R
Sbjct  3    SFCRFYETWFDQLHRLFHQLSKAPKPPTSEYDASHLSNLVDKLMDHYVEYYRVKSEAVER  62

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L VFTA W +SLERSLHWI GWRPTT+FHL+YTESSILFE  I+DILRG+  GDLGD+
Sbjct  63   DVLAVFTAHWTSSLERSLHWIAGWRPTTLFHLVYTESSILFEPRIVDILRGISTGDLGDI  122

Query  511  TPTQLRRV  488
            +P+Q R+V
Sbjct  123  SPSQFRQV  130



>ref|XP_008382157.1| PREDICTED: uncharacterized protein LOC103444967 [Malus domestica]
Length=143

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = -1

Query  607  VFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSD  428
            +F +IY+ESSI FE+HI DIL+G   GDLGDLTP Q  RVSELQCETV+EEN I++QLS+
Sbjct  7    LFWIIYSESSIHFEAHIFDILQGNGTGDLGDLTPYQFGRVSELQCETVKEENAISEQLSE  66

Query  427  WQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQL  248
            WQ    ++IG  +  LD  M  L  +L+ AD LR++T+  +VELLT QQAVEFLIAAA+L
Sbjct  67   WQAEAFEMIGACT-NLDMNMGSLVSVLKTADDLRLRTVRKIVELLTPQQAVEFLIAAAEL  125

Query  247  MFGIRRWGINHDRQREN  197
             FG+R WG+N DR+R N
Sbjct  126  QFGVRGWGMNQDRRRGN  142



>ref|XP_008226586.1| PREDICTED: uncharacterized protein LOC103326167 [Prunus mume]
Length=139

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -1

Query  568  ESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMS  389
            ++HI+DILRG   GDLGDL+P+Q RRVSELQCETV+EEN I+++LS+WQ+G S+++G  +
Sbjct  16   KAHIVDILRGFCTGDLGDLSPSQFRRVSELQCETVKEENAISEELSEWQEGASELMGACT  75

Query  388  GKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDR  209
              LD KM +L  +L+KAD LR++T+  +VELLT QQAVEFLIAAA+L FG+R WG+N DR
Sbjct  76   -NLDMKMGRLVSVLKKADDLRLRTVRKVVELLTPQQAVEFLIAAAELQFGVRGWGMNQDR  134

Query  208  QREN  197
            QR N
Sbjct  135  QRGN  138



>gb|EYU35712.1| hypothetical protein MIMGU_mgv1a011847mg [Erythranthe guttata]
Length=269

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/253 (35%), Positives = 139/253 (55%), Gaps = 36/253 (14%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPR-------PATTADHHQLQQEMVQKVMSHCHEYYRV  713
            +F SF E+W  +    +++L  A +       P+   D   + ++ + +V+ H  +YYR 
Sbjct  12   TFHSFFESWLVEQDHYLEELVSASKRRRVHHHPSAADDDDTVLRQKIARVIDHYEQYYRA  71

Query  712  KSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglr  533
            KS  AK D L +F  PW +SLE +  WIGGWRPT  FHL+Y++S +  +  + D+L+GL 
Sbjct  72   KSTCAKTDALPMFNPPWRSSLEDAFLWIGGWRPTMAFHLLYSKSGLQLQDKLADLLQGLA  131

Query  532  ngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQ-----------------------  422
             GDL DL+P Q+ ++++LQ  TV+EE  I+++L+  Q                       
Sbjct  132  AGDLADLSPPQVNQINDLQRATVREEKEISEKLAKQQEKVADTSMVELSNAVTEAMRNPA  191

Query  421  ---DGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQ  251
               DGG    G ++  L  K   LAE+L++AD LR+KT+  ++ +L+  Q V FLIAAA+
Sbjct  192  AADDGGG---GRVAAALAPKEVGLAEVLQRADDLRLKTLKKVLGVLSPIQGVHFLIAAAE  248

Query  250  LMFGIRRWGINHD  212
            L   +  WG+  D
Sbjct  249  LHLRLHEWGMKRD  261



>ref|XP_009405272.1| PREDICTED: transcription factor HBP-1b(c1)-like [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 136/219 (62%), Gaps = 8/219 (4%)
 Frame = -1

Query  859  FHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILG  680
            F   W  +L +L + L  A   A  A        +V + ++    ++R +S AA+ D + 
Sbjct  8    FVAVWPRELSRLRRDLRCARGDADRA--------LVDRAIALYECFFRARSTAARSDPVR  59

Query  679  VFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQ  500
             + APWAT+LER+ HW+ GWRP  + HL+Y+ESS+ FES + D+L G+ +GDLGDL+  Q
Sbjct  60   AYAAPWATALERAAHWVAGWRPNALIHLLYSESSLRFESQLPDLLLGVHSGDLGDLSSAQ  119

Query  499  LRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMK  320
            L R+ ELQ  T++ E  I+ +++  Q+G ++       +L+ K+ +L  ++E+AD+LR++
Sbjct  120  LGRIDELQRRTIRGELEISAEMAAVQEGLAEPFPRSDAELEGKVGELTRVMERADELRLR  179

Query  319  TITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            T+  +V++L   QAV+ L+AAA L  G+R +G++ D  R
Sbjct  180  TLREVVDILEPVQAVDLLVAAADLEIGLREFGLSQDGSR  218



>ref|XP_006432080.1| hypothetical protein CICLE_v10002078mg [Citrus clementina]
 ref|XP_006464938.1| PREDICTED: transcription factor TGA2-like [Citrus sinensis]
 gb|ESR45320.1| hypothetical protein CICLE_v10002078mg [Citrus clementina]
 gb|KDO52212.1| hypothetical protein CISIN_1g023115mg [Citrus sinensis]
Length=287

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 135/247 (55%), Gaps = 27/247 (11%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SFQ F E+W  +  Q +Q L  A +           +E V+ V+ H  +YYR KS   K 
Sbjct  30   SFQKFFESWLVEQNQHLQALISASKQQENNSSSSNFEEQVRVVVEHYEQYYRAKSRWVKL  89

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+LG+ T  W +SLE S  WIGGWRP+  FHL+Y++S +  E  + D++RGL +GDLGDL
Sbjct  90   DVLGMLTPSWRSSLEDSFLWIGGWRPSMAFHLLYSKSGLQLEGKLHDLIRGLSSGDLGDL  149

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD---------IIGMMSGKLD------  377
            +PTQL RV  LQ   ++EE  ++++L+ +Q+  +D         +  +MS   D      
Sbjct  150  SPTQLTRVDGLQRVIIKEEKDLSEKLAKYQETVADSSLVELSHVVTELMSTNDDRQDSDR  209

Query  376  ------------AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIR  233
                         K  KL EI  KAD LR+KT   ++++LT  QAV FLIAAA+L   + 
Sbjct  210  RLMDDQIESNFVTKEAKLEEIFHKADDLRLKTFKAVIDILTPIQAVHFLIAAAELHLRLH  269

Query  232  RWGINHD  212
             WG   D
Sbjct  270  DWGKQRD  276



>ref|XP_006830264.1| hypothetical protein AMTR_s00130p00113960 [Amborella trichopoda]
 gb|ERM97680.1| hypothetical protein AMTR_s00130p00113960 [Amborella trichopoda]
Length=255

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 140/236 (59%), Gaps = 25/236 (11%)
 Frame = -1

Query  868  FQSFHETWF-EQLRQLVQQLGQAPRPATTADHHQLQQE----MVQKVMSHCHEYYRVKSI  704
            F+ F E W  EQ RQL + +         A H  + ++    ++++VM+H   YY  KS 
Sbjct  11   FKRFFEEWIAEQERQLHELMA--------ASHAHINEKTLRSLIERVMAHYEAYYDAKSK  62

Query  703  AAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngd  524
            AAK +I+G+F+  W + LE +  WI GWRP  VF L+Y ++ +  +S + D+L+GL   +
Sbjct  63   AAKENIVGMFSPTWTSKLENAFLWIAGWRPAMVFRLLYAKAGLQLDSDLADLLQGLSRRN  122

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGM----------MSGKL  380
            L DL+P+QL  V+ELQ +T++EE  I+ +++  Q+G +D  ++G+          +   L
Sbjct  123  LADLSPSQLMAVNELQMKTIKEEEEISRKMAKLQEGVADQPLVGLVQMVNAEEDGVEAAL  182

Query  379  DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            + + E L  +LE AD+LR++T+ ++V +L   QAV+ L+AAAQL   I  WG+  D
Sbjct  183  EEQEEGLERVLECADRLRLETLKSVVGVLNLIQAVDLLVAAAQLHLKIHEWGMKRD  238



>ref|XP_008793320.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=274

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/246 (33%), Positives = 133/246 (54%), Gaps = 24/246 (10%)
 Frame = -1

Query  868  FQSFHETWFEQLR---QLVQQLGQAPRPATTADHHQLQQEM---VQKVMSHCHEYYRVKS  707
            F    E W  + +   Q ++    APRP T  +  + ++ +   V++V+ HC  YYR K+
Sbjct  23   FAELFECWLAERKLHLQALRAAASAPRPETPDEEAEEERRLTLLVRRVLGHCEYYYRAKA  82

Query  706  IAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrng  527
             +AKRD+  +F+  W +S E    W+GGWRP+  FHLIY++S I  ES + +++RG    
Sbjct  83   ASAKRDVTPMFSPTWTSSSENLFLWVGGWRPSVAFHLIYSKSGIQLESQLAEVIRGASTR  142

Query  526  dlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD------------------II  401
            DL DL+  QL+R+ ELQ  T++ E  I+++ +  Q+G +D                    
Sbjct  143  DLADLSQGQLKRIDELQRRTIRIEKEISEEEARTQEGVADKQMVLLSHVLREMGRDGKAA  202

Query  400  GMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
             MM   +  K   +  +LE+AD LR +T+  +VE+L   Q + FLI AA+L   +R +G+
Sbjct  203  EMMEPAMQDKRAGMERVLERADALRQETLKGVVEILRPMQTIHFLITAAELRLRVREYGM  262

Query  220  NHDRQR  203
              D ++
Sbjct  263  KKDAEK  268



>ref|XP_003630355.1| Transcription factor HBP-1b(c1) [Medicago truncatula]
 gb|AET04831.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=272

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/240 (35%), Positives = 137/240 (57%), Gaps = 28/240 (12%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQL--GQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            SF  F E W  +  + + +L   ++ +P  T D       ++ KV+ H   YY+ KS  A
Sbjct  14   SFNKFFECWMVEQNKYLNELVAAKSAQPQLTNDR---MHTLIDKVVEHYECYYKTKSSFA  70

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            K+D+L +F+ PW ++LE +  WIGGWRP+  FHL+Y++ S+ F++ + D+++G +  DLG
Sbjct  71   KKDVLSMFSPPWLSTLEEAFLWIGGWRPSMAFHLLYSKCSMQFQARLNDLIQGQKTCDLG  130

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD---------IIGMMSGK------  383
            DLT +QL    +LQ +T++EE  I D L++ Q+  +D         +  M+ G       
Sbjct  131  DLTASQLAEFDDLQKKTIREEREITDMLAEHQETVADAPMVELSHVVSEMIRGGENEKKE  190

Query  382  --------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
                    L+ K+E L +IL +AD LR++ +  +V +LT +QA+ FLIAAA+L   +  W
Sbjct  191  LEERIESVLEPKVEGLEKILYRADDLRLRALQGIVNILTPKQAIHFLIAAAELHLRLHEW  250



>ref|XP_010674364.1| PREDICTED: transcription factor TGA6-like [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 140/263 (53%), Gaps = 34/263 (13%)
 Frame = -1

Query  883  IKKMSFQSFHETWFEQLRQLVQQLGQAPR---PATTADHHQLQQ--EMVQKVMSHCHEYY  719
            ++  SF  F ETW  +    +++L  A      +T +D    QQ   +V +VM H   YY
Sbjct  21   LRTESFAQFFETWLLEQEHDLEELKAAATCYTESTQSDTEWNQQLTSLVNRVMCHYENYY  80

Query  718  RVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrg  539
            RVKS +A  D+L + +  W ++LE +  W+GGWRP+T FHL+Y+ + +  E+   ++LRG
Sbjct  81   RVKSESADHDVLTMLSPSWRSNLEEAFLWVGGWRPSTAFHLLYSVTGLQLEAGFHELLRG  140

Query  538  lrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD--------------------  419
            L +G+L DL+P QL RV ELQ +TV EE  + +  +  Q+                    
Sbjct  141  LGSGNLADLSPDQLVRVDELQRQTVWEERELTENFAAIQETVADSTMVELSHVATELIRD  200

Query  418  ---------GGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFL  266
                     G   +   +   +  K  KL EIL +AD LR++T+ N++++LT  QAV+FL
Sbjct  201  PNSVTTGPVGPESVNERVESTIGTKENKLKEILGRADDLRLRTLKNVLDILTPIQAVDFL  260

Query  265  IAAAQLMFGIRRWGINHDRQREN  197
            IAAA+L   + +WG+  D    N
Sbjct  261  IAAAELHLRVHQWGVKKDEGANN  283



>ref|XP_011100139.1| PREDICTED: transcription factor TGA1-like, partial [Sesamum indicum]
Length=276

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 97/272 (36%), Positives = 149/272 (55%), Gaps = 43/272 (16%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPR-------------PATTAD---HHQLQQEMVQKVM  740
            SF  F E W  +  Q +Q+L  A R               TT +     +  + ++++V+
Sbjct  3    SFHKFFECWIVEQDQHLQELISAAREYEERRGRGCRQDDGTTVEEDVQDRTLRPLLERVI  62

Query  739  SHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESH  560
             H   YYR KS  AK D+L +F   W +SLE +  WIGGWRP+  FHL+Y++S +  E+ 
Sbjct  63   QHYEHYYRAKSRWAKSDVLSMFNPSWRSSLEDAFMWIGGWRPSMTFHLLYSKSGLQLEAR  122

Query  559  IMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD---------  407
            + ++L+GL  GDLGDL+P+QL +V+ELQ +T++EE  I ++L+  Q+  +D         
Sbjct  123  LTELLQGLSTGDLGDLSPSQLDQVNELQKQTIREEKDITEKLAKQQETVADSSMVELTHV  182

Query  406  IIGMM-SGKLDAKM-------------EKLAEILEKADQLRMKTITNLVELLTAQQAVEF  269
            +  MM  G++D  M             E L E+L++AD LR+KT+  ++ +L+  Q V F
Sbjct  183  VTEMMREGQVDQAMDTERVDETLAPKEEGLVEVLQRADGLRLKTLKEVLNILSPIQGVYF  242

Query  268  LIAAAQLMFGIRRWGINHDRQR----ENNVSQ  185
            LIAAA+L   +  WG   D +R    EN  SQ
Sbjct  243  LIAAAELHLRVHEWGKKRDARRNEHSENGHSQ  274



>ref|XP_010025725.1| PREDICTED: transcription factor TGA2-like [Eucalyptus grandis]
 gb|KCW62438.1| hypothetical protein EUGRSUZ_H05080 [Eucalyptus grandis]
Length=285

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 134/251 (53%), Gaps = 29/251 (12%)
 Frame = -1

Query  880  KKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            ++ SF  F E W  +  Q +  L  A  PA   D   L+  ++ +VM H  +YY+ KS +
Sbjct  20   ERESFHKFFECWLVEQNQHLHDLISASSPARDGDDQALRP-LIDRVMLHYEQYYKAKSRS  78

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            AK+++L +F+  W +S E +  WIGGWRP+  FHL+Y++S +  E+ + +++RGL   DL
Sbjct  79   AKQNVLAMFSPTWRSSFEDAFLWIGGWRPSMAFHLLYSKSGLQLEAQLAELIRGLATSDL  138

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD---------IIGMMSG------  386
             DL+P+QL  + + Q  T+ +E  I ++ +  Q+  +D         I  MM        
Sbjct  139  ADLSPSQLALIDDRQRTTIHQEKAITEKFAKHQETVADASMVELSHTITEMMRAGGGDAA  198

Query  385  -------------KLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLM  245
                          L AK E L E+L+ AD LR+ T+  ++ +LT+ QAV FLIAAA+L 
Sbjct  199  VENEAAMEEEVESALAAKEEGLEEMLQMADDLRLSTLKEILNILTSMQAVHFLIAAAELH  258

Query  244  FGIRRWGINHD  212
              I  WG   D
Sbjct  259  LRIHEWGKKKD  269



>ref|XP_011075022.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=262

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 141/246 (57%), Gaps = 30/246 (12%)
 Frame = -1

Query  883  IKKMSFQSFHETWFE-QLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKS  707
            + + +F+ F+  W E Q   L   +  A +P+ ++    L    V +V+SH  EYYRVKS
Sbjct  11   LDRKNFEEFYIRWKEKQNLHLHDLITTATKPSPSSSFPAL----VDRVISHYEEYYRVKS  66

Query  706  IAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrng  527
             + K D+L + +APW T LE + +W+GGWRP+  FHL+Y++S +  E+ + ++ +G+  G
Sbjct  67   KSIKTDVLLILSAPWKTGLEVAFNWVGGWRPSAAFHLLYSKSGLQLEAKLSELTKGVDMG  126

Query  526  dlgdLTPTQLRRVSELQCETVQEENYIADQL-------SDWQ--------------DGGS  410
            DL DL+  QL R+ +LQ  T+Q+E  I++++       +DW+               GG 
Sbjct  127  DLSDLSSAQLSRMDKLQRITIQQEREISEKVAKRQERAADWEMVELSHDVSELARTQGGQ  186

Query  409  DIIGMMSGKLDA----KMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMF  242
                 M+  +D+    K + L  +++ AD LR+KT+ ++V++L+  QAV FLIAAA+L  
Sbjct  187  SNNSKMARAVDSTLKHKEKDLQLVVQSADNLRLKTLKSIVDILSPIQAVHFLIAAAELHL  246

Query  241  GIRRWG  224
             I  WG
Sbjct  247  RIHDWG  252



>ref|XP_004503896.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cicer arietinum]
Length=277

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 139/255 (55%), Gaps = 32/255 (13%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQL--GQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            SF +F E W  +  Q + +L   ++ +P    D       ++ KV+ H   YY+ KS  A
Sbjct  18   SFHNFFECWLVEQNQHLNELVAAKSSQPQLAIDR---MHTLIDKVVEHYQFYYKEKSRYA  74

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            K+D+L +F+  W +SLE +  WIGGWRP+  FHL+Y++ S+ F++ + D+++GL+  DLG
Sbjct  75   KKDVLSMFSPSWISSLEEAFLWIGGWRPSMAFHLVYSKCSMQFQARLNDLIQGLKTCDLG  134

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI------------------IGMM  392
            DL+ +QL    +LQ  T++EE  I   +++ Q+  +D                   IG  
Sbjct  135  DLSSSQLAEFDDLQKRTIKEEREITGLMAEHQETVADAPMVELSHVVSEIIRDDNQIGEE  194

Query  391  SGK---------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFG  239
            + K         L+ K+E L +IL +AD LR++T+  +V +LT QQ + FLIAAA+L   
Sbjct  195  NEKKLEERIESTLEPKVEGLEKILHRADDLRLRTLQGIVSILTPQQGIHFLIAAAELHLR  254

Query  238  IRRWGINHDRQRENN  194
            +  WG   D  +  N
Sbjct  255  LHEWGKKMDDAKRGN  269



>ref|XP_009799260.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=286

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 135/246 (55%), Gaps = 26/246 (11%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQ--LQQEMVQKVMSHCHEYYRVKSIAA  698
            +F  F E+W  +  Q + QL +A +     + +   +   ++Q+V+ H   YY+ KS +A
Sbjct  19   TFHKFFESWLVEQNQDLDQLVRASKEVNGIEENNRIMLSPIIQRVIQHYENYYKEKSRSA  78

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            K D+LG+    W ++LE +  WIGGWRP+  FHL+Y++S +  E+   D+ RG+  GDLG
Sbjct  79   KEDVLGMLNPTWRSNLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAGFHDLFRGISTGDLG  138

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI----------------------  404
            DL+  QL ++ ELQ +T++EE  ++++L+  Q+  +D                       
Sbjct  139  DLSGIQLGKIDELQNKTLKEEKKLSERLAKVQETMADTSMVELSHVVSEILREEGRQVEE  198

Query  403  --IGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRR  230
                 +   +  K E L E+L+KAD LR++T+  ++ +L   QAV FLIAAA+L   I  
Sbjct  199  TEEEKVKNNIAKKEENLLEVLKKADDLRLRTLKEILGILKPIQAVHFLIAAAELHLRIHD  258

Query  229  WGINHD  212
            WG+  D
Sbjct  259  WGMKKD  264



>ref|XP_004288481.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=280

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 136/251 (54%), Gaps = 32/251 (13%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPAT-TADHHQ-LQQEMVQKVMSHCHEYYRVKSIAAK  695
            FQ+F + W  +  Q +  L  A + A    DH Q L   +V++V+ H  +YY  K   AK
Sbjct  26   FQAFFKCWIAEQNQHLDDLVVASKAADYNGDHDQVLLSSLVERVLKHYEQYYNAKFQWAK  85

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFE---SHIMDIlrglrngd  524
            +++L + + PW +SLE +  WIGGWRP+  FHL+Y++S +  E   + +M  LR    GD
Sbjct  86   QEVLSMLSPPWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLHPEDCSAELMRGLRFSNTGD  145

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQ--------------------------  422
            LGDL+  QL  V ELQ  T+QEE +I+++++  Q                          
Sbjct  146  LGDLSQWQLTMVDELQRRTIQEEKHISEKMAKLQETLADNPLVELSHLATDKMRKNNNVH  205

Query  421  -DGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLM  245
             +GG D +  +   L +K E L +IL KAD LR+ T+ N+ ++L+  QAV FLIAAA+L 
Sbjct  206  EEGGDDHMERVESTLASKEEGLEKILHKADDLRITTLKNITQILSPLQAVHFLIAAAELN  265

Query  244  FGIRRWGINHD  212
              +  WGI  D
Sbjct  266  LRVHDWGIKKD  276



>gb|EYU23876.1| hypothetical protein MIMGU_mgv11b017687mg [Erythranthe guttata]
Length=270

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 138/250 (55%), Gaps = 29/250 (12%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPR--PATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            +FQ F+  W  +  Q + +L  A +  P        L   +V++V+SH  EYYR+K+  A
Sbjct  8    NFQEFYVKWQNKHNQHLYELTNASKTQPQQPQSDSSLSG-LVERVISHYEEYYRIKTKWA  66

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            K D+  + + PW + LE +  W+GGWRPTT FHL+Y++S + F++   ++L G + GDLG
Sbjct  67   KTDVYLLLSPPWNSPLEDAFLWVGGWRPTTAFHLLYSKSGLQFQAQFSNMLIGAKTGDLG  126

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQD----------------------GGS--  410
            DL+  QL R+   Q  T+QEE  I ++ +  QD                      GG+  
Sbjct  127  DLSLDQLGRIDIFQKGTIQEEREITEKEAKQQDRVADKEMVGLSHDASSESTRPVGGTSL  186

Query  409  DIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRR  230
            DI  +++  L  K E    +L+ AD+LRMKT+  ++++L+  QAV FLIAAA+L   +  
Sbjct  187  DIGSLVNSVLKPKEEGFQMLLQSADELRMKTLKGVIDILSPIQAVHFLIAAAELQLCLHE  246

Query  229  WGINHDRQRE  200
            WG   D+Q E
Sbjct  247  WG--KDKQDE  254



>ref|XP_009594445.1| PREDICTED: transcription factor TGA6-like [Nicotiana tomentosiformis]
Length=286

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/258 (34%), Positives = 144/258 (56%), Gaps = 27/258 (10%)
 Frame = -1

Query  904  SKN*RN*IK-KMSFQSFHETWFEQLRQLVQQLGQAPRPATTA--DHHQLQQEMVQKVMSH  734
            S N RN ++ + +F  F E+W  +  Q ++QL +A +       ++ ++   ++Q+V+ H
Sbjct  7    SNNSRNGVQNRETFHKFFESWLVEQNQDLEQLVRASKEVNGVEENNRRMLSPLIQRVIHH  66

Query  733  CHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIM  554
               YY+ KS +AK D+LG+    W ++LE +  WIGGWRP+  FHL+Y++S +  E+   
Sbjct  67   YENYYKEKSRSAKEDVLGMLNPTWRSNLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAGFH  126

Query  553  DIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--------IIG  398
            D+ RG+  GDLGDL+  QL ++ ELQ +T++EE  + ++L+  Q+  +D        I+ 
Sbjct  127  DLFRGISRGDLGDLSGIQLGKIDELQNKTLREEKKLTERLAKVQETVADTSMVELSHIVS  186

Query  397  MM----------------SGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFL  266
             +                   +  K E L E L+KAD LR++T+  ++ +L   QAV FL
Sbjct  187  ELMREEGRQVEETEEEKVKTNIAKKEEGLLEALKKADDLRLRTLKEILGILKPIQAVHFL  246

Query  265  IAAAQLMFGIRRWGINHD  212
            IAAA+L   I  WG+  D
Sbjct  247  IAAAELHLRIHDWGMKKD  264



>ref|XP_004289493.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 137/251 (55%), Gaps = 32/251 (13%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQL----GQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            FQ+F E+W  +  Q +Q L     Q  + A   D   L   +V++V+ H  +YY  KS  
Sbjct  13   FQAFFESWLSEQDQHLQDLIIASKQHQKRAADDDDRVLLSSLVERVVKHYEQYYNKKSQW  72

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlr--glrng  527
            AK+D+L + + PW +SLE +  WIGGWRP+  FHL+Y++S +  E+   +++R   L  G
Sbjct  73   AKQDVLRMLSPPWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLQLEASFAELMRGLRLSTG  132

Query  526  dlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD------------------------  419
            DLGDL+  QL  V ++Q  T+++E +++++++  Q+                        
Sbjct  133  DLGDLSHCQLTMVDKVQRRTIEDEKHLSEKMAKLQETVADATLVELAHEATEMMRNNEVH  192

Query  418  --GGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLM  245
              G  D +  +   L +K E L +IL KAD LRMKT+ N+ ++L+  QAV FLIAAA+L 
Sbjct  193  EGGADDHMERVESTLASKEEGLEKILHKADDLRMKTLRNITQILSPLQAVHFLIAAAELH  252

Query  244  FGIRRWGINHD  212
              +  WG   D
Sbjct  253  LRVHDWGKKKD  263



>dbj|BAA05470.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=287

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 143/258 (55%), Gaps = 35/258 (14%)
 Frame = -1

Query  892  RN*IKK--MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQE----MVQKVMSHC  731
            RN ++K   +F  F ETW  + +Q +++L  A R  +  +++ +++     ++++V+ H 
Sbjct  8    RNGVEKNDKTFHEFFETWLAEQKQELKELVSASRDVSKGNNNVVEERVLVPLIKRVIQHY  67

Query  730  HEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMD  551
              YY  KS   + D+ G+    W ++LE +  WIGGWRP+  FHL+Y++S + FE+ +  
Sbjct  68   EGYYEEKSKYTEEDVFGMLNPTWRSNLEGAFLWIGGWRPSMAFHLLYSKSGLQFEARLPQ  127

Query  550  IlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------  404
            ++RG+  GDLG L+P Q+ +V ELQ +T++EE   +++L+  Q+  +D            
Sbjct  128  LIRGITTGDLGYLSPDQIDKVDELQKKTIREEKKSSEKLARVQETVADASMVELSHIVTQ  187

Query  403  IGMMSG------------------KLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQA  278
            + M+SG                   L  K E L  IL+KAD LR+ T+  ++ +LT  QA
Sbjct  188  LMMISGSRGGGGGGGKILDEEVEANLATKEEGLIIILQKADNLRLNTLKEILAILTPTQA  247

Query  277  VEFLIAAAQLMFGIRRWG  224
            + FLIAAA+L   +  WG
Sbjct  248  IHFLIAAAELHLRLHEWG  265



>ref|XP_003524316.1| PREDICTED: transcription factor TGA4-like [Glycine max]
Length=285

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 138/252 (55%), Gaps = 29/252 (12%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F E W  + +Q ++ L  A      +D     Q +  KV+ H   YY+ KS  AK+
Sbjct  23   SFHKFFECWISEQKQHLKDLLAAESTQLISDEEL--QALNDKVVEHYEYYYKAKSRCAKQ  80

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L + +  W +SLE +  WIGGWRP+  FHLIY++S + FE+ + ++L+GLR  DLGDL
Sbjct  81   DVLAMLSPTWMSSLEEAFLWIGGWRPSMAFHLIYSKSGLQFEARLDEVLQGLRTHDLGDL  140

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-------------IIGMMSGKLDA-  374
            + +QL ++ E+Q  T+ EE  I D ++  Q+  +D             I     G++D  
Sbjct  141  SASQLAQLDEMQRRTILEEREITDLMARHQETVADASMVELSHVVSEMIRANQRGEVDQS  200

Query  373  -------------KMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIR  233
                         K E L +IL KAD+LR  T+ ++V++LT +QA+ FLIAAA+L   + 
Sbjct  201  KEIENKVESTLVLKEEGLEKILLKADELRFITLKDVVDVLTPKQAIHFLIAAAELHLRLH  260

Query  232  RWGINHDRQREN  197
             WG   D ++ N
Sbjct  261  EWGKKMDARKCN  272



>gb|EYU20609.1| hypothetical protein MIMGU_mgv1a010868mg [Erythranthe guttata]
Length=299

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 144/274 (53%), Gaps = 37/274 (14%)
 Frame = -1

Query  928  SVQYNTHNSKN*RN*IKKMSFQSFHETWFEQLRQLVQQLGQAPRP----------ATTAD  779
            S+ Y T  ++N     ++ SF  F E W  +    + +L  A +           AT   
Sbjct  7    SISYMTQATRNGNQ--ERESFHKFFECWIVEQDHHLHELVSASKDIEDRHQHHGGATAEL  64

Query  778  HHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFH  599
            + ++ + ++++V+ H   YYR KS  AK D+L +F   W +SLE +  WIGGWRP+  FH
Sbjct  65   NGRVLRPLLERVVQHYEHYYRAKSRWAKNDVLSMFNPSWRSSLEDAFLWIGGWRPSMAFH  124

Query  598  LIYTESSILFESH-IMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQ  422
            L+Y++S +  E+  I D++ GL NGDL DL+  QL RV  LQ  T++EE  I ++L+  Q
Sbjct  125  LLYSKSGLQLEARAIDDLILGLTNGDLSDLSTGQLGRVDALQKVTLREEKEITEKLAKLQ  184

Query  421  DG--------------------GSDIIGMMSGKLDA----KMEKLAEILEKADQLRMKTI  314
            +                       D +    G+++A    K E L  +LEKAD+LRMKT+
Sbjct  185  ETVADSSMVELSHAVSELIQEEAGDRVAEQEGRVEAALAPKEEGLVGVLEKADELRMKTL  244

Query  313  TNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
              ++++L+  Q V FLIAAA+L   +  WG   D
Sbjct  245  KGVIDILSPTQGVHFLIAAAELHLRVHDWGKKRD  278



>gb|EYU23355.1| hypothetical protein MIMGU_mgv1a023684mg, partial [Erythranthe 
guttata]
Length=261

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 137/246 (56%), Gaps = 27/246 (11%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            +SF  F ++W  +    +Q+L  A +          + ++V++V+ H   YY+ KS+ AK
Sbjct  6    VSFHMFFDSWMVEQNYQLQELVSATKEWGG------RSDVVEQVVHHYEHYYKTKSMWAK  59

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMD---Ilrglrngd  524
            +DIL +F+  W +SLE++  W+GGWRPTT FHL+Y++  +  E+ + D   +  GL  GD
Sbjct  60   KDILSMFSPTWTSSLEKAFMWVGGWRPTTAFHLLYSKCGLQLEAALEDYHHLPSGLNTGD  119

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD----------IIGM-------  395
            LGDL+ +Q+ RV EL   T++EE  I ++L+  Q+  +D          ++ M       
Sbjct  120  LGDLSHSQMVRVDELHKSTLREEKMITEKLAKKQETIADSSMVRLTTELMVHMEEHDQQV  179

Query  394  -MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGIN  218
             +   L +K   L  +L+ AD LR+KT+  L+ +L+  Q   FLIAAA+L   I  WG N
Sbjct  180  VVDAALASKENGLVRVLQMADDLRLKTLKELILILSPIQGAYFLIAAAELHLKIHEWGKN  239

Query  217  HDRQRE  200
             D  R+
Sbjct  240  RDASRK  245



>ref|XP_011022856.1| PREDICTED: transcription factor TGA2-like [Populus euphratica]
Length=280

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/253 (34%), Positives = 133/253 (53%), Gaps = 30/253 (12%)
 Frame = -1

Query  871  SFQSFHETWF-------EQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRV  713
            SF+ F E W        EQL    +      + +  +    + Q ++ +V+ H   YYR 
Sbjct  24   SFRKFFECWLAEQSNYLEQLISTCKDYDHNKKNSPQSSSQAILQPLINRVLEHYEHYYRA  83

Query  712  KSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglr  533
            KS  AK D+L + +  W ++LE +  WIGGWRP+  FHL+Y++S    E+ + +++ GL 
Sbjct  84   KSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLEAQLHELICGLG  143

Query  532  ngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGM--------------  395
             GDLGDL+ +QL RV +LQ +T++EEN + ++ +  Q+  +D   +              
Sbjct  144  TGDLGDLSASQLTRVDQLQRKTIREENELTEKHAKHQEAVADSSMVELSHEVTELLRSES  203

Query  394  ---------MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMF  242
                     +   L  K + L EIL+ AD LR++TI  ++E+LT  QAV FLIAAA+L  
Sbjct  204  TGDEVDEERVESTLAPKKDGLQEILQMADDLRLRTIKGVIEILTPMQAVHFLIAAAELHL  263

Query  241  GIRRWGINHDRQR  203
             +  WG   D  R
Sbjct  264  RLHDWGKKGDWAR  276



>emb|CDP10926.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 137/270 (51%), Gaps = 50/270 (19%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQA------PRPAT---TADHHQLQ------------QEM  755
            +F+ F+ETW +Q  Q +Q+L  A      P P T   TA                    +
Sbjct  21   NFEQFYETWKKQQNQHLQELITASEQVSSPTPPTEGITACSSSSPPPPTDGITATNLSNL  80

Query  754  VQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSI  575
            V++V+ H  EYY+ KS  A ++ L + + PW +SLE +  WIGGWRPT   HL+Y++SS+
Sbjct  81   VKRVVEHYEEYYKTKSEWADKNTLQILSPPWTSSLEDAFLWIGGWRPTMAIHLLYSKSSL  140

Query  574  LFESHIMD-IlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDI  404
             FES   D +   L   DLGDLT +Q+  + ELQ  T+ EE  I  +++  Q+   G+D+
Sbjct  141  QFESKFNDWMQGKLTKHDLGDLTESQISLIDELQKNTIIEEKEITGKMAKQQEKAAGADM  200

Query  403  IGM--------------------------MSGKLDAKMEKLAEILEKADQLRMKTITNLV  302
            + +                              L  K +   +ILEKAD LR++T+ +++
Sbjct  201  VELSHLVSEALREEEKGTKARDHEAEQSQAESSLSPKEKGFKKILEKADNLRLRTLKSII  260

Query  301  ELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            E L+A QAV FLIAAA+L   +  WG   D
Sbjct  261  EALSATQAVHFLIAAAELHLRLHEWGKARD  290



>gb|KHN17404.1| Transcription factor TGA4 [Glycine soja]
Length=402

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 138/252 (55%), Gaps = 29/252 (12%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F E W  + +Q ++ L  A      +D     Q +  KV+ H   YY+ KS  AK+
Sbjct  23   SFHKFFECWISEQKQHLKDLLAAESTQLISDEEL--QALNDKVVEHYEYYYKAKSRCAKQ  80

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L + +  W +SLE +  WIGGWRP+  FHLIY++S + FE+ + ++L+GLR  DLGDL
Sbjct  81   DVLAMLSPTWMSSLEEAFLWIGGWRPSMAFHLIYSKSGLQFEARLDEVLQGLRTHDLGDL  140

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-------------IIGMMSGKLD--  377
            + +QL ++ E+Q  T+ EE  I D ++  Q+  +D             I     G++D  
Sbjct  141  SASQLAQLDEMQRRTILEEREITDLMARHQETVADASMVELSHVVSEMIRANQRGEVDQS  200

Query  376  ------------AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIR  233
                         K E L +IL KAD+LR  T+ ++V++LT +QA+ FLIAAA+L   + 
Sbjct  201  KEIENKVESTLVLKEEGLEKILLKADELRFITLKDVVDVLTPKQAIHFLIAAAELHLRLH  260

Query  232  RWGINHDRQREN  197
             WG   D ++ N
Sbjct  261  EWGKKMDARKCN  272



>ref|XP_002528014.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34370.1| conserved hypothetical protein [Ricinus communis]
Length=271

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 131/246 (53%), Gaps = 26/246 (11%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADH--HQLQQEMVQKVMSHCHEYYRVKSIAA  698
            SF  F E W  + +Q + +L  A +      +  H   Q ++ +V+ H  +YY  KS  A
Sbjct  21   SFHDFFEWWLVEQKQELDELISASKQKLNNKNNNHDSLQPLINRVLEHYEQYYSAKSKWA  80

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            K D+L +F+  W + LE +  WIGGWRP+  FHL+Y++S +  E+ + D++RGL  GDLG
Sbjct  81   KHDVLAMFSPSWTSPLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAQLHDVIRGLCTGDLG  140

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQ--------------------DGGSDIIG  398
            DL+P QL +V E Q   ++EE  I + ++  Q                    D GS I  
Sbjct  141  DLSPNQLVQVDEFQRRIIREEKNITENMAKHQATVADTSMVELTHAISKTRRDEGSSIGN  200

Query  397  ----MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRR  230
                 +   L  K+E L ++L+KAD LR++T+  ++++LT  Q V FLIAAA+L   +  
Sbjct  201  EVQERVESTLKTKLEGLEKVLQKADDLRLRTLKGIIDILTPDQTVHFLIAAAELHLRLHE  260

Query  229  WGINHD  212
             G   D
Sbjct  261  LGKKMD  266



>ref|XP_009402767.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A-like 
[Musa acuminata subsp. malaccensis]
Length=270

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (54%), Gaps = 19/235 (8%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F E W  +  + +Q L  A   A +A      + +V +V+ H   YY  K+ + +RD
Sbjct  27   FAKFFECWLAEQERDLQVLRTA---AASAGEELRLRPLVDRVLGHYEYYYCAKAASVRRD  83

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +L +F   W +S E    W GGWRPT  FHL+Y++S + FE  +++++ G    DL DL+
Sbjct  84   VLPMFNPTWTSSTENLFLWAGGWRPTMAFHLLYSKSGLQFEPRLLELIVGNPTRDLADLS  143

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI----------------IGMMSGKLD  377
            P QL R+  L   TV+ E  I+++ +  Q+  +D                    M  ++ 
Sbjct  144  PDQLERIDGLHRLTVRLEKEISEEEAQVQESVADARMVELTHALAESEEVEADAMEQEMK  203

Query  376  AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
             K +++ E+L++ADQLR++T+  LVE+L   QAV FLIAAA+L   +  +G + D
Sbjct  204  RKRDRMNEVLQRADQLRLETLKGLVEILKPVQAVHFLIAAAELHLKVHEFGKSKD  258



>ref|XP_009757325.1| PREDICTED: transcription factor TGA5-like [Nicotiana sylvestris]
Length=275

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 136/247 (55%), Gaps = 27/247 (11%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQE----MVQKVMSHCHEYYRVKSI  704
            +F  F ETW  +  Q +++L  A R  +  ++  +++     ++++V+ H   YY  KS 
Sbjct  17   TFHKFFETWLAEQNQELKELVSASRDVSKDNNIVVEERVLVPLIERVIQHYEGYYGEKSK  76

Query  703  AAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngd  524
              + D+ G+    W ++LE +  WIGGWRP+  FHL+Y++S + FE  +  ++RG+  GD
Sbjct  77   YTEEDVFGMLNPTWRSNLEGAFLWIGGWRPSMAFHLLYSKSGLQFEPRLPQLIRGITTGD  136

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------IGMMS----  389
            LGDL+P Q+ +V ELQ +T++EE   +++L+  Q+  +D            + M+S    
Sbjct  137  LGDLSPDQISKVDELQKKTIREEKDSSEKLAKVQETVADASMVELSHVVTQLMMISGGGG  196

Query  388  --------GKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIR  233
                      L  K E L  IL+KAD LR+ T+  ++ +LT  QA+ FLIAAA+L   + 
Sbjct  197  GILEEEVEANLATKEEGLVIILQKADNLRLNTLKEILAILTPTQAIHFLIAAAELHLRLH  256

Query  232  RWGINHD  212
             WG   D
Sbjct  257  EWGKKKD  263



>ref|XP_011097086.1| PREDICTED: transcription factor TGA2-like [Sesamum indicum]
Length=300

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 137/259 (53%), Gaps = 39/259 (15%)
 Frame = -1

Query  871  SFQSFHETWF-EQLRQL------------VQQLGQAP-RPATTAD-HHQLQQEMVQKVMS  737
            +F  F E W  EQ R L            +Q+ G    RP T  +   ++ +  + +V+ 
Sbjct  24   TFHEFFECWLSEQSRHLEELVLASKESERLQEQGHDDHRPVTQQEVDERILRPKIAEVIE  83

Query  736  HCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHI  557
            H  +YY VKS+ A+ D+L +F   W +SLE +  WIGGWRP+  FHL+Y++S +  E+ +
Sbjct  84   HYEQYYHVKSLWAENDVLLMFNQSWRSSLEDAFLWIGGWRPSIAFHLLYSKSGLQLEARL  143

Query  556  MDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDII--------  401
             ++ +GL   DLG L+ TQL +V+ELQ  T++EE  I ++L+  Q+  +D +        
Sbjct  144  DELRQGLTVNDLGGLSYTQLNQVNELQRGTIREEKEITEKLAKQQEKVADSLMVELSHAV  203

Query  400  ------GMMSGKLDA----------KMEKLAEILEKADQLRMKTITNLVELLTAQQAVEF  269
                  G  +G + A          K E   EI+++AD LR+KT+  L+  LT  Q V F
Sbjct  204  TESIREGNQAGPIVADERIEATLAVKEEGFTEIIKRADDLRLKTLRELINTLTPSQGVHF  263

Query  268  LIAAAQLMFGIRRWGINHD  212
            LIAAA+L   +  WG   D
Sbjct  264  LIAAAELHMRLHEWGKKRD  282



>ref|XP_002310543.2| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
 gb|EEE90993.2| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
Length=269

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 136/245 (56%), Gaps = 25/245 (10%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQ---------QEMVQKVMSHCHEYY  719
            +F+ F E W  +    ++QL  + +     DH++           Q ++ +V+ H   YY
Sbjct  24   TFRKFFECWLAEQNNYLEQLISSCK---DYDHNKKNSPQSSQATLQPLINRVLEHYEYYY  80

Query  718  RVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrg  539
            R KS  AK D+L + +  W ++LE +  WIGGWRP+  FHL+Y++S    E+ + +++ G
Sbjct  81   RAKSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLEAQLHELICG  140

Query  538  lrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGM----------  395
            L  GDLGDL+ +QL RV +LQ +T++EEN + ++    Q+    S ++ +          
Sbjct  141  LGTGDLGDLSGSQLTRVDQLQRKTIREENELTEKHVKHQETVADSSMVELAHENTGTDEE  200

Query  394  -MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGIN  218
             +   L  + + L EIL+ AD LR++TI  ++++LT  QAV FLIAAA+L   +  WG  
Sbjct  201  RVESTLAPRKDGLQEILQMADDLRVRTIKGVIDILTPIQAVHFLIAAAELHLRLHDWGKK  260

Query  217  HDRQR  203
             D  R
Sbjct  261  GDWAR  265



>ref|XP_006345765.1| PREDICTED: transcription factor TGA1-like [Solanum tuberosum]
Length=285

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 131/246 (53%), Gaps = 26/246 (11%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQ---LQQEMVQKVMSHCHEYYRVKSIA  701
            SF  F E+W  +  Q + QL +A +     + +    +   ++  V+ H  EYYR KS  
Sbjct  14   SFHKFFESWLVKQNQDLDQLVRASKDDDNNNKNNNDMMLSSLIHSVVKHYEEYYREKSRY  73

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            A  DILG+    W ++LE +  WIGGWRP+  FHL+Y++S I  E+++ +++RG    DL
Sbjct  74   AISDILGMLHPSWLSNLEDAFLWIGGWRPSMAFHLLYSKSGIQLEANLHELIRGFNTKDL  133

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-------------------IIG  398
            G+L+  QL  + ELQ +T+ EE  +++ L+  Q+  +D                   ++ 
Sbjct  134  GNLSGNQLVLIDELQHKTISEERKLSENLAKVQETLADASMVELSHVVSELMRDDQLVVN  193

Query  397  ----MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRR  230
                 +   +  K E L ++L+KAD LR+ TI  ++ +LT+ Q V FLIAAA+L   I  
Sbjct  194  DEEEKIKKNISKKEESLLDLLKKADDLRLSTIKEILRILTSTQGVHFLIAAAELHLRIHE  253

Query  229  WGINHD  212
            WG   D
Sbjct  254  WGKKKD  259



>ref|XP_004239641.1| PREDICTED: transcription factor TGA6-like [Solanum lycopersicum]
Length=273

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 132/243 (54%), Gaps = 24/243 (10%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F E+W  +  + + +L +A       ++  L   ++  V+ H  EYYR KS  A  
Sbjct  10   SFHKFFESWLVKQSEDLDELVRASEEYKN-NNDMLLSPLIHSVVKHYEEYYREKSQYAAS  68

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+LG+    W ++LE +  WIGGWRP+  FHL+Y++S I  E+++ +++RG    DLG+L
Sbjct  69   DVLGMLHPSWLSNLEDAFLWIGGWRPSMAFHLLYSKSGIQLEANLHELIRGFSKEDLGNL  128

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD---------IIGMMSGKL-------  380
            +  QL  + ELQ +T+ EE  ++++L+  Q+  +D         +  +M  +L       
Sbjct  129  SGQQLGLIDELQHKTISEERKLSEKLAIVQESVADTSMVELSHVVSELMREQLVVHEEEE  188

Query  379  -------DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
                     K E L ++L+KAD LR+ TI  ++ + T  Q+V FLIAAA+L   +  WG 
Sbjct  189  KKIGKNISKKEESLLDLLKKADDLRLSTIKEILRISTPIQSVHFLIAAAELHLRVHEWGK  248

Query  220  NHD  212
            N D
Sbjct  249  NKD  251



>gb|EAY99001.1| hypothetical protein OsI_20960 [Oryza sativa Indica Group]
Length=223

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 130/224 (58%), Gaps = 9/224 (4%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDI  686
            + FH  W   LR L ++L    R A  AD       +V + ++H   Y   +   A+ D 
Sbjct  8    RRFH-LWLRGLRGLRREL----RAARWADDPAQLGSLVGRFVAHVECYTAAR---AEMDP  59

Query  685  LGVFTAPWATSLER-SLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +   +APWA+ +ER + +W+ GWRPTT+ HL+YTES   FE+ + D+L G+ +G+LGDL+
Sbjct  60   VWTLSAPWASPVERGAAYWLAGWRPTTLVHLLYTESGRRFEAQLPDLLLGVSSGNLGDLS  119

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQL  329
            P+QL ++ +LQ  TV EE+ ++ +++  Q+G   +       +D  + ++  +L +AD L
Sbjct  120  PSQLAQIDDLQRRTVAEEDGLSREMALVQEGHGAVAAGGEVDVDGIVGRVRGVLGRADAL  179

Query  328  RMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            R++T+   VE+L   QA E L+AAA +  G R +G+ +   R +
Sbjct  180  RLRTVKRAVEILEPAQAAELLVAAADMEIGFREFGLKYSSARSD  223



>ref|XP_007159878.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
 gb|ESW31872.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
Length=278

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 135/253 (53%), Gaps = 36/253 (14%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F E W  +  Q ++ L                Q +  KV+ H   YY+ KS  AK+
Sbjct  23   SFHHFFEGWISEQNQHLKDLLVVGEEL---------QSVKDKVVEHYESYYKTKSRCAKQ  73

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L + +  W +SLE +  WIGGWRP+  FHL+Y++S + FE+ + ++++GLR  DLGDL
Sbjct  74   DVLAMLSPTWTSSLEDAFLWIGGWRPSMAFHLLYSKSGLQFEARLQELVQGLRTHDLGDL  133

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-------------IIGMMSGKLDA-  374
            + +Q+ ++ E+Q   + EE  I D ++  Q+  +D             I     G+++  
Sbjct  134  SASQISQLDEMQKRVILEERQITDLMAGHQETVADASMVELSHVASEMIRANERGEVEES  193

Query  373  -------------KMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIR  233
                         K E L +IL+KAD+LR+ T+  +V +LT +QA+ FLIAAA+L   + 
Sbjct  194  KEFEDKVESTLVQKEEGLEKILQKADELRLGTLKAIVNVLTPKQAIHFLIAAAELHLRLH  253

Query  232  RWGINHDRQRENN  194
             WG   D ++EN+
Sbjct  254  EWGKKIDARKENH  266



>ref|XP_004961243.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Setaria italica]
Length=230

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/231 (37%), Positives = 136/231 (59%), Gaps = 16/231 (7%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDI  686
            Q FH  WF  LR L + L  A     + D  QL+  +V + ++H   Y   +   A+ D 
Sbjct  8    QRFH-LWFRGLRSLRRDLSSA---RWSDDPAQLEA-LVGRFVAHLESYCAAR---AELDP  59

Query  685  LGVFTAPWATSLER-SLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +   +APWA+  ER + +W+ GWRPTT+ HL+YTES   FE+ + D+L G+R+G+LGDL+
Sbjct  60   VWTLSAPWASPAERGAAYWLAGWRPTTLVHLLYTESGRRFEAQLPDLLLGVRSGNLGDLS  119

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMM---SG--KLDAK--MEKLAEI  350
            P QL +V ELQ   V EE+ ++ +++  Q+G   ++      SG  +LD +  + +L  +
Sbjct  120  PAQLAQVDELQRRMVAEEDALSREMAQVQEGHGVVVAAAPSPSGETELDVRGLVRRLRAV  179

Query  349  LEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            L++AD LR++T+   VE+L   QA E L+AAA +  G R +G+ +   R+ 
Sbjct  180  LDRADALRLRTMKRAVEILQPAQAAELLVAAADMEIGFREFGLKYGSGRDG  230



>gb|EYU23360.1| hypothetical protein MIMGU_mgv1a019261mg [Erythranthe guttata]
Length=289

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 134/252 (53%), Gaps = 28/252 (11%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            +SF  F ++W  +    +Q+L  A +         L  ++V++V+ H   YY+ KS+ AK
Sbjct  25   VSFHMFFDSWMVEQNYQLQELVSATKEWGGGSV-LLIPDVVEQVVHHYEHYYKTKSMWAK  83

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMD---Ilrglrngd  524
            +DIL +F+  W  SLE++  W GGWRP T FHL+Y++  +  E+   D   +  GL  GD
Sbjct  84   KDILSMFSPTWTHSLEKAFMWAGGWRPATTFHLLYSKCGLQLEAAFEDDYHLPSGLNTGD  143

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGM---------------  395
            LGDL+ +Q+ RV EL   T+ EE  I ++L+  Q+    S ++G+               
Sbjct  144  LGDLSHSQMVRVDELHKRTLWEEKMITEKLAKKQETIADSSMVGLTHSVATELMIRVEEH  203

Query  394  -------MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGI  236
                   +   L +K + L  IL+ AD LR+KT+  L+ +L+  Q V FLIAAA+L   I
Sbjct  204  DHDQQVVVDAALASKEKGLVVILQMADDLRLKTLKQLILILSPIQGVHFLIAAAELHLKI  263

Query  235  RRWGINHDRQRE  200
              WG N D  R+
Sbjct  264  HEWGKNRDASRK  275



>ref|XP_008442175.1| PREDICTED: transcription factor TGA2-like isoform X2 [Cucumis 
melo]
Length=280

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/252 (31%), Positives = 134/252 (53%), Gaps = 32/252 (13%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQ--LQQEMVQKVMSHCHEYYRVKSIAA  698
            SF  F + W ++  Q + +L    +     D+    + + ++++VM H   YYRVKS   
Sbjct  25   SFGEFFKKWMKEQNQYLTELISTVKGGGNKDNDGDIVAEALMKRVMEHYEHYYRVKSHWV  84

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            ++D LG+ +  W +S E +  W+GGWRPT  FHL+Y++S +  E  ++D++ GL  GDL 
Sbjct  85   EKDALGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGDLA  144

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQD----------------------GGSD-  407
            DL+  Q+ ++  LQ   V++E  I ++++ +Q+                      GG + 
Sbjct  145  DLSSHQVVKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMETSGGGEQ  204

Query  406  ---IIGMMSGKLD----AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQL  248
                + M+  +L      K + L E+++ AD+LR+ T+  ++ +LT+ Q V FLIAAA+L
Sbjct  205  NNRDLSMVEEELKLALAGKEDGLKEVVKMADELRLGTLKQIIGILTSTQRVHFLIAAAEL  264

Query  247  MFGIRRWGINHD  212
               I  WG+  D
Sbjct  265  HLRIHEWGLKRD  276



>ref|XP_002985809.1| hypothetical protein SELMODRAFT_123200 [Selaginella moellendorffii]
 gb|EFJ12986.1| hypothetical protein SELMODRAFT_123200 [Selaginella moellendorffii]
Length=245

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 124/229 (54%), Gaps = 16/229 (7%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            S+  F++ W       +QQL +  R   +       + +V K   H   YY  K  AAK+
Sbjct  11   SYTDFYDDWS---NTQLQQLEELERALNSNMSESEIKALVDKAKMHYDYYYGAKDNAAKQ  67

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            ++L V T  W T LE +  W GGWRPT VF L Y  +  L E+ + ++L G+ +  L  L
Sbjct  68   NVLQVMTPAWKTPLETAFMWTGGWRPTMVFQLAYALAGQLVEAELSELLSGVDSPSLASL  127

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGM-----------MSGKLDAK  371
            +  QL R++E+Q +  ++E+ I+ +++  Q G +D   +G+           M   LD+K
Sbjct  128  SARQLERINEMQVKVQKQEDDISHRMAVLQQGMADQPFVGITQTLAASEDDKMEAALDSK  187

Query  370  MEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
            ++ L  +LE+AD LR +T+ N+++ LT  QA ++L+AAAQL    R+ G
Sbjct  188  LKDLESLLEEADNLRRETLHNMLDTLTPVQAAQYLVAAAQLQVAFRKIG  236



>ref|XP_004156023.1| PREDICTED: transcription factor TGA6-like [Cucumis sativus]
 gb|KGN54766.1| hypothetical protein Csa_4G463190 [Cucumis sativus]
Length=255

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 136/253 (54%), Gaps = 34/253 (13%)
 Frame = -1

Query  880  KKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            +++SF  F + W ++  Q + +L    +      ++ + + ++++VM H   YY+VKS  
Sbjct  3    QEISFGEFFQKWMKEQNQYLTELISTAKGG----NNMVAEALMKRVMEHYEHYYKVKSRW  58

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             ++D LG+ +  W +S E +  W+GGWRPT  FHL+Y++S +  E  ++D++ GL  GDL
Sbjct  59   VEKDTLGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGDL  118

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQD-------------------GGSDIIG  398
             DL+  Q+ ++  LQ   V++E  I ++++ +Q+                   G S   G
Sbjct  119  ADLSSHQVIKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMGTSGGGG  178

Query  397  MMSGKLDAKMEK-----------LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQ  251
               G+L+   E+           L E+++ AD+LR++T+  ++ +LT  Q V FLIAAA+
Sbjct  179  QNDGELNMVEEELKLALATKECGLKEVVKMADELRLETLKQIIGILTLTQRVHFLIAAAE  238

Query  250  LMFGIRRWGINHD  212
            L   I  WG+  D
Sbjct  239  LHLRIHEWGLKRD  251



>ref|XP_002441508.1| hypothetical protein SORBIDRAFT_09g028290 [Sorghum bicolor]
 gb|EES19938.1| hypothetical protein SORBIDRAFT_09g028290 [Sorghum bicolor]
Length=231

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 130/229 (57%), Gaps = 13/229 (6%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDI  686
            + FH  WF  LR L + L  A     + D       +V + ++H   Y   +   A  D 
Sbjct  10   RRFH-LWFRGLRSLRRDLASA---RWSDDAAAQLPALVGRFVAHLESYCAAR---AGLDP  62

Query  685  LGVFTAPWATSLER-SLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +   +APWAT  ER + +W+ GWRPTT+ HL+YTES    E+ + D+L G+R+G+LGDLT
Sbjct  63   VWTLSAPWATPAERGAAYWLAGWRPTTLVHLLYTESGRRLEAQLPDLLLGVRSGNLGDLT  122

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMM---SGKLD-AKMEKLAE-ILE  344
            P QL +V +LQ  TV EE+ +A +++  Q+G   +       SG LD A + + A  +L+
Sbjct  123  PAQLAQVDDLQRRTVAEEDALAREMALVQEGHGVVAAPSADGSGLLDVAGLVRTARAVLD  182

Query  343  KADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            +AD LR++T+   VE+L   QA E L+AAA L  G R +G+ H   R+ 
Sbjct  183  RADALRLRTVKRAVEILEPAQAAELLVAAADLEIGFREFGLKHGSGRDG  231



>ref|XP_008806140.1| PREDICTED: transcription factor TGA7-like [Phoenix dactylifera]
Length=277

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/241 (34%), Positives = 127/241 (53%), Gaps = 30/241 (12%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPA----------TTADHHQLQQEMVQKVMSHCHEYY  719
            F  F + W  QL + ++ L  A  P+             D HQL+  +V+ V+ H   YY
Sbjct  11   FAHFFDCWLGQLDRDLRALLAADEPSLDTRHHPHDDANDDEHQLRS-LVEMVLGHYEYYY  69

Query  718  RVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrg  539
            R K  +A+RD+L +F+  WA+S E+   W GGWRP+  F L+Y+E     E  +  +   
Sbjct  70   RAKLASARRDVLTIFSTAWASSTEKLFLWAGGWRPSAAFQLLYSELGRRIERCL--VQGV  127

Query  538  lrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQ----------------DGGSD  407
            LR  DL  L+  QL +V  LQ +T++ E  I+++ +  Q                + G +
Sbjct  128  LRVQDLTRLSALQLEQVDRLQRKTIKTERKISEEEAKAQELVAWPQMVEISHEITESGRE  187

Query  406  IIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
            +  M  G + AK E +  +LE+ADQLRM+TI  +V +L  +QAV+FL AA +L+  + R+
Sbjct  188  VAAMEEGLVGAK-EAMKRVLERADQLRMETIKGVVGILRPRQAVQFLAAAGKLLLRVHRF  246

Query  226  G  224
            G
Sbjct  247  G  247



>ref|XP_007048544.1| TGACG-sequence-specific DNA-binding protein TGA-2.1, putative 
[Theobroma cacao]
 gb|EOX92701.1| TGACG-sequence-specific DNA-binding protein TGA-2.1, putative 
[Theobroma cacao]
Length=245

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 136/232 (59%), Gaps = 24/232 (10%)
 Frame = -1

Query  880  KKMSFQSFHETWFEQLRQLVQQLGQAPRPA-TTADHHQLQQEMVQKVMSHCHEYYRVKSI  704
            ++ +FQ+F E W  +  Q +Q+L  A +   +TAD   L   ++++V+ +   YY+ K+ 
Sbjct  11   ERETFQNFFECWLVEQNQHLQELIAASQQHHSTADDDSLCS-LIKRVLENYEHYYKAKAR  69

Query  703  AAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngd  524
              K D+L + +  W ++ + +  WIGGWRP   FHL+Y +S +  E  + +++RG+  GD
Sbjct  70   WGKEDVLAMLSPAWTSTFKDAFLWIGGWRPIMAFHLLYFKSGLQLEDQLNELIRGMGRGD  129

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-----IIGMMSGK--------  383
            LGDL+P QL R+ ELQ +T++EE  + ++++  Q+  +D     +  ++SG         
Sbjct  130  LGDLSPCQLSRIDELQAKTIKEEKEVTEKMAKHQETVADSSMLELNHLVSGNDEERGWGR  189

Query  382  ---------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAA  254
                     ++ K E L E+L++AD LR++T+  ++++LT  QAV FLIAAA
Sbjct  190  CGSGEGESAMECKEEGLKEMLQRADDLRLRTLKAVIDILTPIQAVHFLIAAA  241



>ref|XP_008227573.1| PREDICTED: transcription factor TGA2-like [Prunus mume]
Length=272

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 134/266 (50%), Gaps = 35/266 (13%)
 Frame = -1

Query  883  IKKMSFQSFHETWFEQLRQLVQQL----------GQAPRPATTADHHQLQQEMVQKVMSH  734
            ++  SF +F E W  +  Q +Q L          G     A    +  L+  +V++V+ H
Sbjct  8    VEHESFHNFFECWLAEQNQHLQDLIIASKNNLYNGNPTTTAAANTNTSLRT-LVERVVKH  66

Query  733  CHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIM  554
              +YY  KS   K+D+L + +  W TSLE +  WIGGWRP+  FHL Y++S +  E+ + 
Sbjct  67   YEQYYEAKSRWVKQDVLRMLSPSWTTSLEDAFLWIGGWRPSMTFHLFYSKSGLQLEARLT  126

Query  553  DIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD---------II  401
            +++ GL  GDL D++  QL +V  LQ  TV+EE  I ++++  Q+  +D         I 
Sbjct  127  ELIEGLGTGDLADISQHQLMQVDHLQRRTVKEERDITEKMAKQQESVADTSTVELSHVIT  186

Query  400  GMMSGK---------------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFL  266
             +MS                 L +K   L EIL++AD LR+KT+  +  +LT  QAV F 
Sbjct  187  ELMSANGGHEHEVEADRVESVLASKERGLEEILQRADSLRLKTLKAITHILTPIQAVHFF  246

Query  265  IAAAQLMFGIRRWGINHDRQRENNVS  188
            IAAA+L   +  WG   D     N S
Sbjct  247  IAAAELHLRLHDWGKKEDASSRGNSS  272



>ref|XP_006380400.1| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
 gb|ERP58197.1| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
Length=277

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 135/253 (53%), Gaps = 33/253 (13%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQ---------QEMVQKVMSHCHEYY  719
            +F+ F E W  +    ++QL  + +     DH++           Q ++ +V+ H   YY
Sbjct  24   TFRKFFECWLAEQNNYLEQLISSCK---DYDHNKKNSPQSSQATLQPLINRVLEHYEYYY  80

Query  718  RVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrg  539
            R KS  AK D+L + +  W ++LE +  WIGGWRP+  FHL+Y++S    E+ + +++ G
Sbjct  81   RAKSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLEAQLHELICG  140

Query  538  lrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGM------------  395
            L  GDLGDL+ +QL RV +LQ +T++EEN + ++    Q+  +D   +            
Sbjct  141  LGTGDLGDLSGSQLTRVDQLQRKTIREENELTEKHVKHQETVADSSMVELAHEVTELLRS  200

Query  394  ---------MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMF  242
                     +   L  + + L EIL+ AD LR++TI  ++++LT  QAV FLIAAA+L  
Sbjct  201  ENTGTDEERVESTLAPRKDGLQEILQMADDLRVRTIKGVIDILTPIQAVHFLIAAAELHL  260

Query  241  GIRRWGINHDRQR  203
             +  WG   D  R
Sbjct  261  RLHDWGKKGDWAR  273



>gb|EYU23363.1| hypothetical protein MIMGU_mgv1a023034mg [Erythranthe guttata]
Length=292

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/256 (34%), Positives = 134/256 (52%), Gaps = 30/256 (12%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRP--------ATTADHHQLQQEMVQKVMSHCHEYY  719
            +SF  F ++W  +    +Q+L  A +         A       +   +V++V+ H   YY
Sbjct  23   VSFHMFFDSWIVEQNHHLQKLVSASKEWGGGGGGVAFDVSGRSVLIPVVEQVVHHYEHYY  82

Query  718  RVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMD--Il  545
            + KS+ AK+DIL +F+  W  SLE++  W+GGWRP T  HL+Y++  +  E+      + 
Sbjct  83   KTKSMWAKKDILSMFSPTWTHSLEKAFMWVGGWRPATAIHLLYSKCGLQLEAAFEGDYLP  142

Query  544  rglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGM--------  395
            RGL  GDLGDL+ +Q+ RV EL   T+ EE  I ++L+  Q+    S ++G+        
Sbjct  143  RGLNTGDLGDLSHSQMVRVDELHKSTLWEEKMITEKLAKQQETIADSSMVGLTTELMIRV  202

Query  394  ----------MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLM  245
                      +   L +K + L  IL+ AD LR+KT+  L+ +LT  Q V FLIAAA+L 
Sbjct  203  EEHDHDQQVVVDAALASKEKGLVVILQMADDLRLKTLKGLILILTPIQGVHFLIAAAELH  262

Query  244  FGIRRWGINHDRQREN  197
              I  WG N D  R +
Sbjct  263  LKIHEWGKNRDASRNH  278



>ref|XP_007214751.1| hypothetical protein PRUPE_ppa024940mg [Prunus persica]
 gb|EMJ15950.1| hypothetical protein PRUPE_ppa024940mg [Prunus persica]
Length=277

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 135/267 (51%), Gaps = 39/267 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQ---------------QEMVQKVMS  737
            SF +F E W  +  Q +Q L  A     T  ++                  + +V++V+ 
Sbjct  11   SFHNFFECWLSEQNQHLQDLIIASENNQTTRNNLYNGNTTTTAAANTNTSLRTLVERVVK  70

Query  736  HCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHI  557
            H  +YY  KS   K+D+L + +  W TSLE +  WIGGWRP+  FHL Y++S +  E+ +
Sbjct  71   HYEQYYEAKSRWVKQDVLRMLSPSWTTSLEDAFLWIGGWRPSMAFHLFYSKSGLQLEARL  130

Query  556  MDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI----IGMMS  389
             +++ GL  GDL D++  QL +V  LQ  TV+EE  I ++++  Q+  +D     +  M+
Sbjct  131  TELIEGLGTGDLADISQHQLMQVDHLQRRTVKEERDITEKMAKQQESVADTSMVELAHMT  190

Query  388  GKL--------------------DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEF  269
             +L                     +K + L EIL++AD LR+KT+  +  +LT  QAV F
Sbjct  191  TELMSTNGGHEHEAEEDRVECVVASKEQCLEEILQRADSLRLKTLKAITHILTPIQAVHF  250

Query  268  LIAAAQLMFGIRRWGINHDRQRENNVS  188
            LIAAA+L   +  WG   D +   N S
Sbjct  251  LIAAAELHLRLHDWGKKEDARSRGNSS  277



>ref|XP_002984747.1| hypothetical protein SELMODRAFT_181239 [Selaginella moellendorffii]
 gb|EFJ13997.1| hypothetical protein SELMODRAFT_181239 [Selaginella moellendorffii]
Length=245

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 123/228 (54%), Gaps = 16/228 (7%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            +  F++ W       +QQL +  R   +       + +V K   H   YY  K  AAK++
Sbjct  12   YTDFYDDWS---NTQLQQLEELERALNSNMSESEIKALVDKAKMHYDYYYGAKDNAAKQN  68

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +L V T  W T LE +  W GGWRPT VF L Y  +  L E+ + D+L G+ +  L  L+
Sbjct  69   VLQVMTPAWKTPLETAFMWTGGWRPTMVFQLAYALAGQLVEAELSDLLSGVDSPSLASLS  128

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGM-----------MSGKLDAKM  368
              QL +++E+Q +  ++E+ I+ +++  Q G +D   +G+           M   +D+K+
Sbjct  129  ARQLEKINEMQVKVQKQEDDISHRMAVLQQGMADQPFVGITQTLAASEDDKMEAAVDSKL  188

Query  367  EKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
            + L  +LE+AD LR +T+ N+++ LT  QA ++L+AAAQL    R+ G
Sbjct  189  KDLESLLEEADNLRRETLHNMLDTLTPVQAAQYLVAAAQLQVAFRKIG  236



>ref|NP_001152723.1| tumor-related protein-like [Zea mays]
 gb|ACG49152.1| tumor-related protein-like [Zea mays]
 gb|AFW79131.1| tumor protein-like protein [Zea mays]
Length=232

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 129/232 (56%), Gaps = 14/232 (6%)
 Frame = -1

Query  877  KMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            + + + FH  WF  LR L + L  A     + D        V + ++H   Y   +   A
Sbjct  6    EAAARRFH-LWFRGLRSLRRDLASA---RWSDDPTAQLPAQVGRFVAHLESYCAAR---A  58

Query  697  KRDILGVFTAPWATSLER-SLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
              D +   +APWAT  ER + +W+ GWRPTT+ HL+YTES    E+ + D+L G+R+G+L
Sbjct  59   GLDPVWTLSAPWATPAERGAAYWLAGWRPTTLVHLLYTESGRRLEAQLPDLLLGVRSGNL  118

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMM----SGKLDAK--MEKL  359
            GDLTP QL +V +LQ  TV EE+ +A +++  Q+G   ++       SG LD    + + 
Sbjct  119  GDLTPAQLAQVDDLQRRTVAEEDALAREMALVQEGHGVVVLPAAPDGSGGLDVAGLVRRA  178

Query  358  AEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
              +L++AD LR++T+   VE+L   QA E L+AAA L  G R +G+ H   R
Sbjct  179  RAVLDRADALRLRTVKRAVEILEPAQAAELLVAAADLEIGFREFGLKHGSGR  230



>ref|NP_001056306.1| Os05g0560200 [Oryza sativa Japonica Group]
 dbj|BAF18220.1| Os05g0560200 [Oryza sativa Japonica Group]
Length=223

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 130/224 (58%), Gaps = 9/224 (4%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDI  686
            + FH  W   LR L ++L    R A  AD       +V + ++H   Y   +   A+ D 
Sbjct  8    RRFH-LWLRGLRGLRREL----RAARWADDPAQLGSLVGRFVAHVECYTAAR---AEMDP  59

Query  685  LGVFTAPWATSLER-SLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +   +APWA+ +ER + +W+ GWRPTT+ HL+YTES   FE+ + D+L G+ +G+LGDL+
Sbjct  60   VWTLSAPWASPVERGAAYWLAGWRPTTLVHLLYTESGRRFEAQLPDLLLGVSSGNLGDLS  119

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQL  329
            P+QL ++ +LQ  TV EE+ ++ +++  Q+G   +       +D  + ++  +L +AD L
Sbjct  120  PSQLAQIDDLQRRTVAEEDGLSREMALVQEGHGAVAVGGGIDVDGIVGRVRGVLGRADAL  179

Query  328  RMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            R++T+   VE+L   QA E L+AAA +  G R +G+ +   R +
Sbjct  180  RLRTVKRAVEILEPAQAAELLVAAADMEIGFREFGLKYSSARSD  223



>ref|XP_008442174.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
Length=281

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 134/253 (53%), Gaps = 33/253 (13%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQ--LQQEMVQKVMSHCHEYYRVKSIAA  698
            SF  F + W ++  Q + +L    +     D+    + + ++++VM H   YYRVKS   
Sbjct  25   SFGEFFKKWMKEQNQYLTELISTVKGGGNKDNDGDIVAEALMKRVMEHYEHYYRVKSHWV  84

Query  697  KRDIL-GVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            ++D L G+ +  W +S E +  W+GGWRPT  FHL+Y++S +  E  ++D++ GL  GDL
Sbjct  85   EKDALAGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGDL  144

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQD----------------------GGSD  407
             DL+  Q+ ++  LQ   V++E  I ++++ +Q+                      GG +
Sbjct  145  ADLSSHQVVKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMETSGGGE  204

Query  406  ----IIGMMSGKLD----AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQ  251
                 + M+  +L      K + L E+++ AD+LR+ T+  ++ +LT+ Q V FLIAAA+
Sbjct  205  QNNRDLSMVEEELKLALAGKEDGLKEVVKMADELRLGTLKQIIGILTSTQRVHFLIAAAE  264

Query  250  LMFGIRRWGINHD  212
            L   I  WG+  D
Sbjct  265  LHLRIHEWGLKRD  277



>gb|EYU45430.1| hypothetical protein MIMGU_mgv1a012463mg [Erythranthe guttata]
Length=250

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 126/246 (51%), Gaps = 35/246 (14%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            +SF  F ++W  +    +Q+L  A   + +A        ++  V+ H   YY+ KS+ AK
Sbjct  19   VSFHMFFDSWIVEQNHQLQELVSAASASASA---SEASVLIPLVVQHYEHYYKTKSMWAK  75

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
            +DIL +F   W +SLE++  W+GGWRPT  FHL+Y++  + F+               G+
Sbjct  76   KDILSMFRPSWRSSLEKAYMWVGGWRPTMTFHLLYSKCGLQFQD-------------TGN  122

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQD----------------GGSDII---GMM  392
            L+ +Q+ RV +L   T+ +E  I ++L+  Q+                GG  ++   G++
Sbjct  123  LSHSQMERVDKLHKTTLWKEKMITEKLAKLQETMADSSMVELTDHSRHGGDQVVHHQGLV  182

Query  391  SGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
               L  K + L  IL+ AD+LR+ T+ +L+ +L+  Q V FLIAAA+L   +  WG   D
Sbjct  183  DAALAPKEKGLVGILQMADELRLNTLKDLILILSPIQGVYFLIAAAELHLRMHDWGKKRD  242

Query  211  RQRENN  194
                +N
Sbjct  243  DDASHN  248



>ref|XP_008807787.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=216

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 115/232 (50%), Gaps = 34/232 (15%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
             ++F + W   L +L  +L  APR     D   + + +V + ++H  +YY  K+  A RD
Sbjct  1    MEAFFDAWIAGLEELQNELLSAPR-----DRPDVLRPLVARALAHHQDYYHQKARLAARD  55

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYT--ESSILFESHIMDIlrglrngdlgd  515
            +L VF+  W T  ERS  WI GW+P+  F L+ +  +      SH               
Sbjct  56   VLRVFSPRWLTPFERSFLWIAGWKPSIAFRLLRSLDDDDDGDASH---------------  100

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGG------SDIIGMMSGKLDAK-----M  368
             +P Q R V+ LQ ET   E  +++ ++  Q+        +   G+ +G+  A+     +
Sbjct  101  -SPEQRRAVAVLQRETASAERALSEDMARAQEAMALPQVLAAARGVRNGEARAEAAEMVV  159

Query  367  EKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
              L  +L  AD LR +T+T LV++LT  Q V+FL+AAAQL   + RWG+  D
Sbjct  160  RSLELLLASADALRARTVTRLVDILTPAQTVDFLLAAAQLRLRVHRWGMRRD  211



>ref|XP_010922993.1| PREDICTED: uncharacterized protein LOC105046169 [Elaeis guineensis]
Length=562

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 127/241 (53%), Gaps = 30/241 (12%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADH----------HQLQQEMVQKVMSHCHEYY  719
            F  F E W  QL + +Q L  A  P+    H          H L+  +V  V  H   YY
Sbjct  7    FAHFFECWLGQLDRDLQALLAADVPSLDPQHQPHSDANNNEHHLRS-LVDMVKGHYEYYY  65

Query  718  RVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrg  539
            R K  +A+RD+L +F+  WATS E+   W GGWRP   F ++Y+ES    E  +  +   
Sbjct  66   RAKLASARRDVLAIFSPAWATSTEKLFLWAGGWRPGAAFQILYSESGRRVEPWL--VQGV  123

Query  538  lrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD----------------GGSD  407
            LR+ DL  L+  QL RV +LQ  T++ E  I+++ ++ Q+                 G +
Sbjct  124  LRDDDLAGLSALQLERVDQLQRRTLETERMISEEEAEAQELVAWPQMMEISHEITVSGLE  183

Query  406  IIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
            +  M  G + AK E +  +LE+ADQLR++TI ++V +L+ +QAV+FL AA +L+  +  +
Sbjct  184  VAAMEDGLVGAK-EAMRRVLERADQLRLETIQSVVGILSPRQAVQFLAAAGKLLLRVHEF  242

Query  226  G  224
            G
Sbjct  243  G  243



>ref|XP_010093103.1| hypothetical protein L484_007912 [Morus notabilis]
 gb|EXB53541.1| hypothetical protein L484_007912 [Morus notabilis]
Length=292

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 127/259 (49%), Gaps = 39/259 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SFQ F E W     Q +Q+L  A +   +A      + ++++V+ H   YYR K+  ++R
Sbjct  24   SFQKFFECWLSGQNQHLQELISAAKSPASAADEAALRSLIERVVKHYECYYRAKATWSRR  83

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFE-----SHIMDIlrglrng  527
            D+L + T  W ++LE +  WIGGWRP+  FHL+Y++S +  E     S +++ +      
Sbjct  84   DVLAMLTPSWRSTLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAPGRLSELINAMTTTTAT  143

Query  526  dl------gdLTPTQLRRVSELQCET-----------------------VQEENYIADQL  434
                     D++P QL RV  LQ  T                       V+  + +++Q+
Sbjct  144  ATAIREDLADISPEQLSRVDGLQRRTIKEEKEISEEMAKRQETLAAPDIVELSHVVSEQM  203

Query  433  SDWQDGGSD-----IIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEF  269
            +    G  D         +   L  K + L E+LE+AD+LR++T+ +++ LLT  QAV F
Sbjct  204  TAGGGGSRDGDEEEEEERVETALKPKEKGLEEVLERADELRLRTLKDVIHLLTPIQAVHF  263

Query  268  LIAAAQLMFGIRRWGINHD  212
            LIAAA+L   I  WG   D
Sbjct  264  LIAAAELHLRIHEWGKKRD  282



>ref|XP_010104546.1| hypothetical protein L484_025521 [Morus notabilis]
 gb|EXC01147.1| hypothetical protein L484_025521 [Morus notabilis]
Length=235

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/260 (30%), Positives = 130/260 (50%), Gaps = 47/260 (18%)
 Frame = -1

Query  916  NTHNSKN*RN*IKKMSFQSFHETWFEQLRQLVQQLG-QAPRPATTADHHQLQQEMVQKVM  740
            N  NS++         F++F+E W    + ++ QL   A   A   +  + ++ ++++ +
Sbjct  5    NEPNSRD--------RFEAFYEEWLAGQQAILNQLLLVAAETAEKDNDCERRRSLIEQSL  56

Query  739  SHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESH  560
            SH   Y+  ++  A  D+  VF++PW +SLER+  WI G+RPT +  L+        ES 
Sbjct  57   SHYQRYFEERNDIASDDVFVVFSSPWLSSLERAYLWIAGYRPTLILRLV--------ESG  108

Query  559  IMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDG------------  416
            + D+            +P Q RR+  L+ E V+ E  +++ ++  Q+             
Sbjct  109  VADL------------SPEQARRMDRLKAEAVRLEQEVSEAMAAVQESVAARPLVALVSR  156

Query  415  -GSDIIGMMSGKLDAKMEKL-AE---ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQ  251
             G  + G +S  +D  M++L AE   +LE AD LR  T+   +E+L+  QAV+FL+AAA+
Sbjct  157  MGRAVDGEVSA-IDVAMDRLRAEMVGVLESADALRGSTMRRAIEVLSPAQAVKFLVAAAE  215

Query  250  LMFGIRRWGINHDRQRENNV  191
                IRRWG   D  RE  V
Sbjct  216  FQLRIRRWGQQRDSNREPAV  235



>ref|XP_009379553.1| PREDICTED: transcription factor TGA6-like [Pyrus x bretschneideri]
Length=285

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 120/221 (54%), Gaps = 29/221 (13%)
 Frame = -1

Query  760  EMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTES  581
            ++V++V+ H   YY VKS  AK+D+LG+ +  W +SLE +  WIGGWRP+  FHL +++S
Sbjct  64   KLVERVVKHYEHYYEVKSRWAKQDVLGMLSPSWLSSLEDAFLWIGGWRPSMAFHLFHSKS  123

Query  580  SILFESHIMD----IlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGG  413
             +  E+ + +           G+L DL+  QL ++ ++Q  TV+EE  I+++++  Q+  
Sbjct  124  GLQLEARVSEFIRGFCSSSSKGNLADLSSHQLTQMDQMQQRTVKEERDISEKMAKRQEAV  183

Query  412  SD------------IIGMMSGK-------------LDAKMEKLAEILEKADQLRMKTITN  308
            +D            ++   SG              L +K + L EIL +AD LR++T+ +
Sbjct  184  ADSSMVNLSHVITELMNAGSGDDPVAEEDPRVESALASKEQGLEEILHRADNLRLRTLKS  243

Query  307  LVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNVSQ  185
            +  +LT  QAV FLIAAA+L   +  WG   D     + SQ
Sbjct  244  VTHILTPIQAVHFLIAAAELHLRVHDWGKEKDATSHAHSSQ  284



>gb|EYU43340.1| hypothetical protein MIMGU_mgv1a020768mg, partial [Erythranthe 
guttata]
Length=244

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 121/219 (55%), Gaps = 9/219 (4%)
 Frame = -1

Query  841  EQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPW  662
            ++L +L Q L       TT         ++ K+M+H  EY +++S  A+ D+   F   W
Sbjct  23   QELSELNQALTLTAAGCTTTGAADELSHLIDKIMAHFVEYTQIRSCMAQADVSPYFAPTW  82

Query  661  ATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQLRRVSE  482
             TSLERS+ WIGG RP++   LIY  S +  ES + + LRG R G+LG L+  Q+  V E
Sbjct  83   CTSLERSVLWIGGCRPSSFIRLIYALSGLEIESRLSEFLRGARIGNLGGLSGDQIFMVDE  142

Query  481  LQCETVQEENYIADQLSDWQDGGSD-----IIGMMSGKLDAKMEK----LAEILEKADQL  329
            LQ  T+ EE  ++ +++  Q+   D     I     G LDA ++     +AE+L +ADQL
Sbjct  143  LQGRTIGEERKLSTRMASLQEDLLDHPLASIAVKSEGNLDAALDDHGRAMAEMLAEADQL  202

Query  328  RMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            R+ ++  L+ +LT +QAV+F+ A  +L   ++ WG   D
Sbjct  203  RLSSLKELIGILTPRQAVDFMAAGKKLRLCMQDWGKKRD  241



>ref|XP_009792490.1| PREDICTED: uncharacterized protein LOC104239538 [Nicotiana sylvestris]
Length=246

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/240 (33%), Positives = 130/240 (54%), Gaps = 23/240 (10%)
 Frame = -1

Query  865  QSFHETWF----EQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            +S HE+W     E+L +L Q   Q        D H+L Q ++ K++++  +Y   +S  A
Sbjct  13   ESLHESWLNLQHEELIELEQAAAQIKN--GVKDDHKLTQ-LIAKIINNFQDYCNNRSRLA  69

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            K+D+   F     T  E S+ WIGG RP++   LIY  S +  ESH+++ L G++ G+  
Sbjct  70   KKDVSPFFAPKSCTPFENSVLWIGGCRPSSFIRLIYALSGMEIESHLIEFLEGIKTGEFH  129

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIG------MMSGK------LDA  374
             LT  Q+  + +LQ +T+QEE  +  +L+  Q+   DI+       MM  +      LD 
Sbjct  130  GLTIEQMTVIDKLQTKTIQEERKLCSKLASLQE---DIVDQPLASKMMKDQENADEDLDK  186

Query  373  KMEKLAEILEKADQLRMKTITNLVE-LLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
                +A ++E+AD+LRMKT+  +V  L+T  QAVE+L AA ++   +++WG   D +  N
Sbjct  187  HSHNMATVMEEADKLRMKTLKQIVSILITPAQAVEYLAAAKRIRLCLKQWGKKRDHEHTN  246



>dbj|BAJ05339.1| hypothetical protein [Triticum aestivum]
Length=260

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 117/236 (50%), Gaps = 20/236 (8%)
 Frame = -1

Query  871  SFQSFHETW-FEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            SF  F E W  EQ R L      A      AD  +L    V +V+ H   YYR KS AA 
Sbjct  23   SFAKFFECWILEQSRDLAALRAAATARPDDADLRRL----VDRVLGHYEHYYRAKSAAAS  78

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHI--MDIlrglrngdl  521
             D+L +F   W ++ E    W GGWRPT    L+Y++S +  E+ +        L +GDL
Sbjct  79   ADVLPMFAPSWISATESLYLWCGGWRPTAAIQLLYSKSGVQLEAKLPAFLDGGSLGDGDL  138

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQD-------------GGSDIIGMMSGKL  380
            G L+  QL+   +LQ  T++ E  I +  +  Q+             GG D    M  ++
Sbjct  139  GGLSAEQLQAADQLQRRTIRGEREIEEAAAGAQESLATTKMVELAGKGGVDAAEGMEREM  198

Query  379  DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            DAK E +  +LE AD LR++T+  +V LL   QAV FL+AAA+L   + ++G   D
Sbjct  199  DAKAEAMKRVLEMADALRLETLRGVVGLLRPAQAVHFLVAAAELHLAVHKFGRRKD  254



>ref|XP_009758860.1| PREDICTED: transcription factor TGA3-like [Nicotiana sylvestris]
Length=263

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 126/245 (51%), Gaps = 19/245 (8%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTAD-HHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            +S +ETW    R+ + +L QA   A     + Q   +++QK+ ++  EY   +   A+ D
Sbjct  16   ESLYETWMNLQREELTELEQAATQARNGHINDQELTKLIQKITNNFQEYSNNRKRLAQID  75

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
                F     T LE S+ WIGG RP++    IY+   I  ESH+ +  +G + G+L DLT
Sbjct  76   APTFFAPISCTPLENSVLWIGGCRPSSFIRFIYSLCGIEIESHLTEFFQGTKIGELSDLT  135

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQ--------------DGGSDIIGMMS----GK  383
              Q+  V ELQ +T+ EE  +  +LS  Q              D G D     S     +
Sbjct  136  AKQITMVDELQGKTITEERELCSRLSSLQANIVDQPLPSKLKKDNGDDQGDQYSENAYER  195

Query  382  LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            LD ++ ++A ++E+AD+LRMKT+  +  LLT  QAVE+L AA +L    ++WG   D + 
Sbjct  196  LDEQIHEMATVVEEADELRMKTLQEITSLLTPAQAVEYLAAAKRLRLCFQQWGKKRDHEH  255

Query  202  ENNVS  188
             N ++
Sbjct  256  TNKLN  260



>ref|XP_011085982.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/236 (33%), Positives = 125/236 (53%), Gaps = 21/236 (9%)
 Frame = -1

Query  862  SFHETWFEQLRQLVQQLGQA---PRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F++ W     + + +L +A        TAD    +  +++K+M H  +Y + +S+ A+ 
Sbjct  11   CFYQEWMNLQEEELSELNRAISLNANGRTADAELTR--LIEKIMDHYQDYVQRRSLMARA  68

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+   F   W TSLERS+ WIGG RP++   LIY       ESH+ + LRG+R G LG+L
Sbjct  69   DVSPYFAPTWCTSLERSVLWIGGCRPSSFVRLIYALCGEEIESHLSEFLRGVRIGHLGEL  128

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDG----------------GSDIIGMMSGKL  380
            +  Q+  V ELQ +T++EE  +  +L+  Q+                   ++   +   L
Sbjct  129  SGRQISMVDELQSKTIREERKLCTRLAGLQENVLDHPLASIAVKTRGRSCEVSDNLEDAL  188

Query  379  DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            D     +AEIL +ADQLR+ T+  +V +LT +QAV+FL A  +L   ++ WG  +D
Sbjct  189  DKHGRAMAEILGEADQLRLNTLREVVGILTPRQAVDFLAAGKKLRLCMQDWGKKND  244



>ref|XP_008337157.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
Length=284

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 85/275 (31%), Positives = 134/275 (49%), Gaps = 42/275 (15%)
 Frame = -1

Query  883  IKKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQE------------MVQKVM  740
            +++ SF  F E W  +  Q +  L  A +  TT+                    +V++V+
Sbjct  9    VERESFHRFFECWLAEQNQHLHDLITAAKNNTTSAATNPTTTAXINTSSRSLGTLVERVV  68

Query  739  SHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESH  560
             H   YY VKS   K+D+LG+ +  W +SLE +  WIGGWRP+  FHL +++S +  E  
Sbjct  69   KHYEHYYEVKSRWVKQDVLGMLSPSWLSSLEDAFLWIGGWRPSMAFHLFHSKSGLQLEVR  128

Query  559  IMDIl----rglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIG  398
            + + +         GDL DL+  QL +V ++Q  TV+EE  I+++++  Q+  +D  ++G
Sbjct  129  VAEFIRGFCSSGSKGDLADLSSHQLTQVDQMQQRTVKEERDISEKMAKRQEAVADSSLVG  188

Query  397  --------MMSGK----------------LDAKMEKLAEILEKADQLRMKTITNLVELLT  290
                    M +G                 L +K E L E+L +AD LR+ T+  +  +LT
Sbjct  189  LSHVITELMDAGNGXDDPVAEEDPRVEYALASKEEGLEEVLHRADNLRLXTLKAITHILT  248

Query  289  AQQAVEFLIAAAQLMFGIRRWGINHDRQRENNVSQ  185
              QAV FLIAAA+L   +  WG   D       SQ
Sbjct  249  PIQAVHFLIAAAELHLRLHDWGKKKDATTRAQSSQ  283



>gb|EYU31233.1| hypothetical protein MIMGU_mgv1a023634mg, partial [Erythranthe 
guttata]
Length=216

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 99/161 (61%), Gaps = 6/161 (4%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPR------PATTADHHQLQQEMVQKVMSHCHEYYRVK  710
            +F SF E+W  +    +++L  A +      P+   D   + ++ + +V+ H  +YYR K
Sbjct  12   TFHSFFESWLVEQDHYLEELVSASKRRRVHHPSAADDDDTVLRQKIARVIDHYEQYYRAK  71

Query  709  SIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrn  530
            S  AK D L +F  PW +SLE +  WIGGWRPT  FHL+Y++S +  +  + D+L+GL  
Sbjct  72   STCAKTDALPMFNPPWRSSLEDAFLWIGGWRPTMAFHLLYSKSGLQLQDKLADLLQGLAA  131

Query  529  gdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD  407
            GDL DL+P Q+ ++++LQ  TV+EE  I+++L+  Q+  +D
Sbjct  132  GDLADLSPAQVNQINDLQRATVREEKEISEKLAKQQEKVAD  172



>gb|EEE64671.1| hypothetical protein OsJ_19526 [Oryza sativa Japonica Group]
Length=167

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 106/166 (64%), Gaps = 1/166 (1%)
 Frame = -1

Query  691  DILGVFTAPWATSLER-SLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
            D +   +APWA+ +ER + +W+ GWRPTT+ HL+YTES   FE+ + D+L G+ +G+LGD
Sbjct  2    DPVWTLSAPWASPVERGAAYWLAGWRPTTLVHLLYTESGRRFEAQLPDLLLGVSSGNLGD  61

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKAD  335
            L+P+QL ++ +LQ  TV EE+ ++ +++  Q+G   +       +D  + ++  +L +AD
Sbjct  62   LSPSQLAQIDDLQRRTVAEEDGLSREMALVQEGHGAVAVGGGIDVDGIVGRVRGVLGRAD  121

Query  334  QLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
             LR++T+   VE+L   QA E L+AAA +  G R +G+ +   R +
Sbjct  122  ALRLRTVKRAVEILEPAQAAELLVAAADMEIGFREFGLKYSSARSD  167



>emb|CDM81542.1| unnamed protein product [Triticum aestivum]
 emb|CDM84782.1| unnamed protein product [Triticum aestivum]
Length=260

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 117/236 (50%), Gaps = 20/236 (8%)
 Frame = -1

Query  871  SFQSFHETW-FEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            SF  F E W  EQ R L      A      +D  +L    V +V+ H   YYR KS AA 
Sbjct  23   SFAKFFECWILEQSRDLAALRAAATARPDDSDLRRL----VDRVLGHYEHYYRAKSAAAS  78

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHI--MDIlrglrngdl  521
             D+L +F   W ++ E    W GGWRPT+   L++++S +  E+ +        L +GDL
Sbjct  79   ADVLPMFAPSWISATESLYLWCGGWRPTSAIQLLHSKSGLQLEAQLPAFLDGGSLGDGDL  138

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQD-------------GGSDIIGMMSGKL  380
            G L+  QL+   +LQ  TV+ E  I +  +  Q+             GG D    M  ++
Sbjct  139  GGLSAEQLQAADQLQRRTVRRERAIEEVAAGAQESLATTKMVELAGKGGMDAAEGMELEM  198

Query  379  DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            DAK E +  +LE AD LR++T+  +V LL   QAV FL+AAA+L   +  +G   D
Sbjct  199  DAKAEAMKRVLEMADALRLETLRGVVGLLRPAQAVHFLVAAAELHLAVHEFGRRKD  254



>ref|XP_010274492.1| PREDICTED: transcription factor TGA5-like [Nelumbo nucifera]
Length=248

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 125/237 (53%), Gaps = 21/237 (9%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            + FQS    W  Q +  +++L QA       D H     +V+K + H  EY   +SI A+
Sbjct  13   LCFQS----WIAQQQADLEELLQALTIYKGDDTHL--NLIVEKNIQHFQEYTEKRSILAR  66

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             +    F   W TSLE S  WI G RP+    L+Y+      E+ + + L+G+R G+LG+
Sbjct  67   ENATSFFAPSWCTSLENSFLWIAGCRPSLAIRLVYSLCGSELEAQLNEFLQGVRKGNLGE  126

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-----------IIGMMSGKLDAKM  368
            L+  QL  V++LQC T++EE  ++ Q++  Q+  +D           +IG     +D  +
Sbjct  127  LSARQLSLVNDLQCRTIREEEKLSTQMASLQEDIADQPLLTKANEYGLIGASIEHVDTTL  186

Query  367  EK----LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDR  209
            ++    LA ILE+AD+LR+ T+  L+ +LT  QA + L+AA +L   I  WG   DR
Sbjct  187  DEHALALAGILEEADKLRLSTLKELINILTPLQAADLLVAAKKLHLSIHEWGKRRDR  243



>ref|XP_010277052.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nelumbo nucifera]
Length=243

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 114/236 (48%), Gaps = 35/236 (15%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F+E W  QL   +Q+L   PR  +   H    + +V K ++H  EYY  K  AA  D
Sbjct  9    FSEFYEKWLHQLETNLQELLSVPRDQS---HEAKHRALVIKAVTHYKEYYTAKWAAAHED  65

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            ILG F  PW T LE +  W+  WRP+  F L+++    L  +H+           L  ++
Sbjct  66   ILGFFCPPWLTPLENAYIWMTDWRPSVAFRLVHS----LRHTHV-------PGPSLEHMS  114

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-----------------IIGMMSGKL  380
              QL+R+ EL+     EE  +  ++   Q G +D                 ++G + G +
Sbjct  115  EEQLKRMVELRTRIRSEEQKVEMEMERQQVGLADRRMVELARLATRVRNGEVVGELDGFV  174

Query  379  DAKMEKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
            DA ++ + E LE+    AD LR+K +  ++++LT  Q V+F+ A   L   +RRWG
Sbjct  175  DAALKTVLEGLERVMKTADCLRLKALKGVLDVLTPLQCVDFMAATLMLKIQMRRWG  230



>ref|XP_010920258.1| PREDICTED: transcription factor TGA2 [Elaeis guineensis]
Length=257

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 111/218 (51%), Gaps = 31/218 (14%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            +E+V+K M H  EY   +   A+ D    F  PW T+ E S  W+GG RPT    L+Y  
Sbjct  39   RELVEKSMRHYKEYSEKRRALAREDGPTFFCPPWCTAFENSFLWLGGCRPTLSIRLLYAL  98

Query  583  SSILFESHIMDIlrglrngdl-----gdLTPTQLRRVSELQCETVQEENYIADQLSDWQD  419
            S    E+H+ DIL               L+  QL  V++L C T++EE+ ++ +++  Q+
Sbjct  99   SGYELEAHLDDILAPGGLAAAFQRGLVGLSAAQLATVNDLHCRTLKEEDRLSAKMATLQE  158

Query  418  GGSDI---------------IGMMSGK---LDAKM----EKLAEILEKADQLRMKTITNL  305
              +D                +   SG    ++A M    EKLA ++E+ADQLR+ T+  L
Sbjct  159  DVADKPLLPIAVDRARRRAEVAEGSGGREVVEATMKEHEEKLAGMVEEADQLRVATLRTL  218

Query  304  V-ELLTAQQAVEFLIAAAQLMFGIRRWGINHD---RQR  203
            V E+LT  QAVE L+AA QL   +R+WG   D   RQR
Sbjct  219  VTEILTPLQAVELLVAAKQLQLSVRQWGQRRDLHHRQR  256



>ref|XP_009589153.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A-like 
[Nicotiana tomentosiformis]
Length=254

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 128/251 (51%), Gaps = 26/251 (10%)
 Frame = -1

Query  880  KKMSFQSFHETWF----EQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRV  713
            K    +  +E+W     E+LR+L +Q   AP+ +   +  Q Q  ++ K+++H  +Y   
Sbjct  7    KNNELECLYESWMNLQHEELREL-EQAAAAPKNSPKDEEKQTQ--LIDKIINHFQDYCNN  63

Query  712  KSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE-SSILFESHIMD-Ilrg  539
            +S  AK+D+   F     T LE S+ WIGG RP++   LIY     +  ESHI   +   
Sbjct  64   RSRLAKKDVSPFFAPTSCTPLENSVLWIGGCRPSSFVRLIYALFCGMEIESHITQFLKGI  123

Query  538  lrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGMMSG-------  386
             RNG++ + T  Q+  V ELQ +T++EE  ++ +L+  Q+   D  +I            
Sbjct  124  TRNGEIREFTAKQMNMVDELQNKTIREEGKLSSRLASLQEEIVDQPLISKTKKKKDGDDD  183

Query  385  --------KLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRR  230
                     LD   + +A I+E+AD+LRMKT+  +V +L   QAVE+L AA ++   I++
Sbjct  184  VECENADEPLDKHSKYMAAIMEEADELRMKTLKEIVVILEPAQAVEYLAAAKKIRLCIQQ  243

Query  229  WGINHDRQREN  197
            WG   D    N
Sbjct  244  WGKKRDHDHTN  254



>ref|XP_009762839.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana sylvestris]
Length=255

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 122/234 (52%), Gaps = 21/234 (9%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDI  686
            +S +E+W     + +++L QA    +  D H+ Q ++++K+++H  +Y   +S  A++D+
Sbjct  14   ESLYESWMNLQHEELRELEQAAAANSPKDEHK-QTQLIEKIINHFQDYSNNRSRLAQKDV  72

Query  685  LGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE-SSILFESHIMD-IlrglrngdlgdL  512
               F     T LE S+ WIGG RP++   LIY     +  ESHI   +     NG+L   
Sbjct  73   SPFFAPTSCTPLENSVLWIGGCRPSSFIRLIYALFCGMEIESHITQFLQGITANGELPKF  132

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD------------------IIGMMSG  386
            T  Q+  V ELQ +T++EE  ++ +L+  Q+   D                  +      
Sbjct  133  TAEQMNMVDELQSKTIREEGKLSSRLASLQEAIIDQPLISKSKKKKDDGDDDVVCENADE  192

Query  385  KLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
             LD   + +A I+E+AD+LRMKT+  +V +L   QAVE+L AA ++   +++WG
Sbjct  193  PLDKHNKYMAAIMEEADELRMKTLKEIVVILEPDQAVEYLAAAKKIRLCLQQWG  246



>gb|EYU20277.1| hypothetical protein MIMGU_mgv1a018018mg [Erythranthe guttata]
Length=258

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 120/239 (50%), Gaps = 22/239 (9%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MSFQ       ++L +L+  L      ATT+D+      ++ K      +Y   ++  A+
Sbjct  19   MSFQE------QELTELIHSLNLNKTTATTSDNDAEINALLDKATQSFQDYIERRNRLAR  72

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
            RD    F+  W +S E S+ WI G RP++ F+L Y       +S +   L+  ++ +   
Sbjct  73   RDTSAFFSPRWCSSFESSMLWIAGCRPSSFFNLFYALCGSDIDSRLSQFLQDGKSDEFPQ  132

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-IGMMSGKLDAKM--------EK  362
            L+P+QL  +  LQ  T+ EE  +  Q +  Q   +D+ + +++ KL+           E 
Sbjct  133  LSPSQLVAIDNLQRRTIVEEEKLTSQFASLQQDKADVPLALIARKLEGPQYELNEDVRET  192

Query  361  LAEI-------LEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            +AEI       +E+AD LR++T   +V++L   QA+EF+IAA +L   +R WG   DR+
Sbjct  193  IAEIEKAMVCLMEEADNLRLETFKEMVKILKPVQALEFIIAAKKLRVCVRSWGEERDRE  251



>ref|XP_009599896.1| PREDICTED: transcription factor TGA3-like [Nicotiana tomentosiformis]
Length=261

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 125/245 (51%), Gaps = 21/245 (9%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEM---VQKVMSHCHEYYRVKSIAAK  695
            +S +ETW    R+ + +L  A   A     H   QE+   +QK+ ++  EY   +   A+
Sbjct  16   ESLYETWMNLQREELTELEHAVTQARNG--HMNDQELTKLIQKITNNFQEYSNNRKRLAQ  73

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             D    F     T LE S+ WIGG RP++    IY    I  ESH+ + L+G + G+ G+
Sbjct  74   IDASPFFAPTSCTPLENSVLWIGGCRPSSFIRFIYALCGIEIESHLTEFLQGTKIGEFGE  133

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-----IIGMMSGK-----------  383
            LT  Q+  V ELQ +T++EE  +  +L+  Q+   D      +   SG            
Sbjct  134  LTAKQISMVDELQGKTIKEERELCSRLASLQEHIVDQPVASKLKKDSGDEGNYCENADEL  193

Query  382  LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            LD  + ++A ++E+AD LRMKT+  +  LLT  QAVE+L AA ++    ++WG   DR+ 
Sbjct  194  LDEHIHEMATVVEEADDLRMKTLQEITSLLTPAQAVEYLAAAKRMRLCFQQWGKKRDREH  253

Query  202  ENNVS  188
             N ++
Sbjct  254  TNKLN  258



>ref|XP_010667750.1| PREDICTED: transcription factor HBP-1b(c38)-like [Beta vulgaris 
subsp. vulgaris]
Length=257

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 120/243 (49%), Gaps = 46/243 (19%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHH-QLQQEMVQKVMSHCHEYYRVKSIAAK  695
            +F +F + W E  +  + QL        TA+H  +   +++++V+SH  EYY +K+    
Sbjct  41   TFAAFFKGWLEHQQAFLDQL------VDTAEHEDKNSSQLIEQVLSHYAEYYEMKAQVIW  94

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHL--IYTESSILFESHIMDIlrglrngdl  521
            +D+   F+ PW T +E++  W+GG++P+  F L  +   S ++ E               
Sbjct  95   QDVFVAFSPPWLTPIEKTFLWVGGFKPSLTFCLAEVSNNSDMILE---------------  139

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGMMS--GKL---------  380
                  Q+ +++ L+ ET+  E  + D L+  Q+  G   +I ++   G+L         
Sbjct  140  ------QVEKLASLKAETIWAEKNLVDALASVQESMGSPPLISLVKQYGRLVDGEVSEFA  193

Query  379  ---DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDR  209
               D   E ++ +LE AD LR  T+  ++E+L  +Q ++FL   A+   GIR WG+ +D 
Sbjct  194  DVIDKWKESMSRVLESADNLRRNTVIKVIEILNVKQGLKFLAVVAKYYLGIRAWGLQNDV  253

Query  208  QRE  200
            Q++
Sbjct  254  QKD  256



>ref|NP_001042081.1| Os01g0159000 [Oryza sativa Japonica Group]
 dbj|BAB08196.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF03995.1| Os01g0159000 [Oryza sativa Japonica Group]
 gb|EAZ10627.1| hypothetical protein OsJ_00459 [Oryza sativa Japonica Group]
Length=269

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 105/197 (53%), Gaps = 16/197 (8%)
 Frame = -1

Query  757  MVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESS  578
            +V +V+ H   YYR KS AA  D+L +F+  W ++ E    W GGWRPT   HL+Y++S 
Sbjct  64   LVNRVLGHYEHYYRTKSAAASTDVLRMFSPSWTSTTENLYLWCGGWRPTAALHLLYSKSG  123

Query  577  ILFESH--IMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD-----  419
               E+   +     GL  GDLGDL+  QL+   +LQ  TV +E  I +  +  Q+     
Sbjct  124  AQLETQLPVFLAGGGLGAGDLGDLSAEQLQAADQLQRITVSKEREIENAAASAQESLATV  183

Query  418  --------GGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLI  263
                    GG D  G M  ++ +K + +  +LE AD LR++T+  +V LL   QAV FLI
Sbjct  184  KMVELAGGGGMDAEG-MEMEMRSKADGMRRVLEMADGLRLETMREVVALLRPSQAVHFLI  242

Query  262  AAAQLMFGIRRWGINHD  212
            AAA+L   +  +G   D
Sbjct  243  AAAELHLAVHEFGRRKD  259



>ref|XP_006643777.1| PREDICTED: transcription factor TGA6-like [Oryza brachyantha]
Length=266

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 102/191 (53%), Gaps = 14/191 (7%)
 Frame = -1

Query  757  MVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESS  578
            +V +V+ H   YYR KS AA  D+L +F+  W ++ E    W GGWRPT   HL+Y++S 
Sbjct  59   LVDRVLGHYEYYYRTKSAAASNDVLCMFSPSWTSTTENLYLWCGGWRPTAALHLLYSKSG  118

Query  577  ILFESHIMDIlrglrngdl--gdLTPTQLRRVSELQCETVQEENYIADQLSDWQD-----  419
               E+ +   L G   G    GDL+  QL+   +LQ  TV++E  I + ++  Q+     
Sbjct  119  AQLEAQLPMFLTGGSLGTNDLGDLSAEQLQAADQLQRSTVRKEREIENAVASAQESLATV  178

Query  418  -------GGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIA  260
                   GG   +  M  ++ +K E +  +LE AD LR++T+  +V LL   QAV FLIA
Sbjct  179  KMVALAGGGGMDVEAMETEMKSKAEGMKRVLEMADGLRLETMREVVALLRPSQAVHFLIA  238

Query  259  AAQLMFGIRRW  227
            AA+L   +  +
Sbjct  239  AAELHLAVHEF  249



>gb|EAY72627.1| hypothetical protein OsI_00493 [Oryza sativa Indica Group]
Length=269

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 106/199 (53%), Gaps = 16/199 (8%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            + +V +V+ H   YYR KS AA  D+L +F+  W ++ E    W GGWRPT   HL+Y++
Sbjct  62   RRLVDRVLGHYEHYYRTKSAAASTDVLRMFSPSWTSTTENLYLWCGGWRPTAALHLLYSK  121

Query  583  SSILFESH--IMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD---  419
            S    E+   +     GL  GDLGDL+  QL+   +LQ  T+ +E  I +  +  Q+   
Sbjct  122  SGAQLETQLPVFLAGGGLGTGDLGDLSAEQLQAADQLQRITISKEREIENAAASAQESLA  181

Query  418  ----------GGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEF  269
                      GG D  G M  ++ +K + +  +LE AD LR++T+  +V LL   QAV F
Sbjct  182  TVKMVELAGGGGVDAEG-MEMEMRSKADGMRRVLEMADGLRLETMREVVALLRPSQAVHF  240

Query  268  LIAAAQLMFGIRRWGINHD  212
            LIAAA+L   +  +G   D
Sbjct  241  LIAAAELHLAVHEFGRRKD  259



>ref|XP_008358379.1| PREDICTED: uncharacterized protein LOC103422122 [Malus domestica]
Length=111

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -1

Query  466  VQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTA  287
            V+EEN I++QLS+WQ    ++IG  +  LD  M  L  +L+ AD LR++T+  +VELLT 
Sbjct  22   VKEENAISEQLSEWQAEAFEMIGACT-NLDMNMGSLVSVLKTADDLRLRTVRKIVELLTP  80

Query  286  QQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            QQAVEFLIAAA+L FG+R WG+N DR+R N
Sbjct  81   QQAVEFLIAAAELQFGVRGWGMNQDRRRGN  110



>ref|XP_010316826.1| PREDICTED: transcription factor TGA5-like [Solanum lycopersicum]
Length=279

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 110/205 (54%), Gaps = 15/205 (7%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            +++++K + H  EY   +   A  D+       W T+LE S+ WI G RP++   L+Y  
Sbjct  57   KQLIEKSIKHFQEYIDTRRHLACSDVTAYLAPTWCTTLESSMLWISGCRPSSYIRLLYAM  116

Query  583  SSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-  407
            S   FESH+ + L+G R+G L  L   QL  V ELQ +T+++E+ ++++L+  Q+  +D 
Sbjct  117  SGKEFESHLSNYLQGNRSGHLSGLLTVQLNSVDELQRKTIRQEDQLSNKLASLQEEIADQ  176

Query  406  ---IIGMMSGK-----------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEF  269
               II    G            LD   + L  ++E+AD+LRM T+  L+ +L+  QAV+F
Sbjct  177  PFAIIANEVGNPGEICREAEEALDRHAKFLVNVVEEADKLRMVTLKELINILSPLQAVDF  236

Query  268  LIAAAQLMFGIRRWGINHDRQRENN  194
            LIA+ +L   +  WG   D Q   N
Sbjct  237  LIASKKLHLCVNAWGKKRDHQHGRN  261



>ref|XP_010231035.1| PREDICTED: uncharacterized protein LOC104582592 [Brachypodium 
distachyon]
Length=235

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 123/213 (58%), Gaps = 9/213 (4%)
 Frame = -1

Query  847  WFEQLRQLVQQLGQAPRPATTADHHQLQ-QEMVQKVMSHCHEYYRVKSIAAKRDILGVFT  671
            WF  LR L + L    R A  A     Q  ++    ++H  +Y   +   A+ D + + +
Sbjct  19   WFRGLRSLRRDL----RSARWAGDDPAQLGKLAGGFVAHFSDYCAAR---AELDPVLLLS  71

Query  670  APWATSLER-SLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQLR  494
            APWA+  ER + +W+ GWRPTTV HL+YTESS  FE+ + D+L G+R+G+LGDL+P QL 
Sbjct  72   APWASPAERGAAYWLAGWRPTTVVHLLYTESSRRFEAQLPDLLLGVRSGNLGDLSPAQLA  131

Query  493  RVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTI  314
            ++ ELQ   V EE+ ++ +++  Q+G   + G     ++  + +   ++  AD LR++T+
Sbjct  132  QIDELQRRAVAEEDALSREMARLQEGHGVVGGDGDLDVEGIVRRAGAVVAGADALRLRTL  191

Query  313  TNLVELLTAQQAVEFLIAAAQLMFGIRRWGINH  215
               VE+L   QA E L+A A +  G R +G+ H
Sbjct  192  KRAVEILEPAQAAELLVAMADMEIGFREFGLKH  224



>ref|XP_004148432.1| PREDICTED: transcription factor TGA4-like [Cucumis sativus]
 ref|XP_004166651.1| PREDICTED: transcription factor TGA4-like [Cucumis sativus]
Length=230

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 118/243 (49%), Gaps = 38/243 (16%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F  F+E+W    R  ++QL    + A   +  QL   ++++V++H   Y+   S AA  
Sbjct  10   NFADFYESWLTTQRGFLEQLLHVSQIADYKEERQLG--LIKQVLAHYQLYHEEISKAAGE  67

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  VF+APW TS ER+L WI G++P+ VF L+        +  + D+            
Sbjct  68   DVFRVFSAPWLTSYERTLLWISGFKPSIVFRLV--------DGAVKDL------------  107

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGMM--SGKLD----AKMEKLA  356
            TP Q   V EL+ +  ++E  +A+ ++  Q+      I+G+   +G+L      +ME   
Sbjct  108  TPVQAASVEELKTDVKRKERDLAEAMASLQETVAAPPIVGLARRAGRLVDGEICEMENAI  167

Query  355  E--------ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            E        + + AD LR  T+  ++E+L   Q +  L AA +    IR+WGI  D QR 
Sbjct  168  EELKIGMLGVFDGADSLRGTTMKRVMEILRTDQTLRLLTAATEFQQRIRQWGIQRDSQRP  227

Query  199  NNV  191
              +
Sbjct  228  RTI  230



>gb|KGN62783.1| Transcription factor HBP-1b [Cucumis sativus]
Length=237

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 118/243 (49%), Gaps = 38/243 (16%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F  F+E+W    R  ++QL    + A   +  QL   ++++V++H   Y+   S AA  
Sbjct  17   NFADFYESWLTTQRGFLEQLLHVSQIADYKEERQLG--LIKQVLAHYQLYHEEISKAAGE  74

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  VF+APW TS ER+L WI G++P+ VF L+        +  + D+            
Sbjct  75   DVFRVFSAPWLTSYERTLLWISGFKPSIVFRLV--------DGAVKDL------------  114

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGMM--SGKLD----AKMEKLA  356
            TP Q   V EL+ +  ++E  +A+ ++  Q+      I+G+   +G+L      +ME   
Sbjct  115  TPVQAASVEELKTDVKRKERDLAEAMASLQETVAAPPIVGLARRAGRLVDGEICEMENAI  174

Query  355  E--------ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            E        + + AD LR  T+  ++E+L   Q +  L AA +    IR+WGI  D QR 
Sbjct  175  EELKIGMLGVFDGADSLRGTTMKRVMEILRTDQTLRLLTAATEFQQRIRQWGIQRDSQRP  234

Query  199  NNV  191
              +
Sbjct  235  RTI  237



>ref|XP_010277360.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nelumbo 
nucifera]
Length=275

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 115/239 (48%), Gaps = 36/239 (15%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F +F E W  + +Q + ++  A R        Q  ++++ +V+SH  +Y   KS AA RD
Sbjct  54   FHAFLEGWLVRQQQFLDEIVYAKRFCHDDSREQDLRDLIARVLSHYQQYLGEKSRAAHRD  113

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +  V + PW +SLER+L WIGG+RP  VF L+      L                    +
Sbjct  114  VFLVLSPPWFSSLERALFWIGGFRPGLVFRLVANSVGDL--------------------S  153

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGG-----SDII-----------GMMSGKLD  377
              Q++ +  L+ ET  EE  + ++L+  Q+       S+++           G  +  L+
Sbjct  154  QDQVQWMETLRAETSAEERQLEEELARLQESVVAPPLSELLRRRGRAVNGEEGNANPVLE  213

Query  376  AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            + + +   +L  AD LR  T T ++++L+  Q V FL AAAQL   IRR G   D +RE
Sbjct  214  SMITEFEILLGSADMLRANTATKMIQILSPVQTVSFLAAAAQLQLRIRRLGFQRDAERE  272



>ref|XP_004978119.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Setaria italica]
Length=226

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 122/224 (54%), Gaps = 12/224 (5%)
 Frame = -1

Query  856  HETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGV  677
            +  W   LR L  +L    R A  +++      +V   ++H   Y+  +   A+ D +  
Sbjct  10   YRLWLRGLRSLRGEL----RSARWSNYPAQLAALVGCFVAHLESYHAAR---AELDPVVT  62

Query  676  FTAPWATSLERSL-HWIGGWRPTTVFHLIYTESSILFESHIMDIlrglr-ngdlgdLTPT  503
              APWAT+ ERS  +W+ GWR TT+ HL+YTES    ++ + D+L G+R  G+LGDL P 
Sbjct  63   LCAPWATAAERSAAYWLAGWRSTTLVHLLYTESGRRLQAQLPDLLLGVRWPGNLGDLGPA  122

Query  502  QLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGM---MSGKLDAKMEKLAEILEKADQ  332
            QL RV  LQ   V EE+ ++ +++  Q+G   ++     ++  +   + +L  +L  AD 
Sbjct  123  QLARVDALQRRAVAEEDALSREMARVQEGRGGVVTAGPEVALDMGVLVARLGAVLRGADA  182

Query  331  LRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            LR++T+   VE+L   QA E LIAAA L  G+  +G+ +  + E
Sbjct  183  LRLRTMRQAVEILQPAQAAELLIAAADLEIGLHEFGLKYGGRDE  226



>ref|XP_004293959.1| PREDICTED: uncharacterized protein LOC101299272 [Fragaria vesca 
subsp. vesca]
Length=253

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 129/251 (51%), Gaps = 23/251 (9%)
 Frame = -1

Query  877  KMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            K  F+ + ET    L +L+Q +   P      +  QL+Q +  K ++H  +Y + ++  A
Sbjct  10   KCCFKEWMETQERDLTELLQAVTVEPE-----NIEQLKQ-LAGKCITHFEDYIKKRNKLA  63

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMD-Ilrglrngdl  521
             +DI   F   W +  E SL WI G RP+  F LIY  S    ES++ + +         
Sbjct  64   HKDISAYFAPDWCSPWENSLIWIAGCRPSLFFRLIYALSGSEVESNLTEFLRGTKNGYLG  123

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-IIGMMS------GKLDAKMEK  362
              ++ TQL  V+ LQ +T+ EE  +  +L+  Q+  +D  I M++      G+++ ++EK
Sbjct  124  EVMSSTQLVMVNALQSKTISEEERLTMRLAALQEDIADQPIAMIAKGLSKVGEMNEEVEK  183

Query  361  --------LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
                    + ++LE+AD+LRM T+  ++++LT  Q V+FL+A+ +L   + +WG   D Q
Sbjct  184  ALDDHGQHMVKLLEEADELRMNTLKEVLKILTPLQGVDFLVASKKLHLCVHKWGRQRD-Q  242

Query  205  RENNVSQ*SGD  173
            +   V    GD
Sbjct  243  KHGRVESDEGD  253



>gb|EYU43339.1| hypothetical protein MIMGU_mgv1a024141mg, partial [Erythranthe 
guttata]
Length=199

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = -1

Query  793  ATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRP  614
            AT A+  QL    +++VM+H  +Y + +S  A+ D+   F   W TSLERS+ WIGG RP
Sbjct  35   ATGAELSQL----IERVMAHFVDYMQKRSRMARVDVSPYFAPTWCTSLERSVLWIGGCRP  90

Query  613  TTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQL  434
            ++   LIY    +  ESH+ + LRG R G+LG+LT  Q+  V  LQ +T++EE  ++ ++
Sbjct  91   SSFIRLIYALCGLEIESHLAEFLRGARIGNLGELTAAQVAMVDGLQAKTIREERKLSARM  150

Query  433  SDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQA  278
            +      S++ G +   LD     +AEILE+AD+LR+ ++  L+ +LT  QA
Sbjct  151  AGRS---SEMSGNLEAALDKHGRAMAEILEEADRLRLSSLRELIGILTPPQA  199



>gb|KDP41541.1| hypothetical protein JCGZ_15948 [Jatropha curcas]
Length=232

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 117/242 (48%), Gaps = 40/242 (17%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F++F   W ++L+ L +QL  A   A  A   + ++ ++ +V+SH   YY+VK  AA+ 
Sbjct  7    NFETFFNGWLDRLQALSEQLRIAIE-AENAQRTEYRKYLIDQVLSHYKLYYQVKVNAARE  65

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D       PW +S ER+L W+G + P+ +F LI        +  + D+            
Sbjct  66   DPFLFLNPPWLSSFERTLLWLGDFNPSVIFKLI--------DRSVTDL------------  105

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGMM-----SGKL---------  380
            TP Q+ R+ E++    +EE  ++D ++  Q+      I+ +      SG+L         
Sbjct  106  TPEQIERIKEVKLAIRREERVLSDTMASIQESLASPPILNLARRFGRSGRLIDGEVSEIE  165

Query  379  ---DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDR  209
               D    ++  +LE AD LR  T+  ++E+L+  Q+V F+IAAA     +RR G   D 
Sbjct  166  VAEDMLKTQVHNVLESADALRGLTVAKVLEILSPVQSVTFMIAAADFQLRMRRLGQQTDA  225

Query  208  QR  203
             R
Sbjct  226  LR  227



>ref|XP_009619619.1| PREDICTED: transcription factor TGA2-like [Nicotiana tomentosiformis]
Length=255

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 110/206 (53%), Gaps = 16/206 (8%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            ++++ K + H  +Y   +   A+ D+    +  W T+LE S+ WI G  P++   L+Y  
Sbjct  37   KQLISKSIKHFQDYIDNRRHFARNDVSAYLSPTWCTTLESSMLWISGCHPSSFIRLVYAL  96

Query  583  SSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-  407
            S    ESH+ + L+G R GDL +L+  QL+ V ELQ +T+ +EN ++++L+  Q+  +D 
Sbjct  97   SGRELESHLSNYLQGKRYGDLSELSTIQLKSVDELQMKTISQENRLSNKLASLQEEIADH  156

Query  406  --------------IIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLV-ELLTAQQAVE  272
                          I G     LD   + L  ++E+AD+LRM+T   LV  +LT  QA+E
Sbjct  157  PIAIIANEVGNFAEICGEAEEALDKHAKCLMNVVEEADKLRMETFKELVMNILTPFQALE  216

Query  271  FLIAAAQLMFGIRRWGINHDRQRENN  194
            FL+A+ +L   I  WG   D Q   N
Sbjct  217  FLVASKKLHLCINAWGKKRDLQHGRN  242



>ref|XP_010905699.1| PREDICTED: transcription factor HBP-1b(c38)-like [Elaeis guineensis]
Length=169

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 96/217 (44%), Gaps = 55/217 (25%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDI  686
            ++F + W   L +L  +L  APR     D   L + +V + ++H  +YY  K+  A RD+
Sbjct  2    EAFFDAWIAGLEELQNELLSAPR-----DRPDLLRPLVARALNHYQDYYHEKARLAARDV  56

Query  685  LGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTP  506
            L VF+  W T  ERS HWI GW+P+  F +          S ++ +              
Sbjct  57   LRVFSPRWLTPFERSFHWIAGWKPSLAFPMAL--------SQVLAVA-------------  95

Query  505  TQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLR  326
               RRV + +      E  +                            L  +L  AD LR
Sbjct  96   ---RRVRDGEARGQAAEMVV--------------------------RSLELLLASADALR  126

Query  325  MKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINH  215
             +T+T LV++LT  Q+V+FL+AAAQL   +RRWG+  
Sbjct  127  TRTVTCLVDILTPAQSVDFLLAAAQLRLRVRRWGMRR  163



>ref|XP_006358130.1| PREDICTED: transcription factor TGA1-like [Solanum tuberosum]
Length=280

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 111/206 (54%), Gaps = 16/206 (8%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            +++++K + H  EY   +   A  D+       W T+LE S+ WI G RP++   L+Y  
Sbjct  57   KQLIEKSIKHFQEYMDTRRHLAGSDVTAYLAPTWCTTLESSMLWISGCRPSSYIRLLYAM  116

Query  583  SSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-  407
            S   FESH+ + L+G R+G L  L   QL  V ELQ +T+++E+ ++++L+  Q+  +D 
Sbjct  117  SGKEFESHLSNYLQGNRSGHLSGLLTVQLNSVDELQRKTIRQEDQLSNKLASLQEEIADQ  176

Query  406  ---IIGMMSGK-----------LDAKMEKLAEILEKADQLRMKTITNLV-ELLTAQQAVE  272
               II    G            LD   + L  ++E+AD+LRM+T+  LV  +L+  QAV+
Sbjct  177  PFTIIANEVGNLGEICYEAEEALDRHAKFLMNVVEEADKLRMETLKELVINILSPLQAVD  236

Query  271  FLIAAAQLMFGIRRWGINHDRQRENN  194
            FLIA+ +L   +  WG   D Q   N
Sbjct  237  FLIASKKLHLCVNAWGKTRDHQHGRN  262



>ref|XP_010089698.1| hypothetical protein L484_006320 [Morus notabilis]
 gb|EXB38221.1| hypothetical protein L484_006320 [Morus notabilis]
Length=249

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 107/203 (53%), Gaps = 15/203 (7%)
 Frame = -1

Query  760  EMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTES  581
            ++ QK + H   Y   +S  ++ D+   F+  W T  E SL WI G RP+    LIY   
Sbjct  43   KLAQKAIEHFESYISQRSSLSRNDVASFFSPSWCTPWENSLFWIAGCRPSAFIRLIYALD  102

Query  580  SILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDG-----  416
                ES + +ILRG   GD+GDL+  Q+R V ELQ  T++EE  +  +L+  Q+      
Sbjct  103  GADIESKLSEILRGKTVGDIGDLSARQMRAVDELQRRTIREEERLTARLAGLQEDVADQP  162

Query  415  ------GSDIIGMMSGKLDAKM----EKLAEILEKADQLRMKTITNLVELLTAQQAVEFL  266
                  G D IG MSG+++  +    + +AE+LE+AD+LR+ T+  ++ +L   Q VEFL
Sbjct  163  ISAIAKGVDRIGEMSGEIEKVLNEHEQSMAEVLEEADKLRLNTLKEILGILRPVQGVEFL  222

Query  265  IAAAQLMFGIRRWGINHDRQREN  197
              + +L   +  W    D+ + +
Sbjct  223  AMSKKLHLCVHEWSKKRDQNKHD  245



>ref|XP_010316820.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=248

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 122/235 (52%), Gaps = 13/235 (6%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTA--DHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +  +ETW    R+ V +L QA   A     + ++L Q +++K + +  +Y   +S  A+ 
Sbjct  14   ECVYETWMILQRKEVIELEQAAVQAKNGLKNENELTQ-LIEKTVENFQDYANNRSRLARI  72

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  +      TSLE S+ WI G RP+++    Y    +  ESH+ + L+G + G L +L
Sbjct  73   DVSPLLAPTSCTSLENSILWIAGCRPSSLIRFAYALCGMDIESHLTEFLQGKKVGVLSEL  132

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGMMSGK-------LDAKMEKL  359
            T  Q++ +  LQ +T++EE  ++ +L+  Q+   D    G M          LD     +
Sbjct  133  TNKQMKMIDALQAKTIREETNLSSKLASLQEDAVDQPFAGKMENDCENADDVLDEHSRYM  192

Query  358  AEILEKADQLRMKTITNLV-ELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            A++L  AD+LRMKT+  +V  +L   QAVE+L AA +L    + WG   D +R N
Sbjct  193  ADVLRDADELRMKTLKEIVLNILKPLQAVEYLAAAKRLKHCYKIWGQKRDHRRTN  247



>ref|XP_002272336.1| PREDICTED: transcription factor TGA5-like [Vitis vinifera]
Length=240

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 107/239 (45%), Gaps = 23/239 (10%)
 Frame = -1

Query  871  SFQSFHETWF---EQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
             F+ F   W    E++R L+QQ  +     T  D     QE++ +V++H  EYY+ K   
Sbjct  12   PFEIFFRGWLVRHEEVRLLLQQADERDCDETREDEEARVQELIGRVVAHYAEYYKAKQRV  71

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
             + D++ +F  PW T  ERSL WI G+ P   F L+         +++ D+         
Sbjct  72   VREDVMTLFEPPWLTPFERSLLWIAGFMPGFAFRLVM--------NYVKDLNGEQTRMME  123

Query  520  gdLTPTQLRRVSELQCETVQEENY--------IADQLSDWQDGGSDIIGMMSGKLDAKME  365
               T T    + +L  E V+ +          +A +  +W DG  D +      +   ME
Sbjct  124  QLKTETAAEEI-DLTAELVKVKRSPTMISLVEMAARGREWADGERDAVKEKIDMVKLAME  182

Query  364  KLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNVS  188
             L E    AD LR KT   ++E+L   Q V+FL+A   L   +R WG+  + +  N+ S
Sbjct  183  MLVEC---ADCLRYKTALKIMEILNPSQNVKFLLAITGLQLRVRNWGLQREAESRNDNS  238



>ref|XP_011074300.1| PREDICTED: transcription factor TGA1 [Sesamum indicum]
Length=274

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 42/241 (17%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF SF E W  +    ++QL        T   H+   E++ +V SH  E YR KS AA  
Sbjct  49   SFTSFFERWLSRQEAFLRQL-------ETLHRHRECSEIIPQVFSHYQELYREKSRAAHA  101

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  + +APW TS ERS+ WI G+RP+ +F ++                        G+L
Sbjct  102  DVFLLLSAPWLTSFERSMLWISGFRPSILFPILVNSVG-------------------GEL  142

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGMMS--GKL--------DAKM  368
            +  Q +R+  ++ ET ++E  I   ++  Q+  ++  +  +M   GKL        D  M
Sbjct  143  SAEQRQRIEAVKAETRRKEREITQAMARVQETVAEQPLYSLMRKFGKLVDGEVTEFDTSM  202

Query  367  EKLAE----ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            ++L      ++E AD L+  T   +VE+L+  Q V+FL A A+     RRWG+  D +RE
Sbjct  203  DRLKAAMLVVVENADALQGWTAVEVVEILSPVQGVKFLAAVARFQLQSRRWGVEKDSERE  262

Query  199  N  197
             
Sbjct  263  R  263



>ref|XP_007159877.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
 gb|ESW31871.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
Length=201

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 108/189 (57%), Gaps = 27/189 (14%)
 Frame = -1

Query  679  VFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQ  500
            + +  W +SLE +  WIGGWRP+  FHL+Y++S + FE+ + ++++GLR  DLGDL+ +Q
Sbjct  1    MLSPTWTSSLEDAFLWIGGWRPSMAFHLLYSKSGLQFEARLQELVQGLRTHDLGDLSASQ  60

Query  499  LRRVSELQCETVQEENYIADQLSDWQDGGSD-------------IIGMMSGKLDA-----  374
            + ++ E+Q   + EE  I D ++  Q+  +D             I     G+++      
Sbjct  61   ISQLDEMQKRVILEERQITDLMAGHQETVADASMVELSHVASEMIRANERGEVEESKEFE  120

Query  373  ---------KMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
                     K E L +IL+KAD+LR+ T+  +V +LT +QA+ FLIAAA+L   +  WG 
Sbjct  121  DKVESTLVQKEEGLEKILQKADELRLGTLKAIVNVLTPKQAIHFLIAAAELHLRLHEWGK  180

Query  220  NHDRQRENN  194
              D ++EN+
Sbjct  181  KIDARKENH  189



>dbj|BAJ05340.1| hypothetical protein [Hordeum vulgare]
 dbj|BAJ90591.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99476.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=260

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 84/249 (34%), Positives = 119/249 (48%), Gaps = 20/249 (8%)
 Frame = -1

Query  910  HNSKN*RN*IKKMSFQSFHETW-FEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSH  734
            HN    R      SF  F E W  EQ R L      A      AD  +L    V +V+ H
Sbjct  10   HNGSLARASDGGESFAKFFECWILEQSRDLAALRAAATARPHDADLRRL----VDRVLGH  65

Query  733  CHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHI-  557
               YYR KS AA  D+L +F   W ++ E    W GGWRPT    L+Y++S +  E+ + 
Sbjct  66   YENYYRAKSAAASADVLPMFAPSWISATESLYLWCGGWRPTAAVQLLYSKSGVQLEAQLP  125

Query  556  -MDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQ-------------D  419
                   L +GDLG L+  QL+   +L   T++ E  I +  +  Q              
Sbjct  126  AFLDGGSLGDGDLGGLSAEQLQAADQLHRRTIRREREIEEAAASAQESLATTRMVELAGK  185

Query  418  GGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFG  239
            GG D    M  ++DAK E +  +LE AD LR++T+  +V LL   QAV FL+AAA+L   
Sbjct  186  GGMDAAEGMEREMDAKAEAMKRVLEMADGLRLETLRGVVGLLRPAQAVHFLVAAAELHLA  245

Query  238  IRRWGINHD  212
            + ++G + D
Sbjct  246  VHKFGQHKD  254



>ref|XP_008444975.1| PREDICTED: transcription factor TGA4 [Cucumis melo]
Length=237

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 118/243 (49%), Gaps = 38/243 (16%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F  F+E+W    R L++QL    +     +  QL   ++++V++H   Y+   S A   
Sbjct  17   NFADFYESWLTTQRSLLEQLLHVSQITDYKEERQLG--LIKQVLAHYQLYHEEISKAVSE  74

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+   F+APW TS ER+L WI G++P+ VF L+        +S + D+            
Sbjct  75   DVFRTFSAPWLTSYERTLLWISGFKPSIVFRLV--------DSAVKDL------------  114

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGMM--SGKL-DAKMEKLAEIL  347
            TP Q   + EL+ +  ++E  + + ++  Q+      ++G+   +G+L D ++ ++   +
Sbjct  115  TPAQAASLEELKADVKRKERDLTEAMASLQETVAAPPLVGLARRAGRLVDGEICEMKNAI  174

Query  346  EK-----------ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            E+           AD LR  T+  ++E+L   Q +  L AA +    IRRWGI  D QR 
Sbjct  175  EELKIGMLGVFYSADLLRGSTMKRVMEILKTDQTLRPLAAATEFQQRIRRWGIQRDSQRT  234

Query  199  NNV  191
              +
Sbjct  235  RTI  237



>ref|XP_007213175.1| hypothetical protein PRUPE_ppa027008mg, partial [Prunus persica]
 gb|EMJ14374.1| hypothetical protein PRUPE_ppa027008mg, partial [Prunus persica]
Length=230

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 115/226 (51%), Gaps = 22/226 (10%)
 Frame = -1

Query  877  KMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            K  F+ + E   + L +L+Q L   P+      H      + +K + H  +Y   ++  A
Sbjct  10   KCCFKEWMELQEQDLSELLQALKLDPQNKDQLKH------LAEKGICHFQDYINKRTQLA  63

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMD-Ilrglrngdl  521
            +RD+   F   W TS E SL WI G RP+  F L+Y       ES + + +         
Sbjct  64   RRDVSAFFAPTWCTSWENSLLWIAGCRPSLFFRLVYVLGGSKMESKLSEFLQDTREGSLG  123

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-IIGMMS------GKLDAKMEK  362
              LT +QL  V+ LQ +T++EE  +  +L+  Q+  +D  I M++      G+++ ++E+
Sbjct  124  EVLTCSQLVVVNSLQSKTIREEERLTGELAALQEDIADQPIAMIAKGLSQLGEMNREVEE  183

Query  361  --------LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQL  248
                    +  ILE+ADQLR+ T+  LV +LT  QAV+FL+A+ +L
Sbjct  184  ALDEHGQAMVRILEEADQLRLNTVKELVNILTPLQAVDFLVASKKL  229



>ref|XP_008442399.1| PREDICTED: transcription factor HBP-1b(c38) [Cucumis melo]
Length=235

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 108/226 (48%), Gaps = 14/226 (6%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF++F E W  + R  +  L  A   A  + H++  Q  + +++SH  +YY  KS  A+ 
Sbjct  10   SFKAFFEAWLLRQRNYLDDLLSA---AHGSPHNRDLQVSISRILSHYEDYYEKKSRIAQT  66

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            DI  VFT PW T+ ER+L WIGG+RP  +  L+      L +  ++ I R   +  +   
Sbjct  67   DIFLVFTPPWFTTYERTLLWIGGFRPGLIIRLVNQSIDDLSDEQVVRIRRLKDDTKIE--  124

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLA--EILEKA  338
                  R+       +QE+      L  ++ GG D  G + G+   +  K A   +L  A
Sbjct  125  -----ERLLNNDLAKIQEKVAAPPLLEFFRHGGHD--GAVGGEEAMETLKAAFQSVLASA  177

Query  337  DQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            D LR  T   + ++LT  Q V FL A AQL   +R  G+  D +R 
Sbjct  178  DLLRRDTALKVTQILTPAQTVRFLAAVAQLHLRVRALGLQEDARRN  223



>ref|XP_007025355.1| Delay of germination 1, putative [Theobroma cacao]
 gb|EOY27977.1| Delay of germination 1, putative [Theobroma cacao]
Length=408

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 130/237 (55%), Gaps = 17/237 (7%)
 Frame = -1

Query  877  KMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            +  FQ +     ++L +L+Q L        ++++     ++ +K ++   EY   ++  +
Sbjct  9    QCCFQEWMTIQEQELSELLQALNLKENDVNSSEN--TYAKLAEKSINSFQEYIDKRNQLS  66

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            ++D+ G+F   W T+LE SL WIGG RP+    L Y       E  +++IL+GL  GDLG
Sbjct  67   RQDVSGLFAPSWNTALENSLLWIGGCRPSMYIRLTYALCGSQVEFQLLEILQGLARGDLG  126

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-----------IIGMMSGKLDAK  371
             ++ TQL ++++L  +T++EE  +++ L+  Q+  +D            +G  SG++D  
Sbjct  127  QISATQLGKINDLHMKTMKEEERLSNNLASLQENIADQPIAVIAKRLCRVGESSGEVDRA  186

Query  370  MEK----LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            +++    +A IL++AD+LR+ T+  L+ +LT  Q V+FL A+ +L   +  WG   D
Sbjct  187  LDEHESSMANILQEADKLRLSTLKELLGILTPVQGVDFLAASKKLHLCMHEWGKTRD  243



>ref|XP_004968271.1| PREDICTED: transcription factor TGA6-like [Setaria italica]
Length=310

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 118/245 (48%), Gaps = 21/245 (9%)
 Frame = -1

Query  871  SFQSFHETWFEQ---LRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA  701
            SF  F E+W  +       ++    A  P   AD  +L      +V+ H   YYR K+ A
Sbjct  64   SFSRFFESWIAEQSRDLAALRAAASADPPTREADLRRL----ADRVLGHYEHYYRTKAAA  119

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMD-Ilrglrngd  524
            A  D+L +FT  W ++ E    W GGWRPT   HL+YT+S +  E  +   +  G    D
Sbjct  120  AAVDLLRMFTPSWTSTTENLFLWCGGWRPTAALHLLYTKSGMQLEHQLPAFLNGGSLKAD  179

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGG--SDIIGM-----------MSGK  383
            LGDL+  QL+   +LQ  T++ E  I D  +  Q+    + I+ +           M  +
Sbjct  180  LGDLSAGQLQDADQLQRRTIKREREIEDAAASAQEALATAKILELAGGGGGVDADAMERE  239

Query  382  LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            +  K + +  +LE AD LR++T+  +V LL   QAV FL+AAA++   +  +G   D   
Sbjct  240  MKTKADGMKRVLEMADALRLETMRGVVALLRPAQAVHFLLAAAEIHLAVHDFGCRKDGHA  299

Query  202  ENNVS  188
             N  +
Sbjct  300  GNAAA  304



>ref|XP_011101404.1| PREDICTED: transcription factor TGA6-like [Sesamum indicum]
Length=250

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 118/231 (51%), Gaps = 17/231 (7%)
 Frame = -1

Query  847  WFEQLRQLVQQLGQAPR--PATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVF  674
            W     Q + +L Q+ R   A   DH     ++V+K + H  EY   +   A+ D+   F
Sbjct  16   WMSLQEQDLSELLQSLRLNNADGDDHTAELSQLVEKNIRHFQEYLCRRVSLAREDVYPYF  75

Query  673  TAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQLR  494
            +  W TSLE S+ W GG RP+    L+Y  S     S + + L G R G LG+L+P+Q+ 
Sbjct  76   SPTWCTSLEGSMLWAGGCRPSIFIRLVYALSGKEISSRLDEYLHGNRTGGLGELSPSQIN  135

Query  493  RVSELQCETVQEENYIADQLSDWQDGGSD-IIGMMSGKLDAKMEKLAE------------  353
             ++ LQ +T++EE  ++ +L+  Q+  +D  I +++ +L A  E   E            
Sbjct  136  SINSLQLKTIREEEKLSSKLASMQEEMADQPIAIIAKELAAHSEASTEAEEALKSLAVSM  195

Query  352  --ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
              +LE+AD LR+ T+  L+ +LT  QAV+FL    +L   I  WG   D++
Sbjct  196  TSMLEEADNLRLNTLKELMSILTPVQAVDFLATGRKLHLCIHAWGRRRDQK  246



>ref|XP_010037696.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW49450.1| hypothetical protein EUGRSUZ_K02977 [Eucalyptus grandis]
Length=246

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 113/256 (44%), Gaps = 55/256 (21%)
 Frame = -1

Query  880  KKMSFQSFHETWFEQLRQLVQQLGQAPRPATTA--DHHQLQQEMVQKVMSHCHEYYRVKS  707
            K +SF+SF E W  + ++ +++L  A   +     D H    E++ +V+ H  +YY  KS
Sbjct  16   KSLSFESFLEAWLVRQKRYLEELLSAQHSSCEVRQDDHL---ELIHRVLYHYQQYYEEKS  72

Query  706  IAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrng  527
              A  D+  VF+ PW T+LER+L WI G+RP  +F L+         S + D+       
Sbjct  73   RVANWDVFLVFSPPWLTNLERALLWIAGFRPNLLFRLV--------SSSVNDM-------  117

Query  526  dlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQ-------------------------  422
                 T  Q RR+  L  ET  EE  + D+L+  Q                         
Sbjct  118  -----TEDQSRRMDRLVAETRMEEKALNDELAKIQERVGAPPLANAIRRYGRTAQDGETA  172

Query  421  DGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMF  242
            DG  D   +  G L   +EK   ++  AD LR  T   +  +LT  Q V+ L A AQL  
Sbjct  173  DGSGDDSAL--GGLRKALEK---VVANADMLRATTGEKVALVLTPPQMVKVLAAVAQLQL  227

Query  241  GIRRWGINHDRQRENN  194
             +R  G+  D ++  N
Sbjct  228  KVRGLGLQRDAEKGQN  243



>ref|XP_007026666.1| Response to aba and salt 1, putative [Theobroma cacao]
 gb|EOY07168.1| Response to aba and salt 1, putative [Theobroma cacao]
Length=235

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/240 (28%), Positives = 111/240 (46%), Gaps = 37/240 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF +F + W E+  Q + +L    + +  A    L+ +++ +V+SH  +YY  KS  A R
Sbjct  16   SFDAFFQVWLERQEQYLDELLSVQQRSHEAREDDLK-DLITRVLSHHQQYYEEKSRVAHR  74

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            +I  VF+  W +S ER+  WI G++P     L+         + + D+            
Sbjct  75   NIFLVFSPTWLSSFERASLWIAGFKPGFALKLV--------SNSVQDL------------  114

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDG---------GSDIIGMMSGKLDAKMEKL  359
            +  Q  R+  L  ET  EE  + D+L+  Q+                +M+ ++  +   L
Sbjct  115  SQEQSERIKRLMAETRVEERVLNDELARVQESIAAPPLLEIARKRARLMNAEIAGEQAAL  174

Query  358  A-------EILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            A       E++  AD LRM T   +VE+L   Q V FL AA QL+  +R WG+  D +R+
Sbjct  175  ASLRKAVEEVVAAADLLRMTTAMRVVEILNPVQNVNFLTAATQLLVKLRNWGLQKDGERK  234



>ref|XP_009339278.1| PREDICTED: transcription factor TGA5 [Pyrus x bretschneideri]
Length=229

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 115/237 (49%), Gaps = 36/237 (15%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F +F   W ++ +  + QL          +    ++ ++++V+SH  +Y+  K+  A+ D
Sbjct  11   FVTFLGGWLDRQQTFLDQLLNLVESPDYENKDARERILIEQVLSHYQQYFAEKARTAEED  70

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
               +F+ PW +S ERSL W+GG++P+ V  ++        +S + D+            T
Sbjct  71   AFVLFSPPWLSSFERSLLWLGGFKPSMVLRMV--------DSSVEDL------------T  110

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGM-------MSGK---LDAKME  365
              Q+R +  ++ ET + E  +++ ++  Q+      I+ +       M G+   LD  ME
Sbjct  111  AEQVREMDAVKGETRRAERDLSETMARIQESVAAPPILALARRVGRPMEGEISSLDMAME  170

Query  364  KLAE----ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
             L      + E AD LR  T+  +VE+L+ +Q V+ L A AQ    IRRWG+  D Q
Sbjct  171  MLKTAMLGVFESADGLRGSTVRKVVEVLSPEQTVKVLAAVAQFQLRIRRWGLQRDSQ  227



>ref|XP_009132082.1| PREDICTED: uncharacterized protein LOC103856711 isoform X1 [Brassica 
rapa]
Length=259

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 118/229 (52%), Gaps = 36/229 (16%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY--  590
            +E++Q V+    +Y R +S  ++R     F   W T LE +L W+GG RP++   L+Y  
Sbjct  26   RELIQSVIEDFKDYARKRSEHSRRYSSNYFAPTWNTCLENALLWMGGCRPSSFIRLVYAM  85

Query  589  ----TESSI--LFESHIMDIlrgl---------rngdlgdLTPTQLRRVSELQCETVQEE  455
                TE  +   F  +I  +   L             + DLT  QL +++EL  +TVQEE
Sbjct  86   CGSQTELRLTNFFRDNIGGLSMALGETPGRVDGAGESMSDLTAEQLFKINELHMKTVQEE  145

Query  454  NYIADQLSDWQDGGSDI-IGMMS------GKLDAKMEK--------LAEILEKADQLRMK  320
            N +  Q +  Q+  +D+ I + +      G+ D ++E+        +A +L +AD+LR+ 
Sbjct  146  NMLTKQSATLQEDTADMPIAVAAFHKERIGEADVEVERALDKYEDEIARMLAEADKLRLT  205

Query  319  TITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNVSQ*SGD  173
            T+T +VE+LTA QA +FL+A  +L   +  WG    RQRE  + +  GD
Sbjct  206  TLTKIVEILTAVQAADFLLAGKKLHLSMHEWG----RQRERRLLEACGD  250



>ref|XP_004137901.1| PREDICTED: transcription factor TGA7-like [Cucumis sativus]
 ref|XP_004156668.1| PREDICTED: transcription factor TGA7-like [Cucumis sativus]
 gb|KGN58743.1| hypothetical protein Csa_3G731050 [Cucumis sativus]
Length=235

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 108/228 (47%), Gaps = 18/228 (8%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF++F E W  + R  +  L        T  +  LQ   + +++SH  +YY  KS  A+ 
Sbjct  10   SFKAFFEAWLLRQRNYLDDLLSTAH--GTPQNRDLQVS-ISRILSHYEDYYEKKSRIAQT  66

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            DI  VFT PW T+ E++L WIGG+RP  +  L+      L +  ++ I R   +  +   
Sbjct  67   DIFLVFTPPWFTTYEKTLLWIGGFRPGLIVRLVNQSIDDLSDEQVVRIRRLKDDTKVE--  124

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLA----EILE  344
                  R+       +QE+      L  ++ GG D  G++ G  +A ME L      +L 
Sbjct  125  -----ERLLNNDLAKIQEKVAAPPLLEFFRHGGHD--GVIGG--EAAMESLKAAFQSVLA  175

Query  343  KADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
             AD LR  T   + ++LT  Q V FL A AQL   +R  G+  D +R+
Sbjct  176  SADLLRRDTALKVTQILTPAQTVRFLAAVAQLHLRVRALGLQEDAKRD  223



>ref|XP_008345524.1| PREDICTED: transcription factor TGA4-like [Malus domestica]
Length=251

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 111/239 (46%), Gaps = 37/239 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F +F E W  +    + +L  A R    A    LQ +++ +V+ H  +YY  KS  A+R
Sbjct  13   TFVAFFEGWLVRQEHFLDELLSAQRTVDEARDEDLQ-DLISRVLLHYQQYYDEKSRLAQR  71

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  VF+  W +S ER+L WI G++P  VF ++ TES   F                   
Sbjct  72   DVFLVFSPTWFSSYERTLLWIAGYKPGLVFRIV-TESVPDFSDR----------------  114

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGS-----DIIGMMSGKLDAKM-------  368
               Q   ++ L+ ET  EE  + D+L++  +  +     D++       D ++       
Sbjct  115  ---QRINIARLRVETRIEERALNDKLANIHESVAAPPFVDVLRRYGRARDGEIVEDIAVI  171

Query  367  ----EKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
                  L  +L  A+ LR   +T LVE+L+++QAV FL A AQ    IR  G+  D ++
Sbjct  172  ESLKPALESVLVNANLLRTTMVTKLVEILSSRQAVRFLTAVAQFQLKIRSLGLERDAEK  230



>ref|XP_010277361.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Nelumbo 
nucifera]
Length=269

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 110/229 (48%), Gaps = 36/229 (16%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F +F E W  + +Q + ++  A R        Q  ++++ +V+SH  +Y   KS AA RD
Sbjct  54   FHAFLEGWLVRQQQFLDEIVYAKRFCHDDSREQDLRDLIARVLSHYQQYLGEKSRAAHRD  113

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +  V + PW +SLER+L WIGG+RP  VF L+      L +                   
Sbjct  114  VFLVLSPPWFSSLERALFWIGGFRPGLVFRLVANSVGDLSQD------------------  155

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGG-----SDII-----------GMMSGKLD  377
              Q++ +  L+ ET  EE  + ++L+  Q+       S+++           G  +  L+
Sbjct  156  --QVQWMETLRAETSAEERQLEEELARLQESVVAPPLSELLRRRGRAVNGEEGNANPVLE  213

Query  376  AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRR  230
            + + +   +L  AD LR  T T ++++L+  Q V FL AAAQL   IRR
Sbjct  214  SMITEFEILLGSADMLRANTATKMIQILSPVQTVSFLAAAAQLQLRIRR  262



>ref|XP_008366197.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=229

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 113/238 (47%), Gaps = 38/238 (16%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F   W ++ +  + QL +        +    ++ ++++V+SH  +Y+  K+  A+ D
Sbjct  11   FVKFLGGWLDRQQTFLDQLLKLVESPDYENKDARERNLIEQVLSHYQQYFAEKARTAEED  70

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +  +F+ PW +S ERSL W+ G++P+ V  ++        +S + D+            T
Sbjct  71   VFVLFSPPWLSSFERSLLWLAGFKPSMVLRMV--------DSSVEDL------------T  110

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDG-------------GSDIIGMMSGKLDAKM  368
              Q R +  ++ ET + E  +++ ++  Q+              G  + G +S  LD  M
Sbjct  111  AEQAREMDAVKGETRRGERDLSETMARIQESVAAPPILALVRRVGRQMDGEISS-LDMAM  169

Query  367  EKLAE----ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            E L      + E AD LR  T+  +VE+L+ +Q V+ L A AQ    IRRWG+  D Q
Sbjct  170  EMLKTAMLGVFESADGLRGSTVRKVVEVLSPEQTVKVLAAVAQFQLRIRRWGLQRDSQ  227



>ref|XP_011079057.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
 ref|XP_011079058.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=245

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 113/239 (47%), Gaps = 38/239 (16%)
 Frame = -1

Query  868  FQSFHETWF-EQLRQLVQQLGQAPRPATTADHHQLQ-QEMVQKVMSHCHEYYRVKSIAAK  695
            F++F   W  +Q R L   LG   R  +  + ++++ ++++Q+VM H   Y+  K+   +
Sbjct  11   FEAFLGRWLIDQERYLRDLLGLMERNRSEEEEYEVRCKDLIQQVMGHYKHYFEAKARVVE  70

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             ++  V    W +S ER+  WIGG+RP  +F L+        +++++D+           
Sbjct  71   ENVFLVLMPTWFSSFERAYLWIGGFRPGLLFRLV--------KNNVLDL-----------  111

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGM--------------MSGK  383
             T  Q +R++ L  E  +EE  + D+    Q+      ++ +              M   
Sbjct  112  -TEEQSQRINRLMAEIKEEEKELTDEFDRVQEVVASPPMVELVRRLGRLRNGAQHNMESA  170

Query  382  LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            +D     L  ++E AD LRMKT   LVE+L   QAV  L A AQL   +RRWG+  D Q
Sbjct  171  VDRLKLSLETLVECADFLRMKTGIILVEILKPAQAVRLLAAVAQLQLRVRRWGMQRDGQ  229



>ref|XP_010439827.1| PREDICTED: transcription factor TGA6-like [Camelina sativa]
 ref|XP_010449485.1| PREDICTED: transcription factor TGA6-like [Camelina sativa]
Length=231

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 114/241 (47%), Gaps = 40/241 (17%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F  F+E W  QL Q + QL  A    TT    +L+  ++ K+ +H   YY  K  A   
Sbjct  8    KFLEFYENWVIQLEQYLHQLLIAHN--TTMSEIELRA-LISKLTTHHKAYYTAKWAAIGE  64

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L  F   W T LE++  W+ GW+P+TVF ++      L +S ++ +            
Sbjct  65   DVLAFFGPVWLTPLEKACFWLTGWKPSTVFRMV----DRLRKSRLVLV------------  108

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDG------------GSDIIGMMSGKLDAKM  368
               Q+R++ EL+ +T  EE  I  ++  +Q              G  + G     ++A +
Sbjct  109  -EAQVRKLEELRAKTKFEEQKIEREVERYQVAMGDRKMVELARLGCHVGGESVVVIEAAV  167

Query  367  EKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            + LA  LEK    AD +R+KT+  ++++L   Q VEFL AAA     +RRWG     QR 
Sbjct  168  KGLATGLEKMVKAADCVRLKTLKGILDILAPPQCVEFLAAAAAFQVQLRRWG----NQRH  223

Query  199  N  197
            N
Sbjct  224  N  224



>ref|XP_010414743.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=231

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 112/238 (47%), Gaps = 42/238 (18%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA---  701
            +F SF   W  + RQL+QQL       T+    + ++ +V + +SHC +YY+ KS A   
Sbjct  9    TFTSFFNDWLLRHRQLIQQLAHFDDETTSVTPVE-EESLVTQFLSHCLQYYQEKSAAVSV  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            A  DI   F+ PW +S E+ + WIGG++P  VF LI T  + L                 
Sbjct  68   AGDDIYDFFSPPWLSSCEKLILWIGGFKPGMVFKLITTSVNDL-----------------  110

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKL----------DAK  371
               T  Q  ++  ++ ET + E  +  + +  Q    D + ++  K            +K
Sbjct  111  ---TCQQKDQLESIRLETKRRERALMGRFAHLQQSVGDPLLLVPFKRIGASRLGEREQSK  167

Query  370  MEKLAEILEK--------ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
            ME+  E+L++        ADQLR  T+  +VE+L   QA++ L AA +  F +R  G+
Sbjct  168  MEEAMEVLKREMKEAMKNADQLRCVTVRKVVEVLNPGQAIKLLRAAGEFYFKLRDLGV  225



>emb|CDX99446.1| BnaC01g11060D [Brassica napus]
Length=239

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 113/241 (47%), Gaps = 46/241 (19%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F  F+E+W  QL Q + QL  A     T    +L+  ++ K+ +H   YY  K  A   
Sbjct  8    KFLEFYESWIFQLEQYLHQLLIAHNNINTMSEIELRG-LISKLTAHHKAYYTAKWAAIGE  66

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLI------YTESSILFESHIMDIlrglrn  530
            DIL  F   W   LE+S  W+ GW+P+T F ++      +  + +L E+           
Sbjct  67   DILAFFGPVWLNPLEKSCFWLTGWKPSTAFRMLDRLRKSWRPTVVLVEA-----------  115

Query  529  gdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-----------IIGMMSGK  383
                     Q+RR+ EL+ +T  +E  I  ++  +Q   +D            +G + G+
Sbjct  116  ---------QVRRLEELRVKTRFDEERIETEMERYQVAMADRKMVELARLGCRVGGVEGE  166

Query  382  ----LDAKMEKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
                ++A ++ LA  LEK    AD +R+KT+  ++++L   Q VEFL AAA     +RRW
Sbjct  167  STVLVEAAVKGLATRLEKMVKAADCVRLKTLKGILDVLAPPQCVEFLAAAAAFQVQLRRW  226

Query  226  G  224
            G
Sbjct  227  G  227



>ref|XP_004305124.1| PREDICTED: transcription factor TGA4-like [Fragaria vesca subsp. 
vesca]
Length=229

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 109/244 (45%), Gaps = 39/244 (16%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF++F E W  +    + +L  A + A  A    L+ ++V +V+ H  +YY  KS  A+R
Sbjct  3    SFETFFEGWLVRQEHYLDELQSAQQRAHEAREVDLR-DLVSRVLLHYQQYYEEKSRIAQR  61

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  VF+  W TSLER+L WI G++P   F L+           + D+            
Sbjct  62   DVFMVFSPTWFTSLERALLWIAGFKPGLAFRLV--------SDSVPDL------------  101

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKM------------  368
            +  Q  RV+ L  ET  EE  + D+L+   +  +    +   +  A+             
Sbjct  102  SDDQRVRVTRLVEETRVEERALNDKLAKIHESVAAPPLVDVARRHARYVESEGAEGEEEE  161

Query  367  ------EKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
                    L ++L  A+ LR    T LVE+++  QAV FL+A  Q    IR WG+  D +
Sbjct  162  AATRLKSALEDVLADANLLRTTVATKLVEMMSGAQAVRFLVAVGQFQLKIRSWGLERDAR  221

Query  205  RENN  194
            R   
Sbjct  222  RSRG  225



>ref|XP_006472990.1| PREDICTED: transcription factor TGA5-like [Citrus sinensis]
Length=313

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 115/238 (48%), Gaps = 37/238 (16%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            M+F++F + W  +   L  QL  A  P     +++L Q ++ +V+SH  +YY  KS+AA 
Sbjct  82   MNFEAFFKDWLIRQENLSYQLLDAIAPENI-HNNELHQCLIDQVLSHYQQYYLEKSLAAT  140

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
             D+  + + PW T  ER+  WIGG+RP+ +F LI         + + D+           
Sbjct  141  EDVFQIISPPWLTFPERTFLWIGGFRPSLIFKLI--------ANSVQDL-----------  181

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDG------------GSDIIGMMSGKLDAK  371
             T  Q   V +++ ET +EE  +   ++  Q+              ++++     + +A 
Sbjct  182  -TAEQESEVQQVKAETRREERELGQTMARVQESVASAPFMNLARRSANLVDGEVPEAEAA  240

Query  370  MEKLAE----ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDR  209
            M++L +    +LE AD LR      ++++L   Q V+FL A AQ     RRW ++ D+
Sbjct  241  MKELQKGMVAVLEAADALRSTAAWKVLQILLPIQTVKFLAAVAQFHLTTRRWCLDRDQ  298



>ref|XP_003634633.1| PREDICTED: transcription factor TGA4-like [Vitis vinifera]
Length=246

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 120/242 (50%), Gaps = 23/242 (10%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQA-PRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            F    + W  Q  Q +Q+L Q     +  +DH    + ++QK + H  +Y   ++  +K 
Sbjct  9    FHCCFQDWINQQHQDLQELLQVLDTDSPDSDH---LRHLIQKSLQHFQDYSATRAELSKL  65

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D    F   W TS E S  W+GG RP+    L+Y+ S    ++ + D L+G   G+L D+
Sbjct  66   DAPSFFCPSWITSFENSFLWLGGCRPSLAIRLLYSISGSELQAQLPDFLKGCTRGNLADI  125

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-----------IIGMMSGKLDAKME  365
            + TQL  ++ L    V+EE+ ++ +++  Q+  +D            +G  S  +++ +E
Sbjct  126  SATQLISINALHGWIVREEDRLSSRMASMQEDTADEPLAIIAKKLRTVGEYSRTVNSAIE  185

Query  364  ----KLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
                 LA +LE+AD+LR+ T   L E+LT  Q   FL+A+ +L   +  WG    +QR  
Sbjct  186  THSQALARVLEEADKLRLSTFKGLQEILTPLQGAHFLVASKKLHLSMHEWG----KQRAE  241

Query  196  NV  191
             V
Sbjct  242  QV  243



>ref|XP_010052186.1| PREDICTED: transcription factor HBP-1b(c38) [Eucalyptus grandis]
Length=242

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/231 (26%), Positives = 107/231 (46%), Gaps = 8/231 (3%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  + E W  +L +   QL  A R  +T +     + +V K+ +H  EYY  K  AA  D
Sbjct  9    FSDYFEKWVSRLEEYSHQLHSASRETSTTEEEL--RALVSKLTAHHKEYYTAKWAAAGGD  66

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLI---YTESSILFE---SHIMDIlrglrng  527
            +   F+ PW++ LE +  W+ GW+P+T F +I       +++ E   + I  +   +R  
Sbjct  67   VFAFFSPPWSSPLENAYSWLTGWKPSTAFRVIEALRARGAVVAEDQLTRIEQLRAKIRLE  126

Query  526  dlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEIL  347
            +       + ++V       V+       ++      G  + G++   L      L  I+
Sbjct  127  EERVEREMERQQVGLADRRMVELARLAGRRVEAATAAGPQVDGLVDAALKGLASGLEWIM  186

Query  346  EKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
            + AD +R+KT+  +++ L+  Q VEFL A + L   +RRWG     Q E++
Sbjct  187  KAADCVRLKTLKGVLDELSPSQCVEFLAALSALQVQLRRWGKKRQSQAEHS  237



>ref|XP_002263705.1| PREDICTED: transcription factor TGA2-like [Vitis vinifera]
Length=231

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 108/238 (45%), Gaps = 39/238 (16%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F+ F + W       + +L    R        ++  ++V +V++H   YY  KS   +R+
Sbjct  11   FERFLQRWMVSQEHYLDELLTTERNCGEYGEKEMT-DLVSRVLTHYQLYYEQKSRVIERN  69

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +  VF+ PW T LER+L WIGG++P   F ++      L E                   
Sbjct  70   VFVVFSPPWFTPLERTLLWIGGFKPGLAFRIVAEAVGELSED------------------  111

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQD-------------GGSDIIGMMSGKLDAKM  368
              Q RR++ELQ ET  EE  ++D+L+  Q+              G    G + G  D+  
Sbjct  112  --QRRRMNELQEETRTEERLLSDELARIQETVAAPPLMELARQAGRRRDGEILGS-DSVT  168

Query  367  EKLAEILE----KADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            E L+  LE     A+ LRM T   +VE+LT  Q V+FL A  +    IR WG+  +R+
Sbjct  169  ELLSSALETVVRDAELLRMSTAVKVVEILTPIQNVKFLGAVGRFHMKIRTWGLQRNRE  226



>emb|CDO96811.1| unnamed protein product [Coffea canephora]
Length=259

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 117/237 (49%), Gaps = 21/237 (9%)
 Frame = -1

Query  859  FHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILG  680
            FHE    Q   L + L          D   L +++VQK + H   Y   ++  A+  +  
Sbjct  19   FHEWMILQEADLSEMLQALTVEDNFGDRDVLLRQLVQKNVEHFQAYADERTRLAQDHVSP  78

Query  679  VFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT--P  506
             F   W +SLE SL W+ G RP+    LIY  S I  ESHI + L+G R  +L +L+   
Sbjct  79   FFAPSWCSSLENSLLWLAGCRPSLFITLIYALSGIEIESHIPEFLQGTRTSELSELSLAA  138

Query  505  TQLRRVSELQCETVQEENYIADQLSDWQDGGSD----IIGMMSG-----------KLDAK  371
             QL  +++LQ  T+++E  ++ QL+  Q+  +D    +I   S             LD  
Sbjct  139  PQLSMINQLQRRTIKQEEELSQQLACLQEKIADQPFALIAKESSHVASQNVQADEALDEH  198

Query  370  MEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG----INHD  212
               +  ILE+AD+LR+KT+  ++ +L+  QAV+FL+A  +L   I  WG    I HD
Sbjct  199  STSMVRILEEADKLRIKTLKEMMNILSPVQAVDFLVAGKKLHLCIHDWGQKRDIKHD  255



>ref|XP_011101398.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=238

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 108/226 (48%), Gaps = 16/226 (7%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F+  W  QL   +Q L    R  +   H Q  ++MV K+ +H  +YY  K  AA  D
Sbjct  18   FSDFYRKWMGQLEDFLQLLLVVSREHS---HSQAAEDMVNKLTAHHKQYYTFKWAAAHED  74

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +L  FT  W + LE +  W+ GW+P+ VF L+  ES+ + E  +  I        + +  
Sbjct  75   VLAFFTPVWLSRLENAHLWVTGWKPSLVFRLV--ESAAMTEEQVKKIEALRVKIKMEEER  132

Query  508  PT------QLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLAEIL  347
                    Q+        E V++E     QL++   G +++ G++   +   +  L  ++
Sbjct  133  VEREMERQQVAVADRKMVELVRQE-----QLAEKNGGAAEVSGLVEVAVRGMLAGLERVM  187

Query  346  EKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDR  209
            + AD +R+KT+  ++++LT  Q V+ L A + L   +R+ G   D+
Sbjct  188  KMADCVRLKTLKGMLDVLTPIQCVDLLAAKSMLQIQMRKMGEKRDK  233



>ref|XP_006282688.1| hypothetical protein CARUB_v10005444mg [Capsella rubella]
 gb|EOA15586.1| hypothetical protein CARUB_v10005444mg [Capsella rubella]
Length=280

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/244 (29%), Positives = 116/244 (48%), Gaps = 38/244 (16%)
 Frame = -1

Query  838  QLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWA  659
            ++ +L Q L    R     D+ +L+ ++++ V+S   +Y R +S  ++R     F   W 
Sbjct  26   RMTELRQALSNGER-----DNAKLR-DLIRAVISDFEDYARKRSKHSRRYSSNYFAPTWN  79

Query  658  TSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL-----------  512
            T LE +L WIGG RP++   L+Y       E    +  R      L              
Sbjct  80   TCLENALLWIGGCRPSSFIRLVYAMCGSQTEHRFTNFFRNNNIESLSMALGETHGEMGGG  139

Query  511  ------TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-IGMMS------------  389
                  T  QL +++EL  +TV+ EN ++ Q +  Q+   D+ IG+ +            
Sbjct  140  ESMSDLTAEQLFKINELHLKTVKAENKLSKQSASLQEDTVDMPIGITAFYKEEIGETDVV  199

Query  388  --GKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINH  215
                LD   E +A +L +AD+LR+ T+TN+VE+LTA QA +FL+A  +L   +  WG   
Sbjct  200  VERALDKHEEDMAGLLAEADKLRLTTLTNMVEILTAVQAADFLLAGKKLHLAMHEWGRCR  259

Query  214  DRQR  203
            +R+R
Sbjct  260  ERRR  263



>ref|XP_010449483.1| PREDICTED: uncharacterized protein LOC104731709 isoform X1 [Camelina 
sativa]
Length=279

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 110/219 (50%), Gaps = 32/219 (15%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY--  590
            +++ +  +    +Y R +S  ++R     +   W T LE +L WIGG RP++   LIY  
Sbjct  45   RDLARTAIRDFEDYARKRSKHSRRYSSNYYAPTWNTCLENALLWIGGCRPSSFIRLIYAM  104

Query  589  ----TE---SSILFESHIMDIlrglrng--------dlgdLTPTQLRRVSELQCETVQEE  455
                TE   SS L  ++I D+   L            + DLT  QL +++EL  +TVQ E
Sbjct  105  CGSQTEHRFSSFLCNNNIDDLSMALGETHGEIGGEDSMSDLTAEQLFKINELHLKTVQAE  164

Query  454  NYIADQLSDWQDGGSDIIGMMSG---------------KLDAKMEKLAEILEKADQLRMK  320
            N ++ Q +  Q+  +DI   M+                 LD   E +A +L +AD+LR+ 
Sbjct  165  NKLSKQSASLQEDTADIPMAMAAFYKEEIGETDVVVERALDKHEEDMAGLLVEADKLRLT  224

Query  319  TITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            T+T +VE+LTA QAV+FL+A  +L   +  WG   + +R
Sbjct  225  TMTKIVEILTAVQAVDFLLAGKKLHLAMHEWGRCREHRR  263



>ref|XP_007206845.1| hypothetical protein PRUPE_ppa027068mg [Prunus persica]
 gb|EMJ08044.1| hypothetical protein PRUPE_ppa027068mg [Prunus persica]
Length=245

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 115/243 (47%), Gaps = 39/243 (16%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F +F E W  +    + +L  A +    A   + Q+++V +V+ H  +YY  KS  A+RD
Sbjct  12   FGAFFEAWLVRQEHFLDELLSAQQRINEA-RDEDQRDLVYRVLLHYQQYYDEKSRIAQRD  70

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +  VF+ PW TS ERSL WI G++P   F L+ TES       + D+            +
Sbjct  71   VFLVFSPPWFTSFERSLLWIAGYKPGLAFRLL-TES-------VPDL------------S  110

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGS-----DI---IGMMSG--------KLD  377
              Q  R++ L  ET  EE  + D+L+   +  +     D+    G  +          +D
Sbjct  111  DGQRVRMARLMEETRVEERALNDKLAKIHESVAAPPLVDVARRYGRFANGEIVEEDVAID  170

Query  376  AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI--NHDRQR  203
                 L  +LE ++ LR    T LV++L++ QAV FL A  Q    IR  G+  + D+QR
Sbjct  171  ELKSALESVLENSNLLRTTMATKLVDMLSSAQAVRFLAAVVQFQLKIRSLGLERDADKQR  230

Query  202  ENN  194
            E N
Sbjct  231  ELN  233



>ref|XP_006301016.1| hypothetical protein CARUB_v10021407mg [Capsella rubella]
 gb|EOA33914.1| hypothetical protein CARUB_v10021407mg [Capsella rubella]
Length=234

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/240 (27%), Positives = 109/240 (45%), Gaps = 43/240 (18%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA---  701
            +F +F + W    RQL++QL      A+T+     ++ +V K +SHC +YY+ KS A   
Sbjct  9    TFATFFDDWLNHHRQLIEQLAHFADEASTSVTQVEEESLVTKFLSHCLQYYQEKSSAMSV  68

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            A  D+   F+ PW  S E+ + WIGG++P  VF LI T  + L                 
Sbjct  69   AGEDLYDFFSPPWLNSYEKLILWIGGFKPGMVFKLITTSVNDL-----------------  111

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGK--------------  383
               T  Q  ++  ++ ET + E  +    +  Q    D + M+  K              
Sbjct  112  ---TSHQKDQLESIRLETQRRERALTRGFALLQQSVGDPLLMVRFKNIGALRLGEREQPG  168

Query  382  ------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
                  ++   +++ E+++ ADQLR  T+  +VE+L  +QAV+ L A  +    +R  G+
Sbjct  169  MKEEEAMEVLKKEMTEVMKNADQLRCVTVEKVVEVLNPRQAVKLLRAVGEFYLRLRDLGV  228



>ref|XP_010064898.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
Length=268

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 117/245 (48%), Gaps = 28/245 (11%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F      W  Q    + +L QA   A + D  +L+  +  K + H  +Y   +S  A+ D
Sbjct  20   FGCCFRNWMAQQHLDLDELLQAV-SADSGDAEKLRS-LAGKSIQHFRDYLEARSQLAQHD  77

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHI----------MDIlrg  539
                F  PW TS E S  WIGG RPT    L+Y+ S    E+ +               G
Sbjct  78   APSFFCPPWCTSFENSFLWIGGCRPTLAIRLVYSSSGSDLEAQLDGGARRGDDDRSNGSG  137

Query  538  lrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD----IIGMMSGKLDAK  371
               G+LG++T +QL+ ++EL  +T++ E  ++ +++  Q+  +D    +I   SG++  +
Sbjct  138  GGGGNLGEITASQLKSINELHMKTLRMEEKLSGRMASMQEEIADDPLALIAKRSGRVGEE  197

Query  370  ME-----------KLAEILEKADQLRMKTITNLV-ELLTAQQAVEFLIAAAQLMFGIRRW  227
             E            LA +L +AD+LR+ T+  LV E+LT  QAVEFL+   +L   I  W
Sbjct  198  SESVERVMKRHALSLARVLTEADELRLATLRELVEEILTPLQAVEFLVTTKKLHLSIHEW  257

Query  226  GINHD  212
            G   D
Sbjct  258  GKRRD  262



>ref|XP_009789465.1| PREDICTED: uncharacterized protein LOC104237085 [Nicotiana sylvestris]
Length=275

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 107/206 (52%), Gaps = 16/206 (8%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            ++++ K + H  +Y   +   A+ D+       W T+LE S+ WI G  P++   LIY  
Sbjct  57   KQLIAKSIKHFQDYIDNRRHFARNDVSAYLAPTWCTTLESSMIWISGCHPSSFIRLIYAL  116

Query  583  SSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-  407
            S    ESH+ + L+G R GDL +L+  QL+ + EL  +T+++EN ++  L+  Q+  +D 
Sbjct  117  SGRELESHLSNYLQGKRYGDLSELSTIQLKSIDELHMKTIRQENRLSKMLTSLQEEIADQ  176

Query  406  --------------IIGMMSGKLDAKMEKLAEILEKADQLRMKTITNL-VELLTAQQAVE  272
                          I G     LD   + L  ++E+AD+LRM+T   L + +L+  QA+E
Sbjct  177  PIAIIANEVGNFAEICGEAEEALDKHAKCLRHVIEEADKLRMETFKELAMNILSPFQALE  236

Query  271  FLIAAAQLMFGIRRWGINHDRQRENN  194
            FL+A+ +L   +  WG   D Q   N
Sbjct  237  FLVASKKLHLCVNAWGKKRDLQHGRN  262



>ref|XP_009132069.1| PREDICTED: uncharacterized protein LOC103856700 [Brassica rapa]
 emb|CDX78882.1| BnaA01g09490D [Brassica napus]
Length=239

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/241 (29%), Positives = 112/241 (46%), Gaps = 46/241 (19%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F  F+E W  QL Q + QL  A     T    +L+  ++ K+ +H   YY  K  A   
Sbjct  8    KFLEFYEGWIFQLEQYLHQLLIAHNNINTMSEIELRG-LISKLTAHHKAYYTAKWAAIGE  66

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLI------YTESSILFESHIMDIlrglrn  530
            D+L  F   W   LE+S  W+ GW+P+T F ++      +  + +L E+           
Sbjct  67   DVLAFFGPVWLNPLEKSCFWLTGWKPSTAFRMLDRLRKSWRPTVVLVEA-----------  115

Query  529  gdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-----------IIGMMSGK  383
                     Q+RR+ EL+ +T  +E  I  ++  +Q   +D            +G + G+
Sbjct  116  ---------QVRRLEELRVKTRFDEERIETEMERYQVAMADRKMVELARLGCRVGGVEGE  166

Query  382  ----LDAKMEKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
                ++A ++ LA  LEK    AD +R+KT+  ++++L   Q VEFL AAA     +RRW
Sbjct  167  STVLVEAAVKGLATRLEKMVKAADCVRLKTLKGILDVLAPPQCVEFLAAAAAFQVQLRRW  226

Query  226  G  224
            G
Sbjct  227  G  227



>ref|XP_008219160.1| PREDICTED: transcription factor HBP-1b(c38) [Prunus mume]
Length=232

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 121/241 (50%), Gaps = 38/241 (16%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQ-APRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            F +F   W E+ +  + QL +    P++    HQ Q+ ++++V+ H  +Y+  K + A+ 
Sbjct  13   FIAFLGGWLERQQTFLDQLLRLVDLPSSENKAHQ-QRHLIEQVLCHYQQYFSEKDLTAEE  71

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  +F+ PW +S ER++ W+ G++P+ V  ++        +S + D+            
Sbjct  72   DVFVLFSPPWLSSFERTMLWLAGFKPSLVLRMV--------DSSVEDL------------  111

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIG-------MMSGK---LDAKM  368
            T  Q R++  ++ ET   E  ++++++  Q+      I+        +M G+   LD  M
Sbjct  112  TEEQARKMEAVKGETRWAERELSEKMARIQESVAAPPILALARRVGRLMDGEISSLDLAM  171

Query  367  EKLAE----ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            E L      + E AD LR  ++  +VE+L  +Q V+ L A AQ   GIRR G+  D +++
Sbjct  172  ETLKTAMLGVFESADGLRGSSVRKVVEVLRPEQTVKVLAAVAQFQLGIRRLGLQRDSEQQ  231

Query  199  N  197
            +
Sbjct  232  S  232



>ref|XP_009395216.1| PREDICTED: transcription factor TGA2-like [Musa acuminata subsp. 
malaccensis]
Length=261

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 106/219 (48%), Gaps = 31/219 (14%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            +E+V++ M H  EY+  +    + D       PW  S E S+ W GG RP+    LIY+ 
Sbjct  42   RELVERCMRHYEEYHERRRGLVRDDSPTFLCPPWCNSFENSMIWAGGCRPSMFIRLIYSL  101

Query  583  SSILFESHI---MDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSD-----  428
            SS   E+H+              L  L+ +QL RV+E+   T+QEE+ I  Q++      
Sbjct  102  SSSGLEAHLDAPAGRAVSSHGEGLMGLSSSQLARVNEIHRSTLQEEDKITSQMATLQENV  161

Query  427  --------------WQDGGSDII--GMMSGKLDAKMEKLAEILEK----ADQLRMKTITN  308
                          WQ  G+  +  G    +++A ME+  E +E+    AD+LR++T   
Sbjct  162  ADGPLLPIVKKRQMWQWSGTSRVENGGGDAEVEAAMEEYTESMERLVQEADRLRVETART  221

Query  307  LV-ELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
            LV E+LT++QAVE L+AA QL   +   G  H R + N 
Sbjct  222  LVLEILTSKQAVELLVAAKQLQLSVHECG--HQRDQRNG  258



>ref|XP_011098215.1| PREDICTED: transcription factor TGA6-like [Sesamum indicum]
Length=257

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 68/237 (29%), Positives = 117/237 (49%), Gaps = 15/237 (6%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            + QSF   W  Q  Q +++L       + +D  +L+  +  K M    EYY  +++ A++
Sbjct  8    NVQSFSAEWIAQQHQDLKELLDELSTNSESDSEKLKL-LSDKSMKRFEEYYERRALLAQQ  66

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFE-SHIMDIlrglrngdlgd  515
            D   + +  W T  E +  WIGG RP+    +IY    +  + S + ++ +  R G L +
Sbjct  67   DAPLLLSPAWCTPFENAFFWIGGSRPSLYVRIIYLVCGLEVDGSQLAELFQSKRKGSLLE  126

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI--------IGMMS-GKLDAKME-  365
            ++  Q+  +  L C+T++EE  I+ +++  Q+  +D+        +G  S  +LD  M+ 
Sbjct  127  ISAQQIDMIDALHCKTIREEQKISARMASLQEEIADVPLALVAQEVGESSLQELDHAMDT  186

Query  364  ---KLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
                LA IL  ADQLR+ T+  L+ LL   QA E L A  +L   +  WG   D Q+
Sbjct  187  HYLSLASILTDADQLRLSTLKELIGLLKPLQAAELLFAIKKLTLSMHEWGKRKDHQQ  243



>ref|XP_009764515.1| PREDICTED: transcription factor TGA6 [Nicotiana sylvestris]
Length=235

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 105/238 (44%), Gaps = 26/238 (11%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F ++ E W  QL + ++ L   P+  +    H+    +V K+ +H  +YY VK  AA  
Sbjct  8    NFSNYFENWMSQLEEFLRLLLMVPKETSYVKDHE---SLVNKMTTHHKDYYTVKWAAAHE  64

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            DIL  F   W + LE +  W+ GW+P+  F L+   S  L +  +  I          + 
Sbjct  65   DILSFFNPVWLSPLENAYLWVTGWKPSMAFRLVGANSE-LSDEQVKSIDALKVKIRAEEE  123

Query  511  TPT-------------QLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAK  371
                            ++  ++ L    V+     +D      D  + + G++   L   
Sbjct  124  RVEREMERQQVALGDRKMVELARLNSSRVRTSGCSSD-----SDSNNQLDGLVEVALKGL  178

Query  370  MEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            M  L  +++ AD  R+KT+  L+++L  +Q V+ L A   L   +R+WG    R++EN
Sbjct  179  MVSLERVMKMADCARLKTLKGLLDILNPKQCVDLLAAITMLQIQMRKWG----RKKEN  232



>ref|XP_004238547.1| PREDICTED: transcription factor HBP-1b(c38) [Solanum lycopersicum]
Length=243

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 112/243 (46%), Gaps = 38/243 (16%)
 Frame = -1

Query  859  FHETWFEQLRQLVQQLGQAPRPATTADHHQLQ-QEMVQKVMSHCHEYYRVKSIAAKRDIL  683
            ++E W  QL+  +++L          D  + +  E+V +V+ H  +YYR K  +  RD+ 
Sbjct  17   YYENWLIQLQYFLEKLNAISSSYGGDDEEENRSNELVTQVLDHYQDYYREKFNSTNRDVF  76

Query  682  GVFTAPWATSLERSLHWIGGWRPTTVFHLI-YTESSILFESHIMDIlrglrngdlgdLTP  506
             + + PW TSLE++  WI G++P+T+F  I Y+  S L                    T 
Sbjct  77   LLVSPPWYTSLEKTFLWIAGFKPSTLFPTINYSIGSEL--------------------TT  116

Query  505  TQLRRVSELQCETVQEENYIADQLSDWQD-------------GGSDIIGMMS---GKLDA  374
             Q   +  L+ ET +EE  I   ++  Q+             GG+ + G  S     +D 
Sbjct  117  EQCENLKRLKAETKREEKVIEKGMAKVQEKVAAPPIFELMKRGGTVVDGEASELESVIDG  176

Query  373  KMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
                +  ++E A+ LR  T+ N++++L  +QAV+ L A AQ     R+ G+  D Q    
Sbjct  177  MKHSMMSMVETAEHLRGSTVKNILDILRQKQAVKLLAAVAQFHLQARKLGLQMDIQSAKR  236

Query  193  VSQ  185
            +++
Sbjct  237  INE  239



>ref|XP_010518808.1| PREDICTED: uncharacterized protein LOC104798429 [Tarenaya hassleriana]
Length=293

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 108/220 (49%), Gaps = 31/220 (14%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYT-  587
            +E+ QK++    +Y R +   A+R     F  PW + LE +L W+GG RP++   LIY  
Sbjct  58   RELNQKIVRDFEQYMRKRYELARRFSSPYFAPPWNSQLENALLWMGGCRPSSFIRLIYAL  117

Query  586  --ESSILFESHIMDIlrglrngdlgdL-------------TPTQLRRVSELQCETVQEEN  452
                + +F S  +D+          D+             T TQ+R+++++   TVQ E+
Sbjct  118  CGAETEMFLSKFIDLSSCPNYSPATDVIGEVETGCSIGGLTTTQMRKLNDIHIATVQAED  177

Query  451  YIADQLSDWQDGGSD--------IIGMMSGK-------LDAKMEKLAEILEKADQLRMKT  317
             +  +++  Q+  SD         +  + G        LD +   LAEI+ +AD+LR+ T
Sbjct  178  KLTSRVASVQEDTSDKPAALVAYYVDSVGGSHEAVERALDKQEAALAEIVSEADKLRLST  237

Query  316  ITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            + +++ +L+  QA +FL AA +L   +  WG   DR+R N
Sbjct  238  MKSIIGILSTVQASDFLFAAKKLHLSMHEWGSLRDRRRRN  277



>emb|CBI30697.3| unnamed protein product [Vitis vinifera]
Length=211

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 109/226 (48%), Gaps = 37/226 (16%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F+E W  QL + +Q+L +  R      H   ++ +V +V +H  EYY  K  AA  D
Sbjct  9    FIEFYEKWMCQLEENLQRLLKVSR---EIPHRTEREALVSRVTTHLKEYYNAKWAAAHED  65

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYT--ESSILFESHIMDIlrglrngdlgd  515
            +L  F+  W + LE +  W+ GW+P+T F LI +  ++ +  ES                
Sbjct  66   VLAFFSPVWLSPLENAYLWVTGWKPSTAFRLIESLRQTGVPGES----------------  109

Query  514  LTPTQLRRVSELQCETVQEENYI--ADQLSDWQDGG--SDIIGMMSGKLDAKMEKLAEIL  347
                    ++E+Q   + +   +  A   S   +GG  S+  G++   L   +  L  ++
Sbjct  110  --------LAEMQQVALADRKMVELARAASRVSNGGLASEENGLVEVALKGLLSGLERVM  161

Query  346  EKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMF--GIRRWGINH  215
            + AD  R+KT+  ++E+L+  Q V+FL  AA LMF   +R+WGI  
Sbjct  162  KAADCARLKTLKGILEVLSPLQCVDFL--AATLMFHVNLRKWGIKR  205



>gb|AHA62826.1| delay of germination 1 B, partial [Lepidium sativum]
Length=260

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/248 (26%), Positives = 125/248 (50%), Gaps = 27/248 (11%)
 Frame = -1

Query  865  QSFHETWFE----QLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            +S ++ W +    ++  L Q L Q        D+    +E+++K++    +Y   ++  +
Sbjct  13   ESCYQEWMDLQSQRIPDLKQLLAQRRSNEADTDNDNKLRELLEKIIGDFKKYAGKRADLS  72

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIlrglrn  530
             R     +   W + LE +L W+GG RP++ F L+Y    +++ I    ++ D+     +
Sbjct  73   HRCSSNYYAPSWNSPLENALLWMGGCRPSSFFRLVYALCGSQTEIRVTQYLRDMDGLESS  132

Query  529  ----gdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------IG-  398
                  L DLT  QL +++ L  + ++EE  +  +++  Q+  +DI           +G 
Sbjct  133  GGIGTSLSDLTAEQLAKINVLHVKIIEEEEKMTKKVASLQEDAADIPIATVAYEEEHVGK  192

Query  397  ---MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
               ++   LD + E +A++L +AD LR+ TIT +VE+L+  QA +FL+A  +L   + +W
Sbjct  193  PNMVVDQALDKQEEAMAKLLGEADSLRVDTITKVVEILSPVQAADFLLAGKKLHLSMHQW  252

Query  226  GINHDRQR  203
            G   DR+R
Sbjct  253  GTMRDRRR  260



>ref|XP_008443347.1| PREDICTED: uncharacterized protein LOC103486954 [Cucumis melo]
Length=291

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/246 (27%), Positives = 120/246 (49%), Gaps = 22/246 (9%)
 Frame = -1

Query  877  KMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            +  F+ + +   E L  L++ L Q P    + + +     +++  +SH   Y   +++ A
Sbjct  36   RRCFEEWMQLQREDLTHLLESLHQ-PTNNNSQETNNTTSTVIRNCISHFDHYISKRNLLA  94

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFE--SHIMDIlrglrngd  524
            +     +F   W TSLE+SL W+ G RP+    L Y  +S   E  ++  D         
Sbjct  95   QEYPSPLFAPTWCTSLEKSLLWMAGCRPSIFIRLTYALTSCSTEPLTNDGDNKNSDSFIG  154

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDG-GSDIIGMMSGKLDAKME------  365
            +G+L+P+Q+ RV+ L   T++ E  + D+L+ WQ+    D I ++  K D   E      
Sbjct  155  IGELSPSQMTRVNGLHMRTIKAEQKLTDELASWQEELADDPIAVIVAKGDCGDEVVMNNE  214

Query  364  -----------KLAEILEKADQLRMKTITNLV-ELLTAQQAVEFLIAAAQLMFGIRRWGI  221
                        + E++ KAD+LR+ T+  LV E+L   QA++FL+A+ +L   + +WG 
Sbjct  215  EAEMALKEHEKVMGEVIGKADKLRLNTMKELVLEILKPTQALQFLVASKKLQLSLHQWGK  274

Query  220  NHDRQR  203
              D ++
Sbjct  275  RRDEKQ  280



>ref|XP_006356862.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Solanum tuberosum]
Length=236

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/239 (26%), Positives = 108/239 (45%), Gaps = 37/239 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +   ++E W  QL+  +++L          +      E+V KV+ H  +YYR K  +  R
Sbjct  12   NINPYYENWLIQLQNFLEKLNAISSSYGEDEEENKSSELVTKVLDHYQDYYREKFNSTNR  71

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLI-YTESSILFESHIMDIlrglrngdlgd  515
            D+  + + PW TSLE++  WI G++P+T+F  I Y+  S L                   
Sbjct  72   DVFLLVSPPWYTSLEKTFLWIAGFKPSTLFPTINYSIGSEL-------------------  112

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQD-------------GGSDIIGM---MSGK  383
             T  Q  ++  L+ ET +EE  I   ++  Q+             GG+ + G    +   
Sbjct  113  -TTEQEEKLKRLKAETKREEKVIEKGMAKVQERGAAPPIFELMKRGGTVVDGEATDLESI  171

Query  382  LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            +D     +  ++E A+ LR  T+  ++++L  +Q+V+ L A AQ     R+ G+  D Q
Sbjct  172  IDGMKNSMMSMVETAEHLRGSTVRKILDILQQKQSVKLLAAVAQFHLQARKLGLQMDIQ  230



>gb|AAT64037.1| predicted protein [Gossypium hirsutum]
Length=253

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/235 (26%), Positives = 107/235 (46%), Gaps = 13/235 (6%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F + W  QL   +QQL +  R   +   HQ    +V K+ +H  EYY VK  AA  D
Sbjct  9    FSEFFDKWICQLDGYLQQLVRVSREGLSESEHQ---TLVSKLTAHYKEYYTVKWAAAHED  65

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYT--ESSI--LFESHIMDIlrglrngdl  521
            +L  +   W + LE +  W+ GW+P+ +F ++ +    S+  L E  +  I +      L
Sbjct  66   VLVFYCPVWLSKLENACSWLTGWKPSMIFGVVESMRRKSVAELTEEQVRKIEQLRVKIKL  125

Query  520  gdLTPT------QLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKL  359
             +          Q+        E V+    I ++      G   + G++   L   +  L
Sbjct  126  EEEKVEREMERQQVAMADRKMVELVRTARRIRNEELVVVVGNHQVEGLVEVALKGVLAGL  185

Query  358  AEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
              +++ AD +R+K +  ++++L   Q+++FL     L   IR+WG N D Q+ +N
Sbjct  186  ERVMKAADCVRLKALKGVLDVLNPSQSLDFLAGICMLQIQIRKWGQNRDNQKGSN  240



>ref|XP_010511109.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=231

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 110/238 (46%), Gaps = 42/238 (18%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA---  701
            +F SF   W  + RQL+QQL        +    + ++ +V + +SHC +YY+ KS A   
Sbjct  9    TFTSFFNDWLLRHRQLIQQLAHFDDETISVTPEE-EESLVTQFLSHCLQYYQEKSAAVSV  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            A  DI   F+ PW +S E+ + WIGG++P  VF LI T  + L                 
Sbjct  68   AGDDIYDFFSPPWLSSCEKLILWIGGFKPGMVFKLITTSVNDL-----------------  110

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKL----------DAK  371
               T  Q  ++  ++ ET + E  +  + +  Q    D + M+  K            ++
Sbjct  111  ---TSHQKDQLESIRLETKRRERALMGRFAHLQQSVGDPLLMVPFKRIGALRLGEREQSE  167

Query  370  MEKLAEILEK--------ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
            ME+  E+L++        ADQLR  T+  +VE+L   QA++ L AA +    +R  G+
Sbjct  168  MEEAMEVLKREMKEAMKNADQLRCVTVRKVVEVLNPGQAIKLLRAAGEFYLKLRDLGV  225



>ref|XP_010317335.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=250

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 106/200 (53%), Gaps = 17/200 (9%)
 Frame = -1

Query  760  EMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTES  581
            ++ +K++ H  E+   +   A++D+   F     + LE S+ WI G RP++   LIY   
Sbjct  50   QLAEKIIQHFQEHSDNRLRLARKDVSPFFAPVTCSPLENSVLWIAGCRPSSFIRLIYALC  109

Query  580  SILFESHIMDIlrglr---ngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGS  410
               FE  +      L      DL +L+  QLR ++ELQ +T++EE  I+ + +  Q+   
Sbjct  110  G--FEPDVQGTDPCLEGIVTEDLRELSEKQLRMINELQGKTIREERRISTKFASLQEDTV  167

Query  409  D--IIGMMSGK----------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFL  266
            D  + G M  +          LD     +A+++E+AD+LRMKT+  +V +L   QAVE+L
Sbjct  168  DQPLAGKMKKEGHGCEKADEALDEHSGHMADVIEEADRLRMKTLKEIVNILEPVQAVEYL  227

Query  265  IAAAQLMFGIRRWGINHDRQ  206
             AA ++ F +++WG   D+Q
Sbjct  228  AAAKKMRFCVQQWGEKRDQQ  247



>ref|XP_002266016.2| PREDICTED: transcription factor TGA2 [Vitis vinifera]
Length=245

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 119/243 (49%), Gaps = 43/243 (18%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F+E W  QL + +Q+L +  R      H   ++ +V +V +H  EYY  K  AA  D
Sbjct  15   FIEFYEKWMCQLEENLQRLLKVSR---EIPHRTEREALVSRVTTHLKEYYNAKWAAAHED  71

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYT--ESSILFESHIMDIlrglrngdlgd  515
            +L  F+  W + LE +  W+ GW+P+T F LI +  ++ +  ES             L +
Sbjct  72   VLAFFSPVWLSPLENAYLWVTGWKPSTAFRLIESLRQTGVPGES-------------LAE  118

Query  514  LTPTQLRRVSELQCE-----------TVQEENYIADQ--------LSDWQDGG--SDIIG  398
            ++  Q+++V EL+               +++  +AD+         S   +GG  S+  G
Sbjct  119  MSEEQMKKVEELRVRIRLEEEKVEREMERQQVALADRKMVELARAASRVSNGGLASEENG  178

Query  397  MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMF--GIRRWG  224
            ++   L   +  L  +++ AD  R+KT+  ++E+L+  Q V+FL  AA LMF   +R+WG
Sbjct  179  LVEVALKGLLSGLERVMKAADCARLKTLKGILEVLSPLQCVDFL--AATLMFHVNLRKWG  236

Query  223  INH  215
            I  
Sbjct  237  IKR  239



>ref|XP_011082771.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Sesamum 
indicum]
Length=358

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 103/197 (52%), Gaps = 11/197 (6%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            + +V+K + H  EY+  +++ A+      F   W TS E +  WIGG RP+  F L+Y+ 
Sbjct  155  KPLVEKSIKHFEEYHGRRALMAQHYAPSFFYPTWCTSFETAFFWIGGCRPSLAFRLVYSV  214

Query  583  SSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI  404
                    + +ILRG R G+L D++  Q+  ++ L C+TV+EE+ ++ ++ +  D    +
Sbjct  215  CGTELSGQLSEILRGERKGNLADISAHQMEMINTLHCKTVREEDMMSTRMEEIADEPLAM  274

Query  403  IGMMSGK-----------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAA  257
            +   +G+           +DA    LA IL  AD+LR+ T+  L+ +LT  Q V+ LI+ 
Sbjct  275  LATSAGRVGEWSKELVRAMDAHSLSLASILADADKLRISTLKELMAILTPFQGVDLLISI  334

Query  256  AQLMFGIRRWGINHDRQ  206
             +L   +  WG   + Q
Sbjct  335  KKLHLSMHEWGKTKELQ  351



>gb|ACD56655.1| predicted protein [Gossypioides kirkii]
Length=253

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/235 (26%), Positives = 107/235 (46%), Gaps = 13/235 (6%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F + W  QL   +QQL + P    +      QQ +V K+ +H  EYY VK  AA  D
Sbjct  9    FSEFFDKWICQLDGYLQQLVRVPSEGLSESE---QQALVSKLTAHYKEYYTVKWAAAHED  65

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYT--ESSI--LFESHIMDIlrglrngdl  521
            +L  +   W + LE +  W+ GW+P+ +F ++ +    S+  L E  +  I +      L
Sbjct  66   VLVFYCPVWLSKLENAYSWLTGWKPSMIFGVVESTRRKSVAELTEEQVRKIEQLRVKIKL  125

Query  520  gdLTPT------QLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKL  359
             +          Q+        E V+    I ++      G   + G++   L   +  L
Sbjct  126  EEEKVEREMERQQVAMADRKVVELVRTARRIRNEELVVVVGNHQVEGLVEVALKGVLAGL  185

Query  358  AEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENN  194
              +++ AD +R+K +  ++++L   Q+++FL     L   IR+WG N D Q+ +N
Sbjct  186  ERVMKAADCVRLKALKGVLDILNPSQSLDFLAGTCMLQIQIRKWGQNRDNQKGSN  240



>gb|EYU36422.1| hypothetical protein MIMGU_mgv1a025661mg [Erythranthe guttata]
Length=236

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/239 (27%), Positives = 114/239 (48%), Gaps = 35/239 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F SF ++W  +    ++QL     PA   D ++    ++ +V SH  E Y  K+  A  
Sbjct  6    NFTSFFDSWLTRQEAFLRQLEALLSPADGFDRNRECAAIIPRVFSHYQEMYMEKAALAGE  65

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  + +APW +S ER+L WI G+RP+ +F +I T  +                    DL
Sbjct  66   DVFLLMSAPWLSSFERTLVWISGFRPSMLFPMIETAVA-------------------EDL  106

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGMM----------SGKLDAKM  368
            +  Q R +  ++ E  ++E  I  +++  Q+  ++  + G++          + +L+A M
Sbjct  107  SDEQKREIEGVKAEIRRKEREINQKMARVQETVAEPPLCGLVKKFGRLVDGETTELEAAM  166

Query  367  EKLAE----ILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
             +L      ++  AD+LR  T   +V +L   Q V+F  A A+     R+WG+  DRQR
Sbjct  167  VELKAAMLVVVGNADELRGWTAAAVVGILNPVQGVKFFAAVARFQLQARKWGVEKDRQR  225



>ref|XP_007140269.1| hypothetical protein PHAVU_008G097900g [Phaseolus vulgaris]
 gb|ESW12263.1| hypothetical protein PHAVU_008G097900g [Phaseolus vulgaris]
Length=231

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 118/247 (48%), Gaps = 39/247 (16%)
 Frame = -1

Query  883  IKKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSI  704
            +   SF++F + W  + ++ + +L  A +         ++  ++ +V+ H  +Y+  KS 
Sbjct  4    VNAASFEAFLQGWMVRQKEFLGELLSAQQQYQEGRRADVR-PLIDRVICHYGQYFEEKSK  62

Query  703  AAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngd  524
             A  +I  VF+ PW +SLE+S  W+GG++P   F ++ T         + D+        
Sbjct  63   LAHHNIFLVFSPPWFSSLEKSFLWVGGFKPGVAFQVVNT--------ALRDL--------  106

Query  523  lgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGMM--SGKL--------  380
                T  Q  ++S+L+ E+  +E  + D L+  Q+  +D  ++ M    G+L        
Sbjct  107  ----TEDQKEKMSKLKKESKVKERTLNDDLAKLQESVADPPLVDMARSQGRLCFSRSFMV  162

Query  379  ------DAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGIN  218
                   A  EKL  ++  AD LR  T   ++++L   Q V F+++AA+L   IR WG++
Sbjct  163  DQGLVPSAFKEKLENLVADADALRTDTALKIMKILRPAQIVSFMVSAAELQIKIRSWGLD  222

Query  217  HDRQREN  197
             D Q  +
Sbjct  223  KDAQNAD  229



>emb|CDY23102.1| BnaC09g18560D [Brassica napus]
Length=280

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/252 (29%), Positives = 123/252 (49%), Gaps = 32/252 (13%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQA-PRPAT-------TADHHQLQQEMVQKVMSHCHEYYRVK  710
            +S ++ W     Q V +L QA P+  T        AD ++L+ E+ Q ++     Y   +
Sbjct  13   ESCYQQWMSLQSQRVPELKQALPQRRTHEGTADAAADDNKLR-ELTQNIIGDFKNYAGKR  71

Query  709  SIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIl-  545
            +  + R     +   W T LE +L W+GG RP++ F L+Y    +++ IL    + +I  
Sbjct  72   ADLSHRCSSNYYAPSWNTPLENALLWMGGCRPSSFFRLVYALCGSQTEILVTQFLRNIDG  131

Query  544  ---rglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI----------  404
                G     L DLT  QL  ++ L  + + EE  +  ++S  Q+  +DI          
Sbjct  132  YDYSGSGGASLSDLTAEQLAEINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEE  191

Query  403  -IG----MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFG  239
             +G    M+   LD + E +A +L +AD LR+ T+T ++E+LT  QA +F +A  +L   
Sbjct  192  HVGEPNAMVDQALDKQEEAMATLLAEADNLRVDTLTKIIEILTPVQAGDFFMAGKKLHLS  251

Query  238  IRRWGINHDRQR  203
            + +WG   DR+R
Sbjct  252  MHQWGALRDRRR  263



>ref|XP_004234088.1| PREDICTED: transcription factor TGA6-like [Solanum lycopersicum]
Length=251

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/241 (27%), Positives = 124/241 (51%), Gaps = 20/241 (8%)
 Frame = -1

Query  865  QSFHETWF----EQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            ++ + +W     E+L++L   + +A +     D      E+++K++++   Y   +S  A
Sbjct  12   ENLYNSWMNNQQEELKELQNAIVRARKNELNDDELN---ELLRKMVNNFQGYANGRSRLA  68

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            + D+   F   W T LE S+ WIGG RP+T   LIY    I  +SH    L+G++ G+ G
Sbjct  69   RVDVSPFFAPTWCTPLENSVLWIGGCRPSTFIRLIYALCGIEIQSHTARYLQGMKIGEFG  128

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGK-------------LD  377
             L+  Q+  + +LQ + + EE   + +L+  Q+   D    M+ +             L+
Sbjct  129  HLSGEQITMIDKLQRQIILEERRFSSRLASLQEDVVDQPFAMAARIYDTERDENEIEPLN  188

Query  376  AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
               E ++ +LE+ D+LRMKT+  ++ +LT  Q VE+L A  ++   +++WG   +++  +
Sbjct  189  KHGEDMSNLLEEVDELRMKTLKEILGILTPIQGVEYLAATKRIRLCLQQWGKKREQEHNS  248

Query  196  N  194
            N
Sbjct  249  N  249



>ref|XP_008243515.1| PREDICTED: transcription factor TGA4-like [Prunus mume]
Length=246

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 112/243 (46%), Gaps = 39/243 (16%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F +F E W  +    + +L  A +    A    L+ ++V +V+ H  +YY  KS  A+RD
Sbjct  14   FGAFFEAWLVRQEHFLDELLSAQQRINEARDEDLR-DLVYRVLLHYQQYYDEKSRIAQRD  72

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +  VF+ PW TS ERSL WI G++P   F L+ TES       + D+             
Sbjct  73   VFLVFSPPWFTSFERSLLWIAGYKPGLAFRLL-TES-------VPDL------------C  112

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGS-----DI---IGMMSG--------KLD  377
              Q  R++ L  ET  EE  + D+L+   +  +     D+    G  +          +D
Sbjct  113  DGQRVRMARLMEETRVEERALNDKLAKIHESVAAPPLVDVARRYGRFANGEIVEEDVAID  172

Query  376  AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD--RQR  203
                 L  +L  ++ LR    T LV++L++ QAV FL A AQ    IR  G+  D  +QR
Sbjct  173  ELQSALESVLANSNLLRTTMATKLVDMLSSAQAVRFLGAVAQFQLKIRSLGLERDANKQR  232

Query  202  ENN  194
            E N
Sbjct  233  ELN  235



>ref|XP_004161213.1| PREDICTED: uncharacterized LOC101207776 [Cucumis sativus]
Length=293

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/243 (26%), Positives = 115/243 (47%), Gaps = 26/243 (11%)
 Frame = -1

Query  853  ETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVF  674
            E W +  R+ +  L ++    T  D       +++  +SH   Y   +++ A+     +F
Sbjct  40   EEWMQLQREDLTHLLKSLHQPTNNDTTTTTTTVIRNCISHFEHYISNRTLLAQEHPSPLF  99

Query  673  TAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL----TP  506
               W TSLE SL W+ G RP+    LIY  +S   E  I +        +        +P
Sbjct  100  APTWCTSLENSLLWMAGCRPSIFIRLIYALTSCSSEPLITNDDGNKNGNNTVTSIGELSP  159

Query  505  TQLRRVSELQCETVQEENYIADQLSDWQ---------------DGGSDII--GMMSGKLD  377
            +Q+ RV+ L   TV+ E  +  +L+ WQ               D G +++   MM+ + +
Sbjct  160  SQMTRVNGLHMRTVKAEEKLTSELASWQEELADEPIALIAAKGDCGDEVVLNNMMNEEAE  219

Query  376  AKMEK----LAEILEKADQLRMKTITNLV-ELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
              +++    + +++ KAD+LR+ T+  LV E+L   QA++FL+A+ +L   + +WG   D
Sbjct  220  MALKEHEKVMGKVIGKADELRLNTMKELVLEILKPTQALQFLVASKKLHLSLHQWGKRRD  279

Query  211  RQR  203
             ++
Sbjct  280  EKQ  282



>ref|XP_009792613.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=260

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/235 (28%), Positives = 123/235 (52%), Gaps = 15/235 (6%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQ----QEMVQKVMSHCHEYYRVKSIAA  698
            ++ +E+W E   Q + +L  A   AT A  +Q       +++ +++++   Y   +S  A
Sbjct  24   ENLYESWMENQNQELNELQNA---ATLARKNQKTDTELNQLLARMVNNFQGYVNGRSRLA  80

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            + DI   F   W T LE S+ WIGG RP++    IY    +  ESH+ + L+G+   D G
Sbjct  81   RVDISPYFAPTWCTPLENSVLWIGGCRPSSFIRPIYALCGMEIESHLTEFLQGMEISDFG  140

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD--IIGMMSGK------LDAKMEK  362
             L+  Q+  + +L  +++ EE  ++ +L+  Q+   D  II   +        L+   + 
Sbjct  141  QLSGKQIMLIDKLHRKSIVEERKLSSKLASLQEDVVDQPIITAANNSENEEEPLNKHGQG  200

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            +  +LE+AD+LRM T+  ++ +LT  Q VE+L +A ++   +++WG   +++  N
Sbjct  201  MTTLLEEADELRMNTLKEILGILTPIQGVEYLASAKRIRLSLQQWGKKREQEHTN  255



>emb|CDP06021.1| unnamed protein product [Coffea canephora]
Length=114

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -1

Query  427  WQDGGSDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQL  248
            ++DG SD +GM S     KME L  ++EKADQLR+KTI  LVEL T +QA EFLIAAA L
Sbjct  40   FRDGASDFVGMRSHGDGGKMEVLVRVVEKADQLRLKTIEKLVELFTPRQAAEFLIAAAHL  99

Query  247  MFGIRRWGINHDRQ  206
             FG+R  G  +DR+
Sbjct  100  QFGVRALGATYDRR  113



>ref|XP_010434503.1| PREDICTED: transcription factor TGA6-like isoform X1 [Camelina 
sativa]
Length=231

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 112/241 (46%), Gaps = 40/241 (17%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F  F+E W  QL Q + QL  A    TT    +L+  ++ K+ +H   YY  K  A   
Sbjct  8    KFLEFYENWVIQLEQYLHQLLIAHN--TTMSEIELRA-LISKLTTHHKAYYTAKWAAIGE  64

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L  F   W T LE++  W+ GW+P+TVF ++      L +S ++ +            
Sbjct  65   DVLAFFGPVWLTPLEKACFWLTGWKPSTVFRMV----DRLRKSRLVLVE-----------  109

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDA------------KM  368
               Q+R++ EL+ +T  EE  I  ++  +Q    D   +   +L               +
Sbjct  110  --AQVRKLEELRAKTKFEEQKIEREVERYQVAMGDRKMVELARLGCHVGGESVVVVEAAV  167

Query  367  EKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRE  200
            + LA  LEK    AD +R+KT+  ++++L   Q VEFL AAA     +RRWG     QR 
Sbjct  168  KGLATGLEKMVKAADCVRLKTLKGILDILAPPQCVEFLAAAAAFQVQLRRWG----NQRH  223

Query  199  N  197
            N
Sbjct  224  N  224



>ref|XP_004150221.1| PREDICTED: uncharacterized protein LOC101207776 [Cucumis sativus]
 gb|KGN65627.1| hypothetical protein Csa_1G470430 [Cucumis sativus]
Length=293

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 115/243 (47%), Gaps = 26/243 (11%)
 Frame = -1

Query  853  ETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVF  674
            E W +  R+ +  L ++    T  D       +++  +SH   Y   +++ A+     +F
Sbjct  40   EEWMQLQREDLTHLLKSLHQPTNNDTTTTTTTVIRNCISHFEHYISNRTLLAQEHPSPLF  99

Query  673  TAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL----TP  506
               W TSLE SL W+ G RP+    LIY  +S   E  I +        +        +P
Sbjct  100  APTWCTSLENSLLWMAGCRPSIFIRLIYALTSCSSEPLITNDDDNKNGNNTVTSIGELSP  159

Query  505  TQLRRVSELQCETVQEENYIADQLSDWQ---------------DGGSDII--GMMSGKLD  377
            +Q+ RV+ L   T++ E  +  +L+ WQ               D G +++   MM+ + +
Sbjct  160  SQMTRVNGLHMRTIKAEEKLTSELASWQEELADEPIALIAAKGDCGDEVVLNNMMNEEAE  219

Query  376  AKMEK----LAEILEKADQLRMKTITNLV-ELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
              +++    + +++ KAD+LR+ T+  LV E+L   QA++FL+A+ +L   + +WG   D
Sbjct  220  MALKEHEKVMGKVIGKADELRLNTMKELVLEILKPTQALQFLVASKKLHLSLHQWGKRRD  279

Query  211  RQR  203
             ++
Sbjct  280  EKQ  282



>ref|XP_011082770.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Sesamum 
indicum]
Length=362

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 106/201 (53%), Gaps = 15/201 (7%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            + +V+K + H  EY+  +++ A+      F   W TS E +  WIGG RP+  F L+Y+ 
Sbjct  155  KPLVEKSIKHFEEYHGRRALMAQHYAPSFFYPTWCTSFETAFFWIGGCRPSLAFRLVYSV  214

Query  583  SSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSD-  407
                    + +ILRG R G+L D++  Q+  ++ L C+TV+EE+ ++ +++  Q+  +D 
Sbjct  215  CGTELSGQLSEILRGERKGNLADISAHQMEMINTLHCKTVREEDMMSTRMASLQEEIADE  274

Query  406  ---IIGMMSGK-----------LDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEF  269
               ++   +G+           +DA    LA IL  AD+LR+ T+  L+ +LT  Q V+ 
Sbjct  275  PLAMLATSAGRVGEWSKELVRAMDAHSLSLASILADADKLRISTLKELMAILTPFQGVDL  334

Query  268  LIAAAQLMFGIRRWGINHDRQ  206
            LI+  +L   +  WG   + Q
Sbjct  335  LISIKKLHLSMHEWGKTKELQ  355



>ref|XP_011101452.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=249

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 106/211 (50%), Gaps = 15/211 (7%)
 Frame = -1

Query  793  ATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRP  614
            A   DH    +E+V K + H  EY   ++  A+  +   F+  W TSLE S+ W GG RP
Sbjct  35   ADGDDHTADLRELVDKNIRHFQEYASQRARLARNHVSPFFSPTWCTSLEGSMLWAGGCRP  94

Query  613  TTVFHLIYTESSILFESHIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQL  434
            +    L+Y  S     SH+ + L G R+G LG+L+ +Q+  ++ LQ  T+Q+E+ ++  L
Sbjct  95   SIFVRLVYVLSGKELASHLDEYLHGGRSGGLGELSASQINSINSLQLRTIQQEDKLSANL  154

Query  433  SDWQDGGSDIIGMMSGK---------------LDAKMEKLAEILEKADQLRMKTITNLVE  299
            +  Q+  +D    +  K               L+A    L  +L +AD LR+ T+  L  
Sbjct  155  ASIQEEMADQPIFIIAKELAACSQTSTEADEALNALTASLIGVLGEADSLRLNTLKELTS  214

Query  298  LLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            +LT  Q+V+F+  A +L   +  WG   DR+
Sbjct  215  ILTPVQSVDFIATARKLHLCVHAWGRRRDRE  245



>gb|EYU28097.1| hypothetical protein MIMGU_mgv1a017794mg, partial [Erythranthe 
guttata]
Length=237

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 112/223 (50%), Gaps = 21/223 (9%)
 Frame = -1

Query  859  FHETWFEQLRQLVQQLGQA---PRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F++ W       + +L +A       +T+D    Q  ++ +++++   Y +++ + AK D
Sbjct  12   FYQQWMALQEHELSELNRAITLNANGSTSDFELTQ--LIDRILTNFKNYVKMRRVMAKED  69

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +       W T+LERS+ WIGG RP++   LIY    +L ES++ + L G    +LG+L+
Sbjct  70   VSPYMAPTWCTTLERSVLWIGGCRPSSYIRLIYALCGMLTESNLTEFLNGSNTVNLGELS  129

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDGGSD----IIGM------------MSGKLD  377
              Q+  V ELQ +T+ EE  I+ +++  Q+   D    +I +            +   L 
Sbjct  130  GAQMSMVDELQKKTIAEERRISTRMAGLQEDVLDDPLAVIAVGSEGGSCGSSGTVEEALT  189

Query  376  AKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQL  248
                 +A  LE ADQLRM T+  ++ +LT  Q V +L A  +L
Sbjct  190  EHGGAMAATLEAADQLRMDTLVEVIRILTPSQGVSYLAAGKKL  232



>ref|XP_006366944.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum tuberosum]
Length=240

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 120/250 (48%), Gaps = 42/250 (17%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF++F + WF +  Q + +L       TT D   + + ++ +++SH  EYY  KS  +  
Sbjct  14   SFEAFLQGWFLRQEQFLNELTIT---QTTLDES-IMRNLISRILSHYQEYYEEKSRMSHI  69

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            ++  +F+  W T LE+S  WI G++P   F L+    + L E+                 
Sbjct  70   NVFYMFSPSWFTPLEKSFLWIAGFKPGLAFPLVMNSVNDLSEN-----------------  112

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGMMS------------GKLDA  374
               Q+ R++ L+ ET  EE  + D+L+  Q+      ++G+               ++D 
Sbjct  113  ---QIERINRLRIETRIEERNLMDKLAKLQESVAAPPLMGLAQQYGMEMLRDGEITEVDE  169

Query  373  KMEKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
            ++E L   +E     AD+LR +T  ++V +L   Q+++FL AAAQL   IR  G+  + +
Sbjct  170  EIEILRTAVENVVTDADRLRTRTADSVVGILNPLQSLKFLAAAAQLQLRIRMVGMQREAE  229

Query  205  RENNVSQ*SG  176
            R + +   +G
Sbjct  230  RRHQMDTSNG  239



>ref|XP_002888220.1| hypothetical protein ARALYDRAFT_893661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64479.1| hypothetical protein ARALYDRAFT_893661 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 105/238 (44%), Gaps = 43/238 (18%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA---  701
            +F SF   W  + RQ VQ+L       T     +  + ++   +SHC +YY  KS+A   
Sbjct  9    TFASFFNDWLLRHRQFVQELSHLADETTRTPVEE--ESLLSNFLSHCLQYYEEKSVAMSV  66

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            A  D+   F+ PW +S E+ + WIGG++P  VF LI T  + L                 
Sbjct  67   AGDDVYDFFSPPWLSSYEKLILWIGGFKPGMVFKLITTSVNDL-----------------  109

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGM------------------  395
               T  Q+ ++  ++ ET + E  +  + +  Q    D + M                  
Sbjct  110  ---TSHQIDQLENIRLETKRRERDLMRRFALLQQSVGDPLLMVPFRRIGVLSLGEGEQSE  166

Query  394  MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
            M   +D   E++   ++ ADQLR  T+  +VE+L  +QA++ L AA +    +R  G+
Sbjct  167  MEEAMDVMKEEMITAMKNADQLRCVTVGKVVEVLNPRQAIKLLRAAGEFYLLLRDLGV  224



>gb|KEH23189.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=231

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 110/247 (45%), Gaps = 47/247 (19%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPR-PATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            +F  F + W  + R  +  L  A + P   AD  +L   ++ +V+ H  +YY  KS  A 
Sbjct  8    AFDEFLQGWMIRQRNYLNDLLSAQQQPQELADSDRLN--LLNRVLCHYGQYYEEKSKIAH  65

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgd  515
            ++IL +F+ PW +SLE+S  W+ G++P   FHL+      L E                 
Sbjct  66   QNILLLFSPPWFSSLEKSFLWVAGFKPGLTFHLVNKTLEDLSED----------------  109

Query  514  LTPTQLRRVSELQCETVQEENYIADQLSDWQDGGS-----DII----------------G  398
                Q +R+SEL+ E   +E  + D+L+   +  +     D +                G
Sbjct  110  ----QRQRLSELKQEIKMKERELNDELAKVHESMAAPPVLDNVRSHGRVCLSRSFMAEEG  165

Query  397  MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGIN  218
             +S      +E L   +  AD LR +T   +V++L   Q + F +A A+L   +R  G +
Sbjct  166  TVSSSFKETLENL---VTNADALRTETALRVVQILKPAQVLNFFVAVAELQLKVRSLGFD  222

Query  217  HDRQREN  197
             D QREN
Sbjct  223  KDAQREN  229



>ref|XP_002272259.1| PREDICTED: transcription factor TGA3-like [Vitis vinifera]
Length=237

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/238 (29%), Positives = 113/238 (47%), Gaps = 44/238 (18%)
 Frame = -1

Query  868  FQSFHETWF---EQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            F+ F   W    E+LRQL+ Q  +        D     QE++ + ++H  EYY+ K    
Sbjct  15   FERFFRGWLVRQEELRQLLLQATE-----RDCDEEAGLQELIGRAVAHYAEYYKAKQRVV  69

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            + D+L +   PW T  ERSL WIGG++P   F L+         +++ ++          
Sbjct  70   REDVLILLGPPWLTPFERSLLWIGGFKPGFAFRLVT--------NYVTNL----------  111

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI--IGM-------MSGKLDAKME  365
              T  Q +R+ +L+ ET ++E  +  +LS  +   + I  + M       ++G+ D   E
Sbjct  112  --TEEQKQRMEQLRAETAEDERKLTAELSRVRTRPTAISLVEMATMARERVNGERDTVDE  169

Query  364  KL------AEIL-EKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            ++      AEIL E AD LR KT   ++ +L   Q V+FL+A  QL   +R W +  +
Sbjct  170  RIEMMKLAAEILVECADYLRCKTALKIMGILNPSQNVKFLLAVTQLQRRVRNWRMERE  227



>ref|XP_010439826.1| PREDICTED: uncharacterized protein LOC104723193 [Camelina sativa]
Length=279

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 126/259 (49%), Gaps = 35/259 (14%)
 Frame = -1

Query  883  IKKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSI  704
            I+K+    ++E W     + + +L QA       D+ +L+ ++ +  +    +Y   +S 
Sbjct  8    IEKVQEDCYNE-WMSLQARRMTELKQALSNGEK-DYAKLR-DLARTALRDFEDYAGKRSK  64

Query  703  AAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY------TE---SSILFESHIMD  551
             ++R     +   W T LE +L WIGG RP++   LIY      TE   S+ L   +I D
Sbjct  65   HSRRYSSNYYAPTWNTCLENALLWIGGCRPSSFIRLIYAMCGSQTEHRFSNFLRNDNIDD  124

Query  550  Ilrglrng--------dlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGM  395
            +   L            + DLT  QL +++EL  +TVQ EN ++ Q +  Q+  +DI   
Sbjct  125  LSMALGETHGEIGGGDSMSDLTAEQLFKINELHLKTVQAENKLSKQSASLQEDTADIPMA  184

Query  394  MSG---------------KLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIA  260
            M+                 LD   E +A +L +AD+LR+ T+T +VE+LTA QAV+FL+A
Sbjct  185  MAAFYKEEIGEADVVVERALDKHEEDMAGLLVEADKLRLTTLTKIVEILTAVQAVDFLLA  244

Query  259  AAQLMFGIRRWGINHDRQR  203
              +L   +  WG   + +R
Sbjct  245  GKKLHLAMHEWGRCREHRR  263



>ref|XP_010434502.1| PREDICTED: uncharacterized protein LOC104718448 [Camelina sativa]
Length=279

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 108/219 (49%), Gaps = 32/219 (15%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY--  590
            +++ +  +    +Y   +S  ++R     +   W T LE +L WIGG RP++   LIY  
Sbjct  45   RDLARTALRDFEDYAGKRSKHSRRYSSNYYAPTWNTCLENALLWIGGCRPSSFIRLIYAM  104

Query  589  ----TE---SSILFESHIMDIlrglrng--------dlgdLTPTQLRRVSELQCETVQEE  455
                TE   S+ L   +I D+   L            + DLT  QL +++EL  +TVQ E
Sbjct  105  CGSQTEHRFSNFLRNDNIDDLSMALGETHGETGGEDSMSDLTAEQLFKINELHLKTVQAE  164

Query  454  NYIADQLSDWQDGGSDIIGMMSG---------------KLDAKMEKLAEILEKADQLRMK  320
            N ++ Q +  Q+  +DI   M+                 LD   E +A +L +AD+LR+ 
Sbjct  165  NKLSKQSASLQEDTADIPMAMAAFYKEEIGETDVVVERALDKHEEDMAGLLVEADKLRLT  224

Query  319  TITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            T+T +VE+LTA QAV+FL+A  +L   +  WG   + +R
Sbjct  225  TMTKIVEILTAVQAVDFLLAGKKLHLAMHEWGRCREHRR  263



>ref|XP_002534284.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28101.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 120/255 (47%), Gaps = 43/255 (17%)
 Frame = -1

Query  868  FQSFHETWFE-------QLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVK  710
            F  F E W         QLR++V    +  +  T  D     Q +V KV  H  EYY +K
Sbjct  11   FSEFLEKWMRLLDGYLLQLRKVVSSKDRLNKHGTYCDEKL--QAIVSKVAQHYKEYYIIK  68

Query  709  SIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrn  530
               A  D+L  F+  W + LE +  WI  W+P+ VF L+ +    L  +H         +
Sbjct  69   WALAHEDVLAFFSPTWISPLETASSWITDWKPSVVFKLVDS----LRTNH----RVPGPS  120

Query  529  gdlgdLTPTQLRRVSELQCETVQEENY-----------IAD----QLSDW-----QDGG-  413
              L +LT  Q+R++ EL+ +   EE             IAD    +L+ W      DG  
Sbjct  121  STLAELTQEQVRKIEELKLKIRLEEQKVEREMERQQVAIADRKMVELARWVYRVKNDGKV  180

Query  412  SDIIGMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIR  233
            S + G++   L+  +  L ++++ AD +R++ +  ++++L+  Q VEFL A A L   +R
Sbjct  181  SQVEGLVQAALNGALAGLEKVMKAADCVRLRALKGILDVLSPFQCVEFLAATAMLHIQLR  240

Query  232  RWGINHDRQRENNVS  188
            +WG     +R +N++
Sbjct  241  QWG-----KRRHNIT  250



>ref|XP_002863451.1| hypothetical protein ARALYDRAFT_330831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39710.1| hypothetical protein ARALYDRAFT_330831 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 121/255 (47%), Gaps = 38/255 (15%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MS QS      +QL  LVQ+     R     +H +  +E+  K++    +Y   ++  A 
Sbjct  20   MSLQSQRINEVKQL--LVQR-----RSHRDEEHDKKLRELTGKILGDFKDYAGKRADLAH  72

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY------TESSIL--------FES--  563
            R     +   W T LE +L W+GG RP++ F LIY      TE  +         +ES  
Sbjct  73   RCSSNYYAPTWNTRLENALIWMGGCRPSSFFRLIYALCGSQTEIRVTQFLRNIDGYESSG  132

Query  562  HIMDIlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-------  404
             ++D+  G     L +L+  QL +++ L  + + EE  +  ++S  Q+  +DI       
Sbjct  133  RVLDVFGGGGGASLSNLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPIATVAY  192

Query  403  ----IG----MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQL  248
                IG    ++    D + E +A +L +AD LR+ T+  +VE+L+  QA +FL+A  +L
Sbjct  193  EMENIGEPNMVVDQAFDKQEEAMAGLLAQADNLRVDTLAKIVEILSPVQAADFLLAGKKL  252

Query  247  MFGIRRWGINHDRQR  203
               +  WG   DR+R
Sbjct  253  HLSMHEWGTTRDRRR  267



>ref|XP_002870028.1| hypothetical protein ARALYDRAFT_492991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46287.1| hypothetical protein ARALYDRAFT_492991 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 105/203 (52%), Gaps = 22/203 (11%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY--  590
            +++V K+++    Y R +S  + R     F   W + +E S+ W+GG RP++   LIY  
Sbjct  26   EDLVGKIVNDFQTYARKRSELSHRCCANYFAPSWNSPIENSMLWMGGCRPSSFIRLIYAL  85

Query  589  --TESSILFESHIMDIlrglrng---dlgdLTPTQLRRVSELQCETVQEENYIADQLSDW  425
              +++  L   +++ I           + DLT TQL +++EL  + +++E+ I    +++
Sbjct  86   CGSQAETLLTQNLLHIDENFDVNHGGFMSDLTATQLEKINELHMKVIKKEDKITKTSANF  145

Query  424  QDGGSDII---------GMMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVE  272
            QD  +D+            +   LD   E +A +L +AD+LR +T+  +VE++T  QA E
Sbjct  146  QDDVADMPIADVVVHGDAAVEDALDKHEEGMAVLLAEADKLRFETLRKIVEVMTPVQAAE  205

Query  271  FLIAAAQLMFGIRRWGINHDRQR  203
            FL+A  +L F +      HDR R
Sbjct  206  FLLAGKRLHFSL------HDRGR  222



>gb|ACV41800.1| delay of germination 1 [Lepidium sativum]
 gb|ACV41801.1| delay of germination 1 A [Lepidium sativum]
Length=279

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 122/248 (49%), Gaps = 27/248 (11%)
 Frame = -1

Query  865  QSFHETWF----EQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            +S ++ W     +++  L   L Q        D+    +E+++K++    +Y   ++  +
Sbjct  13   ESCYQEWMNLQSQRVPDLKHLLAQRRSNKANTDNDNKLRELLEKIIGDFKKYAGKRADLS  72

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIlrglrn  530
             R     +   W T LE +L W+GG RP++ F L+Y    +E+ I    ++ DI     +
Sbjct  73   HRCSSNYYAPSWNTPLENALLWMGGCRPSSFFRLVYALCGSETEIRVTQYLRDIDGLESS  132

Query  529  ----gdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------IG-  398
                  L DLT  QL +++ L  + +++E  +  +++  Q+  +DI           +G 
Sbjct  133  GGMGTSLSDLTAEQLAKINILHVKIIEDEEKMTKKVASLQEDAADIPIATVAYEEEHVGK  192

Query  397  ---MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
               ++   LD + E +A++L +AD LR++T+  +VE+L+  +A  FL+A  +L   +  W
Sbjct  193  PNMVVDQALDKQEESMAKLLGEADNLRVETLVKIVEILSPVEAANFLLAGKKLHLSMHEW  252

Query  226  GINHDRQR  203
            G   DR+R
Sbjct  253  GTMRDRRR  260



>ref|XP_009802153.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana sylvestris]
Length=247

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/247 (27%), Positives = 110/247 (45%), Gaps = 42/247 (17%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F E W  +  Q + +L  A             ++++ +V++H  EYY  KS  + R+
Sbjct  15   FGGFLEGWLIRQEQFLDELLVAQDTFDEETQEGAIRDLISRVLAHYQEYYEEKSRMSHRN  74

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +  VF+  W T LER+  WI G++P   F L+    + L E+                  
Sbjct  75   VFHVFSPTWFTPLERTFLWITGFKPGLAFTLVTDSVNDLSEN------------------  116

Query  508  PTQLRRVSELQCETVQEENYIADQLSDWQDG------------------GSDIIGMMSGK  383
              Q++R++ L+ ET  EE  + D+L+  Q+                    +D I +    
Sbjct  117  --QVQRINRLRYETKVEEKSLTDELAKIQESVAAPPLIEMARRVGMQLLHTDGINIEITD  174

Query  382  LDAKMEKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINH  215
             D  +E L   +E     AD+LR +T   +V LL+  Q++ FL AAAQL   +R  G+  
Sbjct  175  GDENIETLKSAMENVVTDADRLRTRTAERVVGLLSPLQSLRFLTAAAQLQLRLRMMGMQR  234

Query  214  DRQRENN  194
            + +R+ N
Sbjct  235  EAERQQN  241



>ref|XP_009607760.1| PREDICTED: transcription factor TGA6-like [Nicotiana tomentosiformis]
Length=255

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/235 (28%), Positives = 120/235 (51%), Gaps = 15/235 (6%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQ----QEMVQKVMSHCHEYYRVKSIAA  698
            ++ +++W     Q + +L  A   AT A  +Q       +++ +++++   Y   +S  A
Sbjct  24   ENLYQSWMYNQNQELNELENA---ATLARENQKNDTELNQLLARMVNNFQGYVNGRSRLA  80

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlg  518
            + D+   F   W T LE S+ WIGG RP++   LIY    +  ESH+ + L+G + GD G
Sbjct  81   RVDVSPYFAPTWCTPLENSVLWIGGCRPSSFIRLIYALCGMEIESHLNEFLQGTKIGDFG  140

Query  517  dLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGK--------LDAKMEK  362
             L+  Q+  + +LQ + + EE     +L+  Q+   D     + K        L+   + 
Sbjct  141  QLSGEQVTMIDKLQRKIIVEERKHCSKLASLQEDVVDQPIATAAKNRENEEEPLNKHGQG  200

Query  361  LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            +  +LE+AD+LRM  +  ++ +LT  Q VE+L AA ++   ++RWG   +++  N
Sbjct  201  MTTLLEEADELRMNALKEILGILTPIQGVEYLAAAKRIRLCLQRWGKKREQEHNN  255



>gb|EEC71515.1| hypothetical protein OsI_03809 [Oryza sativa Indica Group]
Length=294

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 108/241 (45%), Gaps = 52/241 (22%)
 Frame = -1

Query  763  QEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTE  584
            + +V++ M    EY   +   A+ D   +F  PW TS E S+ WIGG RP+    L+Y+ 
Sbjct  42   RAVVERCMRGYAEYVSTRRALAREDGAALFAPPWCTSFENSVLWIGGCRPSLTIRLLYSL  101

Query  583  SSILFESHIMDIlrglrngdlgdL------TPTQLRRVSELQCETVQEENYIADQLSDWQ  422
            S    E HI + + G               T  QL  V++L   T+++E+ ++D+L+  Q
Sbjct  102  SGEGLEEHIEEFISGRGALGAARGMGLLGITARQLELVNDLHRRTLRDEDALSDRLATLQ  161

Query  421  DGGSD---------------------------------IIGMMSGKLDAKMEK-------  362
            +  +D                                 ++    G +D +++        
Sbjct  162  EDVADRPLLPIVRERATAAAAALGAGASCDGLATRTRLVVATPEGAVDHEVDAAIGRYKA  221

Query  361  -LAEILEKADQLRMKTITNLV-ELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQRENNVS  188
             L  +LE+AD+LRM T   LV E+LT +QAVE L+AA QL   +R W     R+ E  V+
Sbjct  222  GLGRLLEEADELRMSTAQTLVTEILTPRQAVETLVAAKQLHLKVRSW----SRRGEAAVT  277

Query  187  Q  185
            Q
Sbjct  278  Q  278



>gb|KDP24433.1| hypothetical protein JCGZ_24997 [Jatropha curcas]
Length=232

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 109/250 (44%), Gaps = 35/250 (14%)
 Frame = -1

Query  910  HNSKN*RN*IKKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHC  731
            H S   R      SF+ F E W  +    + +L    +    +    L+ +++ +V+SH 
Sbjct  3    HGSGKGRGDANAGSFEEFFEGWLVRQEHYLDELLSVEQHYHESRDEDLK-DLIARVLSHY  61

Query  730  HEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMD  551
             +YY  KS  A+R++  VF+ PW T  +R+L WI G++P   F ++    + L E     
Sbjct  62   EQYYEEKSRMAQRNVFLVFSPPWFTPFQRTLLWIAGFKPALTFQIVNGSVNDLSED----  117

Query  550  IlrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQD--GGSDIIGMMSGKLD  377
                            Q +R+S L  ET   E  + D+L+   +      ++ +   +  
Sbjct  118  ----------------QSQRMSRLNEETTASERILTDELARIHESVASPPLLDLARRQGR  161

Query  376  AKMEK------------LAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIR  233
             + E+            +  ++  AD LR  T+T +VE+L   Q V+FL AA QL   IR
Sbjct  162  GRWEEDEVSYKSTIGSAMESLVATADLLRTNTVTKVVEILNPVQNVKFLSAATQLHLRIR  221

Query  232  RWGINHDRQR  203
              G+   R R
Sbjct  222  NLGLQRQRHR  231



>ref|XP_011081582.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=249

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 114/237 (48%), Gaps = 18/237 (8%)
 Frame = -1

Query  865  QSFHETWFE-QLRQLVQQLGQAPRPATTADHHQLQQ-EMVQKVMSHCHEYYRVKSIAAKR  692
            Q  ++ W   Q ++L + L  +     T D +  +  ++++K++ H  +Y   +   A R
Sbjct  10   QCLYKEWMRLQEQELSELLHHSLNLNNTTDTNDAETTQLLEKIIQHFQDYCDNRRHLAHR  69

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
             +   F+  W T+LE S+ WI G RP++ F+L+Y       +S +        N D    
Sbjct  70   HVSAFFSPSWCTTLENSMSWIAGCRPSSFFNLVYALCGSNIDSSLSQF-LQDGNSDFPKF  128

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-IGMMSGKLDAKME----------  365
            + +QL  + +LQ  T  EE  +  Q++  Q   +D+ + +++ +L  + E          
Sbjct  129  SASQLSAIDKLQRRTTIEEEMLTAQMASLQQDMTDMPLALIARELSPRNELNLDVQKRLG  188

Query  364  ----KLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQ  206
                 +   +  AD LR+ T+  L ++L   QA+E++IAA +L   I+ WGI  DR+
Sbjct  189  KFEQAMRSAMNDADNLRINTVKELFKILKPVQALEYIIAAKKLRLCIQSWGIEKDRE  245



>ref|XP_009623095.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
Length=247

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 116/248 (47%), Gaps = 42/248 (17%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            SF  F E W  +  Q +++L  A           + ++++ +V++H  EYY  KS  + R
Sbjct  14   SFGVFLEGWLIRQEQYLEELLVAQDTFDEETEEGVIRDLISRVLAHYQEYYEEKSRMSHR  73

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            ++  VF+  W T LER+  WI G++P   F L+ T+S       + D+            
Sbjct  74   NVFLVFSPTWFTPLERTFLWITGFKPGLAFTLV-TDS-------VNDL------------  113

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDG------------------GSDIIGMMSG  386
            +  Q++R++ L+ ET  EE  + D+L+  Q+                    +D I +   
Sbjct  114  SGNQVQRINRLRYETKIEEKSLTDELAKIQESVAAPPLMELARRIGMQLLYTDGINIEIT  173

Query  385  KLDAKMEKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGIN  218
              D  +E L   +E     AD+LR +T   +V +L+  Q++ FL AAAQL   +R  G+ 
Sbjct  174  DGDENIETLKSAMENVVTDADRLRTRTAERVVGVLSPLQSLRFLTAAAQLQLRLRMMGMQ  233

Query  217  HDRQRENN  194
             + +R+ N
Sbjct  234  REAERQQN  241



>emb|CAB37450.1| putative protein [Arabidopsis thaliana]
 emb|CAB78867.1| putative protein [Arabidopsis thaliana]
Length=229

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 109/232 (47%), Gaps = 35/232 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F  F+E+W  QL   + QL  A    T ++     + ++ K+ +H   YY  K  A + 
Sbjct  8    KFLEFYESWVIQLELYLHQLLIAHNNNTMSETEL--RHLISKLTTHHKAYYTAKWAAIRE  65

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L  F + W   LE +  W+ GW+P+ VF ++      L +S ++ +            
Sbjct  66   DVLAFFGSVWLNPLENACSWLTGWKPSMVFRMV----DRLRKSRVVLV------------  109

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDG------------GSDIIGMMSGKLDAKM  368
               Q++++ EL+ +T  +E  I  ++  +Q              G  + G     ++A +
Sbjct  110  -EAQVKKLEELRVKTKFDEQKIEREMERYQVAMADRKMVELARLGCHVGGESVMVVEAAV  168

Query  367  EKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
              L+  LEK    AD +R+KT+  ++++LT  Q VEFL AAA     +RRWG
Sbjct  169  RGLSMGLEKMVKAADCVRLKTLKGILDILTPPQCVEFLAAAATFQVQLRRWG  220



>gb|AJE25535.1| DOG1-like protein [Brassica napus]
Length=280

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 109/219 (50%), Gaps = 24/219 (11%)
 Frame = -1

Query  790  TTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPT  611
              AD  +L+ E+ QK++    +Y R ++  + R     +   W T LE +L W+GG RP+
Sbjct  46   AAADDKKLR-ELTQKIIGDFKDYARKRADLSHRCSSSYYAPSWNTPLENALIWMGGCRPS  104

Query  610  TVFHLIY----TESSILFESHIMDI----lrglrngdlgdLTPTQLRRVSELQCETVQEE  455
            + F L+Y    +++ I     + +I      G     L DLT  QL +++ L  + + EE
Sbjct  105  SFFRLVYALCGSQTEIRVTQFLRNIDGYDASGSGGASLSDLTAEQLAKINVLHVKIIDEE  164

Query  454  NYIADQLSDWQDGGSDI-----------IG----MMSGKLDAKMEKLAEILEKADQLRMK  320
              +  ++S  Q+  +DI           +G     +   LD + E +A +L +AD LR+ 
Sbjct  165  EKMTKKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLRVY  224

Query  319  TITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            T++ ++E+L   QA +FL+A  +L   +  WG   DR+R
Sbjct  225  TLSKIIEVLAPMQAADFLLAGKKLHLSMHAWGALRDRRR  263



>emb|CDY61468.1| BnaCnng37860D [Brassica napus]
 gb|AJE25536.1| DOG1-like protein [Brassica napus]
Length=280

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 113/234 (48%), Gaps = 23/234 (10%)
 Frame = -1

Query  835  LRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWAT  656
            L+Q + Q       A  A   +  +E+ QK++    +Y R ++  + R     +   W T
Sbjct  30   LKQALAQRRSHEGTADAATDEKKLRELTQKIIGDFKDYARKRADLSHRCSSNYYAPSWNT  89

Query  655  SLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDI----lrglrngdlgdLTPTQ  500
             LE +L W+GG RP++ F L+Y    +++ I     + ++      G     L DLT  Q
Sbjct  90   PLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNVDGYDTSGSGGASLSDLTAEQ  149

Query  499  LRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------IG----MMSGKLDAKME  365
            L +++ L  + + EE  +  ++S  Q+  +DI           +G     +   LD + E
Sbjct  150  LAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEE  209

Query  364  KLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
             +A +L +AD LR+ T++ ++E+L   QA +FL+A  +L   +  WG   DR+R
Sbjct  210  AMATLLAEADNLRVYTLSKIIEVLAPMQAADFLLAGIKLHLSMHSWGALRDRRR  263



>gb|ACV41802.1| delay of germination 1, partial [Brassica rapa subsp. pekinensis]
Length=258

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 109/219 (50%), Gaps = 24/219 (11%)
 Frame = -1

Query  790  TTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPT  611
              AD  +L+ E+ QK++    +Y R ++  + R     +   W T LE +L W+GG RP+
Sbjct  24   AAADDKKLR-ELTQKIIGDFKDYARKRADLSHRCSSSYYAPSWNTPLENALIWMGGCRPS  82

Query  610  TVFHLIY----TESSILFESHIMDI----lrglrngdlgdLTPTQLRRVSELQCETVQEE  455
            + F L+Y    +++ I     + +I      G     L DLT  QL +++ L  + + EE
Sbjct  83   SFFRLVYALCGSQTEIRVTQFLRNIDGYDASGSGGASLSDLTGEQLAKINVLHLKIIDEE  142

Query  454  NYIADQLSDWQDGGSDI-----------IG----MMSGKLDAKMEKLAEILEKADQLRMK  320
              +  ++S  Q+  +DI           +G     +   LD + E +A +L +AD LR+ 
Sbjct  143  EKMTKKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLRVY  202

Query  319  TITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            T++ ++E+L   QA +FL+A  +L   +  WG   DR+R
Sbjct  203  TLSKIIEVLAPMQAADFLLAGKKLHLSMHAWGALRDRRR  241



>ref|XP_006414073.1| hypothetical protein EUTSA_v10027388mg [Eutrema salsugineum]
 gb|ESQ55526.1| hypothetical protein EUTSA_v10027388mg [Eutrema salsugineum]
Length=238

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/240 (28%), Positives = 111/240 (46%), Gaps = 32/240 (13%)
 Frame = -1

Query  892  RN*IKKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQ-QEMVQKVMSHCHEYYR  716
            RN I++  F  F+E W  QL Q + QL  A    T     +++ + M+ K+ +H   YY 
Sbjct  2    RNRIEE-KFLEFYEGWIFQLEQYLHQLIVAHNNYTNNTMSEMELRGMISKLTTHHKAYYT  60

Query  715  VKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrgl  536
             K  A   D+L  F   W   LERS  W+ GW+P+  F ++         + +++     
Sbjct  61   AKWAAIGEDVLAFFGPVWLNPLERSCFWLTGWKPSMAFRIVDRLRKSWRPTVVLE-----  115

Query  535  rngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDG------------GSDIIGMM  392
                       Q++++ EL+ +T  +E  I  ++  +Q              G  I G  
Sbjct  116  ---------EAQVKKLEELRVKTRFDEEKIEREMERYQVAMADRKMVELAKLGCHIGGES  166

Query  391  SGKLDAKMEKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
            +  ++A ++ LA  LEK    AD  R+KT+  ++++L+  Q VEFL AAA     +RR G
Sbjct  167  AVVVEAAVKGLAMALEKMVKVADCARLKTLKGILDILSPPQCVEFLAAAAAFQVQLRRLG  226



>ref|XP_009769468.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=262

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 113/251 (45%), Gaps = 45/251 (18%)
 Frame = -1

Query  889  N*IKKMSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQ--LQQEMVQKVMSHCHEYYR  716
            N I   SF++F + W  +  Q + +L  A     T D  Q  + + ++  V++H  EY+ 
Sbjct  9    NNITVGSFEAFFQGWLLRQEQFLNELIIA---QNTFDESQEGVIKNLISGVLAHYQEYFE  65

Query  715  VKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrgl  536
             KS  + R++  VF+  W T LE+S  WI G++P   F L+      L            
Sbjct  66   EKSRMSHRNVFNVFSPAWFTPLEKSYLWIAGFKPGLAFSLVMNSVDDL------------  113

Query  535  rngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDG-------------GSDIIGM  395
                    +  Q+ R++ L+ ET  +E  + D+L+  Q+              G  ++  
Sbjct  114  --------SQNQVERINRLKFETRVQEKNLMDELAKIQESVAAPPFMGLAQQFGVHLLRG  165

Query  394  MSGKL---DAKMEKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGI  236
              GK+   D  +E L   LE     AD+LR +T   +V +L   Q++ FL AAAQL   I
Sbjct  166  DGGKIREVDENIETLRSALENVITDADKLRTRTAERVVGILNPLQSLRFLTAAAQLQLRI  225

Query  235  RRWGINHDRQR  203
            R  G+  + +R
Sbjct  226  RMLGMQTEAER  236



>ref|NP_193600.2| transcription factor-related protein [Arabidopsis thaliana]
 gb|AAO41945.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50710.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84072.1| transcription factor-related protein [Arabidopsis thaliana]
Length=232

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 109/232 (47%), Gaps = 35/232 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F  F+E+W  QL   + QL  A    T ++     + ++ K+ +H   YY  K  A + 
Sbjct  11   KFLEFYESWVIQLELYLHQLLIAHNNNTMSETEL--RHLISKLTTHHKAYYTAKWAAIRE  68

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+L  F + W   LE +  W+ GW+P+ VF ++      L +S ++ +            
Sbjct  69   DVLAFFGSVWLNPLENACSWLTGWKPSMVFRMV----DRLRKSRVVLV------------  112

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDWQDG------------GSDIIGMMSGKLDAKM  368
               Q++++ EL+ +T  +E  I  ++  +Q              G  + G     ++A +
Sbjct  113  -EAQVKKLEELRVKTKFDEQKIEREMERYQVAMADRKMVELARLGCHVGGESVMVVEAAV  171

Query  367  EKLAEILEK----ADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
              L+  LEK    AD +R+KT+  ++++LT  Q VEFL AAA     +RRWG
Sbjct  172  RGLSMGLEKMVKAADCVRLKTLKGILDILTPPQCVEFLAAAATFQVQLRRWG  223



>ref|XP_009377744.1| PREDICTED: transcription factor TGA4-like [Pyrus x bretschneideri]
Length=251

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 70/244 (29%), Positives = 112/244 (46%), Gaps = 47/244 (19%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F +F E W  +    + +L    +    A    L+ +++ +V+ H  +YY  KS  A R
Sbjct  13   TFVAFFEGWLVRQEHFLDELLSTQQTIDEARDEDLR-DLISRVLLHYQQYYDEKSRLAHR  71

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            D+  VF+  W +S ER+L WI G++P  VF ++ TES       + D+            
Sbjct  72   DVFLVFSPKWFSSYERTLLWIAGYKPGLVFRIV-TES-------VPDL------------  111

Query  511  TPTQLRRVSELQCETVQEENYIADQLSDW-------------------QDGG--SDIIGM  395
            +  Q   ++ L+ ET  EE  + D+L+                     +DGG   DI  +
Sbjct  112  SDRQRVNIARLREETRVEERALNDKLAKIHESVAAPPFVDVLRRYGRARDGGIVEDIAVI  171

Query  394  MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINH  215
             S K       L  +L  A+ LR   +T LVE+L+++QAV FL A AQ    IR  G+  
Sbjct  172  ESLK-----PALESVLVNANLLRTTMVTKLVEILSSRQAVRFLTAVAQFQLKIRSLGLER  226

Query  214  DRQR  203
            D ++
Sbjct  227  DAEK  230



>ref|XP_009101563.1| PREDICTED: transcription factor HBP-1b(c38) [Brassica rapa]
Length=280

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 109/219 (50%), Gaps = 24/219 (11%)
 Frame = -1

Query  790  TTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPT  611
              AD  +L+ E+ QK++    +Y R ++  + R     +   W T LE +L W+GG RP+
Sbjct  46   AAADDKKLR-ELTQKIIGDFKDYARKRADLSHRCSSSYYAPSWNTPLENALIWMGGCRPS  104

Query  610  TVFHLIY----TESSILFESHIMDI----lrglrngdlgdLTPTQLRRVSELQCETVQEE  455
            + F L+Y    +++ I     + +I      G     L DLT  QL +++ L  + + EE
Sbjct  105  SFFRLVYALCGSQTEIRVTQFLRNIDGYDASGSGGASLSDLTGEQLAKINVLHLKIIDEE  164

Query  454  NYIADQLSDWQDGGSDI-----------IG----MMSGKLDAKMEKLAEILEKADQLRMK  320
              +  ++S  Q+  +DI           +G     +   LD + E +A +L +AD LR+ 
Sbjct  165  EKMTKKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLRVY  224

Query  319  TITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQR  203
            T++ ++E+L   QA +FL+A  +L   +  WG   DR+R
Sbjct  225  TLSKIIEVLAPMQAADFLLAGKKLHLSMHAWGALRDRRR  263



>gb|EMT22752.1| hypothetical protein F775_12222 [Aegilops tauschii]
Length=308

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 119/254 (47%), Gaps = 50/254 (20%)
 Frame = -1

Query  811  GQAPRPATT--ADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSL  638
            G+AP  A T  A   +L+  +V++ M    EY   +   A+ +       PW T+ E S+
Sbjct  41   GEAPANAATERATDAELRA-VVERCMRGYQEYAASRRAMARENGAAFVAPPWCTAFENSV  99

Query  637  HWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL-----TPTQLRRVSELQC  473
             W+GG RP+    L+Y+ S    E  I + + G   G   ++     T TQL+++++L  
Sbjct  100  LWLGGCRPSLAIRLLYSISGEGLEEDIEEFVSGRGRGLAEEMGLIGITATQLQQINDLHR  159

Query  472  ETVQEENYIADQLSDWQDGGSD-----II-------------------------------  401
             T+++E Y+ ++L+  Q+  +D     I+                               
Sbjct  160  CTLRDEGYLTERLASLQENIADRPLLPIVRERAAAAAALVGQGRSAKRDDIAGRLAAAES  219

Query  400  -GMMSGKLDAKMEK----LAEILEKADQLRMKTITNLV-ELLTAQQAVEFLIAAAQLMFG  239
             G ++ ++DA ME     LA +LE+AD+LRM T   L  E+LT +QAVE L+AA QL   
Sbjct  220  SGGLAAEVDAAMESYSAGLARLLEEADELRMSTARALATEILTPRQAVEMLVAAKQLHLA  279

Query  238  IRRWGINHDRQREN  197
            +R W    +   +N
Sbjct  280  VRDWSRRKEEGAQN  293



>gb|AJE25537.1| DOG1-like protein [Brassica napus]
Length=280

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 118/252 (47%), Gaps = 32/252 (13%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQA--------PRPATTADHHQLQQEMVQKVMSHCHEYYRVK  710
            +S ++ W     Q V +L QA              AD ++L+ E+ Q ++     Y   +
Sbjct  13   ESCYQQWMSLQSQRVPELKQALAQRRTHEGTADAAADDNKLR-ELTQNIIGDFKNYAGKR  71

Query  709  SIAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIlr  542
            +  + R     +   W T LE +L W+GG RP++   L+Y    +++ IL    + +I  
Sbjct  72   ADLSHRCSSNYYAPSWNTPLENALLWMGGCRPSSFSRLVYALCGSQTDILVTQFLRNIDG  131

Query  541  glrngdlgdL----TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI----------  404
               +G  G      T  QL  ++ L  + + EE  +  ++S  Q+  +DI          
Sbjct  132  YNYSGSGGASLSDLTAEQLAEINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEE  191

Query  403  -IG----MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFG  239
             +G    M+   LD + E +A +L +AD LR+ T+T ++E+LT  QA +F +A  +L   
Sbjct  192  HVGEPNAMVDQALDKQEEAMATLLAEADNLRVDTLTKIIEILTPVQAGDFFMAGKKLHLS  251

Query  238  IRRWGINHDRQR  203
            + +WG   DR+R
Sbjct  252  MHQWGALRDRRR  263



>gb|AGG09198.1| delay of germination 1a [Lepidium papillosum]
Length=279

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/248 (26%), Positives = 123/248 (50%), Gaps = 27/248 (11%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLG--QAPRPATTA--DHHQLQQEMVQKVMSHCHEYYRVKSIAA  698
            +S ++ W     Q +  L    A R +  A  D+ +  +E+++K++     Y   ++  +
Sbjct  13   ESCYQEWMNLQSQRIPDLKHLSAQRRSNKANTDNDKKLRELLEKIIGDFKIYAGKRADLS  72

Query  697  KRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIlrglrn  530
             R     +   W T LE +L W+GG RP++ F L+Y    +E+ I    ++ DI     +
Sbjct  73   HRCSSNYYAPSWNTPLENALLWMGGCRPSSFFRLVYALCGSETEIRVTQYLRDIDGLESS  132

Query  529  ----gdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------IG-  398
                  L DLT  QL +++ L  + +++E  +  +++  Q+  +DI           +G 
Sbjct  133  GGMGTSLSDLTAEQLAKINILHVKIIEDEEKMTKKVASLQEDAADIPIATVAYEEEHVGK  192

Query  397  ---MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
               ++   LD + E +A++L +AD LR++T+  +VE+L+  +A  FL+A  +L   +  W
Sbjct  193  PNMVVDQALDKQEESMAKLLGEADNLRVETLVKIVEILSPVEAANFLLAGKKLHLSMHEW  252

Query  226  GINHDRQR  203
            G   DR+R
Sbjct  253  GTMRDRRR  260



>ref|XP_009613589.1| PREDICTED: transcription factor TGA6 [Nicotiana tomentosiformis]
Length=237

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 106/247 (43%), Gaps = 36/247 (15%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F ++ E W  QL + ++ L   P+  +    H+    +V K+ +H  +YY  K  AA  
Sbjct  8    NFSNYFENWMSQLEEFLRLLLIVPKEISHVKDHE---TLVNKMTAHHKDYYTAKWAAAHE  64

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            DIL  F   W + LE +  W+ GW+P+  F L+   +S L +  +  I          + 
Sbjct  65   DILSFFNPVWLSPLENAYLWVTGWKPSMAFRLLVGATSELSDEQVKSIDALKVKIRAEEE  124

Query  511  TP-------------------TQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMS  389
                                  +L   + ++      ++++ +QL           G++ 
Sbjct  125  RVEREMERQQVALGDRKMVELARLNSSTRVRTSGCTSDSHLNNQLD----------GLVE  174

Query  388  GKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDR  209
              L   M  L  +++ AD +R+KT+  L+++L   Q V  L A + L   +R+WG    R
Sbjct  175  VALKGLMISLERVMKMADCVRLKTLKGLLDILNPTQCVGLLAAISMLQIQMRKWG----R  230

Query  208  QRENNVS  188
            ++EN  S
Sbjct  231  KKENLCS  237



>gb|KFK31508.1| hypothetical protein AALP_AA6G121700 [Arabis alpina]
Length=278

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 116/247 (47%), Gaps = 26/247 (11%)
 Frame = -1

Query  865  QSFHETWFEQLRQLVQQLGQA---PRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            +S ++ W       V +L QA    R     +  +  +E++ K++     Y   ++  + 
Sbjct  16   ESCYQGWMAIQSGRVPELKQALAHRRSQNDPNADKTLRELIGKIIGDFKNYAGKRAHLSN  75

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIl----rg  539
                  +   W T LE +L W+GG RP++ F LIY    +++ I     + +I      G
Sbjct  76   LCGSNYYAPSWNTHLENALIWMGGCRPSSFFRLIYALCGSQTEIRVYQFLRNIDGYDPSG  135

Query  538  lrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------IG--  398
                 L DLT  QL +++ L  + + EE  +  ++S  Q+  +DI           +G  
Sbjct  136  GGGASLSDLTAEQLAKINVLHVKIIDEEEKLTKKISSLQEDAADIPIATVAYSEEHVGEP  195

Query  397  --MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
              M+   LD + E +A +L +AD LR+ T+T +VE+LT  Q  +FL+A  +L   +  WG
Sbjct  196  NAMVDKALDKQEEAMASLLAQADHLRVDTLTKIVEILTPTQGADFLLAGKKLHLSMHEWG  255

Query  223  INHDRQR  203
               DR+R
Sbjct  256  TVRDRRR  262



>ref|XP_007025357.1| Transcription factor-related, putative [Theobroma cacao]
 gb|EOY27979.1| Transcription factor-related, putative [Theobroma cacao]
Length=251

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/242 (26%), Positives = 116/242 (48%), Gaps = 33/242 (14%)
 Frame = -1

Query  868  FQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRD  689
            F  F E W  QL   +QQL +  + + +++  + QQ +V K+ +H  E+Y VK  AA  D
Sbjct  9    FSQFFEKWICQLDDYLQQLLRVSKESLSSEADE-QQALVSKLTAHYKEFYTVKWTAAHED  67

Query  688  ILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdLT  509
            +L  +   W + LE +  W+ GW+P+ +F L+ +          +            +LT
Sbjct  68   VLAFYCPVWLSKLENAYSWLTGWKPSMIFRLVESMRRTRVPGPGL-----------AELT  116

Query  508  PTQLRRVSELQCE-----------TVQEENYIAD-QLSDWQDGGSDI-IGMMSGKLDAKM  368
              QLR++ +L+ +             +++  +AD ++ +     S I  G + G++D  +
Sbjct  117  EEQLRKIEQLRMKIKLEEEKVEREMERQQVALADRKMVELVRMASRIRKGELVGQVDGLV  176

Query  367  E--------KLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            E         L  +++ AD +R+KT+  ++++L   Q+V+FL     L   +R+WG   D
Sbjct  177  EVAIKGILAGLERVMKAADCVRLKTLKGVLDVLNPSQSVDFLAGTCMLQIQLRQWGQRRD  236

Query  211  RQ  206
             Q
Sbjct  237  GQ  238



>gb|KCW69957.1| hypothetical protein EUGRSUZ_F03275, partial [Eucalyptus grandis]
Length=228

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 106/212 (50%), Gaps = 27/212 (13%)
 Frame = -1

Query  793  ATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRP  614
            A + D  +L+  +  K + H  +Y   +S  A+ D    F  PW TS E S  WIGG RP
Sbjct  17   ADSGDAEKLRS-LAGKSIQHFRDYLEARSQLAQHDAPSFFCPPWCTSFENSFLWIGGCRP  75

Query  613  TTVFHLIYTESSILFESHI----------MDIlrglrngdlgdLTPTQLRRVSELQCETV  464
            T    L+Y+ S    E+ +               G   G+LG++T +QL+ ++EL  +T+
Sbjct  76   TLAIRLVYSSSGSDLEAQLDGGARRGDDDRSNGSGGGGGNLGEITASQLKSINELHMKTL  135

Query  463  QEENYIADQLSDWQDGGSD----IIGMMSGKLDAKME-----------KLAEILEKADQL  329
            + E  ++ +++  Q+  +D    +I   SG++  + E            LA +L +AD+L
Sbjct  136  RMEEKLSGRMASMQEEIADDPLALIAKRSGRVGEESESVERVMKRHALSLARVLTEADEL  195

Query  328  RMKTITNLV-ELLTAQQAVEFLIAAAQLMFGI  236
            R+ T+  LV E+LT  QAVEFL+   +L   I
Sbjct  196  RLATLRELVEEILTPLQAVEFLVTTKKLHLSI  227



>ref|XP_006281774.1| hypothetical protein CARUB_v10027949mg [Capsella rubella]
 gb|EOA14672.1| hypothetical protein CARUB_v10027949mg [Capsella rubella]
Length=291

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/253 (27%), Positives = 120/253 (47%), Gaps = 31/253 (12%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAK  695
            MS QS      E++ +L Q L Q        D+    +E+  K++    EY   ++  A+
Sbjct  20   MSLQS------ERIPELKQLLAQRQSQHGDKDNDDKLRELTGKIIGDFKEYAGKRASLAR  73

Query  694  RDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIlrglrng  527
            R     +   W T LE +L W+GG RP++ F L+Y    +++ I     + +I     +G
Sbjct  74   RCSSNYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYESSG  133

Query  526  dlgdL-----TPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------IGM  395
              G       +  QL +++ L  + + EE  +  ++S  Q+  +DI           +G+
Sbjct  134  GGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKISSLQEDAADIPIATVAYEVEHVGV  193

Query  394  ----MSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRW  227
                +   LD + E +A +L +AD LR+ T+  +VE+L+  Q  +FL+A  +L   +  W
Sbjct  194  PNTVVDQALDKQEEAMASLLAEADHLRVDTLAKIVEILSPVQGADFLLAGKKLHLSMHEW  253

Query  226  GINHD-RQRENNV  191
            G   D R+RE+ V
Sbjct  254  GCMRDSRRREHMV  266



>emb|CDY52216.1| BnaAnng11390D [Brassica napus]
Length=280

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 118/251 (47%), Gaps = 32/251 (13%)
 Frame = -1

Query  862  SFHETWFEQLRQLVQQLGQA--------PRPATTADHHQLQQEMVQKVMSHCHEYYRVKS  707
            S ++ W     Q V +L QA              AD ++L+ E+ Q ++     Y   ++
Sbjct  14   SCYQQWMSLQSQRVPELKQALAQRRTHEGTADAAADDNKLR-ELTQNIIGDFKNYAGKRA  72

Query  706  IAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIl--  545
              + R     +   W T LE +L W+GG RP++ F L+Y    +++ I     + +I   
Sbjct  73   DLSHRCSSSYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGY  132

Query  544  --rglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------  404
               G     L DLT  QL +++ L  + + EE  +  ++S  Q+  +DI           
Sbjct  133  DYSGSGGASLSDLTAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEH  192

Query  403  IG----MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGI  236
            +G    M+   LD + E +A +L +AD LR+ T+  ++E+LT  QA +FL+A  +L   +
Sbjct  193  VGEPNAMVDQALDKQEEAMATLLAEADNLRVDTLAKIIEILTPVQAGDFLMAGKKLHLSM  252

Query  235  RRWGINHDRQR  203
              WG   DR+R
Sbjct  253  HHWGALRDRRR  263



>emb|CDY58051.1| BnaA06g40200D [Brassica napus]
Length=280

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 121/254 (48%), Gaps = 32/254 (13%)
 Frame = -1

Query  874  MSFQSFHETWFEQLRQLVQQLGQAPRPATTAD---HHQLQQEMVQKVMSHCHEYYRVKSI  704
            MS QS      +++  L Q L Q      TAD   + +  +E+ QK++    +Y R ++ 
Sbjct  20   MSLQS------QRVLDLKQALAQRRSHEGTADAAANDKKLRELTQKIIGDFKDYARKRAD  73

Query  703  AAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDI----  548
             + R     +   W + LE +L W+GG RP++ F L+Y    +++ I     + +I    
Sbjct  74   LSHRCSSSYYAPSWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYD  133

Query  547  lrglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------I  401
              G     L DLT  QL +++ L  + + EE  +  ++S  Q+  +DI           +
Sbjct  134  ASGSGGASLSDLTAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEHV  193

Query  400  G----MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIR  233
            G     +   LD + E +A +L + D LR+ T++ ++E+L   QA +FL+A  +L   + 
Sbjct  194  GEPNLAVDQALDKQEEAMATLLAEGDNLRVYTLSKIIEVLAPMQAADFLLAGKKLHLSMH  253

Query  232  RWGINHDRQRENNV  191
             WG   DR+R   V
Sbjct  254  AWGALRDRRRRECV  267



>ref|XP_009114387.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Brassica rapa]
Length=280

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 118/251 (47%), Gaps = 32/251 (13%)
 Frame = -1

Query  862  SFHETWFEQLRQLVQQLGQA--------PRPATTADHHQLQQEMVQKVMSHCHEYYRVKS  707
            S ++ W     Q V +L QA              AD ++L+ E+ Q ++     Y   ++
Sbjct  14   SCYQQWMSIQSQRVPELKQALAQRRTHEGTADAAADDNKLR-ELTQNIIGDFKNYAGKRA  72

Query  706  IAAKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIY----TESSILFESHIMDIl--  545
              + R     +   W T LE +L W+GG RP++ F L+Y    +++ I     + +I   
Sbjct  73   DLSHRCSSSYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGY  132

Query  544  --rglrngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDI-----------  404
               G     L DLT  QL +++ L  + + EE  +  ++S  Q+  +DI           
Sbjct  133  DYSGSGGASLSDLTAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEH  192

Query  403  IG----MMSGKLDAKMEKLAEILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGI  236
            +G    M+   LD + E +A +L +AD LR+ T+  ++E+LT  QA +FL+A  +L   +
Sbjct  193  VGEPNAMVDQALDKQEEAMATLLAEADNLRVDTLAKIIEILTPVQAGDFLMAGKKLHLSM  252

Query  235  RRWGINHDRQR  203
              WG   DR+R
Sbjct  253  HHWGALRDRRR  263



>ref|XP_004486274.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Cicer arietinum]
Length=234

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 112/228 (49%), Gaps = 20/228 (9%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
             F  F++ W  +L +++ QL Q  +        Q  Q +V KV +H  EYY VK  AA  
Sbjct  8    KFSEFYQKWIFKLEEILHQLLQVSKT-----EEQEIQSLVSKVTTHLKEYYTVKWGAAHE  62

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLI--------YTESSILFESHIMDIlrgl  536
            D++  FT  W + LE +  W+ GW+P+TVF ++         TE     +  I ++   +
Sbjct  63   DVVIFFTPTWLSPLENAHLWVTGWKPSTVFRILDGLNAAFDMTEEQ---KKKIDELRVRV  119

Query  535  rngdlgdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMSGKLDAKMEKLA  356
            R  +       + ++V+    + V+    +A      + G + + G++   L A    L 
Sbjct  120  RIEEEKVEREMERQQVAMADLKMVE----LAKLSCRARKGDARVDGLVGVALKAVFGGLE  175

Query  355  EILEKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHD  212
            ++++ +D +R+KT+  ++++LT  Q VEFL A   +   +R++G+  D
Sbjct  176  KVMKTSDCVRLKTLKGVLDVLTPIQCVEFLAANIGIQLRLRKFGMKRD  223



>ref|XP_010316825.1| PREDICTED: transcription factor TGA6 [Solanum lycopersicum]
Length=219

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 113/230 (49%), Gaps = 25/230 (11%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIAAKR  692
            +F  + E W  QL +L++QL   PR  +  + H+L   +V K+ +H   YY  K  AA  
Sbjct  8    NFTKYFENWMIQLEELLKQLVIVPRETSYVNDHEL---LVSKMTTHHKNYYTAKWAAAHE  64

Query  691  DILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdlgdL  512
            DIL  FT  W + LE    WI GW+P+  F L+        +  + +I            
Sbjct  65   DILAFFTPMWLSPLEIVYSWITGWKPSMAFRLVSGGGGAFSDEELKNIDGLR--------  116

Query  511  TPTQLR-RVSELQCETVQEENYIAD----QLSDWQDGGSDIIGMMSGKLDAKMEKLAEIL  347
               ++R    +++ E  +++  I D    +L+  ++   +++ +    L   +E+   ++
Sbjct  117  --VKIRGEEEKVEREMERQQVAIGDRKMVELARIRNDNDELVELALKGLRMSLER---VM  171

Query  346  EKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGINHDRQREN  197
            + AD +R+KT+  L+E+L+  Q+V+FL A + +   +R+ G    R+R N
Sbjct  172  KMADCVRLKTLKGLLEILSPLQSVDFLAAISTIQIQMRKRG----RKRIN  217



>ref|XP_006285421.1| hypothetical protein CARUB_v10006838mg [Capsella rubella]
 gb|EOA18319.1| hypothetical protein CARUB_v10006838mg [Capsella rubella]
Length=281

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 110/209 (53%), Gaps = 22/209 (11%)
 Frame = -1

Query  787  TADHHQLQQEMVQKVMSHCHEYYRVKSIAAKRDILGVFTAPWATSLERSLHWIGGWRPTT  608
            ++D H+L  E+V K+++   +Y   +S  + R      T  W ++LE  L W+GG RP++
Sbjct  42   SSDDHKLG-ELVGKILNDFKKYAEKRSELSNRSCSSYLTPSWNSALENGLLWMGGCRPSS  100

Query  607  VFHLIY----TESSILFESHIMDIlrglrng---dlgdLTPTQLRRVSELQCETVQEENY  449
               +IY    +++      +++DI   ++      + DLT TQL +++EL  + +++E+ 
Sbjct  101  FVRVIYALCGSQAETQLSQYLLDIDENVKVNHGVFMSDLTATQLAKINELHMKVIEKEDK  160

Query  448  IADQLSDWQDGGSDI--------IGMMSGK------LDAKMEKLAEILEKADQLRMKTIT  311
            +  + +  Q+  +D+        + ++ G       LD   E +A ++ +AD LR +T+ 
Sbjct  161  VTKKSASLQENVADMPIAIAAYAMDLVDGNVVVKDALDKHEEGMAALMGEADTLRFETLR  220

Query  310  NLVELLTAQQAVEFLIAAAQLMFGIRRWG  224
             +VE++T  QA EFL+A  +L   +  WG
Sbjct  221  KIVEVITPVQAAEFLLAGKRLHVSLHEWG  249



>dbj|BAH30346.1| hypothetical protein [Arabidopsis thaliana]
Length=225

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 107/238 (45%), Gaps = 42/238 (18%)
 Frame = -1

Query  871  SFQSFHETWFEQLRQLVQQLGQAPRPATTADHHQLQQEMVQKVMSHCHEYYRVKSIA---  701
            +F SF   W  + RQ VQQL       T     + ++ +V   +SH  +YY  KS+A   
Sbjct  9    TFASFFNDWLCRHRQFVQQLAHLADKTTIVTPIE-EESLVSNFLSHYLQYYEEKSVAMSV  67

Query  700  AKRDILGVFTAPWATSLERSLHWIGGWRPTTVFHLIYTESSILFESHIMDIlrglrngdl  521
            A  DI   F+ PW +S E+ + WIGG++P  VF LI T  + L                 
Sbjct  68   AGDDIYDFFSPPWLSSYEKLILWIGGFKPGMVFKLITTSVNDL-----------------  110

Query  520  gdLTPTQLRRVSELQCETVQEENYIADQLSDWQDGGSDIIGMMS----GKL------DAK  371
               T  Q+ ++  ++ ET + E  +  + +  Q    D + M+     G L        +
Sbjct  111  ---TSHQIDQLESIRLETKRRERDLMRRFALLQQSVGDPLLMVPFRRIGVLRLGEGEQPE  167

Query  370  MEKLAEIL--------EKADQLRMKTITNLVELLTAQQAVEFLIAAAQLMFGIRRWGI  221
            ME   E+L        + ADQLR  T+  +VE+L  +Q+++ L AA +    +R  G+
Sbjct  168  MEDAMEVLKVEMIKAMKNADQLRCVTVGKVVEVLNPRQSIKLLRAAGEFYLRLRDLGV  225



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2307507805398