BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16116_g1_i2 len=1946 path=[821:0-644 2764:645-645 1465:646-1945]

Length=1946
                                                                      Score     E

ref|XP_009769412.1|  PREDICTED: probable apyrase 7                      598   0.0      
ref|XP_011071932.1|  PREDICTED: probable apyrase 7                      577   0.0      
ref|XP_006476828.1|  PREDICTED: probable apyrase 7-like isoform X1      486   5e-161   
gb|KDO69558.1|  hypothetical protein CISIN_1g008515mg                   486   5e-161   
ref|XP_006439869.1|  hypothetical protein CICLE_v10019521mg             486   6e-161   
ref|XP_004298967.1|  PREDICTED: probable apyrase 7-like                 479   2e-158   
ref|XP_010678812.1|  PREDICTED: probable apyrase 7 isoform X1           477   1e-157   
gb|KDP31065.1|  hypothetical protein JCGZ_11441                         475   1e-156   
ref|XP_010102520.1|  Nucleoside-diphosphatase mig-23                    473   2e-156   
ref|XP_011046181.1|  PREDICTED: probable apyrase 7 isoform X1           473   5e-156   
ref|XP_011046156.1|  PREDICTED: probable apyrase 7 isoform X1           473   5e-156   
ref|XP_007209872.1|  hypothetical protein PRUPE_ppa003837mg             468   6e-154   
emb|CBI14994.3|  unnamed protein product                                468   4e-153   
ref|XP_002278485.3|  PREDICTED: probable apyrase 7                      464   2e-152   Vitis vinifera
ref|XP_007036306.1|  GDA1/CD39 nucleoside phosphatase family prot...    464   3e-152   
ref|XP_008244997.1|  PREDICTED: probable apyrase 7                      459   7e-151   
gb|EYU22154.1|  hypothetical protein MIMGU_mgv1a004670mg                456   7e-150   
ref|XP_002321616.2|  hypothetical protein POPTR_0015s09140g             449   7e-147   Populus trichocarpa [western balsam poplar]
ref|XP_011046182.1|  PREDICTED: probable apyrase 7 isoform X2           444   2e-145   
ref|XP_011046157.1|  PREDICTED: probable apyrase 7 isoform X2           444   2e-145   
ref|XP_010027400.1|  PREDICTED: probable apyrase 7                      437   1e-141   
ref|XP_006600631.1|  PREDICTED: probable apyrase 7-like isoform X2      422   2e-136   
ref|XP_006600630.1|  PREDICTED: probable apyrase 7-like isoform X1      419   4e-135   
ref|XP_004157831.1|  PREDICTED: probable apyrase 7-like                 419   9e-135   
ref|XP_004508886.1|  PREDICTED: probable apyrase 7-like                 414   6e-133   
ref|XP_004152561.1|  PREDICTED: probable apyrase 7-like                 413   1e-132   
ref|XP_008438672.1|  PREDICTED: probable apyrase 7                      414   2e-132   
ref|XP_007155454.1|  hypothetical protein PHAVU_003G202700g             410   1e-131   
gb|KEH31816.1|  GDA1/CD39 nucleoside phosphatase family protein         405   1e-129   
gb|KHG10426.1|  Apyrase                                                 380   2e-120   
ref|XP_002511362.1|  adenosine diphosphatase, putative                  333   2e-103   Ricinus communis
ref|XP_010678813.1|  PREDICTED: probable apyrase 7 isoform X2           323   2e-99    
ref|XP_010678814.1|  PREDICTED: probable apyrase 7 isoform X3           323   2e-99    
ref|XP_008374884.1|  PREDICTED: probable apyrase 7                      327   1e-98    
emb|CAN78602.1|  hypothetical protein VITISV_007378                     288   2e-86    Vitis vinifera
emb|CDP16931.1|  unnamed protein product                                278   4e-84    
ref|XP_009394436.1|  PREDICTED: probable apyrase 7                      276   1e-78    
ref|XP_006830097.1|  hypothetical protein AMTR_s00123p00080920          268   1e-75    
ref|XP_002441234.1|  hypothetical protein SORBIDRAFT_09g022850          265   7e-75    Sorghum bicolor [broomcorn]
ref|XP_010111782.1|  Ectonucleoside triphosphate diphosphohydrola...    265   1e-74    
ref|XP_004961804.1|  PREDICTED: probable apyrase 7-like isoform X1      264   2e-74    
ref|XP_003557508.1|  PREDICTED: probable apyrase 7                      261   2e-73    
gb|AFW78299.1|  putative nucleoside phosphatase GDA1/CD39 family ...    259   6e-73    
ref|XP_006385169.1|  nucleoside phosphatase family protein              260   1e-72    
ref|XP_008649721.1|  PREDICTED: probable apyrase 7                      259   2e-72    
ref|XP_006654523.1|  PREDICTED: probable apyrase 7-like                 259   2e-72    
ref|XP_007221964.1|  hypothetical protein PRUPE_ppa001790mg             259   4e-72    
ref|XP_011028520.1|  PREDICTED: probable apyrase 7                      259   4e-72    
gb|KDP37807.1|  hypothetical protein JCGZ_06709                         258   9e-72    
ref|XP_009385985.1|  PREDICTED: probable apyrase 7                      256   1e-71    
ref|XP_008787941.1|  PREDICTED: probable apyrase 7                      256   1e-71    
gb|AAM08556.1|AC092749_9  Putative nucleoside phosphatase               255   3e-71    Oryza sativa [red rice]
ref|XP_002966332.1|  hypothetical protein SELMODRAFT_407789             252   3e-71    
ref|NP_001064408.1|  Os10g0350500                                       255   5e-71    Oryza sativa Japonica Group [Japonica rice]
gb|EAY78135.1|  hypothetical protein OsI_33182                          254   6e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_010940026.1|  PREDICTED: probable apyrase 7                      254   6e-71    
ref|XP_010936778.1|  PREDICTED: LOW QUALITY PROTEIN: probable apy...    254   1e-70    
ref|XP_008221118.1|  PREDICTED: probable apyrase 7                      253   6e-70    
ref|XP_002978228.1|  hypothetical protein SELMODRAFT_443766             251   7e-70    
gb|EYU20055.1|  hypothetical protein MIMGU_mgv1a001966mg                251   2e-69    
ref|XP_002533795.1|  adenosine diphosphatase, putative                  250   5e-69    Ricinus communis
ref|XP_008782414.1|  PREDICTED: probable apyrase 7                      249   5e-69    
ref|XP_002273561.1|  PREDICTED: probable apyrase 7                      250   7e-69    Vitis vinifera
ref|XP_010449381.1|  PREDICTED: probable apyrase 7                      249   1e-68    
ref|XP_009420860.1|  PREDICTED: probable apyrase 7                      248   1e-68    
ref|XP_010434438.1|  PREDICTED: probable apyrase 7                      249   2e-68    
emb|CAN73342.1|  hypothetical protein VITISV_042406                     249   2e-68    Vitis vinifera
gb|EYU43437.1|  hypothetical protein MIMGU_mgv1a001715mg                248   3e-68    
ref|XP_006482408.1|  PREDICTED: probable apyrase 7-like isoform X1      247   7e-68    
gb|EMS62472.1|  Ectonucleoside triphosphate diphosphohydrolase 8        246   7e-68    
ref|XP_003612462.1|  Ectonucleoside triphosphate diphosphohydrolase     246   7e-68    
ref|XP_006430913.1|  hypothetical protein CICLE_v10011132mg             247   7e-68    
ref|XP_010054004.1|  PREDICTED: probable apyrase 7                      246   1e-67    
ref|NP_567579.2|  GDA1/CD39 nucleoside phosphatase family protein       246   1e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132598.1|  PREDICTED: probable apyrase 7                      245   2e-67    
emb|CDX78924.1|  BnaA01g09910D                                          245   2e-67    
dbj|BAJ93718.1|  predicted protein                                      245   2e-67    
ref|XP_007040844.1|  GDA1/CD39 nucleoside phosphatase family prot...    246   2e-67    
emb|CDX99396.1|  BnaC01g11560D                                          243   3e-67    
ref|XP_004512309.1|  PREDICTED: probable apyrase 7-like                 244   4e-67    
ref|XP_010256291.1|  PREDICTED: probable apyrase 7 isoform X2           244   5e-67    
ref|XP_004509482.1|  PREDICTED: probable apyrase 7-like isoform X1      244   5e-67    
emb|CDP13976.1|  unnamed protein product                                244   1e-66    
ref|XP_010277647.1|  PREDICTED: probable apyrase 7                      244   1e-66    
ref|XP_010256289.1|  PREDICTED: probable apyrase 7 isoform X1           244   1e-66    
ref|XP_006282448.1|  hypothetical protein CARUB_v10004214mg             243   1e-66    
ref|XP_002867950.1|  nucleoside phosphatase family protein              243   2e-66    
ref|XP_008377056.1|  PREDICTED: probable apyrase 7                      242   4e-66    
ref|XP_006841011.1|  hypothetical protein AMTR_s00085p00097760          229   4e-66    
ref|XP_010535960.1|  PREDICTED: probable apyrase 7                      242   6e-66    
ref|XP_004147770.1|  PREDICTED: probable apyrase 7-like                 241   7e-66    
ref|XP_006413999.1|  hypothetical protein EUTSA_v10024508mg             241   7e-66    
ref|XP_011084872.1|  PREDICTED: probable apyrase 7                      241   8e-66    
gb|KHG13526.1|  Ectonucleoside triphosphate diphosphohydrolase 1        242   8e-66    
ref|XP_008451878.1|  PREDICTED: probable apyrase 7                      241   1e-65    
ref|XP_006355646.1|  PREDICTED: probable apyrase 7-like                 241   2e-65    
ref|XP_007156349.1|  hypothetical protein PHAVU_003G279000g             239   3e-65    
gb|EPS73668.1|  nucleoside phosphatase family protein                   233   8e-65    
ref|XP_011076655.1|  PREDICTED: probable apyrase 7                      238   1e-64    
ref|XP_004291300.1|  PREDICTED: probable apyrase 7-like                 237   3e-64    
ref|XP_010692947.1|  PREDICTED: probable apyrase 7                      236   5e-64    
ref|XP_009588053.1|  PREDICTED: probable apyrase 7                      236   8e-64    
ref|XP_009804492.1|  PREDICTED: probable apyrase 7                      235   1e-63    
ref|XP_004239949.1|  PREDICTED: probable apyrase 7                      235   2e-63    
gb|EMT02116.1|  Ectonucleoside triphosphate diphosphohydrolase 8        230   1e-62    
gb|AET03506.2|  GDA1/CD39 nucleoside phosphatase family protein         231   3e-62    
ref|XP_003629030.1|  Ectonucleoside triphosphate diphosphohydrolase     231   3e-62    
ref|XP_009136998.1|  PREDICTED: LOW QUALITY PROTEIN: probable apy...    230   6e-62    
ref|XP_003517106.1|  PREDICTED: probable apyrase 7-like isoformX1       229   9e-62    
ref|XP_003547875.1|  PREDICTED: probable apyrase 7-like                 229   1e-61    
ref|XP_007158059.1|  hypothetical protein PHAVU_002G120700g             229   1e-61    
gb|KHN12488.1|  Ectonucleoside triphosphate diphosphohydrolase 1        226   1e-60    
ref|XP_006599123.1|  PREDICTED: probable apyrase 7-like isoform X3      224   3e-60    
ref|XP_003538924.1|  PREDICTED: probable apyrase 7-like                 224   6e-60    
ref|XP_001778140.1|  predicted protein                                  218   1e-59    
ref|XP_006599122.1|  PREDICTED: probable apyrase 7-like isoform X2      223   1e-59    
ref|XP_003548590.1|  PREDICTED: probable apyrase 7-like isoform X1      223   2e-59    
gb|KHN16963.1|  Ectonucleoside triphosphate diphosphohydrolase 1        221   1e-58    
emb|CAA16707.1|  putative protein                                       222   3e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783110.1|  predicted protein                                  211   7e-57    
ref|XP_001784358.1|  predicted protein                                  211   4e-56    
ref|XP_001752330.1|  predicted protein                                  208   9e-56    
emb|CDY01587.1|  BnaC07g35770D                                          207   5e-54    
gb|KHN41783.1|  Auxin-induced protein 5NG4                              207   3e-53    
gb|KDO72274.1|  hypothetical protein CISIN_1g039222mg                   199   2e-51    
ref|XP_009593921.1|  PREDICTED: uncharacterized protein LOC104090517    120   5e-28    
gb|KFM25933.1|  Ectonucleoside triphosphate diphosphohydrolase 1        125   5e-27    
dbj|BAJ96922.1|  predicted protein                                      124   5e-27    
gb|EYU28756.1|  hypothetical protein MIMGU_mgv1a004089mg                121   1e-25    
ref|XP_002876854.1|  nucleoside phosphatase family protein              117   2e-24    
ref|XP_010425073.1|  PREDICTED: probable apyrase 6                      117   3e-24    
ref|XP_010939489.1|  PREDICTED: probable apyrase 6 isoform X1           115   8e-24    
ref|XP_008802602.1|  PREDICTED: probable apyrase 6 isoform X2           115   9e-24    
ref|XP_008802601.1|  PREDICTED: probable apyrase 6 isoform X1           115   2e-23    
ref|XP_010502309.1|  PREDICTED: probable apyrase 6                      114   2e-23    
ref|XP_010514066.1|  PREDICTED: probable apyrase 6                      114   2e-23    
ref|XP_006290845.1|  hypothetical protein CARUB_v10016956mg             114   3e-23    
ref|XP_009773397.1|  PREDICTED: probable apyrase 6                      114   3e-23    
ref|XP_008802603.1|  PREDICTED: probable apyrase 6 isoform X3           113   4e-23    
gb|KFK33476.1|  hypothetical protein AALP_AA5G018300                    112   1e-22    
ref|XP_006395745.1|  hypothetical protein EUTSA_v10003943mg             112   1e-22    
gb|KFK33477.1|  hypothetical protein AALP_AA5G018300                    110   3e-22    
ref|NP_565293.1|  probable apyrase 6                                    110   4e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009616750.1|  PREDICTED: probable apyrase 6                      110   4e-22    
gb|AAK62457.1|AF387012_1  putative nucleoside triphosphatase            110   4e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554315.1|  PREDICTED: probable apyrase 6 isoform X2           110   5e-22    
ref|XP_009152223.1|  PREDICTED: probable apyrase 6                      110   6e-22    
ref|XP_010554314.1|  PREDICTED: probable apyrase 6 isoform X1           109   7e-22    
ref|XP_005842970.1|  hypothetical protein CHLNCDRAFT_141807             107   8e-22    
ref|XP_011075504.1|  PREDICTED: probable apyrase 6                      109   1e-21    
ref|XP_010939490.1|  PREDICTED: probable apyrase 6 isoform X2           108   1e-21    
emb|CDY03024.1|  BnaC07g22030D                                          108   3e-21    
ref|XP_010527907.1|  PREDICTED: probable apyrase 6 isoform X1           107   5e-21    
ref|XP_010258343.1|  PREDICTED: probable apyrase 6 isoform X1           107   5e-21    
ref|XP_010258344.1|  PREDICTED: probable apyrase 6 isoform X2           106   8e-21    
ref|XP_005773354.1|  hypothetical protein EMIHUDRAFT_435744             105   9e-21    
gb|KHN12207.1|  Ectonucleoside triphosphate diphosphohydrolase 1        105   2e-20    
emb|CDY49103.1|  BnaA06g09030D                                          105   2e-20    
ref|XP_005783080.1|  hypothetical protein EMIHUDRAFT_423944             104   2e-20    
ref|XP_003518729.1|  PREDICTED: probable apyrase 6-like isoform 1       105   2e-20    
gb|KDO82926.1|  hypothetical protein CISIN_1g009360mg                   105   2e-20    
ref|XP_009148706.1|  PREDICTED: probable apyrase 4                      104   3e-20    
gb|KDP41200.1|  hypothetical protein JCGZ_15607                         104   3e-20    
ref|XP_002961510.1|  hypothetical protein SELMODRAFT_63506              103   4e-20    
emb|CDY39331.1|  BnaC05g10480D                                          103   7e-20    
ref|XP_002971296.1|  hypothetical protein SELMODRAFT_94922              103   7e-20    
ref|XP_009398170.1|  PREDICTED: LOW QUALITY PROTEIN: probable apy...    103   8e-20    
ref|XP_004973524.1|  PREDICTED: probable apyrase 6-like isoform X3      102   1e-19    
ref|XP_004973523.1|  PREDICTED: probable apyrase 6-like isoform X2      102   1e-19    
ref|XP_004973522.1|  PREDICTED: probable apyrase 6-like isoform X1      102   1e-19    
ref|XP_005643034.1|  hypothetical protein COCSUDRAFT_49229              103   1e-19    
ref|XP_010683184.1|  PREDICTED: probable apyrase 6                      102   2e-19    
ref|XP_004238804.1|  PREDICTED: probable apyrase 6                      102   2e-19    
ref|XP_006438694.1|  hypothetical protein CICLE_v10031190mg             102   2e-19    
ref|XP_006483153.1|  PREDICTED: probable apyrase 6-like                 102   2e-19    
ref|XP_010917046.1|  PREDICTED: probable apyrase 6 isoform X1           101   3e-19    
gb|ELT89294.1|  hypothetical protein CAPTEDRAFT_163643                  100   3e-19    
ref|XP_009148707.1|  PREDICTED: probable apyrase 5                      100   4e-19    
ref|XP_002946218.1|  hypothetical protein VOLCADRAFT_78871              100   4e-19    
gb|EPH53877.1|  hypothetical protein CAOG_08437                         100   6e-19    
ref|XP_006417038.1|  hypothetical protein EUTSA_v10007501mg             100   7e-19    
ref|XP_007157620.1|  hypothetical protein PHAVU_002G084900g             100   8e-19    
ref|XP_006355131.1|  PREDICTED: probable apyrase 6-like                 100   8e-19    
ref|NP_172877.1|  probable apyrase 5                                  99.8    1e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890045.1|  nucleoside phosphatase family protein            99.4    1e-18    
gb|ADG38761.1|  AT4G19180-like protein                                95.5    1e-18    
ref|XP_006417036.1|  hypothetical protein EUTSA_v10007616mg           98.6    2e-18    
gb|AEN82492.1|  AT4G19180-like protein                                95.1    2e-18    
ref|XP_009634621.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...  99.0    2e-18    
gb|EPS67236.1|  hypothetical protein M569_07539                       99.4    2e-18    
gb|ADG38766.1|  AT4G19180-like protein                                94.7    2e-18    
ref|XP_006827247.1|  hypothetical protein AMTR_s00010p00262060        99.0    3e-18    
ref|NP_563942.1|  probable apyrase 4                                  98.6    3e-18    Arabidopsis thaliana [mouse-ear cress]
gb|ADG38760.1|  AT4G19180-like protein                                94.4    3e-18    
ref|XP_010257480.1|  PREDICTED: probable apyrase 6                    98.6    3e-18    
ref|XP_006417035.1|  hypothetical protein EUTSA_v10009320mg           97.8    3e-18    
ref|XP_010713029.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...  98.6    4e-18    
gb|AAK76563.1|  putative nucleoside triphosphatase                    97.8    4e-18    Arabidopsis thaliana [mouse-ear cress]
emb|CDY39332.1|  BnaC05g10470D                                        97.4    6e-18    
ref|XP_005797585.1|  PREDICTED: ectonucleoside triphosphate dipho...  98.2    6e-18    
ref|XP_010458912.1|  PREDICTED: probable apyrase 4                    97.4    6e-18    
ref|XP_007424809.1|  PREDICTED: ectonucleoside triphosphate dipho...  97.4    6e-18    
gb|KFK43668.1|  hypothetical protein AALP_AA1G157400                  96.7    1e-17    
emb|CDH13994.1|  probable Guanosine-diphosphatase                     96.7    1e-17    
ref|XP_010066911.1|  PREDICTED: probable apyrase 6 isoform X1         96.7    1e-17    
ref|XP_003686251.1|  hypothetical protein TPHA_0F03360                96.7    1e-17    
gb|AAQ10658.1|  apyrase 2                                             94.0    1e-17    Solanum tuberosum [potatoes]
gb|EEC83627.1|  hypothetical protein OsI_29353                        95.9    2e-17    Oryza sativa Indica Group [Indian rice]
ref|XP_001756852.1|  predicted protein                                95.5    2e-17    
ref|XP_002890044.1|  predicted protein                                95.9    2e-17    
ref|XP_002444398.1|  hypothetical protein SORBIDRAFT_07g021350        95.9    2e-17    Sorghum bicolor [broomcorn]
gb|EGU12671.1|  hypothetical protein RTG_01221                        96.7    2e-17    
ref|XP_007267593.1|  nucleoside phosphatase GDA1/CD39                 95.5    2e-17    
gb|EMG46023.1|  Guanosine-diphosphatase                               95.5    3e-17    
ref|XP_004297301.1|  PREDICTED: probable apyrase 6-like isoform 2     95.5    3e-17    
emb|CDP00335.1|  unnamed protein product                              95.5    3e-17    
ref|XP_010476473.1|  PREDICTED: probable apyrase 3                    95.1    3e-17    
ref|NP_001061886.1|  Os08g0436100                                     95.5    3e-17    Oryza sativa Japonica Group [Japonica rice]
emb|CDX81623.1|  BnaC08g39780D                                        95.1    3e-17    
ref|NP_001147985.1|  LOC100281594                                     95.1    3e-17    Zea mays [maize]
ref|XP_008675061.1|  PREDICTED: LOC100281594 isoform X3               95.1    4e-17    
ref|XP_002176263.1|  predicted protein                                95.5    4e-17    Phaeodactylum tricornutum CCAP 1055/1
gb|EMS25962.1|  golgi apyrase                                         95.9    4e-17    
ref|XP_002507899.1|  predicted protein                                94.4    4e-17    Micromonas commoda
emb|CCA67983.1|  related to YND1-apyrase (NDPase/NTPase)              95.5    4e-17    
ref|XP_007764454.1|  hypothetical protein CONPUDRAFT_162097           95.9    4e-17    
ref|XP_008416447.1|  PREDICTED: ectonucleoside triphosphate dipho...  94.7    4e-17    
gb|ESW97388.1|  Apyrase with wide substrate specificity               95.5    4e-17    
ref|XP_002950854.1|  hypothetical protein VOLCADRAFT_91259            94.7    5e-17    
ref|XP_007720865.1|  apyrase                                          95.1    5e-17    
emb|CEF59763.1|  Nucleoside phosphatase GDA1/CD39 family-containi...  94.4    5e-17    
ref|XP_004297300.1|  PREDICTED: probable apyrase 6-like isoform 1     94.7    6e-17    
ref|XP_002273709.1|  PREDICTED: probable apyrase 6 isoform X2         94.4    6e-17    Vitis vinifera
ref|XP_008416439.1|  PREDICTED: ectonucleoside triphosphate dipho...  94.7    6e-17    
gb|EPY51301.1|  nucleoside diphosphatase Ynd1                         94.7    6e-17    
dbj|GAA96344.1|  hypothetical protein E5Q_03010                       95.1    6e-17    
ref|XP_010562917.1|  PREDICTED: ectonucleoside triphosphate dipho...  94.4    7e-17    
ref|XP_003677655.1|  hypothetical protein NCAS_0G04170                94.4    7e-17    
ref|XP_010476471.1|  PREDICTED: probable apyrase 4                    94.4    7e-17    
ref|XP_009014335.1|  hypothetical protein HELRODRAFT_191021           92.0    7e-17    
ref|XP_007475531.1|  PREDICTED: ectonucleoside triphosphate dipho...  93.6    7e-17    
ref|XP_007575838.1|  PREDICTED: ectonucleoside triphosphate dipho...  94.4    7e-17    
ref|XP_008806007.1|  PREDICTED: probable apyrase 6                    94.0    7e-17    
ref|XP_007475529.1|  PREDICTED: ectonucleoside triphosphate dipho...  94.0    8e-17    
gb|EMD38143.1|  hypothetical protein CERSUDRAFT_113288                94.7    8e-17    
gb|EOB05804.1|  Ectonucleoside triphosphate diphosphohydrolase 1      94.0    8e-17    
ref|NP_001275348.1|  apyrase precursor                                93.6    8e-17    
gb|ADN83844.1|  putative apyrase AP5                                  93.6    8e-17    
ref|XP_427896.3|  PREDICTED: ectonucleoside triphosphate diphosph...  94.4    9e-17    Gallus gallus [bantam]
ref|NP_172876.1|  probable apyrase 3                                  93.6    9e-17    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011096861.1|  PREDICTED: LOW QUALITY PROTEIN: apyrase-like     93.2    9e-17    
ref|XP_001703482.1|  hypothetical protein CHLREDRAFT_143952           93.6    9e-17    Chlamydomonas reinhardtii
ref|XP_009360338.1|  PREDICTED: probable apyrase 6 isoform X2         93.6    1e-16    
gb|EPB83582.1|  guanosine-diphosphatase                               92.4    1e-16    
sp|P80595.2|APY_SOLTU  RecName: Full=Apyrase; AltName: Full=ATP-d...  93.2    1e-16    Solanum tuberosum [potatoes]
gb|EPS96858.1|  hypothetical protein FOMPIDRAFT_149159                94.4    1e-16    
ref|XP_009360337.1|  PREDICTED: probable apyrase 6 isoform X1         93.6    1e-16    
emb|CDO91777.1|  unnamed protein product                              93.6    1e-16    
ref|XP_006417037.1|  hypothetical protein EUTSA_v10007743mg           92.4    1e-16    
ref|XP_003645855.1|  hypothetical protein Ecym_3567                   93.2    1e-16    
gb|ABK95896.1|  unknown                                               90.9    1e-16    Populus trichocarpa [western balsam poplar]
ref|XP_007361463.1|  hypothetical protein DICSQDRAFT_78440            94.0    2e-16    
ref|XP_008488701.1|  PREDICTED: ectonucleoside triphosphate dipho...  93.6    2e-16    
ref|XP_008802605.1|  PREDICTED: probable apyrase 6 isoform X4         92.0    2e-16    
ref|XP_007395592.1|  hypothetical protein PHACADRAFT_255752           93.6    2e-16    
gb|AEY98046.1|  FAFR362Cp                                             92.8    2e-16    
ref|XP_007509489.1|  predicted protein                                92.8    2e-16    
ref|XP_008441708.1|  PREDICTED: probable apyrase 6                    93.2    2e-16    
emb|CDF90968.1|  ZYBA0S09-01838g1_1                                   92.8    2e-16    
ref|XP_006033791.1|  PREDICTED: ectonucleoside triphosphate dipho...  93.2    2e-16    
ref|XP_004065616.1|  PREDICTED: ectonucleoside triphosphate dipho...  93.2    2e-16    
ref|XP_002472317.1|  predicted protein                                93.6    2e-16    Postia placenta Mad-698-R
ref|XP_005507083.1|  PREDICTED: ectonucleoside triphosphate dipho...  92.8    2e-16    
ref|XP_003668224.1|  hypothetical protein NDAI_0A08280                93.6    2e-16    
ref|XP_001435724.1|  hypothetical protein                             92.0    2e-16    Paramecium tetraurelia strain d4-2
ref|XP_007863144.1|  hypothetical protein GLOTRDRAFT_114425           93.6    2e-16    
emb|CDP04086.1|  unnamed protein product                              92.4    2e-16    
ref|XP_001696196.1|  hypothetical protein CHLREDRAFT_167044           92.0    2e-16    Chlamydomonas reinhardtii
ref|XP_006349910.1|  PREDICTED: apyrase 2 isoform X2                  92.0    2e-16    
ref|XP_009906472.1|  PREDICTED: ectonucleoside triphosphate dipho...  92.8    2e-16    
ref|XP_006349909.1|  PREDICTED: apyrase 2 isoform X1                  92.4    2e-16    
ref|NP_985909.1|  AFR362Cp                                            92.4    2e-16    
ref|XP_002325398.1|  putative apyrase family protein                  92.0    2e-16    
ref|XP_003972274.1|  PREDICTED: ectonucleoside triphosphate dipho...  92.8    2e-16    
emb|CDR37491.1|  CYFA0S01e11166g1_1                                   92.8    3e-16    
gb|EPX74949.1|  guanosine-diphosphatase Gda1                          92.4    3e-16    
ref|XP_009058996.1|  hypothetical protein LOTGIDRAFT_123541           92.4    3e-16    
ref|XP_005458723.1|  PREDICTED: ectonucleoside triphosphate dipho...  92.4    3e-16    
ref|XP_007424818.1|  PREDICTED: ectonucleoside triphosphate dipho...  92.4    3e-16    
ref|XP_004252980.1|  PREDICTED: apyrase                               91.7    4e-16    
gb|EMC80763.1|  Ectonucleoside triphosphate diphosphohydrolase 8      91.7    4e-16    
ref|XP_007300366.1|  nucleoside phosphatase GDA1/CD39                 91.7    4e-16    
gb|AAZ94880.1|  ecto-nucleosidase triphosphate diphosphohydrolase 7   92.0    4e-16    
ref|XP_006417039.1|  hypothetical protein EUTSA_v10007159mg           92.0    4e-16    
ref|XP_006573108.1|  PREDICTED: probable apyrase 6-like isoform X2    91.7    4e-16    
dbj|BAO39576.1|  guanosine-diphosphatase                              91.7    4e-16    
ref|XP_009559783.1|  PREDICTED: ectonucleoside triphosphate dipho...  91.7    5e-16    
ref|XP_005048710.1|  PREDICTED: ectonucleoside triphosphate dipho...  91.7    5e-16    
ref|XP_002168245.2|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    5e-16    
gb|EYU37260.1|  hypothetical protein MIMGU_mgv1a006675mg              90.9    5e-16    
gb|KFQ46135.1|  Ectonucleoside triphosphate diphosphohydrolase 1      90.9    5e-16    
gb|KHN79288.1|  Nucleoside-diphosphatase mig-23                       91.7    5e-16    
ref|NP_001191525.1|  uncharacterized protein LOC100533297 precursor   90.9    5e-16    
ref|XP_009155520.1|  apyrase                                          92.0    5e-16    
ref|XP_003327100.1|  hypothetical protein PGTG_08877                  92.4    5e-16    
ref|XP_009416865.1|  PREDICTED: probable apyrase 6                    91.7    6e-16    
ref|XP_008036642.1|  hypothetical protein TRAVEDRAFT_145439           92.0    6e-16    
ref|XP_010097613.1|  Ectonucleoside triphosphate diphosphohydrola...  91.7    6e-16    
ref|XP_007223149.1|  hypothetical protein PRUPE_ppa003785mg           91.7    6e-16    
emb|CCL99627.1|  predicted protein                                    92.0    6e-16    
ref|XP_003517975.1|  PREDICTED: probable apyrase 6-like isoformX1     91.3    6e-16    
gb|ETE66836.1|  Ectonucleoside triphosphate diphosphohydrolase 7      91.7    7e-16    
ref|XP_010743001.1|  PREDICTED: ectonucleoside triphosphate dipho...  91.7    7e-16    
gb|ABA00734.1|  LALP1                                                 91.3    7e-16    
ref|NP_001015918.1|  ectonucleoside triphosphate diphosphohydrola...  91.3    7e-16    
ref|XP_009085921.1|  PREDICTED: ectonucleoside triphosphate dipho...  91.3    8e-16    
ref|XP_007046094.1|  GDA1/CD39 nucleoside phosphatase family prot...  90.9    8e-16    
ref|XP_008302079.1|  PREDICTED: ectonucleoside triphosphate dipho...  91.3    8e-16    
emb|CDS11642.1|  hypothetical protein LRAMOSA03905                    91.7    8e-16    
ref|XP_009625429.1|  PREDICTED: apyrase-like                          90.5    8e-16    
ref|XP_005830490.1|  hypothetical protein GUITHDRAFT_95407            90.1    9e-16    
ref|XP_005429011.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.7    9e-16    
ref|XP_010871012.1|  PREDICTED: ectonucleoside triphosphate dipho...  90.9    9e-16    
gb|KDQ10575.1|  hypothetical protein BOTBODRAFT_136647                91.3    1e-15    
ref|XP_010871013.1|  PREDICTED: ectonucleoside triphosphate dipho...  90.9    1e-15    
gb|KGL76191.1|  Ectonucleoside triphosphate diphosphohydrolase 1      90.1    1e-15    
ref|XP_003381268.1|  ectonucleoside triphosphate diphosphohydrola...  90.5    1e-15    
ref|XP_010917047.1|  PREDICTED: probable apyrase 6 isoform X2         90.1    1e-15    
ref|XP_004200909.1|  Piso0_003519                                     90.5    1e-15    
ref|XP_003218500.1|  PREDICTED: ectonucleoside triphosphate dipho...  90.5    1e-15    
ref|XP_011017112.1|  PREDICTED: probable apyrase 6 isoform X2         90.5    1e-15    
ref|XP_010721388.1|  PREDICTED: ectonucleoside triphosphate dipho...  90.1    1e-15    
ref|XP_006360924.1|  PREDICTED: apyrase-like                          89.7    1e-15    
gb|KEP55512.1|  nucleoside-diphosphatase                              90.9    1e-15    
gb|EUC66323.1|  nucleoside-diphosphatase                              90.9    1e-15    
ref|XP_005144158.1|  PREDICTED: ectonucleoside triphosphate dipho...  90.5    1e-15    
ref|XP_010066912.1|  PREDICTED: probable apyrase 6 isoform X2         89.7    2e-15    
ref|XP_010211413.1|  PREDICTED: ectonucleoside triphosphate dipho...  90.1    2e-15    
ref|XP_010190391.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...  89.7    2e-15    
ref|XP_001579703.1|  hypothetical protein                             89.4    2e-15    
ref|XP_001642629.1|  hypothetical protein Kpol_312p10                 90.5    2e-15    
ref|XP_010211414.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.7    2e-15    
ref|XP_005520908.1|  PREDICTED: ectonucleoside triphosphate dipho...  90.1    2e-15    
gb|ERG84046.1|  nucleoside-diphosphatase mig-23                       89.7    2e-15    
ref|XP_005094066.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.7    2e-15    
ref|XP_001454921.1|  hypothetical protein                             89.0    2e-15    
ref|XP_006307338.1|  hypothetical protein CARUB_v10008956mg           89.4    2e-15    
ref|XP_008729834.1|  hypothetical protein G647_07296                  90.1    2e-15    
ref|XP_006689239.1|  hypothetical protein CANTEDRAFT_126815           89.7    2e-15    
gb|ELU13735.1|  hypothetical protein CAPTEDRAFT_169216                89.7    2e-15    
gb|ELU45406.1|  nucleoside-diphosphatase                              90.1    2e-15    
ref|XP_010071586.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.7    2e-15    
ref|XP_010071588.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.7    2e-15    
ref|XP_006843727.1|  hypothetical protein AMTR_s00007p00221730        89.0    2e-15    
gb|EPB82791.1|  guanosine-diphosphatase                               88.2    3e-15    
ref|XP_010563320.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.4    3e-15    
ref|XP_009503418.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.7    3e-15    
emb|CCO27596.1|  hypothetical protein BN14_01581                      89.7    3e-15    
ref|NP_001071453.1|  ectonucleoside triphosphate diphosphohydrola...  87.0    3e-15    
ref|XP_007326400.1|  hypothetical protein AGABI1DRAFT_117868          89.4    3e-15    
ref|XP_009503426.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.4    3e-15    
ref|XP_455837.1|  hypothetical protein                                89.0    3e-15    
ref|XP_006457801.1|  hypothetical protein AGABI2DRAFT_182942          89.4    3e-15    
gb|ETO00535.1|  ectonucleoside triphosphate diphosphohydrolase 6 ...  85.9    3e-15    
ref|XP_005607741.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.4    3e-15    
ref|XP_006443348.1|  hypothetical protein CICLE_v10019963mg           87.8    3e-15    
ref|XP_009959967.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...  89.0    3e-15    
ref|XP_003680354.1|  hypothetical protein TDEL_0C02540                89.0    3e-15    
gb|AGO11116.1|  AaceriAFR362Cp                                        89.0    3e-15    
gb|KFH70721.1|  hypothetical protein MVEG_03569                       89.7    3e-15    
ref|XP_008518033.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.0    3e-15    
ref|XP_005289418.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.0    3e-15    
ref|XP_002619891.1|  hypothetical protein CLUG_01050                  89.4    4e-15    
ref|XP_001526173.1|  guanosine-diphosphatase                          89.4    4e-15    
ref|XP_006349906.1|  PREDICTED: apyrase-like                          88.6    4e-15    
ref|XP_003671047.2|  hypothetical protein NDAI_0G00280                89.0    4e-15    
ref|XP_001753690.1|  predicted protein                                88.6    4e-15    
gb|KEQ59534.1|  putative nucleoside diphosphatase                     89.4    4e-15    
ref|XP_008934141.1|  PREDICTED: ectonucleoside triphosphate dipho...  89.0    4e-15    
gb|EPY49692.1|  guanosine-diphosphatase Gda1                          88.6    4e-15    
ref|XP_002497428.1|  ZYRO0F05324p                                     88.6    4e-15    
emb|CDK26657.1|  unnamed protein product                              89.0    4e-15    
gb|EKC36330.1|  Ectonucleoside triphosphate diphosphohydrolase 7      89.0    4e-15    
ref|XP_010406647.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    4e-15    
ref|XP_003687867.1|  hypothetical protein TPHA_0L00770                89.0    5e-15    
ref|NP_593447.1|  guanosine-diphosphatase Gda1                        88.6    5e-15    
ref|XP_006136956.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    5e-15    
ref|XP_009541824.1|  hypothetical protein HETIRDRAFT_60065            88.2    5e-15    
ref|XP_003364543.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    5e-15    
ref|XP_004247967.1|  PREDICTED: apyrase-like                          87.8    5e-15    
ref|XP_006135585.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    5e-15    
ref|XP_006135586.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    5e-15    
ref|XP_001492994.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    5e-15    
ref|XP_005940017.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    5e-15    
emb|CBY36960.1|  unnamed protein product                              87.8    5e-15    
gb|EIE75476.1|  hypothetical protein RO3G_00180                       89.0    6e-15    
ref|XP_010201884.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    6e-15    
ref|XP_010999472.1|  PREDICTED: apyrase 2-like                        87.8    6e-15    
ref|XP_004947620.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    6e-15    
emb|CEI87921.1|  hypothetical protein RMCBS344292_02326               89.0    6e-15    
ref|XP_005234310.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    6e-15    
ref|XP_009663943.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.6    6e-15    
gb|EIE90941.1|  hypothetical protein RO3G_15652                       87.0    6e-15    
ref|XP_010201885.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    6e-15    
emb|CDH50644.1|  related to ynd1-apyrase (ndpase ntpase)              88.6    6e-15    
ref|XP_009793993.1|  PREDICTED: apyrase-like                          87.8    7e-15    
emb|CBY18429.1|  unnamed protein product                              85.9    7e-15    
emb|CCH45954.1|  Guanosine-diphosphatase                              88.2    7e-15    
ref|XP_785341.2|  PREDICTED: ectonucleoside triphosphate diphosph...  88.2    7e-15    
ref|XP_009918344.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_009317817.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_005234311.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_009692842.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_004571840.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_009918423.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_009817546.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_417683.2|  PREDICTED: ectonucleoside triphosphate diphosph...  88.2    7e-15    
ref|XP_009483482.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
gb|EOA97750.1|  Ectonucleoside triphosphate diphosphohydrolase 4      88.2    7e-15    
ref|XP_009663945.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_009271323.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_009882420.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_005024561.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_004947619.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_009945533.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
gb|AAT66769.2|  Apyrase-like protein, putative                        87.4    7e-15    
ref|XP_009692841.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_008497858.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_005749641.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    7e-15    
ref|XP_009317816.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009483481.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_010301268.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009882422.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009578633.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_010301267.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009634071.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009471071.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009944023.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009944022.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_006443349.1|  hypothetical protein CICLE_v10019963mg           87.4    8e-15    
ref|XP_010012208.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009817545.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009578632.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_010225856.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009945535.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
dbj|GAA87060.1|  nucleoside diphosphatase                             88.2    8e-15    
ref|XP_009271321.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009634072.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    8e-15    
ref|XP_009471072.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    8e-15    
gb|KDO45540.1|  hypothetical protein CISIN_1g048388mg                 87.4    8e-15    
ref|XP_010287918.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_009875766.1|  PREDICTED: ectonucleoside triphosphate dipho...  88.2    8e-15    
ref|XP_005024562.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    9e-15    
ref|XP_010287919.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    9e-15    
ref|XP_010134753.1|  PREDICTED: ectonucleoside triphosphate dipho...  86.3    9e-15    
ref|XP_007167901.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    9e-15    
ref|XP_002618194.1|  hypothetical protein CLUG_01653                  87.8    9e-15    
ref|XP_010174032.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    9e-15    
ref|XP_005008173.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    9e-15    
ref|XP_504729.1|  YALI0E33407p                                        86.7    9e-15    
ref|XP_007477893.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    9e-15    
ref|XP_005780560.1|  hypothetical protein EMIHUDRAFT_235054           87.0    1e-14    
ref|XP_005513572.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|XP_005373757.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
gb|EMT25379.1|  Ectonucleoside triphosphate diphosphohydrolase 5      84.0    1e-14    
ref|XP_001742918.1|  hypothetical protein                             83.2    1e-14    
ref|XP_003034827.1|  hypothetical protein SCHCODRAFT_43885            87.0    1e-14    
ref|XP_007477894.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
dbj|BAA21575.1|  KIAA0392                                             87.4    1e-14    
ref|XP_007167910.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|XP_003479713.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|XP_008166885.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|NP_004892.1|  ectonucleoside triphosphate diphosphohydrolase ...  87.8    1e-14    
ref|XP_006140733.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|XP_005373758.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|XP_008166886.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|XP_007093965.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|XP_009968736.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
dbj|BAG62183.1|  unnamed protein product                              87.4    1e-14    
ref|XP_007093967.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.8    1e-14    
ref|XP_007104188.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_002709361.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_008975460.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_008977366.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.0    1e-14    
ref|XP_009968737.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_008247784.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_007093966.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_009241904.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_004180403.1|  hypothetical protein TBLA_0D03850                87.4    1e-14    
ref|XP_003984744.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...  87.4    1e-14    
ref|XP_010181470.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_005562901.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_005329381.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_003272921.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_004253046.1|  PREDICTED: probable apyrase 2                    87.0    1e-14    
gb|EHH28350.1|  Ectonucleoside triphosphate diphosphohydrolase 4      87.4    1e-14    
ref|XP_008975461.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_006140734.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_005562904.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    
ref|XP_007093968.1|  PREDICTED: ectonucleoside triphosphate dipho...  87.4    1e-14    



>ref|XP_009769412.1| PREDICTED: probable apyrase 7 [Nicotiana sylvestris]
Length=554

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/559 (61%), Positives = 417/559 (75%), Gaps = 14/559 (3%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRAS-Y  1599
             M+P+ PSKSK +V G   +    K   + + I FI VLI G F FSPSL+  V K +S Y
Sbjct  1     MDPRWPSKSKPYVSGADHNRKMQKIGIIAVSIVFIFVLIGGCFVFSPSLVYNVEKSSSSY  60

Query  1598  FTVVLDCGSTGSRVNIYEW-----MPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLA  1434
             FTVV+DCGS+G+RVNIYEW     + NNG+ PIL+NTYPGNLT+SDGC+YHC+QTEPGL 
Sbjct  61    FTVVVDCGSSGTRVNIYEWKLQGRLNNNGDLPILLNTYPGNLTKSDGCQYHCMQTEPGLD  120

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
              FVGNA G+R+SL PL+R AE+ VP  +R  TPIFVLATAGMR+LP+EDA  V+E V  +
Sbjct  121   KFVGNALGVRSSLDPLLRWAERLVPRERREFTPIFVLATAGMRKLPVEDARVVLEDVADV  180

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             +K+ GF Y+KD+IRVLSG+EEAYYGW+ALNYKM +LGN  GSHTLGLLDLGGSSLQ+V E
Sbjct  181   LKDFGFLYKKDWIRVLSGKEEAYYGWIALNYKMGVLGNLLGSHTLGLLDLGGSSLQLVVE  240

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR  894
             +DE + D HVF S+IGS EH+++ YSL AFG NEAFDR + +LS TQA +ES G  FKVR
Sbjct  241   VDELKIDNHVFNSKIGSPEHQIVRYSLPAFGLNEAFDRTIVMLSHTQALKESPGGAFKVR  300

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
             HPCL+SG VQN+TC  CF ++P SS+  S        N+IL+LG+PNWE CK L   VAT
Sbjct  301   HPCLNSGSVQNYTCLSCFQREPISSDLGSH----INANAILLLGEPNWEMCKSLTRAVAT  356

Query  713   NSSNLERSKVAEQ-NCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
             NSS  + S V +  +C GL SYG + + NL LN+  VTRYHALSGFFAVY  LNLS RAN
Sbjct  357   NSSRGDWSLVHDHASCTGLRSYGGNELLNLMLNASSVTRYHALSGFFAVYQTLNLSPRAN  416

Query  536   LTKMWETGQGLCSRSWVDQTDANG-LCFRILYMASLIKDALCLSNLEIIFGPGDVSWALG  360
             LT+MWE GQ LCS+SW D     G  CFR+LYM SLI+DALCL   EI+FGPGDVSW LG
Sbjct  417   LTRMWEAGQQLCSQSWEDHQGIGGAYCFRVLYMISLIQDALCLGKHEIVFGPGDVSWTLG  476

Query  359   AALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQIKLPMPGRK  180
             AALIE G++     T+ +      +H  M+SSS+ LF++L+C+L+IVYRSQIKLPMPGRK
Sbjct  477   AALIE-GQYLWSDTTKYQYGIFYLKHSKMLSSSVALFLLLLCLLLIVYRSQIKLPMPGRK  535

Query  179   ITSGRASLPSYL-SPKQPN  126
              T  RASLPSY+ S +QPN
Sbjct  536   PTPSRASLPSYIYSKRQPN  554



>ref|XP_011071932.1| PREDICTED: probable apyrase 7 [Sesamum indicum]
 ref|XP_011071933.1| PREDICTED: probable apyrase 7 [Sesamum indicum]
Length=557

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/556 (57%), Positives = 399/556 (72%), Gaps = 10/556 (2%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRASYF  1596
             MEPKSPSKSK  + GF   P + K V V + I  I  ++ GYF F    I    K  +YF
Sbjct  1     MEPKSPSKSKPQITGFTCDPRSPKFVVVTISIILIFGMVCGYFIFKER-IWTTEKIRTYF  59

Query  1595  TVVLDCGSTGSRVNIYEWMPNN-----GEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
             TVVLDCGSTGSRVN++EWM  N     G  P+L+ +YP N+ +S GC+YHC+QTEPGL  
Sbjct  60    TVVLDCGSTGSRVNVFEWMTGNDSRVYGNLPVLLRSYPDNVNKSSGCQYHCMQTEPGLHY  119

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             FV +  G+RASL+PLIR AE+WVP  +R  TPIF+LATAGMRRL  E+A R++  V  +V
Sbjct  120   FVNDVVGVRASLEPLIRYAEQWVPLERRAATPIFILATAGMRRLVAEEAKRILGDVETVV  179

Query  1250  KEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEI  1071
             KEH F YRK ++RVL+G+EEAYYGW ALNYKM + G +S + TLGLLDLGGSSLQVV E+
Sbjct  180   KEHEFLYRKSWVRVLTGKEEAYYGWAALNYKMGVFGKSSRTSTLGLLDLGGSSLQVVAEV  239

Query  1070  DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRH  891
             D   +DEHVFRS+IG VEH ++AYSL AFG NEAFDR +A+LS TQA  ES G +F+VRH
Sbjct  240   DVSTKDEHVFRSKIGPVEHDIVAYSLPAFGLNEAFDRTIALLSHTQALGESAGGVFEVRH  299

Query  890   PCLSSGFVQNHTCRGCFGQK-PsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
             PCL SGFVQN+TC GCFG        + S+++   ELNS+ ++G+PNWE+CKV+A   A 
Sbjct  300   PCLGSGFVQNYTCHGCFGSDYSRVKINMSNQVQVSELNSVFLVGEPNWEQCKVIAGAAAI  359

Query  713   NSSNLERS-KVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
             NSS+ E S  +    C+GL SYG     NLT   H V+RYHALSGFFAVY+ LNLS RAN
Sbjct  360   NSSSSELSYHLNHSKCIGLFSYGGSTKLNLTKTLHTVSRYHALSGFFAVYHALNLSQRAN  419

Query  536   LTKMWETGQGLCSRSWVDQTDANG-LCFRILYMASLIKDALCLSNLEIIFGPGDVSWALG  360
             L+ +WE+G+ LCS SW DQ  +NG  CFR+ Y+ SLI++ALCLS++EIIFGPGDVSW LG
Sbjct  420   LSMLWESGEKLCSGSWADQESSNGQYCFRVPYLTSLIENALCLSDIEIIFGPGDVSWTLG  479

Query  359   AALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQIKLPMPGRK  180
             A+LIE GE   L   +S+   L  +   M+ S + +F++L+ +L+IVY  QIKLPMPGRK
Sbjct  480   ASLIE-GEFLWLDPEKSQNPMLTLKDYIMIPSPVLIFVLLLSLLLIVYCCQIKLPMPGRK  538

Query  179   ITSGRASLPSYLSPKQ  132
               S R SLPSYL PK+
Sbjct  539   TASTRTSLPSYLCPKR  554



>ref|XP_006476828.1| PREDICTED: probable apyrase 7-like isoform X1 [Citrus sinensis]
 ref|XP_006476829.1| PREDICTED: probable apyrase 7-like isoform X2 [Citrus sinensis]
 ref|XP_006476830.1| PREDICTED: probable apyrase 7-like isoform X3 [Citrus sinensis]
 ref|XP_006476831.1| PREDICTED: probable apyrase 7-like isoform X4 [Citrus sinensis]
Length=563

 Score =   486 bits (1252),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 294/569 (52%), Positives = 378/569 (66%), Gaps = 23/569 (4%)
 Frame = -1

Query  1781  LRMEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRAS  1602
             +  EPKSPSK K+ + GF       K   VVL +  ++V ++  F    +   Y     S
Sbjct  1     MESEPKSPSKQKLSITGFSLYKWVFKFCTVVLAVVLLIVGVYCVFEKGRA---YNVVSGS  57

Query  1601  YFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRS----DGCKYHCVQTEP  1443
             Y+TVV+DCGSTG+RVN+YEW     E   FP+LV TYP N T+S      C+YHC+QTEP
Sbjct  58    YYTVVVDCGSTGTRVNVYEWKTRGVESENFPVLVGTYPDNSTKSLLRKSSCQYHCLQTEP  117

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL   VGNASG+RASL+PLI  AE  VP  ++  TPIFVLATAG+RRL +EDA  V++ V
Sbjct  118   GLDKLVGNASGIRASLEPLILWAEWLVPLERQEETPIFVLATAGLRRLTVEDARWVLDDV  177

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               +VKEH F Y K +IRVLSG+EEAYY WVALNYKM  LGN+S + TLGLLDLGGSSLQ+
Sbjct  178   EAVVKEHSFMYEKSWIRVLSGKEEAYYAWVALNYKMGSLGNSSITPTLGLLDLGGSSLQI  237

Query  1082  VTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF  903
             V E D    DEH+ RS IGS+EH++LAYSL  FG N AFDRA+A+LSQ Q  RE  G+  
Sbjct  238   VMEDDGTGNDEHLIRSEIGSIEHRVLAYSLPEFGLNAAFDRAVAMLSQVQMPREGAGDRL  297

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             ++RHPCLSS  +QN+TC GC GQ    ++   S++      S  ++G+PNW+ CK +A  
Sbjct  298   EIRHPCLSSELLQNYTCNGCVGQN--VADRKLSKVKKTAFTSTYLVGEPNWDNCKGIARA  355

Query  722   VATNSSNLERS-KVAEQNC-VGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLS  549
             VA NSSNL+ S    + NC   L S  S ++ N T  +H   R+HALSGFF VYN LNLS
Sbjct  356   VAINSSNLDWSLPTGDVNCKASLSSSDSRKILNSTAVNHRTERFHALSGFFVVYNKLNLS  415

Query  548   SRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRILYMASLIKDALCLSNLEIIF  390
             S ANLT++ + GQ LCSRSW+D   A G        CF++ YM SLI++ALCL + EIIF
Sbjct  416   SGANLTRILDRGQQLCSRSWIDLNKATGHQNYAGQYCFQVPYMTSLIQEALCLGDAEIIF  475

Query  389   GPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRS  210
             GP D+SW LGA L+E G++    +T ++      ++  ++SS I +F+ L+ +L IVY  
Sbjct  476   GPADLSWTLGAVLVE-GKYLWQSSTRAQTSFSLLKNMGLMSSPIFVFVFLLFLLFIVYCG  534

Query  209   QIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             QIKLPMPGRK  +  ASLPSY+ PK +PN
Sbjct  535   QIKLPMPGRKGPAVVASLPSYIHPKRRPN  563



>gb|KDO69558.1| hypothetical protein CISIN_1g008515mg [Citrus sinensis]
Length=563

 Score =   486 bits (1252),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 294/569 (52%), Positives = 378/569 (66%), Gaps = 23/569 (4%)
 Frame = -1

Query  1781  LRMEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRAS  1602
             +  EPKSPSK K+ +  F       K   VVL +  ++V ++  F    +   Y     S
Sbjct  1     MESEPKSPSKQKLSITEFSLFKWVFKFCTVVLAVVLLIVGVYCVFEKGRA---YNVVSGS  57

Query  1601  YFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRS----DGCKYHCVQTEP  1443
             Y+TVV+DCGSTG+RVN+YEW     E    P+LV TYP N T+S      C+YHC+QTEP
Sbjct  58    YYTVVVDCGSTGTRVNVYEWKKRGVESENLPVLVGTYPDNSTKSLLRKSSCQYHCLQTEP  117

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL   VGNASG+RASL+PLI  AE  VP  ++  TPIFVLATAG+RRL +EDA  V++ V
Sbjct  118   GLDKLVGNASGIRASLEPLILWAEWLVPLERQEETPIFVLATAGLRRLTVEDARWVLDDV  177

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               +VKEH F Y K +IRVLSG+EEAYYGWVALNYKM  LGN+S + TLGLLDLGGSSLQ+
Sbjct  178   EAVVKEHSFMYEKSWIRVLSGKEEAYYGWVALNYKMGSLGNSSITPTLGLLDLGGSSLQI  237

Query  1082  VTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF  903
             V E D    DEH+ RS IGS+EH++LAYSLQ FG N AFDRA+A+LSQ Q  RE  G+  
Sbjct  238   VMEDDGTGNDEHLIRSEIGSIEHRVLAYSLQEFGLNAAFDRAVAMLSQVQMPREGAGDRL  297

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             ++RHPCLSS  +QN+TC GC GQ    ++   S++      S  ++G+PNW+ CK +A  
Sbjct  298   EIRHPCLSSELLQNYTCNGCVGQN--VADRKLSKVKKTAFTSTYLVGEPNWDNCKGIARA  355

Query  722   VATNSSNLERS-KVAEQNC-VGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLS  549
             VA NSSNL+ S    + NC   L S  S ++ N T  +H   R+HALSGFF VYN LNLS
Sbjct  356   VAINSSNLDWSLPTGDVNCKASLSSSDSRKILNSTAVNHRTERFHALSGFFVVYNKLNLS  415

Query  548   SRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRILYMASLIKDALCLSNLEIIF  390
             S ANLT++ + GQ LCSRSW+D   A G        CF++ YM SLI++ALCL + EIIF
Sbjct  416   SGANLTRILDRGQQLCSRSWIDLKKATGHQNYTGQYCFQVPYMTSLIQEALCLGDAEIIF  475

Query  389   GPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRS  210
             GP D+SW LGA L+E G++    +T ++      ++  ++SS I +F+ L+ +L IVY  
Sbjct  476   GPADLSWTLGAVLVE-GKYLWQSSTRAQTSFSLLKNTGLMSSPIFVFVFLLFLLFIVYCG  534

Query  209   QIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             QIKLPMPGRK  +  ASLPSY+ PK +PN
Sbjct  535   QIKLPMPGRKGPAVVASLPSYIHPKRRPN  563



>ref|XP_006439869.1| hypothetical protein CICLE_v10019521mg [Citrus clementina]
 gb|ESR53109.1| hypothetical protein CICLE_v10019521mg [Citrus clementina]
Length=563

 Score =   486 bits (1252),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 294/569 (52%), Positives = 378/569 (66%), Gaps = 23/569 (4%)
 Frame = -1

Query  1781  LRMEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRAS  1602
             +  EPKSPSK K+ +  F       K   VVL +  ++V ++  F    +   Y     S
Sbjct  1     MESEPKSPSKQKLSITEFSLFKWVFKFCTVVLAVVLLIVGVYCVFEKGRA---YNVVSGS  57

Query  1601  YFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRS----DGCKYHCVQTEP  1443
             Y+TVV+DCGSTG+RVN+YEW     E    P+LV TYP N T+S      C+YHC+QTEP
Sbjct  58    YYTVVVDCGSTGTRVNVYEWKKRGVESENLPVLVGTYPDNSTKSLLRKSSCQYHCLQTEP  117

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL   VGNASG+RASL+PLI  AE  VP  ++  TPIFVLATAG+RRL +EDA  V++ V
Sbjct  118   GLDKLVGNASGIRASLEPLILWAEWLVPLERQEETPIFVLATAGLRRLTVEDARWVLDDV  177

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               +VKEH F Y K +IRVLSG+EEAYYGWVALNYKM  LGN+S + TLGLLDLGGSSLQ+
Sbjct  178   EAVVKEHSFMYEKSWIRVLSGKEEAYYGWVALNYKMGSLGNSSITPTLGLLDLGGSSLQI  237

Query  1082  VTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF  903
             V E D    DEH+ RS IGS+EH++LAYSLQ FG N AFDRA+A+LSQ Q  RE  G+  
Sbjct  238   VMEDDGTGNDEHLIRSEIGSIEHRVLAYSLQEFGLNAAFDRAVAMLSQVQMPREGAGDRL  297

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             ++RHPCLSS  +QN+TC GC GQ    ++   S++      S  + G+PNW+ CK +A  
Sbjct  298   EIRHPCLSSELLQNYTCNGCVGQN--VADRKLSKVKKTAFTSTYLAGEPNWDNCKGIARA  355

Query  722   VATNSSNLERS-KVAEQNC-VGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLS  549
             VA NSSNL+ S    + NC   L S  S ++ N T  +H+  R+HALSGFF VYN LNLS
Sbjct  356   VAINSSNLDWSLPTGDVNCKASLSSSDSRKILNSTAVNHQTERFHALSGFFVVYNKLNLS  415

Query  548   SRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRILYMASLIKDALCLSNLEIIF  390
             S ANLT++ + GQ LCSRSW+D   A G        CF++ YM SLI++ALCL + EIIF
Sbjct  416   SGANLTRILDRGQQLCSRSWIDLKKATGHQNYTGQYCFQVPYMTSLIQEALCLGDAEIIF  475

Query  389   GPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRS  210
             GP D+SW LGA L+E G++    +T ++      ++  ++SS I +F+ L+ +L IVY  
Sbjct  476   GPADLSWTLGAVLVE-GKYLWQSSTRAQTSFSLLKNTGLMSSPIFVFVFLLFLLFIVYCG  534

Query  209   QIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             QIKLPMPGRK  +  ASLPSY+ PK +PN
Sbjct  535   QIKLPMPGRKGPAVVASLPSYIHPKRRPN  563



>ref|XP_004298967.1| PREDICTED: probable apyrase 7-like [Fragaria vesca subsp. vesca]
Length=543

 Score =   479 bits (1232),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 288/551 (52%), Positives = 374/551 (68%), Gaps = 28/551 (5%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFG-YFAFSPSLILYVRKRASY  1599
             MEP+SPSK ++  MGF Q    L      +L+    +L+FG YFAF       V K   Y
Sbjct  1     MEPESPSKLRLSGMGFTQHKQALN---TSVLVLVTGLLLFGVYFAFKYGRSHSVSK-GPY  56

Query  1598  FTVVLDCGSTGSRVNIYEWM--PNNGEFPILVNTYPGNLTRS---DGCKYHCVQTEPGLA  1434
             +TVV+DCGSTG+RVN+YEW+   +N E P+L+ TYP N T S     CKYHC+QTEPGL 
Sbjct  57    YTVVVDCGSTGTRVNVYEWLVEESNKELPVLLYTYPDNSTESMLLKSCKYHCLQTEPGLD  116

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
              FVGN SG+RASL+PLI  A+  VP  + G TPIFVLATAG+RRLP+EDA RV++ V  +
Sbjct  117   KFVGNLSGIRASLEPLITWAKHKVPVERHGDTPIFVLATAGLRRLPVEDARRVLDDVDAV  176

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             VK+H FF++K +IRVLSG+EEAYYGWVALNYKM    N S   TLGLLDLGGSSLQVV E
Sbjct  177   VKQHSFFHKKSWIRVLSGKEEAYYGWVALNYKMDSFRNHSRLPTLGLLDLGGSSLQVVVE  236

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR  894
             I++ RED H+ RS+ G VEH +LAYSL AFG NEAFDR + +LS  +  +ESR    ++R
Sbjct  237   IEDAREDTHMVRSKFGFVEHDILAYSLPAFGLNEAFDRTVVMLSNMEQLKESRIGKLEIR  296

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
             HPCLSS  V N+TC  CF       E+ +S++   +L+S+ ++G+ NWE+C+ LA   A 
Sbjct  297   HPCLSSDIVHNYTCSSCFQPHAGGQENMTSKVQESKLSSVRLVGEQNWEQCRRLARAAAM  356

Query  713   NSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANL  534
             NSS  + ++ + +        G D + NLT  +H    +HALSGFFAVY+ LNLSSRA L
Sbjct  357   NSSTPDTARCSHR--------GRD-IINLTAVAHPTAHFHALSGFFAVYDKLNLSSRATL  407

Query  533   TKMWETGQGLCSRSWVDQTDANG-----LCFRILYMASLIKDALCLSNLEIIFGPGDVSW  369
             +K+WE GQ LCSRSW + +  NG      CFR+ YMASLI+D LCL + EIIFGPGDVSW
Sbjct  408   SKVWEKGQQLCSRSWTNLSQ-NGYFAWQYCFRVPYMASLIEDGLCLGDKEIIFGPGDVSW  466

Query  368   ALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQIKLPMP  189
              LGAAL+EG      +++   + G+      +VSS I + + L+C+L+IVY S++KLPM 
Sbjct  467   TLGAALVEG--EYLWLSSSQSQSGILNFSLKVVSSPIFVLVSLLCLLLIVYCSKVKLPMI  524

Query  188   GRKITSGRASL  156
             G K+ + RASL
Sbjct  525   GSKV-AARASL  534



>ref|XP_010678812.1| PREDICTED: probable apyrase 7 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=537

 Score =   477 bits (1227),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 272/561 (48%), Positives = 366/561 (65%), Gaps = 40/561 (7%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLK-CvkvvllisfilvlIFGYFAFSPSLILYVRKRASY  1599
             MEP+SPSK KI ++G  +S IT+K C+  + ++   + ++ GY  F  SL         Y
Sbjct  1     MEPQSPSKKKISILGSFKSHITVKFCLIFLAILLVSVGILCGYGLFGKSL--------PY  52

Query  1598  FTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTRS----DGCKYHCVQTEPG  1440
             FTVV+DCGSTG+RVN+YEW  N   NG+ P L+++YP    ++    +GC+YHC+QTEPG
Sbjct  53    FTVVVDCGSTGTRVNVYEWGINGGRNGDLPNLLHSYPNESAKNGLWKNGCEYHCMQTEPG  112

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
             L  FVGN SG+R SL PL+R AE+ +P+ +   TP+FVLATAG+RRL +ED   V+E V 
Sbjct  113   LDKFVGNYSGVRTSLVPLLRWAERMIPNERHEDTPVFVLATAGLRRLVVEDGKTVLEDVE  172

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              +VKEH F +R+D+IRVLSGREEAYYGWVALNYK+  L  ++   TLGLLDLGGSSLQVV
Sbjct  173   RVVKEHSFKWRRDWIRVLSGREEAYYGWVALNYKLGYLNKSTMLPTLGLLDLGGSSLQVV  232

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFK  900
             TE+DE RED H+  S++G VEH+L+AYSL AFG N+AF+R +A+L   ++R  + G    
Sbjct  233   TEVDEAREDSHLLVSKLGLVEHQLMAYSLPAFGLNKAFERTIAMLKSVRSRENADGS--N  290

Query  899   VRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             VRHPCLSS F+ N+TC  C   +P                 + ++G PNWEKCK+L    
Sbjct  291   VRHPCLSSNFLGNYTCTSC--SEPELL--------------LRLVGVPNWEKCKILTQAA  334

Query  719   ATNSSNLERSKV-AEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
             A N S  + S+     +C     +      N+  N+    +YHALSGFFAVY MLNL+ +
Sbjct  335   AMNLSISDWSETRINSSCWRRSPHEGKNTLNVAFNTKTGMQYHALSGFFAVYKMLNLTGK  394

Query  542   ANLTKMWETGQGLCSRSWVDQTDANG--LCFRILYMASLIKDALCLSNLEIIFGPGDVSW  369
             ANLTK+WET Q LCS +W D+ + +G   CF++LY+ SLI+D LCL N +IIFGPGD+SW
Sbjct  395   ANLTKIWETAQHLCSSTWEDEGNVSGGQYCFKVLYLTSLIEDGLCLGNADIIFGPGDISW  454

Query  368   ALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQIKLPMP  189
              LGA+L+EG    R     SR        + ++SS I LFI+LV ++ IVY SQIKLPMP
Sbjct  455   TLGASLVEGKYMWR-TTVGSRTLITTPLSREVLSSPIFLFIILVVLVFIVYHSQIKLPMP  513

Query  188   GRK--ITSGRASLPSYLSPKQ  132
              ++  +    A L S++  K 
Sbjct  514   RKRSSVVGPPAPLTSFMHSKH  534



>gb|KDP31065.1| hypothetical protein JCGZ_11441 [Jatropha curcas]
Length=560

 Score =   475 bits (1222),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 294/569 (52%), Positives = 377/569 (66%), Gaps = 28/569 (5%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRASYF  1596
             ME KSPSK K+ +MGF +    L+    +++I  +LV   GYFAF       + KR  YF
Sbjct  1     MESKSPSKVKLPIMGFARYKRVLRICAAIVVILLLLVA--GYFAFEYRRPRDLAKR-DYF  57

Query  1595  TVVLDCGSTGSRVNIYEWMPN----NGEFPILVNTYPGNLTRS----DGCKYHCVQTEPG  1440
             TVV+DCGSTG+RVN+Y+W       N + PIL +TYP N T S      CKYHC+QTEPG
Sbjct  58    TVVVDCGSTGTRVNVYKWKIRSSSCNWDLPILEHTYPDNSTESLFSGSSCKYHCMQTEPG  117

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
             L  F GN++G+R SL+PLI  AE+WVP  + G TPIFVLATAG+R+LP+ED   V++ V 
Sbjct  118   LDKFAGNSTGVRVSLEPLILWAEQWVPRDRHGDTPIFVLATAGLRKLPVEDVRLVLDDVE  177

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              I+KE  F YR+ +IRVLSG+EEAYYGWVALNYKM  LGN+S   TLGLLDLGGSSLQVV
Sbjct  178   SILKERSFVYRRSWIRVLSGKEEAYYGWVALNYKMGKLGNSSQGSTLGLLDLGGSSLQVV  237

Query  1079  TEID-EFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF  903
              E+  E R++ H+ R++IGSVE ++LA+SLQ+FG NEAFD  +A LSQ Q    S  EI 
Sbjct  238   MEVHGEERDNIHLIRTKIGSVERQILAHSLQSFGLNEAFDGTVAKLSQLQLIIGSNDEIS  297

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             KVRHPCL S F+QN+TC  C G   S  ++ S +M   E  S+  +GDP+WE+C  +A  
Sbjct  298   KVRHPCLGSDFMQNYTCNACNGHNISHRKNMSGQMHKSEYTSL--VGDPDWEQCIRIARA  355

Query  722   VATNSSNLERSK-VAEQNCVGLLSYGSDR-MQNLTLNSHEVTRYHALSGFFAVYNMLNLS  549
              A NSS+ + S      NC   LS+ S     NLT  ++   R+HALSGFFAV N+L+L 
Sbjct  356   AAINSSSSDTSHPTVSNNCKASLSFNSGSGFLNLTAGAYPTRRFHALSGFFAVTNILDLG  415

Query  548   SRANLTKMWETGQGLCSRSWVD-------QTDANGLCFRILYMASLIKDALCLSNLEIIF  390
              RANLTK+WE G+ LCS+S  +       Q      CFR+ YMASLI+DALCL N EIIF
Sbjct  416   PRANLTKIWEKGEQLCSKSSGELSKISEKQNYFRQYCFRLPYMASLIEDALCLGNKEIIF  475

Query  389   GPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRS  210
             GPGD+SW LGAAL+E GE+  L  +++    L +    ++ S I + ++L+ +L I Y S
Sbjct  476   GPGDLSWTLGAALVE-GEYLWLSTSKTSISSLTSME--VIYSPIFVSLLLLFLLFIAYHS  532

Query  209   QIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             QIKLPM G+K      SLPSYL PK +PN
Sbjct  533   QIKLPMIGKK-GPAITSLPSYLYPKHRPN  560



>ref|XP_010102520.1| Nucleoside-diphosphatase mig-23 [Morus notabilis]
 gb|EXB93584.1| Nucleoside-diphosphatase mig-23 [Morus notabilis]
Length=527

 Score =   473 bits (1218),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 273/512 (53%), Positives = 354/512 (69%), Gaps = 20/512 (4%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWM---PNNGEFPILVNTYPGNLTRS----DGCKYHCVQ  1452
             + SY+TVV+DCGSTG+RVN+YEW     N  E PIL+++YP N T+S    + CKYHC+Q
Sbjct  19    KGSYYTVVVDCGSTGTRVNVYEWEGRGENERELPILLHSYPDNSTKSSLLKNSCKYHCMQ  78

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
             TEPGL  FVGN+SG+RASL+PLI  AE+ VP  +   TPIFVLATAG+RR+ +ED  RVM
Sbjct  79    TEPGLDKFVGNSSGVRASLEPLITWAEQMVPLERHSATPIFVLATAGLRRIAVEDVRRVM  138

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggss  1092
             E V  +VKE  F  R+ +IRVLSG+EEAYYGWVALNYKM +  N S S T  LLDLGGSS
Sbjct  139   EDVEDVVKERSFSCRRSWIRVLSGKEEAYYGWVALNYKMGVFRNHSRSPTSALLDLGGSS  198

Query  1091  LQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRG  912
             LQVV E++   +D H+ RS+ G +EH++LAYSL AFG NEAFDR + +LS T+A RES G
Sbjct  199   LQVVVEVESEGKDTHLVRSKFGFIEHRVLAYSLPAFGLNEAFDRTVVLLSHTEALRESGG  258

Query  911   EIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVL  732
                ++RHPC  S FVQN+TCRGCFG   ++   + S+M   E  S+ ++G PNW++CK+L
Sbjct  259   GTLELRHPCYGSDFVQNYTCRGCFGLN-AAEWKNPSQMEKIEYPSLYLVGAPNWQQCKIL  317

Query  731   AMEVATNSSNLE--RSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNML  558
             A   A NSS+L+   S   E +   L       +  LT  +H   R+HALSGFFAV++ L
Sbjct  318   ARAAALNSSSLDWPWSAAGEGDKSRLSFVSGSGILKLTAFAHRTLRFHALSGFFAVFDTL  377

Query  557   NLSSRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRILYMASLIKDALCLSNLE  399
             NLS RANLTK+WE GQ LC RSW D++  +G        CFR+ YMASLI+DAL L + E
Sbjct  378   NLSPRANLTKIWEKGQRLCLRSWADKSSISGNQYYAGHYCFRVPYMASLIEDALRLGDKE  437

Query  398   IIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIV  219
             I FGP DVSW LGAAL+EG   S  + T + +    T +  ++SS I +F+VLVC+L+IV
Sbjct  438   IWFGPPDVSWTLGAALVEG--ESLWLTTSTPQNRTLTSYIKIMSSPIFVFVVLVCLLLIV  495

Query  218   YRSQIKLPMPGRKITSGRASLPSYLSP-KQPN  126
             +RSQ+KLPM G+K  +   S  SY+ P ++PN
Sbjct  496   HRSQVKLPMLGKKSAALVTSSHSYIYPRRRPN  527



>ref|XP_011046181.1| PREDICTED: probable apyrase 7 isoform X1 [Populus euphratica]
Length=550

 Score =   473 bits (1218),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 279/528 (53%), Positives = 366/528 (69%), Gaps = 23/528 (4%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMP----NNGEFPILVNTYPGN--  1491
             YFA + +    V+    ++TVV+DCGSTG+RVN+Y+W      +N + PILV++YP N  
Sbjct  27    YFASNNAGKAVVKSGFYHYTVVVDCGSTGTRVNVYKWWKPASLSNWDLPILVHSYPDNST  86

Query  1490  --LTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
               L+R   CKYHCVQTEPGL  FVGN++G+R SL+PLI  AE+WVP  + G TPIFVLAT
Sbjct  87    QSLSRGSSCKYHCVQTEPGLDKFVGNSTGVRLSLEPLILWAEQWVPRERHGDTPIFVLAT  146

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RR+ IEDA RV++ V  +VKEH F  +K +IRVLSG+EEAYYGWVALNYKM  LGN+
Sbjct  147   AGLRRVLIEDARRVLDDVEDVVKEHSFVSKKSWIRVLSGKEEAYYGWVALNYKMGSLGNS  206

Query  1136  sgshtlglldlggssLQVVTEI-DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR  960
             S   TLGLLDLGGSSLQVV E+ D  R D ++ RS+IG VEH +LA+SL +FG NEAFDR
Sbjct  207   SIGPTLGLLDLGGSSLQVVMEVHDGGRNDANLIRSKIGLVEHYILAFSLSSFGLNEAFDR  266

Query  959   ALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN  780
              +A+LSQ Q       E ++VRHPCL  GF +N++C  C G       + S +    E  
Sbjct  267   TVAMLSQVQPGGGGNNERYEVRHPCLGFGFQRNYSCYVCDGINAPYQRNLSIQTHKSEFT  326

Query  779   SILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE-QNC-VGLLSYGSDRMQNLTLNSHEV  606
             +  ++GDP+WE CK +A   A N S L+ S+  +  NC  GL SYGSD + N    ++  
Sbjct  327   NTHLVGDPDWEICKGIARAAALNLSILDWSQSTDLNNCKTGLSSYGSDTL-NFIAGTYLS  385

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRIL  447
              R+HALSGFFAVYNML+L+  ANLTK+WE GQ +CS+SW D ++A+G        CFR+ 
Sbjct  386   RRFHALSGFFAVYNMLDLAPIANLTKIWEKGQQMCSKSWPDSSNASGNQNNIGKYCFRVP  445

Query  446   YMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVS  267
             YMASLI+DALCL + EI+FGPGD+SW LGA+L+E  E     +TE+    L+ + K ++ 
Sbjct  446   YMASLIEDALCLGDKEIVFGPGDLSWTLGASLVE-VEKPWPSSTETTI--LSLKSKEVLY  502

Query  266   SSITLFIVLVCVLMIVYRSQIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             SSI LF++L+ +  IVY +QIKLPMPG+KI + R S PSY+ PK +PN
Sbjct  503   SSILLFLLLLFISFIVYYNQIKLPMPGKKIPAVRLSFPSYVHPKLRPN  550



>ref|XP_011046156.1| PREDICTED: probable apyrase 7 isoform X1 [Populus euphratica]
Length=550

 Score =   473 bits (1217),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 279/528 (53%), Positives = 366/528 (69%), Gaps = 23/528 (4%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMP----NNGEFPILVNTYPGN--  1491
             YFA + +    V+    ++TVV+DCGSTG+RVN+Y+W      +N + PILV++YP N  
Sbjct  27    YFASNNAGKAVVKSGFYHYTVVVDCGSTGTRVNVYKWWKPASLSNWDLPILVHSYPDNST  86

Query  1490  --LTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
               L+R   CKYHCVQTEPGL  FVGN++G+R SL+PLI  AE+WVP  + G TPIFVLAT
Sbjct  87    QSLSRGSSCKYHCVQTEPGLDKFVGNSTGVRLSLEPLILWAEQWVPRERHGDTPIFVLAT  146

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RR+ IEDA RV++ V  +VKEH F  +K +IRVLSG+EEAYYGWVALNYKM  LGN+
Sbjct  147   AGLRRVLIEDARRVLDDVEDVVKEHSFVSKKSWIRVLSGKEEAYYGWVALNYKMGSLGNS  206

Query  1136  sgshtlglldlggssLQVVTEI-DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR  960
             S   TLGLLDLGGSSLQVV E+ D  R D ++ RS+IG VEH +LA+SL +FG NEAFDR
Sbjct  207   SIGPTLGLLDLGGSSLQVVMEVHDGGRNDANLIRSKIGLVEHYILAFSLSSFGLNEAFDR  266

Query  959   ALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN  780
              +A+LSQ Q       E ++VRHPCL  GF +N++C  C G       + S +    E  
Sbjct  267   TVAMLSQVQPGGGGNNERYEVRHPCLGFGFQRNYSCYVCDGINAPYQRNLSIQTHKSEFT  326

Query  779   SILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE-QNC-VGLLSYGSDRMQNLTLNSHEV  606
             +  ++GDP+WE CK +A   A N S L+ S+  +  NC  GL SYGSD + N    ++  
Sbjct  327   NTHLVGDPDWEICKGIARAAALNLSILDWSQSTDLNNCKTGLSSYGSDTL-NFIAGTYLS  385

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRIL  447
              R+HALSGFFAVYNML+L+  ANLTK+WE GQ +CS+SW D ++A+G        CFR+ 
Sbjct  386   RRFHALSGFFAVYNMLDLAPIANLTKIWEKGQQMCSKSWPDSSNASGNQNNIGKYCFRVP  445

Query  446   YMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVS  267
             YMASLI+DALCL + EI+FGPGD+SW LGA+L+E  E     +TE+    L+ + K ++ 
Sbjct  446   YMASLIEDALCLGDKEIVFGPGDLSWTLGASLVE-VEKPWPSSTETTI--LSLKSKEVLY  502

Query  266   SSITLFIVLVCVLMIVYRSQIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             SSI LF++L+ +  IVY +QIKLPMPG+KI + R S PSY+ PK +PN
Sbjct  503   SSILLFLLLLFISFIVYYNQIKLPMPGKKIPAVRLSFPSYVHPKLRPN  550



>ref|XP_007209872.1| hypothetical protein PRUPE_ppa003837mg [Prunus persica]
 gb|EMJ11071.1| hypothetical protein PRUPE_ppa003837mg [Prunus persica]
Length=545

 Score =   468 bits (1203),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 288/550 (52%), Positives = 368/550 (67%), Gaps = 29/550 (5%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFG-YFAFSPSLILYVRKRASY  1599
             MEPKSPSK K+ +MGF Q    L+      +++ I++L+FG YF F P     V K   Y
Sbjct  1     MEPKSPSKLKLSIMGFAQYKQALR---TGFMVTVIILLLFGAYFVFIPGKGHSVSK-GPY  56

Query  1598  FTVVLDCGSTGSRVNIYEWMP---NNGEFPILVNTYPGNLTRSDG-----CKYHCVQTEP  1443
             +TVV+DCGSTG+RVN+Y+W+    ++ E PIL+ +YP N T  DG     CKYHC+QTEP
Sbjct  57    YTVVVDCGSTGTRVNVYKWLARAVSSKELPILLYSYPDNST--DGMLWKSCKYHCLQTEP  114

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL   VGN SG+RASL+PLI  AE  VPS KR  TPIFVLATAG+RRL +EDA RV+  +
Sbjct  115   GLDKSVGNLSGVRASLEPLITLAEHKVPSEKRRDTPIFVLATAGLRRLAMEDARRVLNDI  174

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               IVKEH F Y K +IRVLSG+EEAYYGWVALNYKM   GN S S TLGLLDLGGSSLQ+
Sbjct  175   EAIVKEHTFLYEKSWIRVLSGQEEAYYGWVALNYKMGSFGNHSRSPTLGLLDLGGSSLQI  234

Query  1082  VTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF  903
             V E+D+ RED ++ RS+ G VEH +LAYSL  FG NEAFDR + +LS  +  RES   I 
Sbjct  235   VVEVDDTREDANLVRSKFGFVEHDILAYSLSEFGLNEAFDRTVVMLSHMEQLRESASGIV  294

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             ++RHPCL +  VQN+TC GC        +  +S++   +  S+ ++G PNWE+C+ LA  
Sbjct  295   EIRHPCLHTDIVQNYTCYGCSQLNAPDQKKVTSQVQETKFPSVYLVGVPNWEQCRRLARV  354

Query  722   VATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
              A NSS  +    A ++C    S     M NLT  +H   R+HALSGFFAVY+ LNLS+R
Sbjct  355   AAINSSTADTDHRA-RSC----SDNGSEMINLTAFAHPKARFHALSGFFAVYDKLNLSTR  409

Query  542   ANLTKMWETGQGLCSRSWVDQTDAN-------GLCFRILYMASLIKDALCLSNLEIIFGP  384
             A LTK+WE GQ +CSRS  D +  +         CFR+ Y+ASLI DALCL + EIIFGP
Sbjct  410   ATLTKIWEKGQQVCSRSGSDLSSNSQNAYFTWQYCFRVPYVASLIDDALCLGDKEIIFGP  469

Query  383   GDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQI  204
              DV+W LGAAL+E GE+     T S+   LA   + ++SS I + ++L+C+L+IVY  Q+
Sbjct  470   ADVTWTLGAALVE-GEYLWSSPTRSQSSILALNME-VISSPIFVLVLLLCILLIVYCCQV  527

Query  203   KLPMPGRKIT  174
             KLPM GRK T
Sbjct  528   KLPMIGRKST  537



>emb|CBI14994.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   468 bits (1204),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 290/576 (50%), Positives = 378/576 (66%), Gaps = 20/576 (3%)
 Frame = -1

Query  1808  IAYFLDNHTLRMEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSL  1629
             +A F+    L MEP+SPSK KI +MGF+Q         +VL +  +LV +  Y  F P  
Sbjct  54    VAGFIHVGVLAMEPRSPSKFKIPIMGFVQYKRVFNIGIIVLAVVLLLVGV--YHVFGPGR  111

Query  1628  ILYVRKRASYFTVVLDCGSTGSRVNIYEWM---PNNGEFPILVNTYPGNLTRS----DGC  1470
                V  R  YFTVV+DCGSTG+RVN+YEW+     N E P+L+++YP   T+S      C
Sbjct  112   GGNVLGRP-YFTVVVDCGSTGTRVNVYEWVMKGERNWELPMLMHSYPDLSTKSPLWKGAC  170

Query  1469  KYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
             +YHC+QTEPGL  FVGN SG+RASL+PLI  AE+ VP  +RG TP+FVLATAG+RRL + 
Sbjct  171   QYHCLQTEPGLDKFVGNYSGVRASLEPLILWAEQQVPPERRGETPVFVLATAGLRRLDVV  230

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D  +V++    +V +H F +R+ +IRVLSG+EEAYYGW+ALNYKM  LGN S   TLGLL
Sbjct  231   DVKQVLDDAEAVVGKHAFLHRRSWIRVLSGKEEAYYGWIALNYKMGRLGNNSRLPTLGLL  290

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             DLGGSSLQVV E+ E RED H+ RSR+G  EH++LAYSL  FG N+AFDR +++LSQ Q 
Sbjct  291   DLGGSSLQVVMEVGESREDGHLVRSRVGLFEHRILAYSLTEFGINKAFDRTVSMLSQVQP  350

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNW  750
              RE  G   +++HPCL S +V N+TC GC     + S  S   M      S+ ++GD NW
Sbjct  351   LREGSGRKLELQHPCLGSDYVNNYTCDGCIFSNATDSNSSQP-MRNHHFTSVYLVGDLNW  409

Query  749   EKCKVLAMEVATNSSNLERSKVA-EQNCVGLL-SYGSDRMQNLTLNSHEVTRYHALSGFF  576
             E+CK LA   A +SS+ + S +    NC   L S+    + N    +H    +HALSGFF
Sbjct  410   EQCKGLARTAAIHSSSSDWSNLTLALNCKAHLPSHSGSNILNSKATTHAAACFHALSGFF  469

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRS-----WVDQTDANGLCFRILYMASLIKDALCL  411
              VY MLNLS RAN+T++WE GQ LCSRS      +    A   CF + Y+ASLI+D LCL
Sbjct  470   VVYTMLNLSQRANMTEIWERGQLLCSRSDAHFGSISGNYARQFCFSVPYLASLIEDGLCL  529

Query  410   SNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCV  231
              + EI FGPGDVSW LGAAL+E GE+  L  T SR    + + K +++S   LFI+L+ +
Sbjct  530   GDAEINFGPGDVSWTLGAALVE-GEYLWLSTTNSRLSISSLKIKSVLASPFFLFILLLGL  588

Query  230   LMIVYRSQIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             L+IVY SQIKLPMPG++    R+SLPSY+ PK +PN
Sbjct  589   LLIVYCSQIKLPMPGKRGAGVRSSLPSYIYPKRRPN  624



>ref|XP_002278485.3| PREDICTED: probable apyrase 7 [Vitis vinifera]
Length=560

 Score =   464 bits (1195),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 286/565 (51%), Positives = 375/565 (66%), Gaps = 20/565 (4%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRASYF  1596
             MEP+SPSK KI +MGF+Q         +VL +  +LV ++    F P     V  R  YF
Sbjct  1     MEPRSPSKFKIPIMGFVQYKRVFNIGIIVLAVVLLLVGVY--HVFGPGRGGNVLGRP-YF  57

Query  1595  TVVLDCGSTGSRVNIYEWM---PNNGEFPILVNTYPGNLTRS----DGCKYHCVQTEPGL  1437
             TVV+DCGSTG+RVN+YEW+     N E P+L+++YP   T+S      C+YHC+QTEPGL
Sbjct  58    TVVVDCGSTGTRVNVYEWVMKGERNWELPMLMHSYPDLSTKSPLWKGACQYHCLQTEPGL  117

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
               FVGN SG+RASL+PLI  AE+ VP  +RG TP+FVLATAG+RRL + D  +V++    
Sbjct  118   DKFVGNYSGVRASLEPLILWAEQQVPPERRGETPVFVLATAGLRRLDVVDVKQVLDDAEA  177

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +V +H F +R+ +IRVLSG+EEAYYGW+ALNYKM  LGN S   TLGLLDLGGSSLQVV 
Sbjct  178   VVGKHAFLHRRSWIRVLSGKEEAYYGWIALNYKMGRLGNNSRLPTLGLLDLGGSSLQVVM  237

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKV  897
             E+ E RED H+ RSR+G  EH++LAYSL  FG N+AFDR +++LSQ Q  RE  G   ++
Sbjct  238   EVGESREDGHLVRSRVGLFEHRILAYSLTEFGINKAFDRTVSMLSQVQPLREGSGRKLEL  297

Query  896   RHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVA  717
             +HPCL S +V N+TC GC     ++  +SS  M      S+ ++GD NWE+CK LA   A
Sbjct  298   QHPCLGSDYVNNYTCDGCIFSN-ATDSNSSQPMRNHHFTSVYLVGDLNWEQCKGLARTAA  356

Query  716   TNSSNLERSKVA-EQNCVGLL-SYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
              +SS+ + S +    NC   L S+    + N    +H    +HALSGFF VY MLNLS R
Sbjct  357   IHSSSSDWSNLTLALNCKAHLPSHSGSNILNSKATTHAAACFHALSGFFVVYTMLNLSQR  416

Query  542   ANLTKMWETGQGLCSRS-----WVDQTDANGLCFRILYMASLIKDALCLSNLEIIFGPGD  378
             AN+T++WE GQ LCSRS      +    A   CF + Y+ASLI+D LCL + EI FGPGD
Sbjct  417   ANMTEIWERGQLLCSRSDAHFGSISGNYARQFCFSVPYLASLIEDGLCLGDAEINFGPGD  476

Query  377   VSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQIKL  198
             VSW LGAAL+E GE+  L  T SR    + + K +++S   LFI+L+ +L+IVY SQIKL
Sbjct  477   VSWTLGAALVE-GEYLWLSTTNSRLSISSLKIKSVLASPFFLFILLLGLLLIVYCSQIKL  535

Query  197   PMPGRKITSGRASLPSYLSPK-QPN  126
             PMPG++    R+SLPSY+ PK +PN
Sbjct  536   PMPGKRGAGVRSSLPSYIYPKRRPN  560



>ref|XP_007036306.1| GDA1/CD39 nucleoside phosphatase family protein, putative [Theobroma 
cacao]
 gb|EOY20807.1| GDA1/CD39 nucleoside phosphatase family protein, putative [Theobroma 
cacao]
Length=559

 Score =   464 bits (1193),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 283/565 (50%), Positives = 370/565 (65%), Gaps = 26/565 (5%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRASYF  1596
             MEPKSPSK K+ VMGF +    LK      LI    + ++  F F  +  +     +SY+
Sbjct  1     MEPKSPSKVKLSVMGFKRWKRVLKVFTFGFLILLSCIGVYLAFNFVKAWNVL---ESSYY  57

Query  1595  TVVLDCGSTGSRVNIYEW----MPNNGEFPILVNTYPGNLTRS----DGCKYHCVQTEPG  1440
             TVV+DCGSTG+RVN++EW    + N G  P LV++YP   T+S    + C YHC+QTEPG
Sbjct  58    TVVVDCGSTGTRVNVFEWEKGGLVNQG-LPYLVHSYPDYSTKSPLWRNSCHYHCMQTEPG  116

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
             L  FVGNASG+RASL+PLI  AE+ VP  + G TPI VLATAG+RRL  +DA +V++ V 
Sbjct  117   LDKFVGNASGMRASLEPLIAWAEQMVPHERHGDTPIIVLATAGLRRLAAKDARQVLDDVE  176

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              +V+ H F Y K++IRVL+G+EEAYYGWVALNYK+  LGN+  + T GLLDLGGSSLQVV
Sbjct  177   IVVRGHSFVYSKNWIRVLTGKEEAYYGWVALNYKLGSLGNSLKASTFGLLDLGGSSLQVV  236

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFK  900
              E+ E   +E+V  S IGS +H +LAYSL AFG  EAFDR + +LSQ Q  R +    F+
Sbjct  237   VEVAEENGNENVMTSNIGSTDHNILAYSLPAFGLTEAFDRTVVMLSQNQTDRGNTTNRFE  296

Query  899   VRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             VRHPCLSS FVQN+TC GC     +  E+S S M   + +   ++GDPNWE+CK L    
Sbjct  297   VRHPCLSSDFVQNYTCSGCPMPNVTDLENSESLMYKSQFSLTYLVGDPNWEQCKELVRAA  356

Query  719   ATNSSNLERS-KVAEQNCVGLLS-YGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSS  546
             A N S  + S ++  +NC    S YG   M NLT  +H   R+HALSGFF V +ML+LS 
Sbjct  357   AMNYSGSDWSHQIVGRNCEANSSPYGGSNMLNLTAVAHHSGRFHALSGFFVVNDMLHLSP  416

Query  545   RANLTKMWETGQGLCSRSWVD-------QTDANGLCFRILYMASLIKDALCLSNLEIIFG  387
             RA++T++WE G+ LCSRS  +       QT A   CFR+ Y+ASLI+D+LCL N EI+FG
Sbjct  417   RASVTEIWEKGEQLCSRSSTELSSISQRQTYAGQSCFRVPYVASLIEDSLCLGNGEIVFG  476

Query  386   PGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQ  207
             PGDVSW LGAALI G +     A+ S  K +      + SS + LF++L+ +L +VY SQ
Sbjct  477   PGDVSWTLGAALIHGLDSIETPASISTTKDMD-----IFSSPVFLFVLLLFLLFVVYCSQ  531

Query  206   IKLPMPGRKITSGRASLPSYLSPKQ  132
             I LPM GRK+     SLPSY+ P++
Sbjct  532   ITLPMLGRKVADVGVSLPSYVHPRR  556



>ref|XP_008244997.1| PREDICTED: probable apyrase 7 [Prunus mume]
Length=545

 Score =   459 bits (1182),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 279/548 (51%), Positives = 365/548 (67%), Gaps = 29/548 (5%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFG-YFAFSPSLILYVRKRASY  1599
             MEPKSPSK K+ + GF Q    L+      +++ I++L+FG YFAF P     V K   Y
Sbjct  1     MEPKSPSKFKLSITGFAQYKQALR---TSFVVTVIILLLFGAYFAFIPRKGHSVSK-GPY  56

Query  1598  FTVVLDCGSTGSRVNIYEWMPNN---GEFPILVNTYPGNLTRSDG-----CKYHCVQTEP  1443
             +TVV+DCGSTG+RVN+Y+W+  +    E PIL+ +YP N T  DG     CKYHC+QTEP
Sbjct  57    YTVVVDCGSTGTRVNVYKWLARDVSSKELPILLYSYPNNST--DGMLWKSCKYHCLQTEP  114

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             G+   VGN SG+RASL+PLI  AE  VPS KR  TPIFVLATAG+RRL +EDA RV+  +
Sbjct  115   GVDKSVGNLSGVRASLEPLITLAEHKVPSEKRRDTPIFVLATAGLRRLAMEDARRVLNDI  174

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               +VKEH F Y+K +IRVLSG+EEAYYGWVALNYKM   GN S S TLGLLDLGGSSLQ+
Sbjct  175   EVVVKEHTFLYKKSWIRVLSGQEEAYYGWVALNYKMGSFGNHSRSPTLGLLDLGGSSLQI  234

Query  1082  VTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF  903
             V E+D  RED ++ RS+ G VEH +LAYSL  FG NEAFDR + +LS  +   ES   I 
Sbjct  235   VVEVDNTREDANLVRSKFGFVEHDILAYSLSEFGLNEAFDRTVVMLSHMEQLTESASGIV  294

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             ++RHPCL +  VQN+TC GC        ++ +S++   +  S+ ++G PNWE+C+ LA  
Sbjct  295   EIRHPCLHTDIVQNYTCYGCSQLNAPDQKNVTSQVQETKFPSVYLVGAPNWEQCRRLAKV  354

Query  722   VATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
              A NSS  + + +  ++C    S   + M NLT  +H   R+HALSGFFA+Y+ LNLS R
Sbjct  355   AAINSSTAD-TDLRARSC----SDNGNEMINLTAFAHPKARFHALSGFFAIYDKLNLSGR  409

Query  542   ANLTKMWETGQGLCSRSWVDQTD-------ANGLCFRILYMASLIKDALCLSNLEIIFGP  384
             A L K+WE GQ +CSRSW D +        A   CFR+ Y+ASL+ DA+CL + EIIFGP
Sbjct  410   ATLMKIWEKGQQVCSRSWSDLSSNSQNAYFAWQYCFRVPYVASLVDDAMCLGDKEIIFGP  469

Query  383   GDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQI  204
              DV+W LGAAL+E GE+     T S+   LA   + ++SS   + ++L+C+L+ VY  Q+
Sbjct  470   ADVTWTLGAALVE-GEYLWSSPTRSQISILALNTE-VISSPFFVLVLLLCILLSVYCCQV  527

Query  203   KLPMPGRK  180
             KLPM GRK
Sbjct  528   KLPMIGRK  535



>gb|EYU22154.1| hypothetical protein MIMGU_mgv1a004670mg [Erythranthe guttata]
Length=516

 Score =   456 bits (1173),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 282/560 (50%), Positives = 362/560 (65%), Gaps = 54/560 (10%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRASYF  1596
             MEPKSPSKSKI + G    P + + V + L I  IL +I GY  F     L     ++YF
Sbjct  1     MEPKSPSKSKIQITGLSYKPRSRQFVIITLSIILILGVIGGYLFFKDRFFL-SENMSTYF  59

Query  1595  TVVLDCGSTGSRVNIYEWMPNNGE-----FPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
             TVVLDCGSTGSRVN+YEWM  NG       P+L+  YP N  +S+GC+Y           
Sbjct  60    TVVLDCGSTGSRVNVYEWMIRNGSKVYGTLPLLLRIYPDNANKSNGCRY-----------  108

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
                               AE+ VP  KR  TPIFVLATAGMRRL  ++A+RV+  V  +V
Sbjct  109   ------------------AEQRVPLEKRASTPIFVLATAGMRRLVAKNANRVLAEVENVV  150

Query  1250  KEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRML-GNTsgshtlglldlggssLQVVTE  1074
             KEHGF Y K++IRVLSG+EEAYYGWVALNYK  +L  ++    TLGLLDLGGSSLQVV E
Sbjct  151   KEHGFLYNKNWIRVLSGKEEAYYGWVALNYKTGVLESSSKKIPTLGLLDLGGSSLQVVAE  210

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR  894
             +D   +D+H  RS+IG+ EH ++AYSL AFG NEAFDR + +LS+T+A+RES G +F++R
Sbjct  211   MDASTKDKHALRSKIGTFEHDIVAYSLPAFGLNEAFDRTIVMLSRTRAKRESVGGVFEIR  270

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
             HPCL SGFV+N+T         S +  +       ELN + ++G+PNWEKC ++A   A 
Sbjct  271   HPCLGSGFVKNYTF------VVSRNSSNRVHEEKNELNPVFLVGEPNWEKCGIIARAAAI  324

Query  713   NSSNLERS-KVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
             NSSN E S ++   NC+GL SYG ++  NLT N H V+RYHALSGFFAVYN LNLS RAN
Sbjct  325   NSSNSESSHQLYNSNCIGLFSYGGNKKLNLTKNLHAVSRYHALSGFFAVYNALNLSRRAN  384

Query  536   LTKMWETGQGLCSRSWVDQTDANGL-CFRILYMASLIKDALCLSNLEIIFGPGDVSWALG  360
             LT MWE GQ LCS     Q   NG  CFR+ Y+ SLI++ALCLS++EIIFGPGD++W LG
Sbjct  385   LTTMWEMGQNLCS----GQKRINGQDCFRLPYLISLIENALCLSDVEIIFGPGDITWTLG  440

Query  359   AALIEGGEHSRLIATESRRKGLATQHK-WMVSSSITLFIVLVCVLMIVYRSQIKLPMPGR  183
             A+LIE  E   L + +SR   L  +    ++ S++  F++L+ +++IVY  Q+KLPM GR
Sbjct  441   ASLIE-TEFLWLHSGKSRNGVLFLKDSITVIPSTLVTFVLLLFLMIIVYSCQVKLPMLGR  499

Query  182   KITSGRASLPSYLSPK-QPN  126
             K    +    SY  PK QPN
Sbjct  500   KNVVAKT---SYFCPKCQPN  516



>ref|XP_002321616.2| hypothetical protein POPTR_0015s09140g [Populus trichocarpa]
 gb|EEF05743.2| hypothetical protein POPTR_0015s09140g [Populus trichocarpa]
Length=543

 Score =   449 bits (1156),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 247/454 (54%), Positives = 319/454 (70%), Gaps = 19/454 (4%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMP----NNGEFPILVNTYPGN--  1491
             YFA + +    V+    ++TVV+DCGSTG+RVN+Y+W      +N + PILV++YP N  
Sbjct  27    YFASNKAGKAVVKSGFYHYTVVVDCGSTGTRVNVYKWWKPASLSNWDLPILVHSYPDNST  86

Query  1490  --LTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
               L+R   CKYHCVQTEPGL  FVGN++G+R SL+PLI  AE+WVP  + G TPIFVLAT
Sbjct  87    QSLSRGSSCKYHCVQTEPGLDKFVGNSTGVRLSLEPLILWAEQWVPRERHGDTPIFVLAT  146

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRL IEDA +V++ V  +VKEH F  +K +IRVLSG+EEAYYGWVALNYKM  LGN+
Sbjct  147   AGLRRLLIEDARQVLDDVEDVVKEHSFVSKKSWIRVLSGKEEAYYGWVALNYKMGSLGNS  206

Query  1136  sgshtlglldlggssLQVVTEI-DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR  960
             S   TLGLLDLGGSSLQVV E+ D  R D ++ RS+IG VEH +LA+SL +FG NEAFDR
Sbjct  207   SIGPTLGLLDLGGSSLQVVMEVHDGGRNDANLIRSKIGLVEHYILAFSLSSFGLNEAFDR  266

Query  959   ALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN  780
              +A+LSQ Q       E ++VRHPCL  GF +N+TC  C G      ++ S +    E  
Sbjct  267   TVAMLSQVQPGGGGNNERYEVRHPCLGFGFQRNYTCYVCDGINVPYQKNLSIQTHKSEFT  326

Query  779   SILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE-QNC-VGLLSYGSDRMQNLTLNSHEV  606
             +  ++GDP+WE CK +A   A N S+L+ S+  +  NC  GL SYGSD + N    +H  
Sbjct  327   NTQLVGDPDWEICKGIARAAALNLSSLDWSQPTDLNNCKTGLSSYGSDTL-NFIAGTHPS  385

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRIL  447
              R+HALSGFFAVYNML+L+  ANLTK+WE GQ +CS+SW D ++ +G        CFR+ 
Sbjct  386   RRFHALSGFFAVYNMLDLAPIANLTKIWEKGQQMCSKSWPDSSNTSGNQNNLGKYCFRVP  445

Query  446   YMASLIKDALCLSNLEIIFGPGDVSWALGAALIE  345
             YMASLI+DALCL + EI+FGPGD+SW LGA+L+E
Sbjct  446   YMASLIEDALCLGDKEIVFGPGDLSWTLGASLVE  479



>ref|XP_011046182.1| PREDICTED: probable apyrase 7 isoform X2 [Populus euphratica]
Length=513

 Score =   444 bits (1143),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 246/454 (54%), Positives = 318/454 (70%), Gaps = 19/454 (4%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMP----NNGEFPILVNTYPGN--  1491
             YFA + +    V+    ++TVV+DCGSTG+RVN+Y+W      +N + PILV++YP N  
Sbjct  27    YFASNNAGKAVVKSGFYHYTVVVDCGSTGTRVNVYKWWKPASLSNWDLPILVHSYPDNST  86

Query  1490  --LTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
               L+R   CKYHCVQTEPGL  FVGN++G+R SL+PLI  AE+WVP  + G TPIFVLAT
Sbjct  87    QSLSRGSSCKYHCVQTEPGLDKFVGNSTGVRLSLEPLILWAEQWVPRERHGDTPIFVLAT  146

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RR+ IEDA RV++ V  +VKEH F  +K +IRVLSG+EEAYYGWVALNYKM  LGN+
Sbjct  147   AGLRRVLIEDARRVLDDVEDVVKEHSFVSKKSWIRVLSGKEEAYYGWVALNYKMGSLGNS  206

Query  1136  sgshtlglldlggssLQVVTEI-DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR  960
             S   TLGLLDLGGSSLQVV E+ D  R D ++ RS+IG VEH +LA+SL +FG NEAFDR
Sbjct  207   SIGPTLGLLDLGGSSLQVVMEVHDGGRNDANLIRSKIGLVEHYILAFSLSSFGLNEAFDR  266

Query  959   ALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN  780
              +A+LSQ Q       E ++VRHPCL  GF +N++C  C G       + S +    E  
Sbjct  267   TVAMLSQVQPGGGGNNERYEVRHPCLGFGFQRNYSCYVCDGINAPYQRNLSIQTHKSEFT  326

Query  779   SILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE-QNC-VGLLSYGSDRMQNLTLNSHEV  606
             +  ++GDP+WE CK +A   A N S L+ S+  +  NC  GL SYGSD + N    ++  
Sbjct  327   NTHLVGDPDWEICKGIARAAALNLSILDWSQSTDLNNCKTGLSSYGSDTL-NFIAGTYLS  385

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRIL  447
              R+HALSGFFAVYNML+L+  ANLTK+WE GQ +CS+SW D ++A+G        CFR+ 
Sbjct  386   RRFHALSGFFAVYNMLDLAPIANLTKIWEKGQQMCSKSWPDSSNASGNQNNIGKYCFRVP  445

Query  446   YMASLIKDALCLSNLEIIFGPGDVSWALGAALIE  345
             YMASLI+DALCL + EI+FGPGD+SW LGA+L+E
Sbjct  446   YMASLIEDALCLGDKEIVFGPGDLSWTLGASLVE  479



>ref|XP_011046157.1| PREDICTED: probable apyrase 7 isoform X2 [Populus euphratica]
Length=513

 Score =   444 bits (1143),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 246/454 (54%), Positives = 318/454 (70%), Gaps = 19/454 (4%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMP----NNGEFPILVNTYPGN--  1491
             YFA + +    V+    ++TVV+DCGSTG+RVN+Y+W      +N + PILV++YP N  
Sbjct  27    YFASNNAGKAVVKSGFYHYTVVVDCGSTGTRVNVYKWWKPASLSNWDLPILVHSYPDNST  86

Query  1490  --LTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
               L+R   CKYHCVQTEPGL  FVGN++G+R SL+PLI  AE+WVP  + G TPIFVLAT
Sbjct  87    QSLSRGSSCKYHCVQTEPGLDKFVGNSTGVRLSLEPLILWAEQWVPRERHGDTPIFVLAT  146

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RR+ IEDA RV++ V  +VKEH F  +K +IRVLSG+EEAYYGWVALNYKM  LGN+
Sbjct  147   AGLRRVLIEDARRVLDDVEDVVKEHSFVSKKSWIRVLSGKEEAYYGWVALNYKMGSLGNS  206

Query  1136  sgshtlglldlggssLQVVTEI-DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR  960
             S   TLGLLDLGGSSLQVV E+ D  R D ++ RS+IG VEH +LA+SL +FG NEAFDR
Sbjct  207   SIGPTLGLLDLGGSSLQVVMEVHDGGRNDANLIRSKIGLVEHYILAFSLSSFGLNEAFDR  266

Query  959   ALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN  780
              +A+LSQ Q       E ++VRHPCL  GF +N++C  C G       + S +    E  
Sbjct  267   TVAMLSQVQPGGGGNNERYEVRHPCLGFGFQRNYSCYVCDGINAPYQRNLSIQTHKSEFT  326

Query  779   SILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE-QNC-VGLLSYGSDRMQNLTLNSHEV  606
             +  ++GDP+WE CK +A   A N S L+ S+  +  NC  GL SYGSD + N    ++  
Sbjct  327   NTHLVGDPDWEICKGIARAAALNLSILDWSQSTDLNNCKTGLSSYGSDTL-NFIAGTYLS  385

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRIL  447
              R+HALSGFFAVYNML+L+  ANLTK+WE GQ +CS+SW D ++A+G        CFR+ 
Sbjct  386   RRFHALSGFFAVYNMLDLAPIANLTKIWEKGQQMCSKSWPDSSNASGNQNNIGKYCFRVP  445

Query  446   YMASLIKDALCLSNLEIIFGPGDVSWALGAALIE  345
             YMASLI+DALCL + EI+FGPGD+SW LGA+L+E
Sbjct  446   YMASLIEDALCLGDKEIVFGPGDLSWTLGASLVE  479



>ref|XP_010027400.1| PREDICTED: probable apyrase 7 [Eucalyptus grandis]
 gb|KCW83315.1| hypothetical protein EUGRSUZ_B00247 [Eucalyptus grandis]
Length=566

 Score =   437 bits (1123),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 254/559 (45%), Positives = 350/559 (63%), Gaps = 21/559 (4%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRASYF  1596
             M+PKSPSK K    GF +    LK   V++L   +L+L+   +      ++      SYF
Sbjct  1     MDPKSPSKVKTSSAGFGRYRGALKIGVVIVLAGSLLLLLLSGWHLGWKSVVSRDPGRSYF  60

Query  1595  TVVLDCGSTGSRVNIYEWM---PNNGEFPILVNTYPGNL----TRSDGCKYHCVQTEPGL  1437
             TVV+DCGSTG+RVN+YEWM    N  E P+LVN+YP +L    T +  C+YHC+QTEPGL
Sbjct  61    TVVVDCGSTGTRVNVYEWMLRGANESELPVLVNSYPDSLIKNQTSNSSCQYHCLQTEPGL  120

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
               F+GNASG+RA+L+PLI  A+KWVP  +   TPIFVLATAG+RR+ ++DA+RV++ V  
Sbjct  121   DRFIGNASGVRAALEPLINWAKKWVPEERHPETPIFVLATAGLRRMAVKDATRVLDDVEA  180

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +V+EH F Y++ +IRVL G+EEA+YGWVALNYKM  LGN S   TLGLLDLGGSSLQV  
Sbjct  181   VVREHAFVYKRSWIRVLHGKEEAFYGWVALNYKMGRLGNQSRLSTLGLLDLGGSSLQVAM  240

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKV  897
             E+ +    E + R ++GS+EH++LAYS  AFG   AF+R L +L+Q +  R+  G  + +
Sbjct  241   EVHDSVNHEQLVRLKVGSIEHRVLAYSFPAFGLRAAFERTLVMLTQNETLRQRDGN-YIL  299

Query  896   RHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVA  717
              HPCL+  +VQN+TC  C     +      S     E + + V+GDPNWE+C++LA   A
Sbjct  300   SHPCLNPNYVQNYTCYNCHAVNTTDEIFLGSTKQKAEFSIMNVIGDPNWEECRMLARAAA  359

Query  716   TNSSNLERSK--VAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
              NSS L+ S   V +     +  +     QN+T  +     +HALSGFFAVY  L LS R
Sbjct  360   ANSSYLKHSSAVVGKSRKEDVFYHNGGDWQNITGVALPDMAFHALSGFFAVYTKLRLSGR  419

Query  542   ANLTKMWETGQGLCSRSWVDQTD-------ANGLCFRILYMASLIKDALCLSNLEIIFGP  384
             AN T++ E G  LCS SW++ +            CF++ Y+ASLI +AL + + +II GP
Sbjct  420   ANFTRLLEKGHRLCSESWINSSHITEHGNYGGQFCFQVPYLASLIDEALHVGDRDIIIGP  479

Query  383   GDVSWALGAALIEGGEHSRL--IATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRS  210
             GD+SW LGA+L+E G+  RL     E+            + S + LF++L+C+   VYR 
Sbjct  480   GDISWTLGASLVE-GKFIRLHPFKAETALSSFRIGRVGSIPSPVLLFVLLICLGAFVYRR  538

Query  209   QIKLPMPGRKITSGRASLP  153
             QIKLPMP +K  +G  SLP
Sbjct  539   QIKLPMPRKKGAAG-ISLP  556



>ref|XP_006600631.1| PREDICTED: probable apyrase 7-like isoform X2 [Glycine max]
Length=554

 Score =   422 bits (1086),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 251/508 (49%), Positives = 336/508 (66%), Gaps = 32/508 (6%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMP-----NNGEFPILVNTYPGNLTRS-----DGCKYHC  1458
             +SY+TVV+DCGSTG+RVN+YEWM      + G  P L+++YP N TRS     + C+YHC
Sbjct  49    SSYYTVVVDCGSTGTRVNVYEWMVGVKGISKGNLPSLLHSYPDNTTRSSSLWKNSCQYHC  108

Query  1457  VQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASR  1278
             +QTEPGL  FV ++ G+R +L+PLI  AE  VP      TP+FVLATAG+RRLP  +A  
Sbjct  109   MQTEPGLHSFVNDSLGVRKALEPLIVWAEHLVPREMHRKTPVFVLATAGLRRLPGLEAEW  168

Query  1277  VMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlgg  1098
             V+  V  +VK+H F + K +IRVLSGREEAYYGWVALNYKM    +   S TLGL+DLGG
Sbjct  169   VLGEVEAVVKDHNFMFSKSWIRVLSGREEAYYGWVALNYKMGSFYSYLDSPTLGLVDLGG  228

Query  1097  ssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRES  918
             SSLQVV E D   +D H+ RS++ S+EH+++A+SL AFG NEAFDR + +L   Q+  E 
Sbjct  229   SSLQVVVETDGAGDDVHMMRSKLSSMEHQIMAFSLPAFGLNEAFDRTVLMLRNNQS--EE  286

Query  917   RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCK  738
             R E+   RHPCL S F+QN+TC  C G   S  + + S+    EL+S+ + G+P+WE+CK
Sbjct  287   RTEL---RHPCLVSTFLQNYTCHSCSGLA-SIYQKNRSQHQEGELHSLRLTGEPDWEQCK  342

Query  737   VLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNML  558
              LA+  A N S+ + S+   +NC    S+    + NLT  +H + ++HALSGFF VYN L
Sbjct  343   ELAIAAAMNLSDSKLSQTVSKNCQA-SSFSGTGILNLTAVAHPI-KFHALSGFFFVYNKL  400

Query  557   NLSSRANLTKMWETGQGLCSRSWVDQTD-------ANGLCFRILYMASLIKDALCLSNLE  399
              LS R NLT +WE+G+ LCS  W   ++       A   CFR+ YMASLI+  LCL ++E
Sbjct  401   KLSPRTNLTMVWESGKQLCSNLWSGLSNVSDNPKYAGQFCFRVAYMASLIEYGLCLGDVE  460

Query  398   IIFGPGDVSWALGAALIEGGEHSRLIATESRRKG---LATQHKWMVSSSIT-LFIVLVCV  231
             ++FGPGD+SW LGAALIEG     L    +R K    ++T     V SS T LF VL+ +
Sbjct  461   MVFGPGDISWTLGAALIEG---KFLWLNSTRHKSHVIISTLKNVKVMSSPTFLFAVLLLL  517

Query  230   LMIVYRSQIKLPMPGRKITSGRASLPSY  147
             L+IVY SQ+KLPMP R+ ++  +SLPSY
Sbjct  518   LLIVYFSQVKLPMPSRRASAPGSSLPSY  545



>ref|XP_006600630.1| PREDICTED: probable apyrase 7-like isoform X1 [Glycine max]
 gb|KHN18436.1| Nucleoside-diphosphatase mig-23 [Glycine soja]
Length=556

 Score =   419 bits (1078),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 251/509 (49%), Positives = 335/509 (66%), Gaps = 32/509 (6%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMP-----NNGEFPILVNTYPGNLTRS-----DGCKYHC  1458
             +SY+TVV+DCGSTG+RVN+YEWM      + G  P L+++YP N TRS     + C+YHC
Sbjct  49    SSYYTVVVDCGSTGTRVNVYEWMVGVKGISKGNLPSLLHSYPDNTTRSSSLWKNSCQYHC  108

Query  1457  VQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASR  1278
             +QTEPGL  FV ++ G+R +L+PLI  AE  VP      TP+FVLATAG+RRLP  +A  
Sbjct  109   MQTEPGLHSFVNDSLGVRKALEPLIVWAEHLVPREMHRKTPVFVLATAGLRRLPGLEAEW  168

Query  1277  VMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlgg  1098
             V+  V  +VK+H F + K +IRVLSGREEAYYGWVALNYKM    +   S TLGL+DLGG
Sbjct  169   VLGEVEAVVKDHNFMFSKSWIRVLSGREEAYYGWVALNYKMGSFYSYLDSPTLGLVDLGG  228

Query  1097  ssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRES  918
             SSLQVV E D   +D H+ RS++ S+EH+++A+SL AFG NEAFDR + +L   Q+  E 
Sbjct  229   SSLQVVVETDGAGDDVHMMRSKLSSMEHQIMAFSLPAFGLNEAFDRTVLMLRNNQS--EE  286

Query  917   RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCK  738
             R E+   RHPCL S F+QN+TC  C G   S  + + S+    EL+S+ + G+P+WE+CK
Sbjct  287   RTEL---RHPCLVSTFLQNYTCHSCSGLA-SIYQKNRSQHQEGELHSLRLTGEPDWEQCK  342

Query  737   VLAMEVATNSSNLERSKVAEQNCVGLLSYG-SDRMQNLTLNSHEVTRYHALSGFFAVYNM  561
              LA+  A N S+ + S+   +NC      G    + NLT  +H + ++HALSGFF VYN 
Sbjct  343   ELAIAAAMNLSDSKLSQTVSKNCQASSFSGIGTGILNLTAVAHPI-KFHALSGFFFVYNK  401

Query  560   LNLSSRANLTKMWETGQGLCSRSWVDQTD-------ANGLCFRILYMASLIKDALCLSNL  402
             L LS R NLT +WE+G+ LCS  W   ++       A   CFR+ YMASLI+  LCL ++
Sbjct  402   LKLSPRTNLTMVWESGKQLCSNLWSGLSNVSDNPKYAGQFCFRVAYMASLIEYGLCLGDV  461

Query  401   EIIFGPGDVSWALGAALIEGGEHSRLIATESRRKG---LATQHKWMVSSSIT-LFIVLVC  234
             E++FGPGD+SW LGAALIEG     L    +R K    ++T     V SS T LF VL+ 
Sbjct  462   EMVFGPGDISWTLGAALIEG---KFLWLNSTRHKSHVIISTLKNVKVMSSPTFLFAVLLL  518

Query  233   VLMIVYRSQIKLPMPGRKITSGRASLPSY  147
             +L+IVY SQ+KLPMP R+ ++  +SLPSY
Sbjct  519   LLLIVYFSQVKLPMPSRRASAPGSSLPSY  547



>ref|XP_004157831.1| PREDICTED: probable apyrase 7-like [Cucumis sativus]
Length=559

 Score =   419 bits (1076),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 272/580 (47%), Positives = 359/580 (62%), Gaps = 51/580 (9%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRAS--  1602
             M+ KSPSK K+    F +    L  + +V+            F  S   IL  + R S  
Sbjct  1     MDLKSPSKLKLSPPRFSKHKWILNLIIIVVT-----------FVISIGAILAYKSRVSNA  49

Query  1601  ----YFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTRS----DGCKYHCV  1455
                 Y+TVV+DCGSTG+R++IYEW   + +  + P+L+ +YP   T+S      C YHC+
Sbjct  50    PKELYYTVVVDCGSTGTRIDIYEWKWRVKSGNDLPVLLRSYPNKSTKSPLRKKSCSYHCM  109

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             QT+PGL  FVGN SG+R SL PLI  AE+ +P  K  +TPIFVL+TAG+RRL  EDA++V
Sbjct  110   QTQPGLDKFVGNISGVRFSLNPLIDWAEQEIPVEKHSLTPIFVLSTAGLRRLAHEDANQV  169

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             +E +  ++KEH F YRK +IRVLSG EEAYYGWVALNYKM    N S   TLG+LDLGGS
Sbjct  170   LEDIEAVIKEHSFMYRKSWIRVLSGIEEAYYGWVALNYKMGSFRNGSRLGTLGILDLGGS  229

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESR  915
             SLQVV E D  RE+    RS++GS EH++LA+S +AFG NEAFDR L +L+QTQ   ES 
Sbjct  230   SLQVVMESDFKREEMQFMRSKVGSFEHQVLAFSWEAFGLNEAFDRTLLLLNQTQVLGESN  289

Query  914   GEIFKVRHPCLSSGFVQNHTCRGC-----FGQKPsssedssSRMMTCELNSILVLGDPNW  750
                 ++RHPCLSS F+Q +TC  C      GQK  S+++S +           ++G+PNW
Sbjct  290   TTTVELRHPCLSSSFMQKYTCYNCSSHDNLGQKKFSNQNSKTAF------PFYLVGNPNW  343

Query  749   EKCKVLAMEVATNSSNLERSKVAEQN-CVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFA  573
             E+CK +A  VA NSS L  S+  E   C+    + +    N  + +   TR+HALSGFFA
Sbjct  344   EQCKRIARAVAINSSTLAWSEPVEATKCLATPLFSNVAGGNNAVVTIPTTRFHALSGFFA  403

Query  572   VYNMLNLSSRANLTKMWETGQGLCSRSWVD--------QTDANGLCFRILYMASLIKDAL  417
             VY  LNLS+RAN T +WE G  LCS S  D        Q+     CF++ YMASLI+DAL
Sbjct  404   VYQSLNLSTRANWTNIWERGLELCSASEADMMRSISANQSSLWQYCFQLPYMASLIEDAL  463

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSS--SITLFIV  243
             CL + E+IFGP DVSW LGAALIEG      + + S     A  H   + +   + +F++
Sbjct  464   CLGDKEVIFGPPDVSWTLGAALIEG----EYLWSSSSTTTTAENHNSTLGNIEPVYVFLL  519

Query  242   LVCVLMIVYRSQIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             L+C+L++VY +QIKLPM GRK     +SLPSY  PK +PN
Sbjct  520   LLCLLLVVYYNQIKLPMLGRKSAGAGSSLPSYALPKHRPN  559



>ref|XP_004508886.1| PREDICTED: probable apyrase 7-like [Cicer arietinum]
Length=561

 Score =   414 bits (1064),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 254/522 (49%), Positives = 337/522 (65%), Gaps = 40/522 (8%)
 Frame = -1

Query  1622  YVRK--RASYFTVVLDCGSTGSRVNIYEWMPNN----GEFPILVNTYPGN----LTRSDG  1473
             Y RK   +SY+TVV+DCGSTG+RVN+YEWM  +       PIL+++YP +    +T+   
Sbjct  42    YSRKPNASSYYTVVIDCGSTGTRVNVYEWMLGSVVGKTNLPILLHSYPDSNNNVITKKSS  101

Query  1472  -----CKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGM  1308
                  C+YHC+QTEPGL  +V ++ G+R +L+PLI  AE  VP      TPIFVLATAG+
Sbjct  102   LWKTSCQYHCMQTEPGLDKYVNDSLGVRQALEPLIVWAESLVPREMHRETPIFVLATAGL  161

Query  1307  RRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgs  1128
             RR+P +DA RV++ V  +VK+H F +   +IRVLSGREEAYYGWVALNYKM    + SGS
Sbjct  162   RRIPKDDAFRVLKDVEAVVKDHSFMFDMRWIRVLSGREEAYYGWVALNYKMGSFDDHSGS  221

Query  1127  htlglldlggssLQVVTEIDEFRED-EHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA  951
              TLGL+DLGGSSLQ+V EID    D EHV R   GS EH+++AYSL AFG NEAFDR + 
Sbjct  222   PTLGLVDLGGSSLQIVVEIDRVTGDNEHVMRPDFGSFEHRIVAYSLPAFGLNEAFDRTVV  281

Query  950   ILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCR-GCFGQKPsssedssSRMMTCELNSI  774
             +L   Q+   SRG   ++RHPCL S FVQN+T       QK      + +++   EL+S+
Sbjct  282   MLRNNQSVERSRGAS-ELRHPCLMSTFVQNYTSGFDATDQK------NHNQLQKTELHSL  334

Query  773   LVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQ----NC-VGLLSYGSDRMQNLTLNSHE  609
              ++G PNWE+C+ +A+  A    NL  S+V+ Q    NC   L S     + N T  +H 
Sbjct  335   SLVGKPNWEQCREIAIAAAM---NLSDSQVSHQAVGANCQTSLFSGIGTGVLNSTAVAHP  391

Query  608   VTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWV-------DQTDANGLCFRI  450
               R+HALSGFF VYN LNL  RANLT +WE+G+ +CS  W        +   A   CFR+
Sbjct  392   TKRFHALSGFFFVYNKLNLRPRANLTMIWESGKQICSDLWAGLSSISENPNYAGQFCFRV  451

Query  449   LYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLAT-QHKWM  273
              YMASLI   LCL ++E+ FGPGDVSW LGAAL+EG      I++      ++T ++  +
Sbjct  452   AYMASLIDYGLCLGDIEMEFGPGDVSWTLGAALVEGKFEWLNISSHKSHTIISTLKNVKV  511

Query  272   VSSSITLFIVLVCVLMIVYRSQIKLPMPGRKITSGRASLPSY  147
             +SSS +LF VL+ +L+IVY SQIKLPMP R+ ++   SLPSY
Sbjct  512   LSSSTSLFAVLLLLLLIVYCSQIKLPMPSRRASAPGLSLPSY  553



>ref|XP_004152561.1| PREDICTED: probable apyrase 7-like [Cucumis sativus]
 gb|KGN64326.1| hypothetical protein Csa_1G046230 [Cucumis sativus]
Length=557

 Score =   413 bits (1062),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 274/582 (47%), Positives = 359/582 (62%), Gaps = 57/582 (10%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRAS--  1602
             M+ KSPSK K+    F +    L  + +V+            F  S   IL  + R S  
Sbjct  1     MDLKSPSKLKLSPPRFSKHKWILNLIIIVVT-----------FVISIGAILAYKSRVSNA  49

Query  1601  ----YFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTRS----DGCKYHCV  1455
                 Y+TVV+DCGSTG+R++IYEW   + +  + P+L+ +YP   T+S      C YHC+
Sbjct  50    PKELYYTVVVDCGSTGTRIDIYEWKWRVKSGNDLPVLLRSYPDKSTKSPLRKKSCSYHCM  109

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             QT+PGL  FVGN SG+R SL PLI  AE+ +P  K  +TPIFVL+TAG+RRL  EDA++V
Sbjct  110   QTQPGLDKFVGNISGVRFSLNPLIDWAEQEIPVEKHSLTPIFVLSTAGLRRLAHEDANQV  169

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             +E +  ++KEH F YRK +IRVLSG EEAYYGWVALNYKM    N S   TLG+LDLGGS
Sbjct  170   LEDIEAVIKEHSFMYRKSWIRVLSGIEEAYYGWVALNYKMGSFRNGSRLGTLGILDLGGS  229

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESR  915
             SLQVV E D  RE+    RS++GS EH++LA+S +AFG NEAFDR L +L+QTQ   ES 
Sbjct  230   SLQVVMESDFKREEMQFMRSKVGSFEHQVLAFSWEAFGLNEAFDRTLLLLNQTQVLGESN  289

Query  914   GEIFKVRHPCLSSGFVQNHTCRGC-----FGQKPsssedssSRMMTCELNSILVLGDPNW  750
                 ++ HPCLSS F+Q +TC  C      GQK  S+++S +           ++G+PNW
Sbjct  290   TTTVELGHPCLSSSFMQKYTCYNCSSHDNLGQKKFSNQNSKTAF------PFYLVGNPNW  343

Query  749   EKCKVLAMEVATNSSNLERSKVAE-QNCVG--LLSYGSDRMQNLTLNSHEVTRYHALSGF  579
             E+CK +A  VA NSS L  S+  E   C+   L S G     N  + +   TR+HALSGF
Sbjct  344   EQCKRIARAVAINSSTLAWSEPIEATKCLATPLFSNGG----NNAVVTIPTTRFHALSGF  399

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSWVD--------QTDANGLCFRILYMASLIKD  423
             FAVY  LNLS+RAN T +WE G  LCS S  D        Q+     CF++ YMASLI+D
Sbjct  400   FAVYQSLNLSTRANWTNIWERGLELCSASEADMMRSISANQSSLWQYCFQLPYMASLIED  459

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSS--SITLF  249
             ALCL + E+IFGP DVSW LGAALIEG      + + S     A  H   + +   + +F
Sbjct  460   ALCLGDKEVIFGPPDVSWTLGAALIEG----EYLWSSSSTTTTAENHNSTLGNIEPVYVF  515

Query  248   IVLVCVLMIVYRSQIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             ++L+C+L++VY +QIKLPM GRK     +SLPSY  PK +PN
Sbjct  516   LLLLCLLLVVYYNQIKLPMLGRKSAGAGSSLPSYALPKHRPN  557



>ref|XP_008438672.1| PREDICTED: probable apyrase 7 [Cucumis melo]
Length=613

 Score =   414 bits (1065),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 273/582 (47%), Positives = 361/582 (62%), Gaps = 43/582 (7%)
 Frame = -1

Query  1796  LDNHTLRMEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYV  1617
             L +  L M+ KSPSK K+    F +    L  + VV+            F  S   IL  
Sbjct  50    LSSRCLTMDLKSPSKLKLSPPRFSKHKWILNLIIVVVT-----------FVISLGAILAY  98

Query  1616  RKRAS------YFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTRS----D  1476
             + R S      Y+TVV+DCGSTG+R+++YEW   + +  E P+L+ +YP N T+S     
Sbjct  99    KSRVSNAPKELYYTVVVDCGSTGTRIDVYEWKWLVKSGNELPVLLRSYPNNSTKSPLRKK  158

Query  1475  GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
              C YHC+QT+PGL  FVGN SG+R SL PLI  AE+ +P  +  +TPIFVL+TAG+RRL 
Sbjct  159   SCSYHCMQTQPGLDKFVGNISGVRVSLNPLIEWAEQEIPVEEHSLTPIFVLSTAGLRRLA  218

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg  1116
              EDA++V+E +  ++KEH F YRK +IRVLSG EEAYYGWVALNYKM    N+S   TLG
Sbjct  219   HEDANQVLEDIEAVIKEHSFMYRKSWIRVLSGIEEAYYGWVALNYKMGRFRNSSRLGTLG  278

Query  1115  lldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
             +LDLGGSSLQVV E D  RE+    RS++GS+EH++LA+S +AFG NEAFDR L +L+QT
Sbjct  279   ILDLGGSSLQVVMESDCKREEMQFMRSKVGSIEHQVLAFSWEAFGLNEAFDRTLLLLNQT  338

Query  935   QARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDP  756
                 ES     ++RHPCLSS F++ +TC  C     S  E  S+++        L+ G+P
Sbjct  339   HVLGESNSTTVELRHPCLSSSFMRKYTCYNCSSHDNSGQEKFSNQISKTAFPFYLI-GNP  397

Query  755   NWEKCKVLAMEVATNSSNLERSKVAE-QNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGF  579
             NWE+CK +A  VA NSS L  S+  E   C+   S  S    N  + +   TR+HALSGF
Sbjct  398   NWEQCKRIARAVAINSSTLAWSEPTEATKCLATAS--SSNGGNNAVVTIPTTRFHALSGF  455

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSWVD--------QTDANGLCFRILYMASLIKD  423
             FAVY  LNLS+RAN T +WE G  LCS S  D        Q+     CF++ YMASLI+D
Sbjct  456   FAVYQSLNLSTRANWTNIWERGLELCSASEADMMRSISANQSSLWQYCFQLPYMASLIED  515

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSS--SITLF  249
             ALCL + E+IFGP DVSW LGAALIEG      + + S     A  H   + +   + +F
Sbjct  516   ALCLGDKEVIFGPPDVSWTLGAALIEG----EYLWSSSSTTTTAENHNSTLGNIEPVYVF  571

Query  248   IVLVCVLMIVYRSQIKLPMPGRKITSGRASLPSYLSPK-QPN  126
             ++L+C+L++VY +QIKLPM GRK     +SL SY+ PK +PN
Sbjct  572   LLLLCLLLVVYYNQIKLPMLGRKSAGAGSSLSSYVLPKHRPN  613



>ref|XP_007155454.1| hypothetical protein PHAVU_003G202700g [Phaseolus vulgaris]
 gb|ESW27448.1| hypothetical protein PHAVU_003G202700g [Phaseolus vulgaris]
Length=560

 Score =   410 bits (1055),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 246/513 (48%), Positives = 335/513 (65%), Gaps = 34/513 (7%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMP-----NNGEFPILVNTYPGNLTR-----SDGCKYHC  1458
             +SY+TVV+DCGS+G+RVN+YEWM      N G  P+L+++YP N TR        C+YHC
Sbjct  48    SSYYTVVVDCGSSGTRVNVYEWMVGVKGINKGNLPVLLHSYPDNTTRRSSLWKSSCQYHC  107

Query  1457  VQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASR  1278
             +QTEPGL  FV ++ G+R +L+PLI  AE+ VP   RG TP FVLATAG+R LP +DA+R
Sbjct  108   MQTEPGLHNFVNDSLGVRQALEPLIVWAEQVVPQEMRGDTPAFVLATAGLRGLPRQDANR  167

Query  1277  VMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg-lldlg  1101
             V+  +  +VK H F   K +IRVLSG+EEAYYGWVALNYKM    ++        LLD+G
Sbjct  168   VLGDIEAVVKAHSFMMSKSWIRVLSGKEEAYYGWVALNYKMGSFDDSYPKSPTLGLLDIG  227

Query  1100  gssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE  921
             GSSLQ+V EID   +D HV RSR+ S+EH+++AYSL AFG N+AFDR + +L   Q+  E
Sbjct  228   GSSLQIVVEIDGAGDDVHVMRSRLRSMEHRIMAYSLPAFGLNDAFDRTVLMLRNNQS-EE  286

Query  920   SRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKC  741
                 I ++RHPCL S +VQN+TC  C G   S  + + S+    EL S+ + G+P+WE+C
Sbjct  287   RTASISELRHPCLVSTYVQNYTCHSCPGLA-SIYKKNDSQHQESELYSLRLTGEPDWEQC  345

Query  740   KVLAMEVATNSSNLERSKVA-EQNCVG--LLSYGSDRMQNLTLNSHEVTRYHALSGFFAV  570
             K LA+  A N S+ + S +   +NC        G+D + NLT  +H + ++HALSGFF V
Sbjct  346   KELAIAAAMNPSDSKVSHLTVSKNCQASSFSGLGTD-IVNLTAVAHPI-KFHALSGFFFV  403

Query  569   YNMLNLSSRANLTKMWETGQGLCSRSWV-------DQTDANGLCFRILYMASLIKDALCL  411
             YN LNL+ R N+T +WE+G+ +CS  W        +   A   CF++ Y+ASLI   LCL
Sbjct  404   YNKLNLTPRTNVTMVWESGKQICSNLWSGLGSVSDNPNYAGQFCFQVAYLASLIDYGLCL  463

Query  410   SNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKG----LATQHKWMVSSSIT-LFI  246
              ++E++FGPGD+SW LGAALIEG    + +   SR       ++T     V SS T LF 
Sbjct  464   GDVEMVFGPGDISWTLGAALIEG----KFLWLNSRSHKAHVIISTLKNVKVMSSPTVLFA  519

Query  245   VLVCVLMIVYRSQIKLPMPGRKITSGRASLPSY  147
             VLV +L+IVY SQIKLPMP R++++  +SLPSY
Sbjct  520   VLVLLLLIVYCSQIKLPMPSRRVSTPGSSLPSY  552



>gb|KEH31816.1| GDA1/CD39 nucleoside phosphatase family protein [Medicago truncatula]
Length=565

 Score =   405 bits (1042),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 241/513 (47%), Positives = 327/513 (64%), Gaps = 32/513 (6%)
 Frame = -1

Query  1604  SYFTVVLDCGSTGSRVNIYEWM----PNNGEFPILVNTYPGNLTRS-------DGCKYHC  1458
             SY+TVV+DCGSTG+RVN+YEWM          PIL+++YP N           + C+YHC
Sbjct  50    SYYTVVIDCGSTGTRVNVYEWMLGGVVGKKNLPILLHSYPDNNATKKNNSLWKNSCQYHC  109

Query  1457  VQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASR  1278
             +QTEPGL   V ++  +R +L+PLI  AE  VP    G TPIFVLATAGMRR+  +D  R
Sbjct  110   MQTEPGLDKLVNDSLRVRRALEPLIMWAESLVPRKMHGDTPIFVLATAGMRRIQRDDVFR  169

Query  1277  VMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlgg  1098
             V+E V  + K+H F + K +IRVLSGREEAYYGWVALNYKM    +     +  L  +  
Sbjct  170   VLEDVEAVAKDHSFMFDKRWIRVLSGREEAYYGWVALNYKMGSFDDDYHRGSSTLGLVDL  229

Query  1097  --ssLQVVTEID-EFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQAR  927
               SSLQ+V EID +  +D +  RS  GS+EH+++AYSL +FG NEAFDR +A+L   Q  
Sbjct  230   GGSSLQIVVEIDRDTGDDVNAIRSEFGSIEHRIVAYSLPSFGLNEAFDRTVAMLRNNQRV  289

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWE  747
               +RG + ++RHPCL S FVQN+TC  C G     +++ S    T EL S+ ++G+P+WE
Sbjct  290   ESTRG-VSELRHPCLMSTFVQNYTCNSCSGFHAVGTKNHSQSQKT-ELRSLSLVGNPDWE  347

Query  746   KCKVLAMEVATNSSNLERSKVAEQ----NC-VGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
             +C+ +A+  A    NL  S+V+ Q    NC   L S       NLT  +H + R+HALSG
Sbjct  348   QCREIAVAAAM---NLSDSQVSHQAVGANCEASLFSGIGTGALNLTAVAHPMKRFHALSG  404

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTD-------ANGLCFRILYMASLIKD  423
             FF VYN LNLS RANLT + E+G+ +CS  W   ++       A   CFR+ YMASLI+ 
Sbjct  405   FFFVYNKLNLSPRANLTTILESGKQICSNLWAGLSNISDHPKYAGQFCFRVAYMASLIEH  464

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIAT-ESRRKGLATQHKWMVSSSITLFI  246
              LCL ++E+ FGPGDVSW LGAAL+EG      IA+ +S+    A ++  ++SS  TLF 
Sbjct  465   GLCLGDVEMEFGPGDVSWTLGAALVEGKFQWLNIASHKSQTIYSALKNVKVMSSPTTLFA  524

Query  245   VLVCVLMIVYRSQIKLPMPGRKITSGRASLPSY  147
             VL+ +L +VY +QIKLPMPGR+ ++  +SLPS+
Sbjct  525   VLLFLLFVVYCTQIKLPMPGRRASAPGSSLPSH  557



>gb|KHG10426.1| Apyrase [Gossypium arboreum]
Length=521

 Score =   380 bits (977),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 252/559 (45%), Positives = 338/559 (60%), Gaps = 60/559 (11%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKR----  1608
             MEPKS SK K+    F  +P              +L  I  Y AF+     +V+ R    
Sbjct  1     MEPKSTSKVKLSAKEF--NPWKRVFNVFSFGFLILLSSIGVYLAFN-----FVKARNILE  53

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTR----SDGCKYHCVQT  1449
             +SY+TVV+DCGSTG+RVNI+EW      +   P L+++YP +LT+       C YHC+QT
Sbjct  54    SSYYTVVVDCGSTGTRVNIFEWEKGGLISDSLPSLLHSYPDDLTKGPLAKQSCHYHCMQT  113

Query  1448  EPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVME  1269
             EPGL  FVGNASG+RASL+PLI  AE+ VP  + G  PI +LATAG+RRL   DA +V++
Sbjct  114   EPGLHKFVGNASGVRASLEPLIAWAEQRVPHERHGHIPIIILATAGLRRLVARDAKQVLD  173

Query  1268  GVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssL  1089
              +  +V+EH F Y K+ IRVL+G+EEAYYGWVALNYKM  LGN+S + T GLLDLGGSSL
Sbjct  174   DIEIVVREHSFVYTKNSIRVLTGKEEAYYGWVALNYKMGSLGNSSKASTFGLLDLGGSSL  233

Query  1088  QVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQ--ARRESR  915
             QVV E+ +  ++ +V  S IGS  HK+LA+SL AFG NEAFDR + +LSQ Q   R   R
Sbjct  234   QVVVEVSDKNDNGNVMTSNIGS-NHKVLAFSLPAFGLNEAFDRTVVMLSQNQTYGRNVYR  292

Query  914   GEIFKVRHPCLSSGFVQNHTCRGC-FGQKPsssedssSRMMTCELNSILVLGDPNWEKCK  738
                F++RHPCLSS FVQN+TC GC         E+S ++M     +S  ++GD NWE+CK
Sbjct  293   ---FELRHPCLSSNFVQNYTCPGCAMLNISDGMENSETQMHKTRFSSTYLIGDLNWEQCK  349

Query  737   VLAMEVATNSSNLERS-KVAEQNCVGLLS-YGSDRMQNLTLNSHEVTRYHALSGFFAVYN  564
              L    A N S  + S +  ++NC    S  G + M  LT   H    +HALSGFF VY+
Sbjct  350   ELVRAAAMNYSGSDWSEQFVDRNCEANSSPNGGNDMLKLTSILHHSGHFHALSGFFVVYD  409

Query  563   MLNLSSRANLTKMWETGQGLCSRSWVDQTDANGLCFRILYMASLIKDALCLSNLEIIFGP  384
             MLNLS RA++T++W+                            +I+DALCL N EI FGP
Sbjct  410   MLNLSPRASVTEIWK---------------------------KVIEDALCLGNAEIAFGP  442

Query  383   GDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQI  204
             GD+SW LGAAL+        + T      ++T     +SS++ L ++L+ + ++V+ SQI
Sbjct  443   GDLSWTLGAALV------YQLDTREASASISTIRNLKMSSTVFLLVLLLSLFLVVHCSQI  496

Query  203   KLPMPGRKITSGRASLPSY  147
             KLPM GRK+++    LPSY
Sbjct  497   KLPMLGRKVSNVGVPLPSY  515



>ref|XP_002511362.1| adenosine diphosphatase, putative [Ricinus communis]
 gb|EEF51964.1| adenosine diphosphatase, putative [Ricinus communis]
Length=440

 Score =   333 bits (854),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 194/397 (49%), Positives = 255/397 (64%), Gaps = 32/397 (8%)
 Frame = -1

Query  1490  LTRSDGCKYHCVQTEPGLAMFVGNASG----LRASLKPLIRGAEKWVPSGKRGVTPIFVL  1323
             L  ++ CKYHC+QTEPGL  FVGNA+G    L   L+ L+                 FVL
Sbjct  7     LFSTNSCKYHCLQTEPGLDKFVGNATGNSGCLLEDLETLL----------------FFVL  50

Query  1322  ATAGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLG  1143
              TAG+RRLP+ED  +V+  V  ++KEH F +R+ +IRVLSG+EEAYYGWVALNY+M  L 
Sbjct  51    VTAGLRRLPLEDTRQVLNDVEEVLKEHSFVHRRSWIRVLSGKEEAYYGWVALNYRMGHLR  110

Query  1142  NTsgshtlglldlggssLQVVTE-IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAF  966
             N S   TLGL+DLG SSLQVV E  D  R++ ++ R +IGSVEH +LAYSL +FG N AF
Sbjct  111   NPSQGSTLGLIDLGDSSLQVVVEGNDGARDETNLIRKKIGSVEHHILAYSLSSFGLNGAF  170

Query  965   DRALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCE  786
             DR +A+LSQ Q  + +  E + +RHPCL   F QN TC  C G   +  ++ ++R    +
Sbjct  171   DRTVAMLSQLQPNKGNADERYTLRHPCLGLKFEQNFTCYACDGLNITYKKNLNNRKHKTK  230

Query  785   LNSILVLGDPNWEKCKVLAMEVATNSSNLE-RSKVAEQNC-VGLLSYGSDRMQNLTLNSH  612
                I ++G+ +WE C  +A   A NSS L+        NC   L SY  +R+ NLT  ++
Sbjct  231   --DIYLVGEADWEHCIEVARAAAMNSSRLDGLQPTVHTNCKSSLSSYNGNRIFNLTAATN  288

Query  611   EVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDANG-------LCFR  453
               +R+HALSGFFAVYNMLNL+ +AN+T +WE  + LCS SW D ++ +G        CF+
Sbjct  289   PTSRFHALSGFFAVYNMLNLAPQANMTSIWEKREQLCSTSWGDLSNISGNQNSFAHYCFQ  348

Query  452   ILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEG  342
             + YMASLIKDALCL + EIIF PGD+ W LGAALIEG
Sbjct  349   VPYMASLIKDALCLGDFEIIFDPGDIFWTLGAALIEG  385



>ref|XP_010678813.1| PREDICTED: probable apyrase 7 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=466

 Score =   323 bits (829),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 185/365 (51%), Positives = 246/365 (67%), Gaps = 34/365 (9%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLK-CvkvvllisfilvlIFGYFAFSPSLILYVRKRASY  1599
             MEP+SPSK KI ++G  +S IT+K C+  + ++   + ++ GY  F  SL         Y
Sbjct  1     MEPQSPSKKKISILGSFKSHITVKFCLIFLAILLVSVGILCGYGLFGKSL--------PY  52

Query  1598  FTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTRS----DGCKYHCVQTEPG  1440
             FTVV+DCGSTG+RVN+YEW  N   NG+ P L+++YP    ++    +GC+YHC+QTEPG
Sbjct  53    FTVVVDCGSTGTRVNVYEWGINGGRNGDLPNLLHSYPNESAKNGLWKNGCEYHCMQTEPG  112

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
             L  FVGN SG+R SL PL+R AE+ +P+ +   TP+FVLATAG+RRL +ED   V+E V 
Sbjct  113   LDKFVGNYSGVRTSLVPLLRWAERMIPNERHEDTPVFVLATAGLRRLVVEDGKTVLEDVE  172

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              +VKEH F +R+D+IRVLSGREEAYYGWVALNYK+  L  ++   TLGLLDLGGSSLQVV
Sbjct  173   RVVKEHSFKWRRDWIRVLSGREEAYYGWVALNYKLGYLNKSTMLPTLGLLDLGGSSLQVV  232

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFK  900
             TE+DE RED H+  S++G VEH+L+AYSL AFG N+AF+R +A+L   ++R  + G    
Sbjct  233   TEVDEAREDSHLLVSKLGLVEHQLMAYSLPAFGLNKAFERTIAMLKSVRSRENADGS--N  290

Query  899   VRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             VRHPCLSS F+ N+TC  C   +P                 + ++G PNWEKCK+L    
Sbjct  291   VRHPCLSSNFLGNYTCTSC--SEPELL--------------LRLVGVPNWEKCKILTQAA  334

Query  719   ATNSS  705
             A N S
Sbjct  335   AMNLS  339


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = -1

Query  401  EIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMI  222
            +IIFGPGD+SW LGA+L+EG    R     SR        + ++SS I LFI+LV ++ I
Sbjct  373  DIIFGPGDISWTLGASLVEGKYMWR-TTVGSRTLITTPLSREVLSSPIFLFIILVVLVFI  431

Query  221  VYRSQIKLPMPGRK--ITSGRASLPSYLSPKQ  132
            VY SQIKLPMP ++  +    A L S++  K 
Sbjct  432  VYHSQIKLPMPRKRSSVVGPPAPLTSFMHSKH  463



>ref|XP_010678814.1| PREDICTED: probable apyrase 7 isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=453

 Score =   323 bits (828),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 185/365 (51%), Positives = 246/365 (67%), Gaps = 34/365 (9%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLK-CvkvvllisfilvlIFGYFAFSPSLILYVRKRASY  1599
             MEP+SPSK KI ++G  +S IT+K C+  + ++   + ++ GY  F  SL         Y
Sbjct  1     MEPQSPSKKKISILGSFKSHITVKFCLIFLAILLVSVGILCGYGLFGKSL--------PY  52

Query  1598  FTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTRS----DGCKYHCVQTEPG  1440
             FTVV+DCGSTG+RVN+YEW  N   NG+ P L+++YP    ++    +GC+YHC+QTEPG
Sbjct  53    FTVVVDCGSTGTRVNVYEWGINGGRNGDLPNLLHSYPNESAKNGLWKNGCEYHCMQTEPG  112

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
             L  FVGN SG+R SL PL+R AE+ +P+ +   TP+FVLATAG+RRL +ED   V+E V 
Sbjct  113   LDKFVGNYSGVRTSLVPLLRWAERMIPNERHEDTPVFVLATAGLRRLVVEDGKTVLEDVE  172

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              +VKEH F +R+D+IRVLSGREEAYYGWVALNYK+  L  ++   TLGLLDLGGSSLQVV
Sbjct  173   RVVKEHSFKWRRDWIRVLSGREEAYYGWVALNYKLGYLNKSTMLPTLGLLDLGGSSLQVV  232

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFK  900
             TE+DE RED H+  S++G VEH+L+AYSL AFG N+AF+R +A+L   ++R  + G    
Sbjct  233   TEVDEAREDSHLLVSKLGLVEHQLMAYSLPAFGLNKAFERTIAMLKSVRSRENADGS--N  290

Query  899   VRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             VRHPCLSS F+ N+TC  C   +P                 + ++G PNWEKCK+L    
Sbjct  291   VRHPCLSSNFLGNYTCTSC--SEPELL--------------LRLVGVPNWEKCKILTQAA  334

Query  719   ATNSS  705
             A N S
Sbjct  335   AMNLS  339


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = -1

Query  401  EIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVLMI  222
            +IIFGPGD+SW LGA+L+EG    R     SR        + ++SS I LFI+LV ++ I
Sbjct  360  DIIFGPGDISWTLGASLVEGKYMWR-TTVGSRTLITTPLSREVLSSPIFLFIILVVLVFI  418

Query  221  VYRSQIKLPMPGRK--ITSGRASLPSYLSPKQ  132
            VY SQIKLPMP ++  +    A L S++  K 
Sbjct  419  VYHSQIKLPMPRKRSSVVGPPAPLTSFMHSKH  450



>ref|XP_008374884.1| PREDICTED: probable apyrase 7 [Malus domestica]
Length=652

 Score =   327 bits (839),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 247/366 (67%), Gaps = 14/366 (4%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFG-YFAFSPSLILYVR-KRAS  1602
             MEPKSP K K+ +MG  Q     K     ++I  I++L FG YF F+          + S
Sbjct  1     MEPKSPXKLKLSIMGSTQYKQAFK---TSIMIIVIMLLFFGAYFGFNSXKGRSASASKGS  57

Query  1601  YFTVVLDCGSTGSRVNIYEWMP---NNGEFPILVNTYPGNLTR---SDGCKYHCVQTEPG  1440
             YFTVV+DCGSTG+RVN+YEW+    +  E P L+ +YP N T+   S  CKYHC+QTEPG
Sbjct  58    YFTVVVDCGSTGTRVNVYEWLXMGVSGKELPSLLYSYPDNSTKGMVSKSCKYHCLQTEPG  117

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
             L  FVGN SG+RASL+PLI  AE  VPS +R  TPIFVLATAG+RRL +ED+ +V++ + 
Sbjct  118   LDKFVGNLSGVRASLEPLITLAEHKVPSERRRETPIFVLATAGLRRLAVEDSRQVLDDIX  177

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              ++KE  F Y+K +IRVLSG+EEAYYGWVALNYK+    N S S TLGLLDLGGSSLQVV
Sbjct  178   SVLKECSFLYKKSWIRVLSGKEEAYYGWVALNYKIXSFQNPSRSPTLGLLDLGGSSLQVV  237

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFK  900
              + D  RED ++ RS+ G VEH++LAYSL  FG NEAFDR +A+LSQ   RRES   + +
Sbjct  238   VZTDXXREDANLLRSKFGFVEHEILAYSLSEFGLNEAFDRTVAMLSQ---RRESAAGVLE  294

Query  899   VRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             +RHPCL    VQN+TC GC  Q  +  ++   ++   +  S+ ++G P+WE+C+ LA   
Sbjct  295   IRHPCLRXDVVQNYTCYGCVXQNXADRKNVIGQLXETKFPSVHLVGAPDWEQCRTLARAA  354

Query  719   ATNSSN  702
             A NSS 
Sbjct  355   AINSST  360


 Score =   142 bits (358),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 114/177 (64%), Gaps = 10/177 (6%)
 Frame = -1

Query  662  LLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVD  483
            LL      M NLT  +H    +HALSGFFAVY+ LNLS RA L K+WE GQ LCS+SW D
Sbjct  472  LLIVTGSEMVNLTAVAHPTAXFHALSGFFAVYDKLNLSGRATLPKIWEKGQQLCSKSWSD  531

Query  482  QT--DANG-----LCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRL  324
            QT    NG      CFR+ Y ASL++DALCL + EI+FGP DV+W LGAAL+EG      
Sbjct  532  QTXNSQNGYFAWQYCFRVPYXASLVEDALCLGDKEIVFGPPDVTWTLGAALVEG--EYLW  589

Query  323  IATESRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQIKLPMPGRKITSGRASLP  153
             +T   R  + T +  + SS I + ++L+ +L++VY SQ+KLPM G +  + RASLP
Sbjct  590  SSTSRSRTSILTLNMEVASSPIFVLVLLLFLLVVVYCSQVKLPMIGXQ-GAARASLP  645



>emb|CAN78602.1| hypothetical protein VITISV_007378 [Vitis vinifera]
Length=425

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 194/261 (74%), Gaps = 7/261 (3%)
 Frame = -1

Query  1601  YFTVVLDCGSTGSRVNIYEWM---PNNGEFPILVNTYPGNLTRSD----GCKYHCVQTEP  1443
             YFTVV+DCGSTG+RVN+YEW+     N E P+L+++YP   T+S      C+YHC+QTEP
Sbjct  101   YFTVVVDCGSTGTRVNVYEWVMKGERNWELPMLMHSYPDLSTKSPLWKGACQYHCLQTEP  160

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL  FVGN SG+RASL+PLI  AE+ VP  +RG TP+FVLATAG+RRL + D  +V++  
Sbjct  161   GLDKFVGNYSGVRASLEPLILWAEQQVPPERRGETPVFVLATAGLRRLDVVDVKQVLDDA  220

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               +V +H F +R+ +IRVLSG+EEAYYGW+ALNYKM  LGN S   TLGLLDLGGSSLQV
Sbjct  221   EAVVGKHAFLHRRSWIRVLSGKEEAYYGWIALNYKMGRLGNNSRLPTLGLLDLGGSSLQV  280

Query  1082  VTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF  903
             V E+ E RED H+ RSR+G  EH++LAYSL  FG N+AFDR +++LSQ Q  RE  G   
Sbjct  281   VMEVGESREDGHLVRSRVGLFEHRILAYSLTEFGINKAFDRTVSMLSQVQPLREGSGRKL  340

Query  902   KVRHPCLSSGFVQNHTCRGCF  840
             +++HPCL S +V N+TC GC 
Sbjct  341   ELQHPCLGSDYVNNYTCDGCI  361



>emb|CDP16931.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   278 bits (711),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 206/302 (68%), Gaps = 9/302 (3%)
 Frame = -1

Query  1022  VEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGC  843
             +EH+LL YSL AFG NEAFDR++ +L+ ++A RESR  IF+VRHPCLSS ++QN TC GC
Sbjct  1     MEHQLLIYSLPAFGLNEAFDRSVVMLTHSEALRESRDGIFEVRHPCLSSSYLQNFTCHGC  60

Query  842   FGQKPsssedssSRMMTCELNS-ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQN-C  669
             FG +  SSE+ +++M   EL+S I + G  NWE CK LA   A NSSN + S++   + C
Sbjct  61    FGLERMSSENVTTKMEEKELSSYIWLAGSSNWENCKELARAAAVNSSNSKLSELENHSKC  120

Query  668   VGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW  489
             +GL S     M NLT  SH    Y+ALSGFFA+ N LNLS++ANLTKMWETG+ +C R W
Sbjct  121   IGLSSRTGKMMLNLTSYSH----YNALSGFFAISNRLNLSAKANLTKMWETGEHICPRLW  176

Query  488   VDQTDANGL-CFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATE  312
              DQ   +   CF + YMASLI+DALCL N EI FGPGDVSW LGAALIE G+H     +E
Sbjct  177   ADQRSTSAQDCFHLSYMASLIEDALCLRNAEITFGPGDVSWTLGAALIE-GDHLWRSTSE  235

Query  311   SRRKGLATQHKWMVSSSITLFIVLVCVLMIVYRSQIKLPMPGRKITSGRASLPSYLSPK-  135
             S++  L  +    +SSS  LF  L  +L+IV+ S IKLPMP R  +S R  LPSYL PK 
Sbjct  236   SQKGFLTLKGNERISSSFLLFASLSFLLLIVHYSHIKLPMPNRGTSSTRGCLPSYLGPKR  295

Query  134   QP  129
             QP
Sbjct  296   QP  297



>ref|XP_009394436.1| PREDICTED: probable apyrase 7 [Musa acuminata subsp. malaccensis]
 ref|XP_009394444.1| PREDICTED: probable apyrase 7 [Musa acuminata subsp. malaccensis]
Length=711

 Score =   276 bits (705),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 171/450 (38%), Positives = 248/450 (55%), Gaps = 31/450 (7%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE----FPILVNTYPGNLTRS----DGCK  1467
             Y  + AS +TVVLDCGSTG+RV +Y+W  +  E    FPI + + P    R+     G  
Sbjct  91    YWSREASEYTVVLDCGSTGTRVYVYKWAVDQNEGTRNFPIALRSLPEGPQRAPATQSGRA  150

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
             YH ++TEPG    V N SGLRA+L+PL++ AE  +P      T +F+ ATAG+RRLP  D
Sbjct  151   YHRMETEPGFHKLVHNESGLRAALQPLLQWAETQIPKHAHKGTSLFLYATAGVRRLPSSD  210

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
             +  ++E    I+K   F  R+D+++++SG EEAYYGW+ALNY+M  LG+     T G LD
Sbjct  211   SEWLLEKAWTILKNSSFLCRRDWVKIISGMEEAYYGWIALNYRMGFLGSLPVGKTYGSLD  270

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQ--TQ  933
             LGGSSLQV  E +   +D+     RI S  H L AYSL  +G N+AFD+++A L +    
Sbjct  271   LGGSSLQVTFETETPTQDDTGIELRIASASHHLSAYSLSGYGLNDAFDKSVAHLFRKIVG  330

Query  932   ARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCEL--NSILVLGD  759
                    +  +++HPCL++G+ + +TC  C       S     + MT  L   ++ +LG 
Sbjct  331   TTDNINNDKLQLKHPCLNTGYREEYTCSRCTSASLEGSPLIGGKTMTKGLTGTTVELLGA  390

Query  758   PNWEKCKVLAMEVATNS--SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALS  585
             P W+KC  LA      S  SNL      E     L    SD +       H   +++A+S
Sbjct  391   PEWDKCSALAKLTVNLSAWSNLSSGVDCELKPCAL----SDGL------PHPHGKFYAMS  440

Query  584   GFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIK  426
             GF+ V+   NLSS A+L  + + GQ  C ++W         Q      CFR  Y+ASL++
Sbjct  441   GFYVVFRFFNLSSEASLEDVLKRGQVFCGKTWEVAKNSVAPQPFIEQYCFRAPYVASLLR  500

Query  425   DALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             D L + + E+I G G ++W LG AL+E G+
Sbjct  501   DGLHIKDSEVIIGSGSITWTLGVALLEAGQ  530



>ref|XP_006830097.1| hypothetical protein AMTR_s00123p00080920 [Amborella trichopoda]
 gb|ERM97513.1| hypothetical protein AMTR_s00123p00080920 [Amborella trichopoda]
Length=721

 Score =   268 bits (684),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 176/513 (34%), Positives = 269/513 (52%), Gaps = 41/513 (8%)
 Frame = -1

Query  1655  GYFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE----FPILVNTYPGNL  1488
             G+  F P    Y     S F++V DCGSTG+RV +YEW+ +N +     P+++ + P   
Sbjct  82    GFRHFRP----YWTSEGSQFSIVFDCGSTGTRVYVYEWLLDNRKGRESLPMVLRSLPEGR  137

Query  1487  TR----SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLA  1320
              R     +G  YH ++TEPG    V N SGLRA++ PL++ AEK +P      TPIFV A
Sbjct  138   HRKSSPQNGRAYHRMETEPGFDKLVHNESGLRAAINPLLQWAEKKIPRHAHQSTPIFVYA  197

Query  1319  TAGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGN  1140
             TAG+RRLP  D+  V++ V  I++E  F Y+  ++++++G EEAY+GW+ALNY M  L  
Sbjct  198   TAGLRRLPSSDSEWVLDKVRSILEESSFLYQDKWVKIINGMEEAYFGWIALNYHMNTLSY  257

Query  1139  TsgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR  960
             +    T G LDLGGSSLQV  E  E  +        IG+V+H+L AYSL  +G N+AFD+
Sbjct  258   SPTKATYGSLDLGGSSLQVTFETQEVGQYGTSLNLSIGAVQHRLTAYSLPGYGLNDAFDK  317

Query  959   ALAI----LSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMT  792
             ++ +    LS     + + G I +++HPCL +G+ + + C  C       S     R   
Sbjct  318   SVVLLLKKLSGPMEMKLNNG-ILQLKHPCLQTGYKEKYMCSQCGSLNQDGSPVIGVRTTG  376

Query  791   CE--LNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQ-NCVGLLSYGSDRMQNLTL  621
              E     I +LG P WE+C  LA      S   E S +    NC       SD+      
Sbjct  377   KEGPATVIELLGAPQWEECSALAKSTVNLS---EWSDLGSGINCKLKPCALSDKF-----  428

Query  620   NSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGL  462
                    ++A+SGFF V+   NL+S A L ++ + GQ  C ++W         Q      
Sbjct  429   -PQPRGEFYAMSGFFVVFRFFNLTSEATLDQVVQKGQEFCGKAWEVAKYSVAPQPFIEQY  487

Query  461   CFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQH  282
             CFR  Y+ SL+++ L + +  ++ G G ++W LG AL+E GE   ++++  + +G    H
Sbjct  488   CFRAPYIVSLLREGLHIKDDRVVVGSGSITWTLGVALLEAGE---ILSSRMQLQGYPVLH  544

Query  281   KWMVSS--SITLFIVLVCVLMIVYRSQIKLPMP  189
               + +    + L I LV V+ I++ +  K   P
Sbjct  545   MKLNTGILIVMLIISLVVVVFIIFSTVSKTWSP  577



>ref|XP_002441234.1| hypothetical protein SORBIDRAFT_09g022850 [Sorghum bicolor]
 gb|EES19664.1| hypothetical protein SORBIDRAFT_09g022850 [Sorghum bicolor]
Length=699

 Score =   265 bits (678),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 168/490 (34%), Positives = 267/490 (54%), Gaps = 28/490 (6%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +S + VVLDCGSTG+RV +YEW  N+ +   FPI++    GN  +    K    
Sbjct  91    VFLSEGSSEYYVVLDCGSTGTRVYVYEWHINHNDANAFPIVLKPL-GNAPKKKSGKLTRL  149

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
             Y  ++TEPGL+  V N SGL+ +++PL++ AEK +P      TP+F+ ATAG+R+LP  D
Sbjct  150   YQRMETEPGLSKLVHNESGLKKAIEPLLQMAEKLIPRHAHKHTPLFLYATAGVRKLPSAD  209

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
             +  +++    I+    F   +D +++++G +EAYYGW+ALN+ M M G +S   T G LD
Sbjct  210   SEWLLDKAWDILNNSSFLCSRDKVKIINGMDEAYYGWIALNHHMNMFGTSSSKMTYGSLD  269

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQAR  927
             LGGSSLQV  E D+  +DE   R  IGSV+H L AYSL  +G N+AFD+++A L +    
Sbjct  270   LGGSSLQVTFENDKSVQDETSIRLSIGSVDHHLSAYSLTGYGLNDAFDKSVAHLVKRLGG  329

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV--LGDPN  753
               S G++ +V+HPCL +G+ +N+TC  C   K   S     +    E   I V  +G P 
Sbjct  330   AASNGKV-QVKHPCLQTGYKENYTCSYCHPLKQDGSPSVGEKNTGKEKQGIAVELVGAPQ  388

Query  752   WEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFA  573
             W +C  LA +V  N S    +       +   +  S+  Q          ++ A+SGFF 
Sbjct  389   WNECSALA-KVTVNLSEWSSASPGLDCNIHPCALASNFPQ-------PHGQFFAMSGFFV  440

Query  572   VYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALC  414
             V+   NL++ A+L  + + GQ  C + W         Q      CFR  Y+ASL+++ L 
Sbjct  441   VFKFFNLTADASLVDVLKRGQEFCEKPWKVAKSSVPPQPFVEQYCFRAPYIASLLREGLQ  500

Query  413   LSNLEIIFGPGDVSWALGAALIEGGE--HSRLIATESRRKGLATQHKWMVSSSITLFIVL  240
             + + +++ G G ++W LG AL+E G+   SRL     R          ++   +   +++
Sbjct  501   IKDSQVVVGSGSITWTLGVALLEAGQALSSRLDIQGYRILDREINPNILIVLFLISIVLV  560

Query  239   VCVLMIVYRS  210
             +C ++ V  S
Sbjct  561   ICAILCVSNS  570



>ref|XP_010111782.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Morus notabilis]
 gb|EXC31696.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Morus notabilis]
Length=742

 Score =   265 bits (678),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 171/463 (37%), Positives = 261/463 (56%), Gaps = 40/463 (9%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPN----NGEFPILVNTY--P  1497
             F  +  + S+  Y  + AS F VVLDCGSTG+RV IY+   +    +   PI V  +  P
Sbjct  107   FLLYLLALSISSYWPQNASKFYVVLDCGSTGTRVYIYQASLDRHSRDRTLPISVKPFGKP  166

Query  1496  GNLTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
             G   +  G  Y+ ++TEPG    VGN +GL+A+++PLI+ AEK +P      T +FV AT
Sbjct  167   GR-RKPAGRAYNRMETEPGFHKLVGNVTGLKAAIRPLIKWAEKQIPRNAHKTTSVFVYAT  225

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRLP  D+ R+++    I++   F  R+++++++SG EEAY+GW+ALN++  MLG  
Sbjct  226   AGVRRLPAADSRRLLDNAWSILQASPFLCRREWVKIISGMEEAYFGWIALNHRTGMLGAR  285

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                 T G LDLGGSSLQV  E  +  E E     RIGSV H L AYSL  +G N+AFD++
Sbjct  286   PRKPTFGALDLGGSSLQVTFENVQNVESETNLDLRIGSVNHHLTAYSLPGYGLNDAFDKS  345

Query  956   LAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCF------GQKPsssedssSRMM  795
             +A L +   R E      +++HPCL +G+ +++TC  C       G+ P  SE S  +  
Sbjct  346   VARLFKATPRTELSNGKVEIKHPCLQTGYKESYTCSQCASANHQQGESPVVSEKSFGKSG  405

Query  794   TCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLN  618
             T    S++++G PNW++C  LA ++A N        V+E N V   S G D  ++   L 
Sbjct  406   T----SVMLIGTPNWDECSALA-KIAVN--------VSEWNSV---SPGIDCDVRPCALA  449

Query  617   ---SHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDAN  468
                +    +++A+SGF+ +Y   NL++ A L  + E G+G C  +W         Q    
Sbjct  450   DGFARPSGQFYAMSGFYVIYRFFNLTADATLDDVLEKGRGFCESTWEVAKNSVAPQPYIE  509

Query  467   GLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGG  339
               CFR  Y+ SL++  L ++  +++ G G ++W LG AL+E G
Sbjct  510   QYCFRAPYIVSLLRQGLHITEDKVVIGSGSITWTLGVALLEAG  552



>ref|XP_004961804.1| PREDICTED: probable apyrase 7-like isoform X1 [Setaria italica]
 ref|XP_004961805.1| PREDICTED: probable apyrase 7-like isoform X2 [Setaria italica]
Length=704

 Score =   264 bits (675),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 164/485 (34%), Positives = 270/485 (56%), Gaps = 30/485 (6%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ +  S + VVLDCGSTG+RV +YEW  N+ +   FPI++    GN  +    K    
Sbjct  91    VFLSEGNSEYYVVLDCGSTGTRVYVYEWHINHNDANGFPIVLKPL-GNAPKKKSGKLTRL  149

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
             Y  ++TEPGL+  V N +GL+ +L+PL++ AEK +P      TP+F+ ATAG+R+LP  D
Sbjct  150   YQRMETEPGLSKLVHNEAGLKKALEPLLQMAEKQIPRRAHKHTPLFLYATAGVRKLPSAD  209

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
             +  +++    ++K   F   +D +++++G +EAYYGW+ALN+ M MLG ++   T G LD
Sbjct  210   SEWLLDKAWDVLKNSSFLCSRDRVKIITGMDEAYYGWIALNHHMNMLGTSASKMTYGSLD  269

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQAR  927
             LGGSSLQV  E D+  +DE     RIGSV+H L AYSL  +G N+AFD+++A L +    
Sbjct  270   LGGSSLQVTFETDKTVQDETSISLRIGSVDHHLSAYSLTGYGLNDAFDKSVAHLVKKLGG  329

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV--LGDPN  753
               + G++ +V+HPCL +G+ +++ C  C   K   S     +    E   + V  +G P 
Sbjct  330   VANNGKV-QVKHPCLQTGYKEDYVCSYCHPLKQDGSPSVGEKTTGKEKQGVPVELVGAPQ  388

Query  752   WEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFA  573
             W +C  LA +V  N S    +       +   +  S+  Q          ++ A+SGFF 
Sbjct  389   WNECSALA-KVTVNLSEWSSASPGLDCNLHPCALASNFPQ-------PHGKFFAMSGFFV  440

Query  572   VYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALC  414
             V+   NL++ A L  + + GQ  C + W         Q   +  CFR  Y+ASL+++ L 
Sbjct  441   VFKFFNLTADATLVDVLKRGQEFCEKPWKVAKSSVPPQPFIDQYCFRAPYIASLLREGLQ  500

Query  413   LSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVC  234
             + + ++I G G ++W LG AL E G+    ++T    +G    H+  ++ +I + + LV 
Sbjct  501   IKDNQVIIGSGSITWTLGVALWEAGQ---ALSTRIDIQGYRILHR-EINPNILIVLFLVS  556

Query  233   VLMIV  219
             +++++
Sbjct  557   IVLVI  561



>ref|XP_003557508.1| PREDICTED: probable apyrase 7 [Brachypodium distachyon]
Length=705

 Score =   261 bits (668),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 163/485 (34%), Positives = 265/485 (55%), Gaps = 30/485 (6%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +S + V+LDCGSTG+RV +YEW  N+ +   FPI +    GN  +    K    
Sbjct  91    VFLSEGSSEYYVILDCGSTGTRVYVYEWTVNHNDGNTFPIALKPL-GNAPKKKSGKLTGR  149

Query  1466  -YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPGL+  V N  G++ +++PL++ AE+ +P      TP+F+ ATAG+R+LP  
Sbjct  150   AYQRMETEPGLSKLVHNEIGMKKAIEPLLQMAERQIPRRAHKHTPVFLYATAGVRKLPSA  209

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +++    ++K   F   +D ++++SG EEAYYGW+ALN+ M MLG +S   T G L
Sbjct  210   DSDWLLDKAWDVLKNSSFLCSRDRVKIISGMEEAYYGWIALNHHMNMLGTSSSEMTYGSL  269

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             DLGGSSLQV  E D+  +D+     RIGSV H+L AYSL  +G N+AFD+++A L +   
Sbjct  270   DLGGSSLQVTFETDKAMQDDTSISLRIGSVNHQLSAYSLSGYGLNDAFDKSVAHLVKILG  329

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCEL--NSILVLGDP  756
                  G++ +V+HPCL +G+ +++ C  C   K   S   S +    E    ++ ++G P
Sbjct  330   GTAGNGKV-QVKHPCLQTGYKEDYVCSYCHSLKQDGSPSVSGKTTGLEKAGTAVELVGAP  388

Query  755   NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFF  576
              W +C  LA +VA N S    +       V   +  S   Q          +++A+SGF+
Sbjct  389   QWSECSALA-KVAVNLSEWSNANSGVDCNVQPCALASTFPQ-------PHGQFYAMSGFY  440

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDAL  417
              V+   NL+  A L  + + GQ  C + W         Q      CFR  Y+ SL+++ L
Sbjct  441   VVFKFFNLTPDATLIDVLKRGQEFCEKPWEVAKSSVPPQPFIEQYCFRAPYITSLLREGL  500

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLV  237
              + + ++I G G ++W LG AL+E G+    ++T    +G    H+ +  + +    V+ 
Sbjct  501   QIKDNQVIIGSGSITWTLGVALLEAGQ---ALSTRMDIQGYMILHREINPTILIALFVIS  557

Query  236   CVLMI  222
              VL+I
Sbjct  558   IVLVI  562



>gb|AFW78299.1| putative nucleoside phosphatase GDA1/CD39 family protein [Zea 
mays]
Length=650

 Score =   259 bits (661),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 167/496 (34%), Positives = 271/496 (55%), Gaps = 31/496 (6%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNL  1488
             F Y ++    +     R+ Y+ VVLDCGSTG+RV +YEW  N+ +   FPI++    GN 
Sbjct  81    FAYGSWRYFHVFLSEGRSEYY-VVLDCGSTGTRVYVYEWHINHNDANAFPIVLKPL-GNA  138

Query  1487  TRSDGCK----YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLA  1320
              +    K    Y  ++TEPGL+  V N SGL+ +++PL++ AEK +P      TP+F+ A
Sbjct  139   PKKKSGKLTRLYQRMETEPGLSKLVHNESGLKKAIEPLLQMAEKLIPRHAHKHTPLFLYA  198

Query  1319  TAGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGN  1140
             TAG+R+LP  D+  +++    I+    F   +D ++++SG +EAYYGW+ALN+ M MLG 
Sbjct  199   TAGVRKLPSADSEWLLDKSWDILNNSSFLCSRDRVKIISGMDEAYYGWIALNHNMDMLGT  258

Query  1139  TsgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR  960
             +S   T G LDLGGSSLQV  E D+  +DE   R  IGSVEH L AYSL  +G N+AFD+
Sbjct  259   SSSKMTYGSLDLGGSSLQVTFENDKSVQDETSIRLSIGSVEHHLSAYSLTGYGLNDAFDK  318

Query  959   ALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN  780
             ++A L +      S G++ +V+HPCL +GF +++ C  C   K   S     +    E  
Sbjct  319   SVAHLVKRLGGVASNGKV-QVKHPCLQTGFKEDYICSYCHPLKQDGSPSVGEKNSGKEKQ  377

Query  779   SILV--LGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEV  606
              I V  +G P W +C  LA +V  N S    +       +   +  S+  +         
Sbjct  378   GIAVELVGAPQWNECSALA-KVTVNLSEWSSASPGLDCNIHPCALASNFPR-------PY  429

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRIL  447
              ++ A+SGF+ V+   NL++ A L  + + GQ  C + W         Q      CFR  
Sbjct  430   GQFFAISGFYVVFKFFNLTADATLGDVQKRGQEFCEKPWKVAKSSVPPQPFVEQYCFRAP  489

Query  446   YMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVS  267
             Y++SL+++ L + + ++I G G ++W  G AL+E G+    +++    +G    H+  ++
Sbjct  490   YISSLLREGLQIKDSQVIIGSGSITWTHGVALLEAGQ---ALSSRLDIQGYRILHR-EIN  545

Query  266   SSITLFIVLVCVLMIV  219
              +I + + L+ +++++
Sbjct  546   PNILIVLFLISIVLVI  561



>ref|XP_006385169.1| nucleoside phosphatase family protein [Populus trichocarpa]
 gb|ERP62966.1| nucleoside phosphatase family protein [Populus trichocarpa]
Length=759

 Score =   260 bits (664),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 166/447 (37%), Positives = 250/447 (56%), Gaps = 30/447 (7%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWM--PNNGEFPILVNTYPGNLTRS-DGCKYHCVQ  1452
             Y  + AS F VVLDCGSTG+RV +Y+     N+   P ++ +Y   ++R   G  Y  ++
Sbjct  141   YWSQGASRFYVVLDCGSTGTRVYVYQATIDHNSDGLPFVLKSYTEGVSRKPSGRAYDRME  200

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
             TEPGL   V N SGL+A++ PL+R AEK +P      T +F+ ATAG+RRLP  D+  ++
Sbjct  201   TEPGLHTLVHNTSGLKAAINPLVRWAEKQIPQQAHKTTSLFLYATAGVRRLPSADSKWLL  260

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggss  1092
             +    I+KE  F  ++++I+++SG EEAYYGW+ALN++  +LG +    T G LD+GGSS
Sbjct  261   DKSWSILKESPFLCQREWIKIISGMEEAYYGWIALNHRTGVLGASPKKATFGALDMGGSS  320

Query  1091  LQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA-ILSQTQARRESR  915
             LQV  E +E   +E     RIG+V H L AYSL  +G N+AFDR++A IL +  +     
Sbjct  321   LQVTFESEEHVHNETSLSLRIGAVNHHLSAYSLAGYGLNDAFDRSVAHILKKPSSADLVS  380

Query  914   GEIFKVRHPCLSSGFVQNHTCRGCFG-QKPsssedssSRMMTCELNS---ILVLGDPNWE  747
             G I ++RHPCL SG+ + + C  CF  Q+  +S     R +   + S   + ++G PNWE
Sbjct  381   GNI-EIRHPCLQSGYKEQYICSQCFSKQQDGASPVIRGRNLGNRVKSGLPVQLIGAPNWE  439

Query  746   KCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH---EVTRYHALSGFF  576
             +C  LA ++A N S          +C          +Q   L  +       ++ +SGFF
Sbjct  440   ECSALA-KIAVNLSEWSNQDPG-IDC---------DLQPCALPPNLPRPYGHFYGMSGFF  488

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDAL  417
              VY   NL+S A L  + E G+  C ++W         Q      CFR  Y+  L+++ L
Sbjct  489   VVYRFFNLTSEAALDDVLEKGREFCEKNWEIAKNSVPPQPFIEQYCFRAPYIVLLLREGL  548

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGE  336
              ++  +II G G ++W LG AL+E G+
Sbjct  549   HITENQIIIGSGSITWTLGVALLEAGK  575



>ref|XP_008649721.1| PREDICTED: probable apyrase 7 [Zea mays]
 gb|AFW78300.1| putative nucleoside phosphatase GDA1/CD39 family protein [Zea 
mays]
Length=701

 Score =   259 bits (661),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 171/506 (34%), Positives = 270/506 (53%), Gaps = 51/506 (10%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNL  1488
             F Y ++    +     R+ Y+ VVLDCGSTG+RV +YEW  N+ +   FPI++    GN 
Sbjct  81    FAYGSWRYFHVFLSEGRSEYY-VVLDCGSTGTRVYVYEWHINHNDANAFPIVLKPL-GNA  138

Query  1487  TRSDGCK----YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLA  1320
              +    K    Y  ++TEPGL+  V N SGL+ +++PL++ AEK +P      TP+F+ A
Sbjct  139   PKKKSGKLTRLYQRMETEPGLSKLVHNESGLKKAIEPLLQMAEKLIPRHAHKHTPLFLYA  198

Query  1319  TAGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGN  1140
             TAG+R+LP  D+  +++    I+    F   +D ++++SG +EAYYGW+ALN+ M MLG 
Sbjct  199   TAGVRKLPSADSEWLLDKSWDILNNSSFLCSRDRVKIISGMDEAYYGWIALNHNMDMLGT  258

Query  1139  TsgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR  960
             +S   T G LDLGGSSLQV  E D+  +DE   R  IGSVEH L AYSL  +G N+AFD+
Sbjct  259   SSSKMTYGSLDLGGSSLQVTFENDKSVQDETSIRLSIGSVEHHLSAYSLTGYGLNDAFDK  318

Query  959   ALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN  780
             ++A L +      S G++ +V+HPCL +GF +++ C  C   K   S     +    E  
Sbjct  319   SVAHLVKRLGGVASNGKV-QVKHPCLQTGFKEDYICSYCHPLKQDGSPSVGEKNSGKEKQ  377

Query  779   SILV--LGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEV  606
              I V  +G P W +C  LA +V  N                 LS  S     L  N H  
Sbjct  378   GIAVELVGAPQWNECSALA-KVTVN-----------------LSEWSSASPGLDCNIHPC  419

Query  605   T----------RYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQT  477
                        ++ A+SGF+ V+   NL++ A L  + + GQ  C + W         Q 
Sbjct  420   ALASNFPRPYGQFFAISGFYVVFKFFNLTADATLGDVQKRGQEFCEKPWKVAKSSVPPQP  479

Query  476   DANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKG  297
                  CFR  Y++SL+++ L + + ++I G G ++W  G AL+E G+    +++    +G
Sbjct  480   FVEQYCFRAPYISSLLREGLQIKDSQVIIGSGSITWTHGVALLEAGQ---ALSSRLDIQG  536

Query  296   LATQHKWMVSSSITLFIVLVCVLMIV  219
                 H+  ++ +I + + L+ +++++
Sbjct  537   YRILHR-EINPNILIVLFLISIVLVI  561



>ref|XP_006654523.1| PREDICTED: probable apyrase 7-like [Oryza brachyantha]
Length=700

 Score =   259 bits (661),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 160/488 (33%), Positives = 261/488 (53%), Gaps = 38/488 (8%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +  + V+LDCGSTG+RV++YEW  N+ +   FPI +    GN  +    K    
Sbjct  91    VFLSEGSPEYYVILDCGSTGTRVHVYEWSVNHDDGSTFPIALKPL-GNAPKKKSGKLTGR  149

Query  1466  -YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPGL   V N +GL+ +++PL+R AEK +P      TP F+ ATAG+R+LP  
Sbjct  150   AYQRMETEPGLNKLVHNETGLKMTIEPLLRMAEKLIPRRAHKHTPAFLYATAGVRKLPSA  209

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +++    I+K   F   +D ++++SG +EAYYGW+ALN+ + MLG +S   T G L
Sbjct  210   DSEWLLDKAWDILKNSSFLCYRDRVKIISGMDEAYYGWIALNHHLNMLGTSSSKMTYGSL  269

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             DLGGSSLQV  E D   +DE     RIGSV H+L AYSL  +G N+AFD+++A L +   
Sbjct  270   DLGGSSLQVTFETDNSIQDETSMSLRIGSVSHQLSAYSLSGYGLNDAFDKSVAHLVKKLG  329

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV--LGDP  756
                  G++ +V+HPCL +G+ +++ C  C   K   S     +    E   + V  +G P
Sbjct  330   GAAGNGKV-QVKHPCLQTGYKEDYICSYCDPLKLDGSPTVGGKTTGKEKQGVAVELIGTP  388

Query  755   NWEKCKVLAMEVATNS--SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
              W +C  LA      S  SN        + C    ++     Q           ++A+SG
Sbjct  389   QWNECSALAKLTVNLSEWSNASSVDCNTKPCALPSTFPQPHGQ-----------FYAMSG  437

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSWV-------DQTDANGLCFRILYMASLIKD  423
             F+ V+   NL++ A L  + + GQ  C + W+        Q      CFR  Y+ +L+++
Sbjct  438   FYVVFKFFNLTADATLVDVLKRGQDFCEKPWMIAKSSVPPQPFIEQYCFRAPYITALLRE  497

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIV  243
              L + + ++I G G ++W LG AL+E G+        SRR  +       ++ +I + + 
Sbjct  498   GLQIKDNQVIIGSGSITWTLGVALLEAGQ------ALSRRTDIQGILHREINPNIIIVLF  551

Query  242   LVCVLMIV  219
             L+ +++++
Sbjct  552   LISIVLVI  559



>ref|XP_007221964.1| hypothetical protein PRUPE_ppa001790mg [Prunus persica]
 gb|EMJ23163.1| hypothetical protein PRUPE_ppa001790mg [Prunus persica]
Length=764

 Score =   259 bits (662),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 176/507 (35%), Positives = 271/507 (53%), Gaps = 47/507 (9%)
 Frame = -1

Query  1658  FGYFAFSPSLILYV--RKRASYFTVVLDCGSTGSRVNIYEWM---PNNGEFPILVNTYPG  1494
             FG+  +  S+ +Y    K    F +VLDCGSTG+RV +Y+      N+G FPI +     
Sbjct  122   FGFLIYLISMFIYSYWSKGTPKFYIVLDCGSTGTRVYVYQASFDNANDGTFPIAMKPLTE  181

Query  1493  NLTRSD----GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFV  1326
              L R      G  Y  ++TEPGL   V N SGL+A++KPLIR AEK +P      T +F+
Sbjct  182   GLQRKPNSHTGRAYDRMETEPGLDKLVHNVSGLKAAIKPLIRWAEKQIPEKAHKTTSLFL  241

Query  1325  LATAGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRML  1146
              ATAG+RRLP  D+  +++    I+K   F  ++D+++++SG EEAY+GW+ALN+   ML
Sbjct  242   YATAGVRRLPSVDSKWLLDNAWSILKNSPFLCQRDWVKIISGLEEAYFGWIALNHHTGML  301

Query  1145  GNTsgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAF  966
             G      T G LDLGGSSLQV  E +E   +E     RIG+V H L AYSL ++G N+AF
Sbjct  302   GARPRKPTFGALDLGGSSLQVTFESNEHVRNETSLNLRIGAVNHHLTAYSLPSYGLNDAF  361

Query  965   DRALAILSQTQARRESRGEIF----KVRHPCLSSGFVQNHTCRGCF-----GQKPsssed  813
             D+++  L + +    ++ E+     K+RHPCL SG+ + + C  C      G  P  ++ 
Sbjct  362   DKSVVHLLE-KLPEITKAELVNGKGKLRHPCLHSGYKEKYVCSECVSKFQEGGSPVIAKT  420

Query  812   ssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQ  633
             S  +     + S+++ G PNW++C  LA  +A N S    ++ +  +C          +Q
Sbjct  421   SLGKGGRSGI-SVMLSGAPNWDECSKLA-RIAVNWSEWS-NRNSGIDC---------DLQ  468

Query  632   NLTLNS---HEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VD  483
                L     H   ++ A+SGFF VY   NL+S A+L  + E G+  C R+W         
Sbjct  469   PCALPDGLPHPYGKFFAISGFFVVYRFFNLTSEASLDDVLEKGREFCERTWEVAKNSVAP  528

Query  482   QTDANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRR  303
             Q      CFR  Y+  L+++ L +++  +I G G ++W LG AL+E G+        S R
Sbjct  529   QPFIEQYCFRAPYIVFLLREGLHITDNHVIIGSGRITWTLGVALLEAGK------ALSTR  582

Query  302   KGLATQHKWMVSSSITLFIVLVCVLMI  222
              GL T   + +  +   FI ++ + ++
Sbjct  583   LGLRTYEIFQIKINPIFFIAVLFISLL  609



>ref|XP_011028520.1| PREDICTED: probable apyrase 7 [Populus euphratica]
 ref|XP_011028521.1| PREDICTED: probable apyrase 7 [Populus euphratica]
 ref|XP_011028522.1| PREDICTED: probable apyrase 7 [Populus euphratica]
 ref|XP_011028523.1| PREDICTED: probable apyrase 7 [Populus euphratica]
 ref|XP_011028524.1| PREDICTED: probable apyrase 7 [Populus euphratica]
Length=759

 Score =   259 bits (661),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 166/447 (37%), Positives = 250/447 (56%), Gaps = 30/447 (7%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWM--PNNGEFPILVNTYPGNLTRS-DGCKYHCVQ  1452
             Y  + AS F VVLDCGSTG+RV +Y+     N+   PI++ +Y   ++R   G  Y  ++
Sbjct  141   YWSQGASRFYVVLDCGSTGTRVYVYQATIDHNSNGLPIVLKSYTEGVSRKPSGRAYDRME  200

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
             TEPGL   V N SGL+A++ PL+R AEK +P      T +F+ ATAG+RRLP  D+  ++
Sbjct  201   TEPGLHTLVHNTSGLKAAINPLVRWAEKQIPQQAHKTTSLFLYATAGVRRLPSADSKWLL  260

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggss  1092
             +    I+KE  F  ++++I+++SG EEAYYGW+ALN++  +LG      T G LD+GGSS
Sbjct  261   DKSWYILKESPFLCQREWIKIISGMEEAYYGWIALNHRTGVLGANPKKATFGALDMGGSS  320

Query  1091  LQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA-ILSQTQARRESR  915
             LQV  E +E   +E     RIG+V H L AYSL  +G N+AFD+++A IL +  +     
Sbjct  321   LQVTFESEEHVHNETSLSLRIGAVNHHLSAYSLAGYGLNDAFDKSVAHILRKPSSADLVS  380

Query  914   GEIFKVRHPCLSSGFVQNHTCRGCFG-QKPsssedssSRMMTCELNS---ILVLGDPNWE  747
             G I ++RHPCL SG+ + + C  CF  Q+  +S     R +   + S   + ++G PNWE
Sbjct  381   GNI-EIRHPCLQSGYKEQYICSQCFSKQQDGASPVIRGRNLGNRVKSGLPVQLIGAPNWE  439

Query  746   KCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH---EVTRYHALSGFF  576
             +C  LA ++A N S          +C          +Q   L  +       ++ +SGFF
Sbjct  440   ECSALA-KIAVNFSEWSNQDPG-IDC---------DLQPCALPPNLPRPYGHFYGMSGFF  488

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDAL  417
              VY   NL+S A L  + E G+  C ++W         Q      CFR  Y+  L+++ L
Sbjct  489   VVYRFFNLTSEAALDDVLEKGREFCEKNWEIAKNSVPPQPFIEQYCFRAPYIVLLLREGL  548

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGE  336
              ++  +II G G ++W LG AL+E G+
Sbjct  549   HITENQIIIGSGSITWTLGVALLEAGK  575



>gb|KDP37807.1| hypothetical protein JCGZ_06709 [Jatropha curcas]
Length=760

 Score =   258 bits (659),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 175/502 (35%), Positives = 270/502 (54%), Gaps = 41/502 (8%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGN-  1491
             F  +  S  ++ Y  +  S F VVLDCGSTG+RV +Y+   +   +   PI + ++ G  
Sbjct  129   FITYVISTYILSYWSQGTSKFYVVLDCGSTGTRVYVYQASIDHNRDSTLPIALKSFAGGI  188

Query  1490  LTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAG  1311
             LT+S+G  Y  ++TEPGL + V N SGL+A+L PL++ AEK +P      T +F+ ATAG
Sbjct  189   LTKSNGRAYDRMETEPGLHLLVRNTSGLKAALNPLVQWAEKQIPEHAHKRTSLFLYATAG  248

Query  1310  MRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsg  1131
             +RRLP  D+  +++    I+KE  F  R+ +++V+SG +EAYYGW+ALNY+  +LG +  
Sbjct  249   VRRLPSADSKWLLDKAWSILKESPFLCRRAWVKVISGMDEAYYGWIALNYQTGVLGKSPK  308

Query  1130  shtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA  951
               T G LD+GGSSLQV  E  +   +E     RIG+  H L AYSL  +G N+AFD+++ 
Sbjct  309   KATFGALDMGGSSLQVTFESKKHTHNETELNLRIGAANHHLTAYSLAGYGLNDAFDKSVV  368

Query  950   -ILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQK-----PsssedssSRMMTC  789
              IL    +     G I +++HPCL SG+ + + C  C   +     P     SS + +  
Sbjct  369   HILRGLPSADLVSGNI-EIKHPCLQSGYKEQYICSQCASNQQNSVSPIVVGKSSDKGVKS  427

Query  788   ELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVA----EQNCVGLLSYGSDRMQNLTL  621
              +  + ++G PNWE+C  LA +VA N S       A     Q C          + ++  
Sbjct  428   GV-PVQLIGAPNWEECSALA-KVAINLSEWSNQSTALDCDLQPCA---------LPDVFP  476

Query  620   NSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGL  462
               H   R++A+SGFF VY   NL+S A L  + E G+  C ++W         Q      
Sbjct  477   RPH--GRFYAMSGFFVVYRFFNLASEAALDDVLEKGREFCEQTWQVAKNSVPPQPFIEQY  534

Query  461   CFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE----HSRLIATESRRKGL  294
             CFR  Y+  L+++ L +++ +I+ G G ++W LG AL E G+      RL + E  R  +
Sbjct  535   CFRAPYVVFLLREGLHITDNQIVIGSGSITWTLGVALFEAGKTLSPRLRLPSYEMLR--M  592

Query  293   ATQHKWMVSSSITLFIVLVCVL  228
                   ++   +   I+LVC+L
Sbjct  593   KIHPIILIVIVVASLILLVCML  614



>ref|XP_009385985.1| PREDICTED: probable apyrase 7 [Musa acuminata subsp. malaccensis]
 ref|XP_009385986.1| PREDICTED: probable apyrase 7 [Musa acuminata subsp. malaccensis]
Length=712

 Score =   256 bits (655),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 159/454 (35%), Positives = 245/454 (54%), Gaps = 32/454 (7%)
 Frame = -1

Query  1631  LILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE----FPILVNTYPG----NLTRSD  1476
             L  ++ + AS + ++LD GSTG+RV +Y+W  +  +    FPI + + P     N +   
Sbjct  88    LHTFLSREASQYYIILDSGSTGTRVYVYKWSIDQNDAIQNFPIALKSLPEGPQRNPSAQS  147

Query  1475  GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
             G  YH ++TEPG    V N SGLR SL+PL++ AEK +P      T +F+ ATAG+RRLP
Sbjct  148   GRAYHRMETEPGFDKLVHNESGLRGSLQPLLQWAEKQIPKHAHKGTSLFLYATAGVRRLP  207

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg  1116
               D+  +++    I+K   F  R+D+++++SG EEAYYGW+ALNY M +LG+     T G
Sbjct  208   SSDSEWLLDKAWTILKNSSFLCRRDWVKIISGMEEAYYGWIALNYHMGLLGSLPAGKTYG  267

Query  1115  lldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
              LDLGGSSLQV  E +    D+     RI S  H L AYSL  +G N+AFD+++A L + 
Sbjct  268   SLDLGGSSLQVTFETETPIHDDTSINLRISSASHHLSAYSLSGYGLNDAFDKSVAHLFRK  327

Query  935   QARRES---RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV-  768
                  +     +  +++HPCL++G+++ + C  C       S     + M+      +V 
Sbjct  328   LVGTSADFINEKKLQLKHPCLNTGYMEEYACSRCTSVNLEGSPLIGGKTMSKRRTGTIVE  387

Query  767   -LGDPNWEKCKVLAMEVATNS--SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRY  597
              LG P WE+C  LA      S  SN       +     L    SD +       H   ++
Sbjct  388   LLGAPQWEECSALAKLTVDLSAWSNFSSGVDCKHKPCAL----SDGL------PHPRGKF  437

Query  596   HALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMA  438
             +A+SGF+ V+   NLSS A+L  + + GQ  C ++W         Q      CFR  Y+A
Sbjct  438   YAMSGFYVVFRFFNLSSEASLRDVLKRGQEFCGKTWQVAKNSVAPQPFIEQYCFRAPYVA  497

Query  437   SLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             SL+++ L + + ++I G G ++W LG A++E G+
Sbjct  498   SLLRNGLQIKDSQVIVGSGSITWTLGVAILEAGQ  531



>ref|XP_008787941.1| PREDICTED: probable apyrase 7 [Phoenix dactylifera]
 ref|XP_008787942.1| PREDICTED: probable apyrase 7 [Phoenix dactylifera]
Length=713

 Score =   256 bits (655),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 161/449 (36%), Positives = 250/449 (56%), Gaps = 29/449 (6%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWMPN----NGEFPILVNTYPGNLTRS----DGCK  1467
             Y+ +  S + V+LDCGSTG+RV +YEW  N    +   PI + + P    R      G  
Sbjct  93    YLSRETSEYYVILDCGSTGTRVYVYEWSINRNKGHSNLPIALRSLPEASQRKFSAGSGRA  152

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
             Y  ++TEPG    V N SGLR ++ PL++ AEK +P        +F+ ATAG+RRLP  D
Sbjct  153   YQRMETEPGFHKLVRNESGLRDAVMPLLQWAEKQIPKRAHKNASLFLYATAGVRRLPSSD  212

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
             ++ +++    I+K   F+ ++D++++++G EEAYYGW+ALN+ M MLG++    T G LD
Sbjct  213   SAWLLDKAWNILKNSSFYCKRDWVKIITGMEEAYYGWIALNHHMGMLGSSPTKETFGALD  272

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAIL----SQ  939
             LGGSSLQV  E ++   DE     RIG+V H L AYSL  +G N+AFD++++ L    S 
Sbjct  273   LGGSSLQVTFETEKPTHDETGIILRIGAVSHYLSAYSLSGYGLNDAFDKSVSYLLKRFSG  332

Query  938   TQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSIL-VLG  762
             T A   + G+I ++RHPCL +G+ + +TC  C       S     +  +     ++ +LG
Sbjct  333   TAAAGLNNGKI-ELRHPCLQTGYKEEYTCSHCATINQEGSPLIGGKTSSGHPGMVIQLLG  391

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
              PNWE+C  LA  +A N S    S  +  +C       SD +           +++A+SG
Sbjct  392   APNWEECSALA-RIAVNLSEWS-STSSGVDCKLKPCALSDNL------PRPRGQFYAMSG  443

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKD  423
             FF V+   NL+S+A L  + + G+  C ++W         Q      CFR  Y+ASL+++
Sbjct  444   FFVVFRFFNLTSKATLGDVLKLGKKFCGKTWEVAKNSVAPQPFIEQYCFRAPYIASLLRE  503

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGE  336
              L + + +++ G G ++W LG AL E G+
Sbjct  504   GLQVRDNQVVIGSGSITWTLGVALSEAGQ  532



>gb|AAM08556.1|AC092749_9 Putative nucleoside phosphatase [Oryza sativa Japonica Group]
Length=681

 Score =   255 bits (651),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 159/488 (33%), Positives = 262/488 (54%), Gaps = 36/488 (7%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +  + V+LDCGSTG+RV +YEW  N+ +   FPI +    GN  +    K    
Sbjct  91    VFLSEGSPEYYVILDCGSTGTRVYVYEWSVNHDDGNTFPIALKPL-GNAPKKKSGKLTGR  149

Query  1466  -YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPGL   V N +GL+ +++PL+R AEK +P      TP F+ ATAG+R+LP  
Sbjct  150   AYQRMETEPGLNKLVHNETGLKMTIEPLLRMAEKLIPRRAHKHTPAFLYATAGVRKLPSA  209

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +++    I+K   F   +D ++++SG +EAYYGW+ALN+ + MLG +S   T G L
Sbjct  210   DSEWLLDKAWDILKNSSFLCSRDRVKIISGMDEAYYGWIALNHHLNMLGTSSSKMTYGSL  269

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             DLGGSSLQV  E D   +DE     RIGS+ H+L AYSL  +G N+AFD+++A L +   
Sbjct  270   DLGGSSLQVTFETDNSIQDETSMSLRIGSISHQLSAYSLSGYGLNDAFDKSVAHLVKKLG  329

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV--LGDP  756
                  G++ +V+HPCL +G+ +++ C  C   K   S     +    E   + V  +G P
Sbjct  330   GAAGNGKV-QVKHPCLQTGYKEDYICSYCHPLKLDGSPSVGGKTTGKEKQGMAVELIGMP  388

Query  755   NWEKCKVLAMEVATNS--SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
              W +C  LA      S  SN        + C    ++     Q           ++A+SG
Sbjct  389   QWNECSALAKLTVNLSEWSNASSVDCNTKPCALPSTFPQPHGQ-----------FYAMSG  437

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKD  423
             F+ V+   NL++ A L  +   GQ  C ++W         Q      CFR  Y+ SL+++
Sbjct  438   FYVVFKFFNLTADATLIDVLNRGQEFCEKTWKVAKSSVPPQPFIEQYCFRAPYITSLLRE  497

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIV  243
              L + + ++I   G ++W LG AL+E G+   +++T    +G    H+  ++ +I + + 
Sbjct  498   GLQIKDNQVIIDSGSITWTLGVALLEAGQ---VLSTRIDIQGYRILHR-EINPNILIVLF  553

Query  242   LVCVLMIV  219
             L+ +++++
Sbjct  554   LISIVLVI  561



>ref|XP_002966332.1| hypothetical protein SELMODRAFT_407789 [Selaginella moellendorffii]
 gb|EFJ32359.1| hypothetical protein SELMODRAFT_407789 [Selaginella moellendorffii]
Length=550

 Score =   252 bits (643),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 158/475 (33%), Positives = 254/475 (53%), Gaps = 37/475 (8%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCK--YHCVQ  1452
             L+ ++    F +V+DCGST +RV +Y W+ N G  P++    P + + +   K  YH ++
Sbjct  86    LWSQEEPIKFAIVMDCGSTSTRVYVYGWVHNGGSIPVMYRP-PSHSSANARVKKAYHRME  144

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
             TEPG    + N SGL A+++PL+  A++ +P+   G TP+ +L TAG+R+L   D+  ++
Sbjct  145   TEPGFHQLLHNESGLGAAVQPLLDWAKQQIPARLHGETPLLLLGTAGLRKLATVDSEWLL  204

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlgg--  1098
             +   GI+++  F  R+ ++R+++G EEAYYGWVALNY +  LG      TLG +      
Sbjct  205   DKAWGIIEKSPFKCRRSWLRIINGVEEAYYGWVALNYILERLGQDETKMTLGTVGSLDLG  264

Query  1097  -ssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE  921
              SSL+V  E  E    ++      G  EH++ AYS   FG N+AFD+++A+L        
Sbjct  265   GSSLEVTFEPGEPIRPDYGVNLSFGQEEHRVYAYSHSGFGLNDAFDKSVALLMHNS---N  321

Query  920   SRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKC  741
              R    +VRHPCL S + Q+++C       PS++  +    +      I+++G+P+W KC
Sbjct  322   VRNGTLEVRHPCLHSEYQQSYSCSSYCVAPPSTNRGAGEGGVP-----IVLVGEPHWGKC  376

Query  740   KVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNM  561
             + LA  V  +S    RS   EQ+   L  Y              + +++A++GFF +Y  
Sbjct  377   QALARSVINSSRFTTRSVDCEQSNCALGKY----------QPRPIGQFYAVAGFFVMYKF  426

Query  560   LNLSSRANLTKMWETGQGLCSRSWV---DQTDANGL----CFRILYMASLIKDALCLSNL  402
               LSS+A+L  +   GQ  C + W    D  D  G     CFR  Y+ +L+++ L L + 
Sbjct  427   FGLSSKASLDDLLSKGQEFCGKPWPVARDSVDPQGFIDRYCFRAPYVVALLREGLHLRDE  486

Query  401   EIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLV  237
             ++  GPGDV+W  GAAL+E G   +  ++ S RK    Q  W  S S  L  +L+
Sbjct  487   QVTVGPGDVTWTQGAALLEAGVLEK--SSRSHRK----QRWWFYSPSFLLPTLLL  535



>ref|NP_001064408.1| Os10g0350500 [Oryza sativa Japonica Group]
 gb|AAM74442.1|AC123594_25 Putative nucleosid phosphatase [Oryza sativa Japonica Group]
 gb|AAP53210.1| nucleoside phosphatase family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26322.1| Os10g0350500 [Oryza sativa Japonica Group]
 gb|EAZ15775.1| hypothetical protein OsJ_31192 [Oryza sativa Japonica Group]
 dbj|BAG91877.1| unnamed protein product [Oryza sativa Japonica Group]
Length=702

 Score =   255 bits (651),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 159/488 (33%), Positives = 262/488 (54%), Gaps = 36/488 (7%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +  + V+LDCGSTG+RV +YEW  N+ +   FPI +    GN  +    K    
Sbjct  91    VFLSEGSPEYYVILDCGSTGTRVYVYEWSVNHDDGNTFPIALKPL-GNAPKKKSGKLTGR  149

Query  1466  -YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPGL   V N +GL+ +++PL+R AEK +P      TP F+ ATAG+R+LP  
Sbjct  150   AYQRMETEPGLNKLVHNETGLKMTIEPLLRMAEKLIPRRAHKHTPAFLYATAGVRKLPSA  209

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +++    I+K   F   +D ++++SG +EAYYGW+ALN+ + MLG +S   T G L
Sbjct  210   DSEWLLDKAWDILKNSSFLCSRDRVKIISGMDEAYYGWIALNHHLNMLGTSSSKMTYGSL  269

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             DLGGSSLQV  E D   +DE     RIGS+ H+L AYSL  +G N+AFD+++A L +   
Sbjct  270   DLGGSSLQVTFETDNSIQDETSMSLRIGSISHQLSAYSLSGYGLNDAFDKSVAHLVKKLG  329

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV--LGDP  756
                  G++ +V+HPCL +G+ +++ C  C   K   S     +    E   + V  +G P
Sbjct  330   GAAGNGKV-QVKHPCLQTGYKEDYICSYCHPLKLDGSPSVGGKTTGKEKQGMAVELIGMP  388

Query  755   NWEKCKVLAMEVATNS--SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
              W +C  LA      S  SN        + C    ++     Q           ++A+SG
Sbjct  389   QWNECSALAKLTVNLSEWSNASSVDCNTKPCALPSTFPQPHGQ-----------FYAMSG  437

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKD  423
             F+ V+   NL++ A L  +   GQ  C ++W         Q      CFR  Y+ SL+++
Sbjct  438   FYVVFKFFNLTADATLIDVLNRGQEFCEKTWKVAKSSVPPQPFIEQYCFRAPYITSLLRE  497

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIV  243
              L + + ++I   G ++W LG AL+E G+   +++T    +G    H+  ++ +I + + 
Sbjct  498   GLQIKDNQVIIDSGSITWTLGVALLEAGQ---VLSTRIDIQGYRILHR-EINPNILIVLF  553

Query  242   LVCVLMIV  219
             L+ +++++
Sbjct  554   LISIVLVI  561



>gb|EAY78135.1| hypothetical protein OsI_33182 [Oryza sativa Indica Group]
Length=702

 Score =   254 bits (650),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 159/488 (33%), Positives = 262/488 (54%), Gaps = 36/488 (7%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +  + V+LDCGSTG+RV +YEW  N+ +   FPI +    GN  +    K    
Sbjct  91    VFLSEGSPEYYVILDCGSTGTRVYVYEWSVNHDDGNTFPIALKPL-GNAPKKKSGKLTGR  149

Query  1466  -YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPGL   V N +GL+ +++PL+R AEK +P      TP F+ ATAG+R+LP  
Sbjct  150   AYQRMETEPGLNKLVHNETGLKMTIEPLLRMAEKLIPRRAHKHTPAFLYATAGVRKLPSA  209

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +++    I+K   F   +D ++++SG +EAYYGW+ALN+ + MLG +S   T G L
Sbjct  210   DSEWLLDKAWDILKNSSFLCSRDRVKIISGMDEAYYGWIALNHHLNMLGTSSSKMTYGSL  269

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             DLGGSSLQV  E D   +DE     RIGS+ H+L AYSL  +G N+AFD+++A L +   
Sbjct  270   DLGGSSLQVTFETDNSIQDETSMSLRIGSISHQLSAYSLSGYGLNDAFDKSVAHLVKKLG  329

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV--LGDP  756
                  G++ +V+HPCL +G+ +++ C  C   K   S     +    E   + V  +G P
Sbjct  330   GAAGNGKV-QVKHPCLQTGYKEDYICSYCHPLKLDGSPSVGGKTTGKENQGMAVELIGMP  388

Query  755   NWEKCKVLAMEVATNS--SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
              W +C  LA      S  SN        + C    ++     Q           ++A+SG
Sbjct  389   QWNECSALAKLTVNLSEWSNASSVDCNTKPCALPSTFPQPHGQ-----------FYAMSG  437

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKD  423
             F+ V+   NL++ A L  +   GQ  C ++W         Q      CFR  Y+ SL+++
Sbjct  438   FYVVFKFFNLTADATLIDVLNRGQEFCEKTWKVAKSSVPPQPFIEQYCFRAPYITSLLRE  497

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIV  243
              L + + ++I   G ++W LG AL+E G+   +++T    +G    H+  ++ +I + + 
Sbjct  498   GLQIKDNQVIIDSGSITWTLGVALLEAGQ---VLSTRIDIQGYRILHR-EINPNILIVLF  553

Query  242   LVCVLMIV  219
             L+ +++++
Sbjct  554   LISIVLVI  561



>ref|XP_010940026.1| PREDICTED: probable apyrase 7 [Elaeis guineensis]
 ref|XP_010940027.1| PREDICTED: probable apyrase 7 [Elaeis guineensis]
 ref|XP_010940028.1| PREDICTED: probable apyrase 7 [Elaeis guineensis]
Length=713

 Score =   254 bits (650),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 164/454 (36%), Positives = 254/454 (56%), Gaps = 39/454 (9%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWMPN----NGEFPILVNTYPGNLTRS----DGCK  1467
             Y     S + V+LDCGSTG+RV +YEW  N    +   PI++ + P    R      G  
Sbjct  93    YWSHETSEYYVILDCGSTGTRVYVYEWSINRNKGHSNLPIVLRSLPEGSQRKFSAGSGRA  152

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
             Y  ++TEPG    V N SGLRA++ PL++ AEK +P        +F+ ATAG+RRLP  D
Sbjct  153   YQRMETEPGFHKLVHNESGLRAAVMPLLQWAEKQIPKRAHKNASLFLYATAGVRRLPSSD  212

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
             ++ +++    I+K   F+ ++D++++++G EEAYYGW+ALN+ M MLG++    T G LD
Sbjct  213   SAWLLDKAWNILKNSSFYCKRDWVKIITGMEEAYYGWIALNHHMGMLGSSPTKKTFGALD  272

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAIL----SQ  939
             LGGSSLQV  E ++   DE     RIG+V H L AYSL  +G N+AFD++++ L    S 
Sbjct  273   LGGSSLQVTFETEKPMHDETSIILRIGAVSHYLSAYSLSGYGLNDAFDKSVSYLLKRFSG  332

Query  938   TQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS------  777
             T A   + G+I ++RHPCL +G+ + +TC  C     ++     S ++  ++NS      
Sbjct  333   TTAAGLNNGKI-ELRHPCLQTGYNEEYTCSHC-----ATINQEGSPVIGGKINSGHPGMV  386

Query  776   ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRY  597
             I +LG  NWE+C  LA  +A N S    S  +  +C       SD +           ++
Sbjct  387   IQLLGAHNWEECSALA-RIAVNLSEWS-STSSGVDCKLKPCALSDNLPR------PRGQF  438

Query  596   HALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMA  438
             +A+SGFF V+   NL+S+A L  + + G+  C ++W         Q      CFR  Y+A
Sbjct  439   YAMSGFFVVFRFFNLTSKATLGDVLKLGKEFCGKTWEVAKNSVAPQPFIEQYCFRAPYIA  498

Query  437   SLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             SL+++ L + + +++ G G ++W LG AL E G+
Sbjct  499   SLLREGLQVKDNQVVIGSGSITWTLGVALSEAGQ  532



>ref|XP_010936778.1| PREDICTED: LOW QUALITY PROTEIN: probable apyrase 7 [Elaeis guineensis]
Length=716

 Score =   254 bits (649),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 161/455 (35%), Positives = 248/455 (55%), Gaps = 32/455 (7%)
 Frame = -1

Query  1631  LILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE----FPILVNTYPGNLTRS----D  1476
             L  Y+    S + V+LDCGSTG+RV +YEW  N  +     PI++ + P    R      
Sbjct  90    LSTYLSHETSEYHVILDCGSTGTRVYVYEWSINGNKGRLALPIVLRSLPEGPQRKFSARS  149

Query  1475  GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
             G  Y  ++TEPG    V N +GL+A++ PL++ AE+ +P   R    +F+ ATAG+RRL 
Sbjct  150   GRAYQRMETEPGFHKLVHNETGLKAAIMPLLQXAERQIPKRARRNASLFLYATAGVRRLL  209

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg  1116
               D+  +++    I+K   F  ++D++++++G EEAYYGW+ALN+ M MLG++    T G
Sbjct  210   SSDSEWLLDRAWNILKSSSFLCKRDWVKIITGMEEAYYGWIALNHHMGMLGSSPSKKTFG  269

Query  1115  lldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAI  948
              LD+GGSSLQV  E ++   DE     RIG+V H L AYSL  +G N+AFD++    L  
Sbjct  270   ALDMGGSSLQVTFETEKPMHDETSINLRIGAVSHYLSAYSLSGYGLNDAFDKSVSHLLKR  329

Query  947   LSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS---  777
             LS T     S G++ ++RHPCL  G+ + +TC  C       S     R+ +        
Sbjct  330   LSGTAVAGLSNGKL-ELRHPCLQIGYREEYTCSRCATINQEGSPLIGGRISSGHAGMAGM  388

Query  776   -ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTR  600
              + +LG PNWE+C  LA  +A N S    +  A    +   + G     NL        +
Sbjct  389   VVELLGAPNWEECSALA-RIAVNLSEWSSTSSAVDCKLKPCALG----DNLP---RPHGK  440

Query  599   YHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYM  441
             ++A+SGFF V+   NL+S+A L  + + G+  C ++W       V Q      CFR  Y+
Sbjct  441   FYAMSGFFVVFRFFNLTSKATLDDVLKLGKEFCGKTWEVARNSVVPQPFIEQYCFRAPYI  500

Query  440   ASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             ASL+++ L + + +++ G G ++W LG AL E G+
Sbjct  501   ASLLREGLQIKDNQVVIGSGSITWTLGVALAEAGQ  535



>ref|XP_008221118.1| PREDICTED: probable apyrase 7 [Prunus mume]
 ref|XP_008221119.1| PREDICTED: probable apyrase 7 [Prunus mume]
Length=764

 Score =   253 bits (646),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 178/510 (35%), Positives = 267/510 (52%), Gaps = 53/510 (10%)
 Frame = -1

Query  1658  FGYFAFSPSLILYV--RKRASYFTVVLDCGSTGSRVNIYEWM---PNNGEFPILVNTYPG  1494
             FG+  +  S+ +Y    K    F +VLDCGSTG+RV +Y+      N+G FPI +     
Sbjct  122   FGFLIYLVSMFIYSYWSKGTPKFYIVLDCGSTGTRVYVYQASFDNANDGTFPIAMKPLTE  181

Query  1493  NLTRSD----GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFV  1326
              L R      G  Y  ++TEPGL   V N SGL+A++KPLIR AEK +P      T +F+
Sbjct  182   GLQRKPNSHIGRAYDRMETEPGLDKLVHNVSGLKAAIKPLIRWAEKQIPEKAHKTTSLFL  241

Query  1325  LATAGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRML  1146
              ATAG+RRLP  D+  +++    I+K   F  ++D+++++SG EEAY+GW+ALN+   ML
Sbjct  242   YATAGVRRLPSVDSKWLLDNAWSILKNSPFLCQRDWVKIISGLEEAYFGWIALNHHTGML  301

Query  1145  GNTsgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAF  966
             G      T G LDLGGSSLQV  E +E   +E     RIG+V H L AYSL ++G N+AF
Sbjct  302   GARPRKPTFGALDLGGSSLQVTFESNERVHNETSLNLRIGAVNHHLTAYSLPSYGLNDAF  361

Query  965   DRALAILSQ-----TQARR-ESRGEIFKVRHPCLSSGFVQNHTCRGCF-----GQKPsss  819
             D+++  L +     T+A     +GE+   RHPCL SG+ + + C  C      G  P  +
Sbjct  362   DKSVVHLLEKLPEITKAELVNGKGEL---RHPCLQSGYKEKYVCSECVSKFQEGGSPVIA  418

Query  818   edssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVA----EQNCVGLLSY  651
             + S  +     + S+++ G PNW++C  LA  +A N S             Q C   L  
Sbjct  419   KKSLGKGGRSGI-SVMLSGAPNWDECSKLA-RIAVNWSEWSNRNSGIDCDLQPCA--LPD  474

Query  650   GSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW------  489
             G  R            ++ A+SGFF VY   NL+S A+L  + E G+  C R+W      
Sbjct  475   GLPR---------PYGKFFAISGFFVVYRFFNLTSEASLDDVLEKGREFCERTWEVAKNS  525

Query  488   -VDQTDANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATE  312
                Q      CFR  Y+  L+++ L +++  +I G G ++W LG AL+E G+        
Sbjct  526   VAPQPFIEQYCFRAPYIVFLLREGLHITDNHVIIGSGRITWTLGVALLEAGK------AL  579

Query  311   SRRKGLATQHKWMVSSSITLFIVLVCVLMI  222
             S R GL +   + +  +   FI ++ + ++
Sbjct  580   STRLGLRSYEIFQIKINPIFFIAVLFISLL  609



>ref|XP_002978228.1| hypothetical protein SELMODRAFT_443766 [Selaginella moellendorffii]
 gb|EFJ20885.1| hypothetical protein SELMODRAFT_443766 [Selaginella moellendorffii]
Length=661

 Score =   251 bits (640),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 157/475 (33%), Positives = 254/475 (53%), Gaps = 37/475 (8%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCK--YHCVQ  1452
             L+ ++    F +V+DCGST +RV +Y W+ N G  P++    P + + +   K  YH ++
Sbjct  86    LWSQEEPIKFAIVMDCGSTSTRVYVYGWVHNGGSIPVMYRP-PSHSSDNARVKKAYHRME  144

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
             TEPG    + N SGL A+++PL+  A++ +P+   G TP+ +L TAG+R+L   D+  ++
Sbjct  145   TEPGFHQLLHNESGLGAAVQPLLDWAKQQIPARLHGETPLLLLGTAGLRKLATVDSEWLL  204

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlgg--  1098
             +   GI+++  F  R+ ++R+++G EEAYYGWVALNY +  LG      TLG +      
Sbjct  205   DKAWGIIEKSPFKCRRSWLRIINGVEEAYYGWVALNYILERLGQDETKMTLGTVGSLDLG  264

Query  1097  -ssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE  921
              SSL+V  E  E    ++      G  EH++ AYS   FG N+AFD+++A+L        
Sbjct  265   GSSLEVTFEPGEPIRPDYGVNLSFGQEEHRVYAYSHSGFGLNDAFDKSVALLMHNS---N  321

Query  920   SRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKC  741
              R    +VRHPCL S + Q+++C       PS++  +    +      I+++G+P+W KC
Sbjct  322   VRNGTLEVRHPCLHSEYQQSYSCSSYCVAPPSTNRGAGEGGVP-----IVLVGEPHWGKC  376

Query  740   KVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNM  561
             + LA  V  +S    RS   EQ+   L  Y              + +++A++GFF +Y  
Sbjct  377   QALARSVINSSRFTTRSVDCEQSNCALGKY----------QPRPIGQFYAVAGFFVMYKF  426

Query  560   LNLSSRANLTKMWETGQGLCSRSWV---DQTDANGL----CFRILYMASLIKDALCLSNL  402
               LSS+A+L  +   GQ  C + W    D  D  G     CFR  Y+ +L+++ L L + 
Sbjct  427   FGLSSKASLDDLLSKGQEFCGKPWPVARDSVDPQGFIDRYCFRAPYVVALLREGLHLRDE  486

Query  401   EIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLV  237
             ++  GPGDV+W  GAAL+E G   +  ++ S R+    Q  W  S S  L  +L+
Sbjct  487   QVTVGPGDVTWTQGAALLEAGVLEK--SSRSHRR----QRWWFYSPSFLLPTLLL  535



>gb|EYU20055.1| hypothetical protein MIMGU_mgv1a001966mg [Erythranthe guttata]
Length=732

 Score =   251 bits (640),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 162/443 (37%), Positives = 242/443 (55%), Gaps = 40/443 (9%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNL--TRSDGCKYHCVQTEP  1443
             AS + VVLDCGSTG+RV +YE   N   +   P+L+ + P +L      G  Y  ++TEP
Sbjct  134   ASKYYVVLDCGSTGTRVYVYEASINHKRDDNLPVLLKSLPESLQSVSHSGRAYKRMETEP  193

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL   V N SGL  ++KPLI+ AE  +P      T +F+ ATAG+RRLP  D+  +++  
Sbjct  194   GLGKLVNNVSGLSEAIKPLIQWAENQIPKKFHKTTSLFLCATAGVRRLPSSDSEWLLDNA  253

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               I+K   F  +K++++V++G EEAYYGW+ALNY   +LG      T G LDLGGSSLQV
Sbjct  254   YSILKNSRFLCKKEWVKVITGMEEAYYGWIALNYHTGVLGAIPKKETYGALDLGGSSLQV  313

Query  1082  VTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAI----LSQTQARRESR  915
               E  + + DE      IGSV H L AYSL  FG N+AFD+++A     L +      + 
Sbjct  314   TFEGKQDKYDETSLNLSIGSVNHHLSAYSLSGFGLNDAFDKSVAYIIKGLKKITDSDLAS  373

Query  914   GEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKV  735
             G++ +++HPCL SG+ + + C  C  +     +  +          + ++G PNWE+C+ 
Sbjct  374   GKV-EIKHPCLQSGYKELYICSHCSSELGKGEKSGA---------PVQLVGAPNWEECRA  423

Query  734   LAMEVATNSS---NLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYN  564
             LA +VA N S   N  R    E N   L        +NL      +  ++A+SGF+ VY 
Sbjct  424   LA-KVAVNLSEWNNHSRGSDCEVNPCAL-------AENLP---RPMGHFYAMSGFYVVYR  472

Query  563   MLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSN  405
               NL+S + L  + E G+  C ++W       V Q      CFR  Y+  L+++ L +++
Sbjct  473   FFNLTSDSTLDDVLEKGREFCDKNWDVARESVVPQPFIEQYCFRAPYVVLLLREGLHITD  532

Query  404   LEIIFGPGDVSWALGAALIEGGE  336
              ++I G G ++W LG AL E G+
Sbjct  533   GQVIVGSGSITWTLGVALFEAGK  555



>ref|XP_002533795.1| adenosine diphosphatase, putative [Ricinus communis]
 gb|EEF28582.1| adenosine diphosphatase, putative [Ricinus communis]
Length=762

 Score =   250 bits (639),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 165/492 (34%), Positives = 267/492 (54%), Gaps = 39/492 (8%)
 Frame = -1

Query  1631  LILYVRKRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYP-GNLTRSDGCKY  1464
             +I Y  +  S F VVLDCGSTG+R  +Y+       +G  PI++ ++  G+  +S+G  Y
Sbjct  139   IISYWSQGVSKFYVVLDCGSTGTRAYVYQASIDHKKDGNLPIVLKSFTEGHSRKSNGRAY  198

Query  1463  HCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDA  1284
               ++TEPGL M V N SGL+A++ PL++ AEK +P      T +F+ ATAG+RRLP  D+
Sbjct  199   DRMETEPGLHMLVHNISGLKAAINPLVQWAEKQIPEHAHKATSLFLYATAGVRRLPTTDS  258

Query  1283  SRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldl  1104
             + +++    I+K   F  ++ +++V+SG +EAYYGW++LNY+  +LGN+    T G LD+
Sbjct  259   NWLLDNAWSILKSSPFLCQRKWVKVISGMDEAYYGWISLNYQTGVLGNSPKKVTFGALDM  318

Query  1103  ggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARR  924
             GGSSLQV  E  +   +E     RIG+  H L AYSL  +G N+AFD+++  + +     
Sbjct  319   GGSSLQVTFESKDLGHNETDLNLRIGAAYHHLTAYSLAGYGLNDAFDKSVVQIFKGLPTT  378

Query  923   E--SRGEIFKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSRMMTCELNSILVL  765
             +   +G I +++HPCL SG+ + + C  C         P     +S + +   +  + ++
Sbjct  379   DLVKKGNI-EIKHPCLQSGYKEQYICSQCASVLQSSAGPVVVGRNSGKGVKPGV-PVQLI  436

Query  764   GDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNS---HEVTRYH  594
             G PNW++C  LA +VA N S    ++ A  +C          +Q   L         +++
Sbjct  437   GAPNWQECSALA-KVAVNLSEWS-NQSAPLDC---------DLQPCALPDIYPRPYGQFY  485

Query  593   ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMAS  435
             A+SGFF VY   NL+S A+L  + E GQ  C ++W         Q      CFR  Y+  
Sbjct  486   AMSGFFVVYRFFNLTSEASLDDVLEKGQEYCQKTWEAAKNSVPPQPFIEQYCFRAPYIVL  545

Query  434   LIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSIT  255
             L+++ L +++  II G G ++W LG AL + G+     A   R +  + +   M    I 
Sbjct  546   LLREGLHITDDHIIIGSGSITWTLGVALFQAGK-----AFSPRLRLPSYEILQMKIHPIV  600

Query  254   LFIVLVCVLMIV  219
             L +VL   L+++
Sbjct  601   LIVVLATSLVLL  612



>ref|XP_008782414.1| PREDICTED: probable apyrase 7 [Phoenix dactylifera]
 ref|XP_008782415.1| PREDICTED: probable apyrase 7 [Phoenix dactylifera]
Length=716

 Score =   249 bits (637),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 155/456 (34%), Positives = 246/456 (54%), Gaps = 36/456 (8%)
 Frame = -1

Query  1631  LILYVRKRASYFTVVLDCGSTGSRVNIYEWMPN----NGEFPILVNTYPGNLTRS----D  1476
             L  Y+   AS + V+LDCGST +RV +Y+W  N    + + PI++ + P    R      
Sbjct  90    LSTYLSHEASEYYVILDCGSTSTRVYVYDWSINRNKGHSDLPIVLRSLPEGSQRKFSARS  149

Query  1475  GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
             G  Y  ++TEPG    V N +GL+A++ PL++ AE+ +P        +F+ ATAG+RRL 
Sbjct  150   GHAYQRMETEPGFHKLVHNETGLKAAIMPLLQWAERQIPKRAHSNASLFLYATAGVRRLR  209

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg  1116
               D+  +++    I+K   FF ++D++++++G EEAYYGW+ALN+ M MLG++    T G
Sbjct  210   SSDSEWLLDKAWNILKSSSFFCKRDWVKIITGMEEAYYGWIALNHHMGMLGSSPSKKTFG  269

Query  1115  lldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
              LD+GGSSLQV  E ++   DE     RIG+V H L AYSL  +G N+AFD++++ + ++
Sbjct  270   ALDMGGSSLQVTFETEKPMHDETSINLRIGTVSHYLSAYSLSGYGLNDAFDKSVSYILKS  329

Query  935   ---QARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS----  777
                 A    R    ++RHPCL  G+ + +TC  C       +     R+ +         
Sbjct  330   FSGTAVAGLRNGKVQLRHPCLHMGYREEYTCPHCATLNQEENPLIGGRISSGHARMAGMV  389

Query  776   ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH---EV  606
             I +LG PNWE+C  LA  +A N S    +  A  +C         R++   L+ +     
Sbjct  390   IELLGAPNWEECSALA-RIAVNLSEWSSTSSA-VDC---------RLKPCALSDNLPRPH  438

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRIL  447
              +++A+SGFF V+   NL+S A L  +   G+  C + W         Q      CFR  
Sbjct  439   GQFYAMSGFFVVFRFFNLTSEATLDDVLNLGKEFCGKKWEVAKSSVAPQPFIEQYCFRAP  498

Query  446   YMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGG  339
             Y+ASL+++ L + + +++ G G ++W LG AL E G
Sbjct  499   YIASLLREGLQIKDNQVVIGSGSITWTLGVALAEAG  534



>ref|XP_002273561.1| PREDICTED: probable apyrase 7 [Vitis vinifera]
 emb|CBI25431.3| unnamed protein product [Vitis vinifera]
Length=770

 Score =   250 bits (638),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 172/494 (35%), Positives = 264/494 (53%), Gaps = 48/494 (10%)
 Frame = -1

Query  1613  KRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTY---PGNLTRSD-GCKYHCV  1455
             + AS F VVLD GSTG+R  +Y+       +G FPI++ ++   P     S  G  Y  +
Sbjct  147   QEASKFYVVLDSGSTGTRAYVYKANIAHKKDGSFPIVLRSFVEGPKKKPSSQSGRAYDRM  206

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             +TEPGL   V N SGL+A++KPL+R AEK +P      T +F+ ATAG+RRLP  D+  +
Sbjct  207   ETEPGLDKLVNNVSGLKAAIKPLLRWAEKQIPKHSHKSTSLFLYATAGVRRLPKSDSDWL  266

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             +     I+K+  F   ++++++++G EEAY+GW+ALNY  R LG++    T G LDLGGS
Sbjct  267   LNNARSIMKDSPFLCHEEWVKIITGMEEAYFGWIALNYHTRTLGSSLKQATFGALDLGGS  326

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAILSQTQAR  927
             SLQV  E      +E     +IG+V H L AYSL  +G N+AFD++    L  L ++   
Sbjct  327   SLQVTFESRNHVHNETNLSVKIGAVNHHLNAYSLSGYGLNDAFDKSVVHLLKKLPESANA  386

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSRMMTCELNSILVLG  762
                 G+I +++HPCL SG+ + + C  C      G  P     +  +     + +I ++G
Sbjct  387   DLLNGKI-ELKHPCLHSGYKKQYVCSHCASRFQEGGSPLVGGKTLGKGGKPGI-AIRLIG  444

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNSHE---VTRYH  594
              P W++C  LA ++A N S               LS G D  +Q   L+ +      +++
Sbjct  445   VPKWDECNALA-KIAVNLSEWS-----------ALSPGLDCEVQPCALSDNSPRPYGKFY  492

Query  593   ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMAS  435
             A+SGFF VY   NL+S A L  + E GQ  C+++W         Q      CFR  Y+A 
Sbjct  493   AMSGFFVVYRFFNLTSDATLDDVLEKGQEFCAKTWEVAKNSVAPQPFIEQYCFRAPYIAL  552

Query  434   LIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLAT-QHKWMVSSSI  258
             L+++ L +++ ++  GPG ++W LG AL+E G       + S R GL   +   M  + +
Sbjct  553   LLREGLHITDNQVTIGPGSITWTLGVALLEAGN------SFSARIGLPRYEILQMKINPV  606

Query  257   TLFIVLVCVLMIVY  216
              LF+VL   L  V+
Sbjct  607   ILFVVLAVSLFFVF  620



>ref|XP_010449381.1| PREDICTED: probable apyrase 7 [Camelina sativa]
 ref|XP_010449382.1| PREDICTED: probable apyrase 7 [Camelina sativa]
 ref|XP_010449384.1| PREDICTED: probable apyrase 7 [Camelina sativa]
Length=748

 Score =   249 bits (636),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 166/467 (36%), Positives = 253/467 (54%), Gaps = 51/467 (11%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPG  1494
             F +  +  S+ +Y    + AS + VV DCGSTG+R  +Y+   N   +   PI++ +   
Sbjct  131   FAFLVYIVSMYIYTNWSRGASRYYVVFDCGSTGTRAYVYQGTINYKKDSSLPIVMKSLTE  190

Query  1493  NLTR-SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
              ++R S G  Y  ++TEPG    V N SGL+ ++KPLI+ AEK +P      T +FV AT
Sbjct  191   GISRKSSGRAYDRMETEPGFDKLVNNRSGLKKAIKPLIQWAEKQIPKHAHRTTSLFVYAT  250

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRL   D+S ++  V  I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG  
Sbjct  251   AGVRRLRPADSSWILGNVWSILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAV  310

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                 T G LDLGGSSLQV  E +E   +E     RIGSV H L AYSL  +G N+AF+R+
Sbjct  311   PKKATFGALDLGGSSLQVTFENEERTHNETNLNLRIGSVNHHLSAYSLAGYGLNDAFERS  370

Query  956   LAILSQTQARRESRGEIF----KVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssS  804
             +  L + +    ++ ++F    +++HPCL++G+   + C  C      G+K  S      
Sbjct  371   VVHLLK-RLPNVNKSDLFEGKLEMKHPCLNTGYKGQYICSQCASSLRGGKKGKSGV----  425

Query  803   RMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE----QNCVGLLSYGSDRM  636
                      I ++G PNWE+C  LA + A NSS    +K+      Q C     Y     
Sbjct  426   --------PIKLVGAPNWEECSALAKK-AVNSSEWSNTKLGVDCDLQPCALPDGY-----  471

Query  635   QNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQT  477
                    H   +++A+SGFF VY   NLS+ A+L  + E G+  C ++W         Q 
Sbjct  472   ------PHPHGQFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQP  525

Query  476   DANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                  CFR  Y+ SL+++ L +++ +II G G ++W LG AL+E G+
Sbjct  526   FIEQYCFRAPYIVSLLREGLYITDKQIIIGSGGITWTLGVALLEAGK  572



>ref|XP_009420860.1| PREDICTED: probable apyrase 7 [Musa acuminata subsp. malaccensis]
 ref|XP_009420861.1| PREDICTED: probable apyrase 7 [Musa acuminata subsp. malaccensis]
 ref|XP_009420862.1| PREDICTED: probable apyrase 7 [Musa acuminata subsp. malaccensis]
 ref|XP_009420863.1| PREDICTED: probable apyrase 7 [Musa acuminata subsp. malaccensis]
Length=710

 Score =   248 bits (634),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 168/487 (34%), Positives = 255/487 (52%), Gaps = 34/487 (7%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWM--PNNGE--FPILVNTYPGNLTRS----DGCK  1467
             ++   AS   V+LDCGSTG+RV +Y+W    N G    PI + + P    R+     G  
Sbjct  91    FLSHEASEHYVILDCGSTGTRVYVYKWTFDQNKGHRNLPIALKSLPEGPQRNPRTQSGRA  150

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
             YH ++TEPG    V +  GLRA L+PL+  AEK +P      T +F+ ATAG+RRLP  D
Sbjct  151   YHRMETEPGFDKLVHDKYGLRAVLQPLLLWAEKQIPKHAHKDTSLFLYATAGVRRLPKSD  210

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
             +  +++    I+K+  F  R+D+I+++SG EEAYYGW+ALN+ M +LG+     T G LD
Sbjct  211   SDWLLDKAWTILKKSSFLCRRDWIKLISGMEEAYYGWIALNHHMGLLGSLPAGKTYGSLD  270

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA-ILSQTQA  930
             LGGSSLQV  E +     +     RI S  H L AYSL  +G N+AFD+++A +  +   
Sbjct  271   LGGSSLQVTFETETPIHADTSISLRIASANHHLSAYSLSGYGLNDAFDKSVAHLFRKFVG  330

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV--LGDP  756
                      +++HPCL++G+   +TC  C   K   S  +  + M+ +   I+V  +G P
Sbjct  331   TGAGLNNKLQLKHPCLNNGYRDKYTCSRCASVKQEGSPLTGGKTMSKKKTGIVVELIGAP  390

Query  755   NWEKCKVLAMEVATNS--SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
              WE+C+ LA      S  SN       E     L    SD +           +++A+SG
Sbjct  391   QWEECRSLARLTVNRSAWSNFSSGIDCELKPCAL----SDGL------PQPRGKFYAMSG  440

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKD  423
             F+ V+   NLSS A+L  +   GQ  C  +W         Q      CFR  Y+ASL++D
Sbjct  441   FYVVFRFFNLSSEASLEDVLIMGQKFCGNTWKVAKNSVAAQPFIEQYCFRAPYVASLLRD  500

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIV  243
              L + + ++I G G ++W LG AL+E G+    ++     KG    ++  +  +I + I 
Sbjct  501   GLHIKDNQVIIGSGSITWTLGVALLEAGQ---ALSKRVEVKGYEIIYR-DIHPAIFVVIF  556

Query  242   LVCVLMI  222
              V VL++
Sbjct  557   FVSVLLL  563



>ref|XP_010434438.1| PREDICTED: probable apyrase 7 [Camelina sativa]
 ref|XP_010434439.1| PREDICTED: probable apyrase 7 [Camelina sativa]
 ref|XP_010434440.1| PREDICTED: probable apyrase 7 [Camelina sativa]
Length=748

 Score =   249 bits (635),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 166/466 (36%), Positives = 248/466 (53%), Gaps = 49/466 (11%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPG  1494
             F +  +  S+ +Y    + AS + VV DCGSTG+R  +Y+   N   +   PI++ +   
Sbjct  131   FAFLVYIVSMYIYTNWSRGASRYYVVFDCGSTGTRAYVYQGTINYKKDSSLPIVMKSLTE  190

Query  1493  NLTR-SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
              ++R S G  Y  ++TEPG    V N SGL+ ++KPLI+ AEK +P      T +FV AT
Sbjct  191   GISRKSSGRAYDRMETEPGFDKLVNNRSGLKKAIKPLIQWAEKQIPKHAHRTTSLFVYAT  250

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRL   D+S ++  V  I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG  
Sbjct  251   AGVRRLRPADSSWILGNVWSILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAV  310

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                 T G LDLGGSSLQV  E +E   +E     RIGSV H L AYSL  +G N+AF+R+
Sbjct  311   PKKATFGALDLGGSSLQVTFENEERTHNETNLNLRIGSVNHHLSAYSLAGYGLNDAFERS  370

Query  956   LAILSQTQARRESRGEI---FKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSR  801
             +  L +          I    +++HPCL++G+   + C  C      G+K  S       
Sbjct  371   VVHLLKRLPNVNKSDLIEGKLEMKHPCLNTGYKGQYICSQCASSLRGGKKGKSGV-----  425

Query  800   MMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE----QNCVGLLSYGSDRMQ  633
                     I ++G PNWE+C  LA + A NSS    +K+      Q C     Y      
Sbjct  426   -------PIKLVGAPNWEECSALAKK-AVNSSEWSNTKLGVDCDLQPCALPDGY------  471

Query  632   NLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTD  474
                   H   +++A+SGFF VY   NLS+ A+L  + E G+  C ++W         Q  
Sbjct  472   -----PHPHGQFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPF  526

Query  473   ANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                 CFR  Y+ SL+++ L +++ +II G G ++W LG AL+E G+
Sbjct  527   IEQYCFRAPYIVSLLREGLYITDKQIIIGSGGITWTLGVALLEAGK  572



>emb|CAN73342.1| hypothetical protein VITISV_042406 [Vitis vinifera]
Length=770

 Score =   249 bits (635),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 172/493 (35%), Positives = 263/493 (53%), Gaps = 48/493 (10%)
 Frame = -1

Query  1613  KRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTY---PGNLTRSD-GCKYHCV  1455
             + AS F VVLD GSTG+R  +Y+       +G FPI++ ++   P     S  G  Y  +
Sbjct  147   QEASKFYVVLDSGSTGTRAYVYKANIAHKKDGSFPIVLRSFVEGPKKKPSSQSGRAYDRM  206

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             +TEPGL   V N SGL+A++KPL+R AEK +P      T +F+ ATAG+RRLP  D+  +
Sbjct  207   ETEPGLDKLVNNVSGLKAAIKPLLRWAEKQIPKHSHKSTSLFLYATAGVRRLPKSDSDWL  266

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             +     I+K+  F   ++++++++G EEAY+GW+ALNY  R LG++    T G LDLGGS
Sbjct  267   LNNARSIMKDSPFLCHEEWVKIITGMEEAYFGWIALNYHTRTLGSSLKQATFGALDLGGS  326

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAILSQTQAR  927
             SLQV  E      +E     +IG+V H L AYSL  +G N+AFD++    L  L ++   
Sbjct  327   SLQVTFESRNHVHNETNLSVKIGAVNHHLNAYSLSGYGLNDAFDKSVVHLLKKLPESANA  386

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSRMMTCELNSILVLG  762
                 G+I +++HPCL SG+ + + C  C      G  P     +  +     + +I ++G
Sbjct  387   DLLNGKI-ELKHPCLHSGYKKQYVCSHCASRFQEGGSPLVGGKTLGKGGKPGI-AIRLIG  444

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNSHE---VTRYH  594
              P W++C  LA ++A N S               LS G D  +Q   L+ +      +++
Sbjct  445   VPKWDECNALA-KIAVNLSEWS-----------ALSPGLDCEVQPCALSDNSPRPYGKFY  492

Query  593   ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMAS  435
             A+SGFF VY   NL+S A L  + E GQ  C+++W         Q      CFR  Y+A 
Sbjct  493   AMSGFFVVYRFFNLTSDATLDDVLEKGQEFCAKTWEVAKNSVAPQPFIEQYCFRAPYIAL  552

Query  434   LIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLAT-QHKWMVSSSI  258
             L+++ L +++ ++  GPG ++W LG AL+E G       + S R GL   +   M  + +
Sbjct  553   LLREGLHITDNQVTIGPGSITWTLGVALLEAGN------SFSARIGLPRYEILQMKINPV  606

Query  257   TLFIVLVCVLMIV  219
              LF+VL   L  V
Sbjct  607   ILFVVLAVSLFFV  619



>gb|EYU43437.1| hypothetical protein MIMGU_mgv1a001715mg [Erythranthe guttata]
Length=769

 Score =   248 bits (634),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 158/456 (35%), Positives = 246/456 (54%), Gaps = 31/456 (7%)
 Frame = -1

Query  1631  LILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK  1467
             L LY    K  S F VV+DCGSTG+RV +Y+   N+ +    PI + + P +  R  G +
Sbjct  132   LFLYSNWSKGPSKFYVVIDCGSTGTRVYVYQASANHNKDDNLPISLKSLPESFHRKSGSQ  191

Query  1466  ----YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRL  1299
                 Y+ ++TEPG    V + SGL+ ++KPLI+ AEK +P      T +F+ ATAG+RRL
Sbjct  192   RGRAYNRMETEPGFDKLVHDISGLKKAIKPLIKWAEKQIPKKSHKTTSLFLYATAGVRRL  251

Query  1298  PIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtl  1119
             P  ++  ++     I+K   F  ++++++ ++G EEAYYGW+ALNY   +LG+     T 
Sbjct  252   PSSESDWLLNNAWSILKTSSFLCKREWVKTITGMEEAYYGWIALNYHTGVLGSIPKKETY  311

Query  1118  glldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQ  939
             G LDLGGSSLQV  E    + +E   +  IG V H L AYSL  +G N+AFD+++A L +
Sbjct  312   GALDLGGSSLQVTFEGKPVKHEETSLKLSIGPVNHHLNAYSLAGYGLNDAFDKSVAHLLK  371

Query  938   TQARRESRGEI----FKVRHPCLSSGFVQNHTCRGCFG--QKPsssedssSRMMTCELN-  780
                +R +  ++     K++HPCL SG+ + + C  C    QK  S      R+     + 
Sbjct  372   KLPQRITNADLVRGKVKIKHPCLQSGYKEQYLCSQCASIRQKDGSPPIEVKRLGKGGKSG  431

Query  779   -SILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVT  603
               I ++G P WE+C  LA +VA N S     +    NC       +D +         V 
Sbjct  432   VPIQLIGSPKWEECSALA-KVAVNLSEWSADRSPGINCEVQPCALADNL------PRPVG  484

Query  602   RYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDANG-------LCFRILY  444
             +++A+SGF+ VY   NL+S + L  + E G+  C ++W     + G        CFR  Y
Sbjct  485   QFYAMSGFYVVYRFFNLTSDSALDDVLEKGRQFCDKNWDVARKSVGPQPFIEQYCFRAPY  544

Query  443   MASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             +  L+++ L +++  +I G G ++W LG AL E G+
Sbjct  545   VVLLLREGLHITDRHVIIGSGSITWTLGVALFEAGK  580



>ref|XP_006482408.1| PREDICTED: probable apyrase 7-like isoform X1 [Citrus sinensis]
 ref|XP_006482409.1| PREDICTED: probable apyrase 7-like isoform X2 [Citrus sinensis]
Length=760

 Score =   247 bits (631),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 162/450 (36%), Positives = 238/450 (53%), Gaps = 38/450 (8%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTR----SDGCKYHCVQT  1449
              S + VVLDCGSTG+RV +YE   N+ +    PIL+N     L+R      G  Y  ++T
Sbjct  139   GSKYYVVLDCGSTGTRVYVYEASLNHNKESSLPILMNPLTKGLSRKSSLQSGRAYDRMET  198

Query  1448  EPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVME  1269
             EPG    V N SGL+A++KPL++ AEK +P      T +F+ ATAG+RRLP  D+  +++
Sbjct  199   EPGFDKLVHNISGLKAAIKPLLQWAEKQIPEHAHKTTSLFIYATAGVRRLPTSDSKWLLD  258

Query  1268  GVVGIVKEHG-FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggss  1092
                 I+K++  F  ++D+++++SG EEAYYGW ALNY+  MLG      T G LDLGGSS
Sbjct  259   NAWSILKKNSPFLCQRDWVKIISGTEEAYYGWTALNYRTGMLGAIPKKETFGSLDLGGSS  318

Query  1091  LQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRG  912
             LQV  E  E   +E     RIG+V H L AYSL  +G N+AFD+++  L +      +  
Sbjct  319   LQVTFESKEHMHNETNLNLRIGAVNHHLSAYSLSGYGLNDAFDKSVVKLLKRIPNVTTSD  378

Query  911   EI---FKVRHPCLSSGFVQNHTCRGCFGQ-----KPsssedssSRMMTCELNSILVLGDP  756
              +    +++HPCL SG+ + + C  C         P        +       ++ + G P
Sbjct  379   LVNGKVEIKHPCLQSGYKEQYVCSHCASSPAENGSPVVGGKKLVKGRKSG-TTVQLTGAP  437

Query  755   NWEKCKVLAMEVATNSSNLERSKVAE---QNCVGLLSYGSDRMQNLTLNSHEVTRYHALS  585
             NWE+C  LA  V   S  L  S   +   Q C   L  G  R            +++A+S
Sbjct  438   NWEECSALAKTVVNLSEWLNISPGVDCDMQPCA--LPDGLPR---------PFGQFYAIS  486

Query  584   GFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIK  426
             GFF VY   NL+S A+L  + E G+  C ++W         Q      CFR  Y+  L++
Sbjct  487   GFFVVYRFFNLTSEASLDDVLEKGREFCEKTWDSARVSVPPQPFIEQYCFRSPYVVLLLR  546

Query  425   DALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             + L +++  II G G ++W LG AL+E G+
Sbjct  547   EGLHITDKTIIVGSGSITWTLGVALLEAGK  576



>gb|EMS62472.1| Ectonucleoside triphosphate diphosphohydrolase 8 [Triticum urartu]
Length=706

 Score =   246 bits (628),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 266/493 (54%), Gaps = 44/493 (9%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +S + V+LDCGSTG+RV +YEW  N+ +   FPI +    GN  +    K    
Sbjct  91    VFLSEGSSEYYVILDCGSTGTRVYVYEWSINHNDGNSFPIALKPL-GNAPKKKSGKLVGR  149

Query  1466  -YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPGL+  V N +G++ +++PL++ AE+ +P      TP+F+ ATAG+R+LP  
Sbjct  150   AYQRMETEPGLSKLVHNEAGMKKAIEPLLQMAERQIPRRAHKHTPVFLYATAGVRKLPTA  209

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +M+    ++K   F   +D +++++G EEAYYGWVALN+ + MLG +S +  +   
Sbjct  210   DSEWLMDKAWDVLKNSSFSCSRDRVKIITGMEEAYYGWVALNHHLNMLGTSSSASEMTYG  269

Query  1109  dlgg--ssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
              L    SSLQV  E D+  + +      IGSV H+L AYSL  +G N+AFD+++A L + 
Sbjct  270   SLDLGGSSLQVTFETDKVVQGDTGVGLTIGSVNHQLSAYSLSGYGLNDAFDKSVAHLVKM  329

Query  935   QARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN--SILVLG  762
                    G++ +V+HPCL +G+ +++ C  C   K   S   S++    E    ++ ++G
Sbjct  330   LGGTAGNGKV-QVKHPCLQTGYREDYVCSYCQPLKQDGSPSVSAKTTGKEKQGTAVELIG  388

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVA----EQNCVGLLSYGSDRMQNLTLNSHEVTRYH  594
              P W++C  LA +V  N S    S       +Q C    ++     Q           ++
Sbjct  389   APQWKECSDLA-KVTVNLSEWSNSSSGLDCNQQPCALASTFPQPHGQ-----------FY  436

Query  593   ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMAS  435
             A+SGF+ V+   NL+  A L  + + GQ  C + W         Q      CFR  Y+ S
Sbjct  437   AMSGFYVVFKFFNLTPDATLVDVLKRGQEFCEKPWDVARSSVPPQPFIEQYCFRAPYITS  496

Query  434   LIKDALCLSNLEIIFGPGDVSWALGAALIEGGEH-SRLIATESRRKGLATQHKWMVSSSI  258
             L+++ L + + ++I G G ++W LG AL+E G+  SR+       +G    H+  ++ +I
Sbjct  497   LLREGLQIKDNQVIIGSGSITWTLGVALLEAGQALSRMDI-----QGYILLHR-EINPNI  550

Query  257   TLFIVLVCVLMIV  219
              + + L+ +++++
Sbjct  551   LIVLFLISIVLVI  563



>ref|XP_003612462.1| Ectonucleoside triphosphate diphosphohydrolase [Medicago truncatula]
 gb|AES95420.1| GDA1/CD39 nucleoside phosphatase family protein [Medicago truncatula]
Length=714

 Score =   246 bits (629),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 169/480 (35%), Positives = 249/480 (52%), Gaps = 30/480 (6%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRV---NIYEWMPNNGEFPILVNTYPGNLTRSD--GCKYHCVQTEPGLA  1434
             + VVLDCGSTG+RV   N Y     +   PI V +    L R    G  Y  ++TEPG+ 
Sbjct  97    YYVVLDCGSTGTRVYVYNAYVQYKRHSSLPIAVKSLRDGLHRKKPTGRAYDRMETEPGID  156

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
               V N SGLR +LKPL+R A+K +P      T +F+ ATAG+RRLP +++  +++    +
Sbjct  157   KLVYNVSGLRGALKPLVRWAKKQIPVHSHKSTSVFLYATAGVRRLPRKESKWLLDNAWNV  216

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             +K+  F  RKD+I+++SG EEAY+GW++LNY   +LG +    T G LDLGGSSLQV  E
Sbjct  217   IKDSPFLCRKDWIKIISGTEEAYFGWISLNYHSGILGVSPRKATYGALDLGGSSLQVTFE  276

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQ----ARRESRGEI  906
              D+    E     RIGSV H L AYSL+ +G NEAF +++A L + +    A  +  G+ 
Sbjct  277   SDQQINTETSLYVRIGSVNHHLTAYSLEGYGLNEAFGKSVAHLFKKEFGSSASADMTGKN  336

Query  905   FKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAM  726
              +++HPCL SG+   +TC  C         +            ++++G P+W++C  LA 
Sbjct  337   IELKHPCLQSGYKSQYTCSHCDRGGSLGVNEKQLSKQGRSGTPLVIVGAPDWQQCSALAK  396

Query  725   EVATNS--SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNL  552
              V   S  SNL            L         NL         ++ +SGF+ VY   NL
Sbjct  397   VVVNLSEWSNLSPGLDCGVTPCAL-------RDNLP---RPYGHFYVISGFYVVYRFFNL  446

Query  551   SSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSNLEII  393
             SS A L  + + G+  C + W         Q      CFR  Y+ASL+++ L +++ +I 
Sbjct  447   SSDATLDDVLKKGEDFCEKRWDVAKKSVAPQPFIEQYCFRAPYIASLLREGLHINDNQIS  506

Query  392   FGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLF--IVLVCVLMIV  219
              G G ++W LG AL+E G+           + L T+    +  +I LF  IVL+C L  V
Sbjct  507   VGSGSITWTLGVALLEAGKAYSTGFGLRNFELLQTKINPPILIAIVLFSLIVLLCALSCV  566



>ref|XP_006430913.1| hypothetical protein CICLE_v10011132mg [Citrus clementina]
 gb|ESR44153.1| hypothetical protein CICLE_v10011132mg [Citrus clementina]
Length=760

 Score =   247 bits (631),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 160/448 (36%), Positives = 238/448 (53%), Gaps = 36/448 (8%)
 Frame = -1

Query  1604  SYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTR----SDGCKYHCVQTE  1446
             S + VVLDCGSTG+RV +YE   N+ +    PIL+N     L+R      G  Y  ++TE
Sbjct  140   SKYYVVLDCGSTGTRVYVYEASLNHNKESSLPILMNPLTKGLSRKSSLQSGRAYDRMETE  199

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PG    V N SGL+A++KPL++ AEK +P      T +F+ ATAG+RRLP  D+  +++ 
Sbjct  200   PGFDKLVHNISGLKAAIKPLLQWAEKQIPEHAHKTTSLFIYATAGVRRLPTSDSKWLLDN  259

Query  1265  VVGIVKEHG-FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssL  1089
                I+K++  F  ++D+++++SG EEAYYGW ALNY+  MLG      T G LDLGGSSL
Sbjct  260   AWSILKKNSPFLCQRDWVKIISGTEEAYYGWTALNYRTGMLGAIPKKETFGSLDLGGSSL  319

Query  1088  QVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGE  909
             QV  E  E   +E     RIG+V H L AYSL  +G N+AFD+++  L +      +   
Sbjct  320   QVTFESKEHMHNETNLNLRIGAVNHHLSAYSLSGYGLNDAFDKSVVKLLKRIPNVTNSDL  379

Query  908   I---FKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCEL----NSILVLGDPNW  750
             +    +++HPCL +G+ + + C  C      +           +      ++ + G PNW
Sbjct  380   VNGKVEIKHPCLQAGYKEQYVCSHCASSPAENGSPVVGGKKLVKGGKSGTTVQLTGAPNW  439

Query  749   EKCKVLAMEVATNSSNLERSKVAE---QNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGF  579
             E+C  LA  V   S  L  S   +   Q C   L  G  R            +++A+SGF
Sbjct  440   EECSALAKTVVNLSEWLNISPGVDCDMQPCA--LPDGLPR---------PFGQFYAISGF  488

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDA  420
             F VY   NL+S A+L  + E G+  C ++W         Q      CFR  Y+  L+++ 
Sbjct  489   FVVYRFFNLTSEASLDDVLEKGREFCEKTWDIARVSVPPQPFIEQYCFRSPYVVLLLREG  548

Query  419   LCLSNLEIIFGPGDVSWALGAALIEGGE  336
             L +++  II G G ++W LG AL+E G+
Sbjct  549   LHITDKNIIVGSGSITWTLGVALLEAGK  576



>ref|XP_010054004.1| PREDICTED: probable apyrase 7 [Eucalyptus grandis]
 gb|KCW78385.1| hypothetical protein EUGRSUZ_D02556 [Eucalyptus grandis]
Length=767

 Score =   246 bits (629),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 162/456 (36%), Positives = 246/456 (54%), Gaps = 41/456 (9%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTR----SDGCKY  1464
             Y  +  S F VVLDCGSTG+RV +Y+   N   +G  P+++ ++   + +      G  Y
Sbjct  141   YWSQGTSKFYVVLDCGSTGTRVYVYQASLNYKKDGSLPLVIKSFNEGVKKKPQSQSGRAY  200

Query  1463  HCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDA  1284
               ++TEPG    V N SGL A++ PL+R A+K +P      T +F+ ATAG+RRLP  D+
Sbjct  201   DRMETEPGFDKLVHNVSGLTAAINPLVRWAKKQIPKQSHKTTSLFLYATAGVRRLPEADS  260

Query  1283  SRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldl  1104
               +++    I+K   F  +K++++++SG EEAYYGW ALNY+  MLG      T G LDL
Sbjct  261   RWLLDNAWPILKTSPFLCKKEWVKIISGVEEAYYGWAALNYRTHMLGFMPKKATFGALDL  320

Query  1103  ggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA----ILSQT  936
             GGSSLQV  E  E   +    + RIG+  H L AYSL  +G N+AFD+++A    I  ++
Sbjct  321   GGSSLQVTFESKENMRNSSSLKLRIGASNHHLNAYSLSGYGLNDAFDKSVARLVKIPPES  380

Query  935   QARRESRGEIFKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSRMMTCELNSIL  771
             +    + G + +++HPCL SG+ + + C  C      G  P        +     + S+ 
Sbjct  381   KNTDLTHGNV-ELKHPCLHSGYKERYICSQCASNFKEGGSPVVQRRKLGKGGKPGI-SLH  438

Query  770   VLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNSHEVT---  603
             ++G PNWE+C  LA +VA N S   R           LS G D  +Q   L  +      
Sbjct  439   LIGAPNWEECSALA-KVAVNISEWSR-----------LSPGIDCDLQPCALPDNLARPHG  486

Query  602   RYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILY  444
              ++A+SGFF VY   NL++ A L  + E G+  C ++W         Q      CFR  Y
Sbjct  487   HFYAMSGFFVVYRFFNLTADATLDDVLEKGREFCEKTWEVAKNSVAPQPFIEQYCFRAPY  546

Query  443   MASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             +A L+++ L +++ +I  G G ++W LGAAL+E G+
Sbjct  547   IALLLREGLHITDNQITIGSGGITWTLGAALLESGK  582



>ref|NP_567579.2| GDA1/CD39 nucleoside phosphatase family protein [Arabidopsis 
thaliana]
 sp|F4JSH1.1|APY7_ARATH RecName: Full=Probable apyrase 7; Short=AtAPY7; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
7 [Arabidopsis thaliana]
 gb|AEE84155.1| GDA1/CD39 nucleoside phosphatase family protein [Arabidopsis 
thaliana]
 gb|AEJ38088.1| nucleoside triphosphate diphosphohydrolase 7 [Arabidopsis thaliana]
 gb|AFL69929.1| GDA1/CD39 nucleoside phosphatase, partial [Arabidopsis thaliana]
Length=740

 Score =   246 bits (628),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 169/466 (36%), Positives = 250/466 (54%), Gaps = 49/466 (11%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPG  1494
             F +  +  S+ +Y    + AS + VV DCGSTG+R  +Y+   N   +   PI++ +   
Sbjct  123   FAFLVYIVSMYIYTNWSRGASRYYVVFDCGSTGTRAYVYQASINYKKDSSLPIVMKSLTE  182

Query  1493  NLTR-SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
              ++R S G  Y  ++TEPG    V N +GL+ ++KPLI+ AEK +P      T +FV AT
Sbjct  183   GISRKSRGRAYDRMETEPGFDKLVNNRTGLKTAIKPLIQWAEKQIPKNAHRTTSLFVYAT  242

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRL   D+S ++  V  I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG  
Sbjct  243   AGVRRLRPADSSWILGNVWSILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAL  302

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                 T G LDLGGSSLQV  E +E   +E     RIGSV H L AYSL  +G N+AFDR+
Sbjct  303   PKKATFGALDLGGSSLQVTFENEERTHNETNLNLRIGSVNHHLSAYSLAGYGLNDAFDRS  362

Query  956   LAILSQTQARRESRGEI---FKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSR  801
             +  L +          I    +++HPCL+SG+   + C  C      G+K  S       
Sbjct  363   VVHLLKKLPNVNKSDLIEGKLEMKHPCLNSGYNGQYICSQCASSVQGGKKGKSGV-----  417

Query  800   MMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSK----VAEQNCVGLLSYGSDRMQ  633
                    SI ++G PNW +C  LA   A NSS    +K       Q C   L  G  R  
Sbjct  418   -------SIKLVGAPNWGECSALAKN-AVNSSEWSNAKHGVDCDLQPCA--LPDGYPRPH  467

Query  632   NLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-VDQTDANG---  465
                       +++A+SGFF VY   NLS+ A+L  + E G+  C ++W V +T  +    
Sbjct  468   G---------QFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCDKAWQVARTSVSPQPF  518

Query  464   ---LCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                 CFR  Y+ SL+++ L +++ +II G G ++W LG AL+E G+
Sbjct  519   IEQYCFRAPYIVSLLREGLYITDKQIIIGSGSITWTLGVALLESGK  564



>ref|XP_009132598.1| PREDICTED: probable apyrase 7 [Brassica rapa]
Length=734

 Score =   245 bits (626),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 164/447 (37%), Positives = 242/447 (54%), Gaps = 47/447 (11%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTR-SDGCKYHCVQTEPG  1440
             AS + VV DCGSTG+R  +Y+   N   +   PI++ +    ++R S G  Y  ++TEPG
Sbjct  138   ASRYYVVFDCGSTGTRAYVYQASLNYKKDSSLPIVMKSLTEGISRKSSGRAYDRMETEPG  197

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
                 V N +GL+ ++KPLI+ AEK +P      T +FV ATAG+RRL   D+S ++  V 
Sbjct  198   FDKLVNNRTGLKKAIKPLIQWAEKQIPKHAHRTTSLFVYATAGVRRLRASDSSWLLGNVW  257

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG      T G LDLGGSSLQV 
Sbjct  258   SILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAVPKKATFGALDLGGSSLQVT  317

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI--  906
              E +E   +E     RIGSV H L AYSL  +G N+AF+R++  L +      +   I  
Sbjct  318   FENEEREHNETNLDLRIGSVNHHLSAYSLAGYGLNDAFERSVVQLLKRVPNVNNSELIEG  377

Query  905   -FKVRHPCLSSGFVQNHTCRGC-----FGQKPsssedssSRMMTCELNSILVLGDPNWEK  744
               ++RHPCL+SG+V  + C  C      G+K  S               I ++G PNW +
Sbjct  378   KLEMRHPCLNSGYVGQYICSQCGSTVKRGKKGKSGV------------PIKLIGAPNWGE  425

Query  743   CKVLAMEVATNSSNLERSKVAE----QNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFF  576
             C  LA ++A NSS   + K       Q C   L  G  R            +++A+SGFF
Sbjct  426   CSALA-KIAVNSSEWSKPKHGVDCDLQPCA--LPDGYPRPHG---------QFYAVSGFF  473

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDAL  417
              VY   NLS+ A+L  + E G+  C ++W         Q      CFR  Y+ SL+++ L
Sbjct  474   VVYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPFIEQYCFRAPYIVSLLREGL  533

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGE  336
              +++ +II G G ++W LG A++E G+
Sbjct  534   YITDKQIIIGSGSITWTLGVAILEAGK  560



>emb|CDX78924.1| BnaA01g09910D [Brassica napus]
Length=735

 Score =   245 bits (626),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 164/447 (37%), Positives = 242/447 (54%), Gaps = 47/447 (11%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTR-SDGCKYHCVQTEPG  1440
             AS + VV DCGSTG+R  +Y+   N   +   PI++ +    ++R S G  Y  ++TEPG
Sbjct  139   ASRYYVVFDCGSTGTRAYVYQASLNYKKDSSLPIVMKSLTEGISRKSSGRAYDRMETEPG  198

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
                 V N +GL+ ++KPLI+ AEK +P      T +FV ATAG+RRL   D+S ++  V 
Sbjct  199   FDKLVNNRTGLKKAIKPLIQWAEKQIPKHAHRTTSLFVYATAGVRRLRASDSSWLLGNVW  258

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG      T G LDLGGSSLQV 
Sbjct  259   SILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAVPKKATFGALDLGGSSLQVT  318

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI--  906
              E +E   +E     RIGSV H L AYSL  +G N+AF+R++  L +      +   I  
Sbjct  319   FENEEREHNETNLDLRIGSVNHHLSAYSLAGYGLNDAFERSVVQLLKRVPNVNNSELIEG  378

Query  905   -FKVRHPCLSSGFVQNHTCRGC-----FGQKPsssedssSRMMTCELNSILVLGDPNWEK  744
               ++RHPCL+SG+V  + C  C      G+K  S               I ++G PNW +
Sbjct  379   KLEMRHPCLNSGYVGQYICSQCGSTVKRGKKGKSGV------------PIKLIGAPNWGE  426

Query  743   CKVLAMEVATNSSNLERSKVAE----QNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFF  576
             C  LA ++A NSS   + K       Q C   L  G  R            +++A+SGFF
Sbjct  427   CSALA-KIAVNSSEWSKPKHGVDCDLQPCA--LPDGYPRPHG---------QFYAVSGFF  474

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDAL  417
              VY   NLS+ A+L  + E G+  C ++W         Q      CFR  Y+ SL+++ L
Sbjct  475   VVYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPFIEQYCFRAPYIVSLLREGL  534

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGE  336
              +++ +II G G ++W LG A++E G+
Sbjct  535   YITDKQIIIGSGSITWTLGVAILEAGK  561



>dbj|BAJ93718.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=701

 Score =   245 bits (625),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/492 (31%), Positives = 263/492 (53%), Gaps = 42/492 (9%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +S + V+LDCGSTG+RV +YEW  N+ +   FPI +    GN  +    K    
Sbjct  91    VFLSEGSSEYYVILDCGSTGTRVYVYEWSINHNDGNSFPIALKPL-GNAPKKKSGKLIGR  149

Query  1466  -YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPGL+  V N +G++ +++PL++ AE+ +P      TP+F+ ATAG+R+LP  
Sbjct  150   AYQRMETEPGLSKLVHNETGMKQAIEPLLQMAERQIPRRAHKHTPVFLYATAGVRKLPAA  209

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +M+    ++K   F   +D +++++G EEAYYGWVALN+ + MLG +S +  +   
Sbjct  210   DSEWLMDNAWDVLKNSSFSCSRDRVKIITGMEEAYYGWVALNHHLNMLGTSSSASEMTYG  269

Query  1109  dlgg--ssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
              L    SSLQV  E D+  + +      IGSV H+L AYSL  +G N+AFD+++A L + 
Sbjct  270   SLDLGGSSLQVTFETDKAVQGDTGVGLTIGSVNHQLSAYSLSGYGLNDAFDKSVAHLVKM  329

Query  935   QARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN--SILVLG  762
                    G++ +V+HPCL +G+ +++ C  C   K   S   S +    E    ++ ++G
Sbjct  330   LGGTAGNGKV-QVKHPCLQTGYREDYVCSYCHPLKQDGSPSVSGKTTGKEKQGTAVELIG  388

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVA----EQNCVGLLSYGSDRMQNLTLNSHEVTRYH  594
              P W++C  LA +V  N S    S        Q C    S+     Q           ++
Sbjct  389   APQWKECSDLA-KVTVNLSEWSNSSSGLDCNLQPCALANSFPQPHGQ-----------FY  436

Query  593   ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMAS  435
             A+SGF+ V+   NL+  A L  + + GQ  C + W         Q      CFR  Y+ S
Sbjct  437   AMSGFYVVFKFFNLTPDATLVDVLKRGQEFCEKPWDVARSSVPPQPFIEQYCFRSPYITS  496

Query  434   LIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSIT  255
             L+++ L + + ++I G G ++W LG AL+E G+      ++   +G    H+  ++ +I 
Sbjct  497   LLREGLQIKDNQVIIGSGSITWTLGVALLEAGQ----ALSKMDIQGYILLHR-EINPNIL  551

Query  254   LFIVLVCVLMIV  219
             + + L+ +++++
Sbjct  552   IVLFLISIVLVI  563



>ref|XP_007040844.1| GDA1/CD39 nucleoside phosphatase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040845.1| GDA1/CD39 nucleoside phosphatase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040846.1| GDA1/CD39 nucleoside phosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25345.1| GDA1/CD39 nucleoside phosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25346.1| GDA1/CD39 nucleoside phosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25347.1| GDA1/CD39 nucleoside phosphatase family protein isoform 1 [Theobroma 
cacao]
Length=770

 Score =   246 bits (628),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 172/491 (35%), Positives = 255/491 (52%), Gaps = 44/491 (9%)
 Frame = -1

Query  1613  KRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTR----SDGCKYHCV  1455
             K AS F VVLDCGSTG+RV +Y+      N+G  PI++ +    L+R      G  Y  +
Sbjct  148   KGASKFYVVLDCGSTGTRVYVYQASIDHKNDGSLPIVMKSLTEGLSRRPSSQSGRAYDRM  207

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             +TEPG    V + SGL+A++ PLI  AEK +P      T +F+ ATAG+RRLP  D+  +
Sbjct  208   ETEPGFHKLVHDKSGLKAAINPLISWAEKQIPEHAHKTTSLFLYATAGVRRLPSADSKWL  267

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             +E    I+K   F  R++++R++SG EEAY+GW ALNY+  MLG T    T G LDLGGS
Sbjct  268   LENAWLILKNSPFLCRREWVRIISGTEEAYFGWTALNYRTGMLGATPKRKTFGALDLGGS  327

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAILSQTQAR  927
             SLQV  E +  + +E     RIG V H L AYSL  +G N+AFD++    L  L      
Sbjct  328   SLQVTFENENHQHNETNLNLRIGVVTHHLSAYSLSGYGLNDAFDKSVVHLLKRLPDGSNT  387

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCFGQK-----PsssedssSRMMTCELNSILVLG  762
                 G+I +++HPCL SG+ + + C  C  +      P        +     +  + ++G
Sbjct  388   NLVNGKI-EIKHPCLHSGYNEQYICSQCASKDQENGSPVVGGKILDKGGKSGI-PVQLIG  445

Query  761   DPNWEKCKVLAMEVATNS---SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHA  591
              PNWE+C  +A +VA N    SNL      +     L    SD +           +++A
Sbjct  446   APNWEQCSAIA-KVAVNLSEWSNLYPGIDCDLQPCAL----SDSLPRPN------GQFYA  494

Query  590   LSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASL  432
             LSGFF VY   NLSS A L  + E G+  C ++W         Q      CFR  Y+ SL
Sbjct  495   LSGFFVVYRFFNLSSDAALDDVLEKGRDFCEKTWEVAKNSVAPQPFIEQYCFRAPYIVSL  554

Query  431   IKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITL  252
             +++ L +++ +++ G G ++W  G AL+  G+     +  SR +    Q   M    I L
Sbjct  555   LREGLHITDSQLVIGSGSITWTKGVALLAAGK-----SFSSRLRLRGYQILQMKIDPIIL  609

Query  251   FIVLVCVLMIV  219
              ++L   L+++
Sbjct  610   IVILFMSLILL  620



>emb|CDX99396.1| BnaC01g11560D [Brassica napus]
Length=617

 Score =   243 bits (619),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 244/444 (55%), Gaps = 48/444 (11%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTR-SDGCKYHCVQTEPG  1440
             AS + VV DCGSTG+R  +Y+   N   +   PI++ +    ++R S G  Y  ++TEPG
Sbjct  28    ASRYYVVFDCGSTGTRAYVYQASINYKKDSSLPIVMKSLTEGISRKSSGRAYDRMETEPG  87

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
                 V N +GL+ ++KPLI+ AE+ +P      T +FV ATAG+RRL   D+S ++  V 
Sbjct  88    FDKLVNNRTGLKKAIKPLIQWAERQIPKHAHRTTSLFVYATAGVRRLRASDSSWLLGNVW  147

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG      T G LDLGGSSLQV 
Sbjct  148   SILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAVPKKATFGALDLGGSSLQVT  207

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFK  900
              E +E   +E     RIGSV H L AYSL  +G N+AF+R++  L     +R       +
Sbjct  208   FENEERAHNETNLDLRIGSVNHHLSAYSLAGYGLNDAFERSVVQL----LKRMPNVNNSE  263

Query  899   VRHPCLSSGFVQNHTCRGC-----FGQKPsssedssSRMMTCELNSILVLGDPNWEKCKV  735
             ++HPCL+SG+   + C  C      G+K  S               I ++G PNW +C  
Sbjct  264   LKHPCLNSGYEGQYVCSQCGSTVKRGKKGKSGV------------PIKLIGAPNWGECSA  311

Query  734   LAMEVATNSSNLERSK----VAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVY  567
             LA ++A NSS   ++K       Q C   L  G  R            +++A+SGFF VY
Sbjct  312   LA-KIAVNSSEWSKTKHGVDCDLQPCA--LPDGYPRPHG---------QFYAVSGFFVVY  359

Query  566   NMLNLSSRANLTKMWETGQGLCSRSW-VDQTDAN------GLCFRILYMASLIKDALCLS  408
                NLS+ A+L  + E G+  C ++W V +T  +        CFR  Y+ SL+++ L ++
Sbjct  360   RFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPFIEQYCFRAPYIVSLLREGLYIT  419

Query  407   NLEIIFGPGDVSWALGAALIEGGE  336
             + +II G G ++W LG A++E G+
Sbjct  420   DKQIIIGSGSITWTLGVAVLEAGK  443



>ref|XP_004512309.1| PREDICTED: probable apyrase 7-like [Cicer arietinum]
Length=704

 Score =   244 bits (623),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 155/440 (35%), Positives = 234/440 (53%), Gaps = 30/440 (7%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRV---NIYEWMPNNGEFPILVNTYPGNLTRSD--GCKYHCVQTEPGLA  1434
             + VVLDCGSTG+RV   N Y     +   PI + +    L R    G  Y  ++TEPG+ 
Sbjct  88    YYVVLDCGSTGTRVYVYNAYIQYKRHSSLPIAIKSLRDGLHRKKPIGRAYDRMETEPGID  147

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
               V N SGLR +LKPL+R A+K +P      T +F+ ATAG+RRLP  ++  +++    +
Sbjct  148   KLVYNVSGLRGALKPLVRWAKKQIPVHSHKSTSLFLYATAGVRRLPRNESRWLLDNAWSV  207

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             +K+  F  RKD+++++SG EEAY+GW++LNY  R+LG +    T G LDLGGSSLQV  E
Sbjct  208   IKDSPFMCRKDWVKIISGTEEAYFGWISLNYHSRILGVSPRKATYGALDLGGSSLQVTFE  267

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQ----ARRESRGEI  906
              D+    E     RIGSV H L AYSL+ +G NEAF +++  L + +       +  G+ 
Sbjct  268   SDQQVNSETSLYVRIGSVNHHLTAYSLEGYGLNEAFGKSVVHLFKKEFGSLVNADMNGKN  327

Query  905   FKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAM  726
              +++HPCL SG+ + + C  C   +     +            ++++G PNW++C  LA 
Sbjct  328   IELKHPCLQSGYKERYVCSRCNKGESLGVGEKQLSKRGGSGTPVVLVGAPNWKQCSALAK  387

Query  725   EVATNS--SNLERS-KVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLN  555
              V   S  SNL        Q C           +NL         ++ +SGF+ V+   N
Sbjct  388   VVVNLSEWSNLSAGLDCGVQPCA--------LRENLP---RPYGHFYVISGFYVVFRFFN  436

Query  554   LSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSNLEI  396
             L+S A L  +   G+  C + W       V Q      CFR  Y+ASL+++ L +++ +I
Sbjct  437   LTSEATLDDVLRKGEDFCEKRWDVAKRSVVPQPFIEQYCFRAPYIASLLREGLHINDNQI  496

Query  395   IFGPGDVSWALGAALIEGGE  336
               G G ++W LG AL+E G+
Sbjct  497   SVGSGSITWTLGVALLEAGK  516



>ref|XP_010256291.1| PREDICTED: probable apyrase 7 isoform X2 [Nelumbo nucifera]
Length=716

 Score =   244 bits (623),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 163/465 (35%), Positives = 237/465 (51%), Gaps = 67/465 (14%)
 Frame = -1

Query  1613  KRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTRSD----GCKYHCV  1455
             +R S + VVLDCGSTG+RV +Y+       +G  PI + + P  + R      G  YH +
Sbjct  146   QRTSKYYVVLDCGSTGTRVYVYQASIIHKKDGRLPISLKSLPEGIQRKSMSRAGRAYHRM  205

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             +TEPGL   V N SGLR+++KPL+  AEK +P      T +F+ ATAG+RRLP  D+  +
Sbjct  206   ETEPGLDKLVHNVSGLRSAIKPLLSWAEKQIPKHAHKSTSLFLYATAGVRRLPPSDSQWL  265

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             ++    I+K   F  ++D+I++++G EEAYYGW++LNY M MLG+     T G LDLGGS
Sbjct  266   LDKAWSILKNSSFLCQRDWIKIITGMEEAYYGWISLNYHMGMLGSMPAKATFGALDLGGS  325

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAILSQTQAR  927
             SLQV  E  E   DE      IG++ H L AYSL  +G N+AFD++    L  L      
Sbjct  326   SLQVTFETKELMHDETSLNLSIGAINHHLSAYSLSGYGLNDAFDKSVFHLLKKLPGITKA  385

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSIL--------  771
                +G I ++ HPCL SG+ + + C  C              ++  E  S L        
Sbjct  386   DLIKGAI-ELNHPCLQSGYKERYICSHC-------------ALLNDESGSPLMGGRNLGK  431

Query  770   ---------VLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTL  621
                      ++G P W++C  LA      S  ++            L+ G D  +Q   L
Sbjct  432   GGKPGFPVNLIGAPQWKECSALAKITVNLSEWMD------------LNQGLDCELQPCAL  479

Query  620   NSHEVTRYH----ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTD  474
              S  + R H    A+SGF+ V+   NL+S A L  + + GQ  C R+W       V Q  
Sbjct  480   -SESLPRPHGHFYAMSGFYVVFRFFNLTSEATLDDVLQKGQEFCERTWEIAKNSVVPQPF  538

Query  473   ANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGG  339
                 CFR  Y+ SL+++ L +S+  +  G G ++W L  AL+E G
Sbjct  539   IEQYCFRAPYIVSLLREGLHISDHRVFVGSGSITWTLSVALLEAG  583



>ref|XP_004509482.1| PREDICTED: probable apyrase 7-like isoform X1 [Cicer arietinum]
 ref|XP_004509483.1| PREDICTED: probable apyrase 7-like isoform X2 [Cicer arietinum]
 ref|XP_004509484.1| PREDICTED: probable apyrase 7-like isoform X3 [Cicer arietinum]
 ref|XP_004509485.1| PREDICTED: probable apyrase 7-like isoform X4 [Cicer arietinum]
Length=725

 Score =   244 bits (623),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 165/454 (36%), Positives = 246/454 (54%), Gaps = 51/454 (11%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYE-----WMPNNGEFPILVNTYPGNLTRSDGCK----YHCVQTE  1446
             + VVLDCGSTG+RV +Y+      +  +   PI+V +    L +  G +    Y  ++TE
Sbjct  103   YYVVLDCGSTGTRVYVYKAEIDHTLTQDTSLPIVVTSLRNGLQKKPGSQSGRAYDRMETE  162

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PGL   V N +GL+ +LKPL++ A K +P      T +F+ ATAG+RRLP ED+  +++ 
Sbjct  163   PGLDKLVHNVTGLKTALKPLLKWAMKQIPEASHKSTSLFLYATAGVRRLPNEDSKWLLDN  222

Query  1265  VVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQ  1086
                ++K   F  RKD++++++G EEAYYGW+ALNY    LG     +T G LDLGGSSLQ
Sbjct  223   AWNVLKGSVFVCRKDWVKIITGTEEAYYGWIALNYDSGNLGVKPRKNTYGALDLGGSSLQ  282

Query  1085  VVTEIDEFRE---DEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESR  915
             V  E ++ ++    E     RIGSV H L AYSL  +G NEAFD+++A +     ++E  
Sbjct  283   VTFEGEDDQQHLNSETSLYVRIGSVNHHLTAYSLAGYGLNEAFDKSVAYI----FKKEKV  338

Query  914   GEIFKVRHPCLSSGFVQNHTCRGCF-------GQKPsssedssSRMMTCELNS--ILVLG  762
             G    V+HPCL +GF   +TC  C        G+ P  + +        E+N   ++++G
Sbjct  339   GLGGSVKHPCLQTGFRNQYTCSRCSSGEKGKEGESPKVNGNVGGGGKG-EINKTPVMLVG  397

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVA-----EQNCVGLLSYGSDRMQNLTLNSHEVTRY  597
              PNW++C  LA +VA N S  E S V      E N   L        +NL      +  +
Sbjct  398   APNWQECSALA-KVAVNLS--EWSDVGQGLDCEVNPCAL-------RENL---PRPMGHF  444

Query  596   HALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMA  438
             + +SGFF VY   NL+S A +  + E G+  C + W         Q      CFR  Y+A
Sbjct  445   YVISGFFVVYRFFNLTSEATIDDVLEKGREFCEKRWDVAKKSVAPQPFIEQYCFRSPYVA  504

Query  437   SLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             SL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  505   SLLREGLHITDRHITVGSGSITWTLGVALLEAGK  538



>emb|CDP13976.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   244 bits (622),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 168/496 (34%), Positives = 262/496 (53%), Gaps = 58/496 (12%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYE---WMPNNGEFPILVNTYPGNLTR----SDGCKYHCVQT  1449
             A  + VVLDCGSTG+RV +YE      ++   PI + + P    R      G  Y+ ++T
Sbjct  145   APKYYVVLDCGSTGTRVYVYEASVHQKSDRNLPISLRSLPKGFKRKSSLQSGRAYNRMET  204

Query  1448  EPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVME  1269
             EPG    V N SGL+ ++KPL+R A+K +P      T +F+ ATAG+RRLP  D+  ++ 
Sbjct  205   EPGFDKLVHNISGLKGAIKPLVRWAKKQIPVHAHKSTSLFLYATAGVRRLPSTDSEWLLN  264

Query  1268  GVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssL  1089
                 I+K   F  +K+++++++G EEAY+GW+ALNY   +LG      T G LDLGGSSL
Sbjct  265   NAWSILKSSSFLCKKEWVKIITGMEEAYFGWIALNYHTHVLGAVPRKETFGALDLGGSSL  324

Query  1088  QVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRES---  918
             QV  E ++   DE   +  +G V H+L AYSL  FG N+AFD+++  L +   +  S   
Sbjct  325   QVTFESNDGVRDESSLKLSLGPVNHRLSAYSLPGFGLNDAFDKSVFHLLRKHPQIGSADL  384

Query  917   -RGEIFKVRHPCLSSGFVQNHTCRGC-----------FGQKPsssedssSRMMTCELNSI  774
               G++ +V+HPCL SG+ + + C  C            GQK   +           +  +
Sbjct  385   LNGKV-EVKHPCLQSGYKEQYDCSHCASLYENDGTPPIGQKKFGTGGK-------PVIPL  436

Query  773   LVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNSH---EV  606
              ++G P WE+C  LA ++A N      S+ ++Q      S G D  +Q   L S+     
Sbjct  437   QLVGTPKWEECSALA-KIAVN-----LSEWSDQ------SPGIDCELQPCALASNLPRPY  484

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRIL  447
              +++A+SGF+ VY   NLSS A L  + E G+  C ++W         Q      CFR  
Sbjct  485   GKFYAMSGFYVVYRFFNLSSDAALDDVLEKGKEFCEKTWDVAKISVAPQPFIEQYCFRAP  544

Query  446   YMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVS  267
             Y+ SL+++ L +++  +I G G ++W LGAAL+E G+     A  +R +  + +   M  
Sbjct  545   YIVSLLREGLHITDSHVIVGSGSITWTLGAALLEAGK-----AVSTRLEFQSYEIMQMKI  599

Query  266   SSITLFIVLVCVLMIV  219
             + + LF VL+    I+
Sbjct  600   NPVVLFSVLIVSFFIL  615



>ref|XP_010277647.1| PREDICTED: probable apyrase 7 [Nelumbo nucifera]
 ref|XP_010277648.1| PREDICTED: probable apyrase 7 [Nelumbo nucifera]
Length=754

 Score =   244 bits (622),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 162/452 (36%), Positives = 243/452 (54%), Gaps = 41/452 (9%)
 Frame = -1

Query  1613  KRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYP-GNLTRS---DGCKYHCV  1455
             ++AS + VVLDCGSTG+RV +Y+       +   PI++ + P GN  +S    G  Y  +
Sbjct  133   EKASKYYVVLDCGSTGTRVFVYQASIVHRKDSSLPIILKSLPEGNQRKSMSRVGRAYRRM  192

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             +TEPGL   V N SGL+A++KPL+  AEK +P      T +F+ +TAG+RRLP  ++  +
Sbjct  193   ETEPGLDKLVHNISGLQAAIKPLLSWAEKQIPKHSHKSTSLFLYSTAGVRRLPTSESQWL  252

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             ++    I+K   F  ++D++++++G EEAYYGW+ALNY M  LG+     T G LDLGGS
Sbjct  253   LDEAWSILKNSSFLCQRDWVKIITGMEEAYYGWIALNYHMGTLGSVPEKATFGALDLGGS  312

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQ-----TQA  930
             SLQV  E  +   DE      IG++ + L AYSL  +G N+AFD+++  L +     T+A
Sbjct  313   SLQVTFETKDIMHDETSLNLSIGAINYHLSAYSLSGYGLNDAFDKSVVHLLKRLPGITKA  372

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCEL----NSILVLG  762
                  G   K+ HPCL SG+ + + C  C      S           +      S+ ++G
Sbjct  373   DLIKGG--IKLNHPCLQSGYKEKYICSQCASLNDESGSPLMDGSSMGKKGKPGTSVNLIG  430

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNS---HEVTRYH  594
              P WEKC  LA +VA N S               L+ G D  +Q   L+        +++
Sbjct  431   APQWEKCGALA-KVAVNLSEWSD-----------LNQGMDCDLQPCALSDSLPRPNGQFY  478

Query  593   ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMAS  435
             A+SGFF V+   NL+S   L  + + GQ  C R+W       V Q      CFR  Y+ S
Sbjct  479   AMSGFFVVFRFFNLTSDVTLDDVLQKGQEFCERTWEVAKNSVVPQPFIEQYCFRAPYIVS  538

Query  434   LIKDALCLSNLEIIFGPGDVSWALGAALIEGG  339
             L++D L +++ ++I G G ++W LG AL+E G
Sbjct  539   LLRDGLHITDSQVIIGSGSITWTLGVALLEAG  570



>ref|XP_010256289.1| PREDICTED: probable apyrase 7 isoform X1 [Nelumbo nucifera]
 ref|XP_010256290.1| PREDICTED: probable apyrase 7 isoform X1 [Nelumbo nucifera]
Length=769

 Score =   244 bits (622),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 163/465 (35%), Positives = 237/465 (51%), Gaps = 67/465 (14%)
 Frame = -1

Query  1613  KRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTRSD----GCKYHCV  1455
             +R S + VVLDCGSTG+RV +Y+       +G  PI + + P  + R      G  YH +
Sbjct  146   QRTSKYYVVLDCGSTGTRVYVYQASIIHKKDGRLPISLKSLPEGIQRKSMSRAGRAYHRM  205

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             +TEPGL   V N SGLR+++KPL+  AEK +P      T +F+ ATAG+RRLP  D+  +
Sbjct  206   ETEPGLDKLVHNVSGLRSAIKPLLSWAEKQIPKHAHKSTSLFLYATAGVRRLPPSDSQWL  265

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             ++    I+K   F  ++D+I++++G EEAYYGW++LNY M MLG+     T G LDLGGS
Sbjct  266   LDKAWSILKNSSFLCQRDWIKIITGMEEAYYGWISLNYHMGMLGSMPAKATFGALDLGGS  325

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAILSQTQAR  927
             SLQV  E  E   DE      IG++ H L AYSL  +G N+AFD++    L  L      
Sbjct  326   SLQVTFETKELMHDETSLNLSIGAINHHLSAYSLSGYGLNDAFDKSVFHLLKKLPGITKA  385

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSIL--------  771
                +G I ++ HPCL SG+ + + C  C              ++  E  S L        
Sbjct  386   DLIKGAI-ELNHPCLQSGYKERYICSHC-------------ALLNDESGSPLMGGRNLGK  431

Query  770   ---------VLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTL  621
                      ++G P W++C  LA      S  ++            L+ G D  +Q   L
Sbjct  432   GGKPGFPVNLIGAPQWKECSALAKITVNLSEWMD------------LNQGLDCELQPCAL  479

Query  620   NSHEVTRYH----ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTD  474
              S  + R H    A+SGF+ V+   NL+S A L  + + GQ  C R+W       V Q  
Sbjct  480   -SESLPRPHGHFYAMSGFYVVFRFFNLTSEATLDDVLQKGQEFCERTWEIAKNSVVPQPF  538

Query  473   ANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGG  339
                 CFR  Y+ SL+++ L +S+  +  G G ++W L  AL+E G
Sbjct  539   IEQYCFRAPYIVSLLREGLHISDHRVFVGSGSITWTLSVALLEAG  583



>ref|XP_006282448.1| hypothetical protein CARUB_v10004214mg [Capsella rubella]
 ref|XP_006282449.1| hypothetical protein CARUB_v10004214mg [Capsella rubella]
 gb|EOA15346.1| hypothetical protein CARUB_v10004214mg [Capsella rubella]
 gb|EOA15347.1| hypothetical protein CARUB_v10004214mg [Capsella rubella]
Length=748

 Score =   243 bits (621),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 165/466 (35%), Positives = 251/466 (54%), Gaps = 49/466 (11%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPG  1494
             F +  +  S+ +Y    +  S + VV DCGSTG+R  +Y+   N   +   PI++ +   
Sbjct  131   FAFLVYIVSMYIYTNWSRGTSRYYVVFDCGSTGTRAYVYQASINYKKDSSLPIVMKSLTE  190

Query  1493  NLTR-SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
              ++R S G  Y  ++TEPG    V N +GL+ ++KPLI+ AEK +P      T +FV AT
Sbjct  191   GISRKSSGRAYDRMETEPGFDKLVNNRTGLKTAIKPLIQWAEKQIPKHAHRTTSLFVYAT  250

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRL   D+S ++  V  I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG  
Sbjct  251   AGVRRLRPADSSWILGNVWSILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAV  310

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                 T G LDLGGSSLQV  E +E   +E     RIGSV H L AYSL  +G N+AF+R+
Sbjct  311   PKKATFGALDLGGSSLQVTFENEERTHNETNLNLRIGSVNHHLSAYSLAGYGLNDAFERS  370

Query  956   LAILSQTQARRESRGEI---FKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSR  801
             +  L +          I    +++HPCL+SG+   + C  C      G+K  S       
Sbjct  371   VVHLLKRLPNVNKSDLIEGKLEMKHPCLNSGYNGQYICSQCASSLKRGKKGKSGV-----  425

Query  800   MMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE----QNCVGLLSYGSDRMQ  633
                     I ++G PNW +C  LA ++A NSS    +K+      Q C   L  G  R  
Sbjct  426   -------PIKLVGAPNWGECSSLA-KIAVNSSEWSNTKLGVDCDLQPCA--LPDGYPRPH  475

Query  632   NLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-VDQTDANG---  465
                       +++A+SGFF VY   NLS+ A+L  + E G+  C ++W V +T  +    
Sbjct  476   G---------QFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPF  526

Query  464   ---LCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                 CFR  Y+ SL+++ L +++ +I+ G G ++W LG AL+E G+
Sbjct  527   IEQYCFRAPYIVSLLREGLYITDKQIVIGSGSITWTLGVALLEAGK  572



>ref|XP_002867950.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44209.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=741

 Score =   243 bits (620),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 167/466 (36%), Positives = 249/466 (53%), Gaps = 49/466 (11%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPG  1494
             F +  +  S+ +Y    + AS + VV DCGSTG+R  +Y+   N   +   PI++ +   
Sbjct  123   FAFLVYIASMYIYTNWSRGASRYYVVFDCGSTGTRAYVYQASINYKKDSSLPIVMKSLTE  182

Query  1493  NLTR-SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
              ++R S G  Y  ++TEPG    V N +GL+ ++KPLI+ AEK +P      T +FV AT
Sbjct  183   GISRKSKGRAYDRMETEPGFDKLVNNRTGLKTAIKPLIQWAEKQIPKHAHRTTSLFVYAT  242

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRL   D+S ++  V  I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG  
Sbjct  243   AGVRRLRPSDSSWILGNVWSILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAL  302

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                 T G LDLGGSSLQV  E +E   +E     RIGSV H L AYSL  +G N+AF+R+
Sbjct  303   PKKATFGALDLGGSSLQVTFENEERTHNETNLNLRIGSVNHHLSAYSLAGYGLNDAFERS  362

Query  956   LAILSQTQARRESRGEI---FKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSR  801
             +  L +          I    +++HPCL+SG+   + C  C      G+K  S       
Sbjct  363   VVHLLKRLPNVNKSDLIEGKLEMKHPCLNSGYNGQYICSQCASSVQGGKKGKSGV-----  417

Query  800   MMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSK----VAEQNCVGLLSYGSDRMQ  633
                     I ++G PNW +C  LA   A NSS    +K       Q C   L  G  R  
Sbjct  418   -------PIKLVGAPNWGECSALAKN-AVNSSEWSNTKHGVDCDLQPCA--LPDGYPRPH  467

Query  632   NLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-VDQTDANG---  465
                       +++A+SGFF VY   NLS+ A+L  + E G+  C ++W V +T  +    
Sbjct  468   G---------QFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPF  518

Query  464   ---LCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                 CFR  Y+ SL+++ L +++ +II G G ++W LG AL+E G+
Sbjct  519   IEQYCFRAPYIVSLLREGLYITDKQIIIGSGSITWTLGVALLEAGK  564



>ref|XP_008377056.1| PREDICTED: probable apyrase 7 [Malus domestica]
Length=759

 Score =   242 bits (618),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 161/447 (36%), Positives = 245/447 (55%), Gaps = 39/447 (9%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTRSD----GCKYHCVQTEPG  1440
             F +VLDCGSTG+RV +Y+       +G FPI++      L R+     G  Y  ++TEPG
Sbjct  139   FYIVLDCGSTGTRVYVYQASYDTEKDGTFPIVMKPLTQGLRRTSNSHRGRAYDRMETEPG  198

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
             L   V N SGL+A++KPLIR AEK +P      T +F+ ATAG+RRLP  D+  +++   
Sbjct  199   LDKLVHNVSGLKAAIKPLIRWAEKQIPQRAHKTTSVFLYATAGVRRLPTVDSQWLLDNAW  258

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              I+K   F  ++D+++++SG EEAY+GW+ALN+   +LG      T G LDLGGSSLQV 
Sbjct  259   SILKNSPFLCQRDWVKIISGLEEAYFGWIALNHHTGILGAKPRKPTFGALDLGGSSLQVT  318

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF-  903
              E +E    E     RIG++ H L AYSL ++G N+AFD+++  L + +    S+ E+  
Sbjct  319   FESNEQVHKETSLNLRIGAMNHHLTAYSLPSYGLNDAFDKSVVHLFE-RLPETSKAELVN  377

Query  902   ---KVRHPCLSSGFVQNHTCRGCFG--QKPsssedssSRMMTCELNSIL--VLGDPNWEK  744
                +++HPCL SG+ + + C  C    Q+  S   +   +     + IL  ++G PNW++
Sbjct  378   GKGELQHPCLQSGYKEQYVCSQCVSKFQEGGSPVIAKKWLDKGGRSGILLRLIGAPNWDE  437

Query  743   CKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNS---HEVTRYHALSGFF  576
             C  LA  VA N S               ++ G D  +Q  +L +       R+  +SGFF
Sbjct  438   CSKLA-RVAVNLSEWSN-----------INPGIDCDLQPCSLPNGVPRPYGRFFVISGFF  485

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDAL  417
              VY   NL+S A+L  + E G+  C R+W         Q      CFR  Y+  L+++ L
Sbjct  486   VVYRFFNLTSEASLDDVLEKGREFCERTWEVAKNSVAPQPFIEQYCFRAPYIVFLLREGL  545

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGE  336
              + + ++I G G ++W LG AL+E G+
Sbjct  546   HIIDNQVIIGSGSITWTLGVALLEAGK  572



>ref|XP_006841011.1| hypothetical protein AMTR_s00085p00097760 [Amborella trichopoda]
 gb|ERN02686.1| hypothetical protein AMTR_s00085p00097760 [Amborella trichopoda]
Length=266

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 164/231 (71%), Gaps = 4/231 (2%)
 Frame = -1

Query  1523  FPILVNTYP----GNLTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPS  1356
              PIL++++P    G   +S  C+YHC+QTEPGL  +V N SGL A+L+PL+  A   VPS
Sbjct  18    LPILLHSFPDYTKGRSQQSVACEYHCMQTEPGLDKYVSNVSGLAAALEPLLHWAGNIVPS  77

Query  1355  GKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGW  1176
              K   TPIFVLATAG+RRLP ED S V+E V  I+  +GF +++ +IR+L GREEAYYGW
Sbjct  78    KKHKTTPIFVLATAGLRRLPSEDGSWVLENVEYIINRYGFMHQRSWIRILDGREEAYYGW  137

Query  1175  VALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYS  996
             +A+NYKM  LG++    T G LDLGGSSL+VV E  E  E++H  RS+IG V H LLAYS
Sbjct  138   LAVNYKMGRLGSSLDKPTFGALDLGGSSLEVVLEKGEVEENQHFLRSQIGLVGHNLLAYS  197

Query  995   LQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGC  843
             L ++G NEAF+R+L +LS+ Q+ ++S     ++RHPCL+ G+++ +TC  C
Sbjct  198   LPSYGLNEAFERSLVLLSKEQSLKKSSSGKLELRHPCLNLGYMEKYTCNSC  248



>ref|XP_010535960.1| PREDICTED: probable apyrase 7 [Tarenaya hassleriana]
Length=755

 Score =   242 bits (617),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 165/466 (35%), Positives = 245/466 (53%), Gaps = 49/466 (11%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPG  1494
             F +  +  S+ +Y    +  S F VV DCGSTG+R  +Y    N   +   PI++ +   
Sbjct  131   FAFLVYIVSMYIYTNWSRGTSRFYVVFDCGSTGTRAYVYRASINYEKDSTLPIVMKSLTE  190

Query  1493  NLTR-SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
              L+R S G  Y  ++TEPG    V N SGL A++ PLI+ AEK +P      T +FV AT
Sbjct  191   GLSRKSSGRAYDRMETEPGFDKLVNNMSGLEAAINPLIQWAEKQIPKRAHRTTSLFVYAT  250

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRLP  D++ +++ V  I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG  
Sbjct  251   AGVRRLPSSDSNWILDNVWSILAKSPFICRREWVKIISGTEEAYFGWTALNYQTSMLGAL  310

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                 T G LDLGGSSLQV  E ++   +      +IG+V H L AYSL  +G N+AF R+
Sbjct  311   PKKATFGALDLGGSSLQVTFENEDQTHNGTNLNLKIGAVNHHLSAYSLAGYGLNDAFARS  370

Query  956   LAILSQ---TQARRESRGEIFKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSR  801
             +  L +     +  +  G   +++HPCL+SG+ + +TC  C      G+K  S       
Sbjct  371   VLQLLKGLPNISNSDLAGGKLEMKHPCLNSGYKEQYTCTQCASIVRGGKKGKSGI-----  425

Query  800   MMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSK----VAEQNCVGLLSYGSDRMQ  633
                     I ++G PNWE+C  LA   A N S    +K       Q C   L  G  R  
Sbjct  426   -------PIKLIGAPNWEECSALAKN-AVNYSEWSNTKHGIDCDLQPCA--LPDGYPRPH  475

Query  632   NLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTD  474
                       +++A+SGFF VY   NLS+ A L  + E G+  C + W         Q  
Sbjct  476   G---------QFYAVSGFFVVYRFFNLSAEAALDDVLEKGRLFCEKPWEVARTSVPPQPF  526

Query  473   ANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                 CFR  Y+ SL+++ L +++ +II G G ++W LG AL+E G+
Sbjct  527   IEQYCFRAPYIVSLLREGLYITDKQIIIGSGSITWTLGVALLEAGK  572



>ref|XP_004147770.1| PREDICTED: probable apyrase 7-like [Cucumis sativus]
 ref|XP_004161562.1| PREDICTED: probable apyrase 7-like [Cucumis sativus]
 gb|KGN53472.1| hypothetical protein Csa_4G056630 [Cucumis sativus]
Length=756

 Score =   241 bits (616),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 166/496 (33%), Positives = 258/496 (52%), Gaps = 57/496 (11%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGN---LTRSDGCKYHCVQTEPGL  1437
             + VVLDCGSTG+R  +Y+   N   NG  PI + +Y G    L    G  Y  ++TEPGL
Sbjct  151   YYVVLDCGSTGTRAFVYQANVNYKKNGALPIAIRSYTGQKKKLKSQSGRAYDRMETEPGL  210

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
                V N +GL+ ++KPL++ AEK +P      T +F+ ATAG+R+LP  D+  +++    
Sbjct  211   DKLVRNMTGLKKAIKPLLQWAEKQIPKRAHESTSLFLYATAGVRKLPPADSKWLLDSAWS  270

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             I+K   F  ++++++ +SG EEAYYGW+ALNY+  +LG T    T G LDLGGSSLQV  
Sbjct  271   ILKSSRFLCQREWVKTISGTEEAYYGWIALNYQKELLGATPREPTYGALDLGGSSLQVTF  330

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA-ILSQTQARRE---SRGE  909
             E  E  ++E     +IG+V++ L AYSL  +G N+AF +++  +L + Q   +   S G+
Sbjct  331   ESKE--QNESSLNIKIGNVDYHLNAYSLTGYGLNDAFGKSVVHLLRRIQEPEKLDLSNGK  388

Query  908   IFKVRHPCLSSGFVQNHTCRGC-----FGQKPsssedssSRMMTCELNSILVLGDPNWEK  744
              FK+ HPCL SG+ + +TC  C      G K                 S+ ++G PNWE+
Sbjct  389   -FKLNHPCLHSGYNEQYTCNQCGKLLDGGSKSGI--------------SLRLIGAPNWEE  433

Query  743   CKVLAMEVATNSSNLERSKVA----EQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFF  576
             C  LA +VA N S    +        Q C    +Y                 ++A+SGFF
Sbjct  434   CSALA-KVAVNFSEWSNTSTGVDCDVQPCAITNNY-----------PPPYGNFYAISGFF  481

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSWVD-------QTDANGLCFRILYMASLIKDAL  417
              V+   NL+S A L  + E G   C + W D       Q      CFR  Y+ SL+++ L
Sbjct  482   VVFRFFNLTSEATLDDVLERGHKFCEKPWDDAQASVPPQPFIEQYCFRAPYIVSLLREGL  541

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLV  237
              +++ +I  G G  +W LG +L+E G+ +  +AT    +G     K  +   I + ++  
Sbjct  542   HITDKQITIGSGSTTWTLGVSLLEAGK-AFTVATRLELRGYEI-FKMKIDPLILMVVLFT  599

Query  236   CVLMIVYRSQIKLPMP  189
              +  ++  S ++  +P
Sbjct  600   SLFFLLALSCVRSALP  615



>ref|XP_006413999.1| hypothetical protein EUTSA_v10024508mg [Eutrema salsugineum]
 gb|ESQ55452.1| hypothetical protein EUTSA_v10024508mg [Eutrema salsugineum]
Length=740

 Score =   241 bits (615),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 167/466 (36%), Positives = 249/466 (53%), Gaps = 49/466 (11%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPG  1494
             F +  +  S+ +Y    + A+ + VV DCGSTG+R  +Y+   N   +   PI++ +   
Sbjct  123   FAFLVYVVSMYIYTNWSRGAARYYVVFDCGSTGTRAYVYQASINYKKDSSLPIVMKSLTE  182

Query  1493  NLTR-SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
              ++R S G  Y  ++TEPG    V N SGL+ ++KPLI+ AEK +P      T +FV AT
Sbjct  183   GISRKSSGRAYDRMETEPGFDKLVNNRSGLKTAIKPLIQWAEKQIPKHAHRRTSLFVYAT  242

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRL   D+S ++  V  I+ +  F  R+++++++SG EEAY+GW ALNY+  MLG  
Sbjct  243   AGVRRLRASDSSWLLGNVWSILAKSPFTCRREWVKIISGTEEAYFGWTALNYQTSMLGAL  302

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                 T G LDLGGSSLQV  E +E   +E     RIGSV H L AYSL  +G N+AF+R+
Sbjct  303   PKKATFGALDLGGSSLQVTFENEERTHNETNLNLRIGSVNHHLSAYSLAGYGLNDAFERS  362

Query  956   LAILSQTQARRESRGEI---FKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSR  801
             +  L +          I    +++HPCL+SG+   + C  C      G+K  S       
Sbjct  363   VVHLLKRLPNVNKSDLIEGKLEMKHPCLNSGYEGQYICSQCASSVQGGKKRKSGV-----  417

Query  800   MMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSK----VAEQNCVGLLSYGSDRMQ  633
                     I ++G PNW +C  LA   A NSS    +K       Q C   L  G  R  
Sbjct  418   -------PIKLVGAPNWGECSALAKN-AVNSSEWSNTKHGIDCDLQPCA--LPDGYPRPH  467

Query  632   NLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-VDQTDANG---  465
                       +++A+SGFF VY   NLS+ A+L  + E G+  C ++W V +T  +    
Sbjct  468   G---------QFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPF  518

Query  464   ---LCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                 CFR  Y+ SL+++ L +++ +II G G ++W LG AL+E G+
Sbjct  519   IEQYCFRAPYIVSLLREGLYITDKQIIIGSGSITWTLGVALLEAGK  564



>ref|XP_011084872.1| PREDICTED: probable apyrase 7 [Sesamum indicum]
Length=769

 Score =   241 bits (616),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 163/488 (33%), Positives = 250/488 (51%), Gaps = 43/488 (9%)
 Frame = -1

Query  1604  SYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTRSDGCK----YHCVQTE  1446
             S F VV+DCGSTG+RV +Y+   N   +   PIL+ + P    R  G +    Y+ ++TE
Sbjct  149   SRFYVVIDCGSTGTRVYVYQASVNHQKDDNLPILLKSLPEGFQRKSGSQRGRAYNRMETE  208

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PG    V N SGLR ++KPLIR AEK +P  +   T +F+ ATAG+RRLP  D+  ++  
Sbjct  209   PGFDKLVRNISGLRKAIKPLIRWAEKQIPKNEHKTTSLFLYATAGVRRLPSPDSDWLLNN  268

Query  1265  VVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQ  1086
                I+K   F  +K+++++++G EEAYYGW+ALNY   +LG+     T G LDLGGSSLQ
Sbjct  269   AWSILKSSPFLCKKEWVKIITGMEEAYYGWIALNYHTGILGSIPKKETYGALDLGGSSLQ  328

Query  1085  VVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAIL----SQTQARRES  918
             V  E       E   +  IG V H L AYSL  +G N+AFD++++ L     Q       
Sbjct  329   VTFESKVSDHGETSLKLSIGPVNHHLSAYSLAGYGLNDAFDKSVSHLLKKFPQVSNADLV  388

Query  917   RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS---ILVLGDPNWE  747
              G++ +++HPCL SG+   + C  C   +         + +     +   + ++G P WE
Sbjct  389   SGKV-EIKHPCLQSGYKSKYVCSHCSSIRLKDGSPIGGKRLPKGGKAGVPVQLIGTPRWE  447

Query  746   KCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNSH---EVTRYHALSGF  579
             +C  LA +VA N S                S G+D  +Q   L  +      +++A+SGF
Sbjct  448   ECSALA-KVAVNLSEWSDH-----------SLGTDCELQPCALEQNLPRPHGQFYAMSGF  495

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDA  420
             + VY   NL+  A L  + E G+  C ++W       V Q      CFR  Y+  L+++ 
Sbjct  496   YVVYRFFNLTPDAALDDVLEKGREFCEKTWDVARKSVVPQPFIEQYCFRAPYVVRLLREG  555

Query  419   LCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVL  240
             L +++  +I G G ++W LG AL E G+         R K  + Q   +  + I L  +L
Sbjct  556   LHITDSHVIIGSGSITWTLGVALFEAGKE-----FPYREKNYSYQILRVEINPIILLAIL  610

Query  239   VCVLMIVY  216
                L +++
Sbjct  611   FASLFVLF  618



>gb|KHG13526.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Gossypium arboreum]
Length=798

 Score =   242 bits (617),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 172/495 (35%), Positives = 254/495 (51%), Gaps = 41/495 (8%)
 Frame = -1

Query  1619  VRKRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTR----SDGCKYH  1461
             +RK AS F VVLDCGSTG+RV +Y+      N+G  PI++ +    L+R      G  Y 
Sbjct  101   MRKGASKFYVVLDCGSTGTRVYVYKASIGHKNDGSLPIVMKSLTEGLSRKPSTQSGRAYD  160

Query  1460  CVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDAS  1281
              ++TEPGL   V N SGL A+L PLI  AEK +P  +   T +F+ ATAG+RRLP  D+ 
Sbjct  161   RMETEPGLHKLVHNKSGLAAALNPLISWAEKQIPEREHKNTFLFLYATAGVRRLPNADSK  220

Query  1280  RVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlg  1101
              ++E    I+K   F   K+++++++G EEAY GW ALNY   MLG T    T G LDLG
Sbjct  221   WLLENAWSILKRSPFLCHKEWVKIITGTEEAYLGWTALNYLTSMLGATLKKATFGALDLG  280

Query  1100  gssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE  921
             GSSLQV  E +  + +E     +IG V H L AYSL  +G N+AFD+++  L ++     
Sbjct  281   GSSLQVTFENEHRQHNETNLNLKIGVVTHHLSAYSLSGYGLNDAFDKSVVRLLRSLPDGS  340

Query  920   SRGEI---FKVRHPCLSSGFVQNHTCRGCFGQK-----PsssedssSRMMTCELNSILVL  765
             +   +    +++HPCL SG+ + + C  C  +      P        +     +  + + 
Sbjct  341   NANLVNGMIEIKHPCLHSGYKERYICSQCASKDQESGSPLVQGKILDKGGKSGI-PVHLT  399

Query  764   GDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNS---HEVTRY  597
             G PNWE+C  +A + A N S               L  G D  +Q   L         ++
Sbjct  400   GAPNWEQCSAIA-KAAVNLSEWST-----------LYPGIDCDLQPCALPDSLPRPYGQF  447

Query  596   HALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMA  438
             +ALSGFF VY   NLS  A L  + E G+  C + W         Q      CFR  Y+ 
Sbjct  448   YALSGFFVVYRFFNLSPEAALDDVLEKGREFCEKPWEVAKKSVAPQPFIEQYCFRAPYIV  507

Query  437   SLIKDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSI  258
             SL+++ L +S+ +++ G G ++W +G AL+E G+           + L T+   M+  +I
Sbjct  508   SLLREGLHISDSQLVVGSGSITWTMGVALLEAGKSFSSRLALPGYQILQTKIDPMILIAI  567

Query  257   TL--FIVLVCVLMIV  219
              L   ++LVC L  V
Sbjct  568   LLMSLVLLVCALSCV  582



>ref|XP_008451878.1| PREDICTED: probable apyrase 7 [Cucumis melo]
Length=756

 Score =   241 bits (614),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 157/445 (35%), Positives = 240/445 (54%), Gaps = 51/445 (11%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGN---LTRSDGCKYHCVQTEPGL  1437
             + VVLDCGSTG+R  +Y+   N   NG  PI + +Y G    L    G  Y  ++TEPGL
Sbjct  151   YYVVLDCGSTGTRAFVYQANVNYKKNGALPIAIRSYTGQKKKLKSQSGRAYDRMETEPGL  210

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
                V N +GL+ ++KPL++ AEK +P      T +F+ ATAG+R+LP  D+  +++    
Sbjct  211   DKLVRNVTGLKKAIKPLLQWAEKQIPKRAHESTSLFLYATAGVRKLPPADSKWLLDSAWS  270

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             I+K   F  ++++++ +SG EEAYYGW+ALNY+  +LG T    T G LDLGGSSLQV  
Sbjct  271   ILKSSRFLCQREWVKTISGTEEAYYGWIALNYQKELLGATPREPTYGALDLGGSSLQVTF  330

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA-ILSQTQARRE---SRGE  909
             E  E  ++E     +IG+V++ L AYSL  +G N+AF +++  +L + Q   +   S G+
Sbjct  331   ESKE--QNESSLNIKIGNVDYHLNAYSLTGYGLNDAFGKSVVHLLRRIQEPEKLDLSNGK  388

Query  908   IFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN---SILVLGDPNWEKCK  738
              FK+ HPCL +G+ + +TC  C             +++    N   S+ ++G PNWE+C 
Sbjct  389   -FKLNHPCLHTGYNEQYTCNQC------------GKLLDRGSNFGISLRLIGAPNWEECS  435

Query  737   VLAMEVATNSSNLERSKVA----EQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAV  570
              LA +VA N S    +        Q C    +Y                 ++A+SGFF V
Sbjct  436   ALA-KVAVNFSEWSNTSTGVDCDVQPCAITNNY-----------PPPYGNFYAISGFFVV  483

Query  569   YNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCL  411
             +   NL+S A L  + E GQ  C + W         Q      CFR  Y+ SL+++ L +
Sbjct  484   FRFFNLTSEATLDDVLERGQKFCEKPWDVAQASVPPQPFIEQYCFRAPYIVSLLREGLHI  543

Query  410   SNLEIIFGPGDVSWALGAALIEGGE  336
             ++ +I  G G  +W LG +L+E G+
Sbjct  544   TDKQITIGSGSTTWTLGVSLLEAGK  568



>ref|XP_006355646.1| PREDICTED: probable apyrase 7-like [Solanum tuberosum]
Length=766

 Score =   241 bits (614),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 155/450 (34%), Positives = 242/450 (54%), Gaps = 37/450 (8%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTRSD----GCKYHCVQ  1452
             R S + VVLDCGSTG+RV +Y+  PN   + + PI++ + P +  R+     G  Y+ ++
Sbjct  143   RDSKYYVVLDCGSTGTRVYVYQASPNYVKDNDLPIVLRSLPESFQRNSRLQSGRAYNRME  202

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
             TEPG    V N SGL+ ++KPLI+ A K +P      T +++ ATAG+RRLP  D+  ++
Sbjct  203   TEPGFDKLVHNTSGLKRAIKPLIKWAAKQIPRHAHKTTYLYLHATAGVRRLPNSDSEWLL  262

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggss  1092
                  I+K   F  ++++++ ++G EEAY+GW+A+NY   +LG      T G LDLGGSS
Sbjct  263   NNAWSILKSSPFLCKREWVKTITGMEEAYFGWIAMNYHTGILGAKPKKGTFGALDLGGSS  322

Query  1091  LQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAILSQTQARR  924
             LQV  E  E   DE      IG+V H L AYSL+ +G N+AFD++    L  L +     
Sbjct  323   LQVTFESKESLPDETSLELNIGAVNHHLTAYSLEGYGLNDAFDKSVVQLLKRLPKISDAD  382

Query  923   ESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS----ILVLGDP  756
              + G I +++HPCL+SG+ + + C  C          SS R +  +       + ++GDP
Sbjct  383   LTSGNI-EIKHPCLNSGYKEQYICTHCVSLYQEGGNPSSGREVASKEGKPGVRVQLVGDP  441

Query  755   NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH---EVTRYHALS  585
              WE+C  LA + A N S    +K +  +C          +Q   L  +      +++A+S
Sbjct  442   KWEECSSLA-KFAVNLSEWS-NKSSGIDC---------ELQPCALAENLPRPFGQFYAMS  490

Query  584   GFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIK  426
             GFF VY   NL+  A L  + E G+  C ++W         Q      CFR  Y+ SL++
Sbjct  491   GFFVVYRFFNLTPDAALDDVLEKGREFCDKTWDVAKTSVAPQPFIEQYCFRAPYIVSLLR  550

Query  425   DALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             + L +++ ++  G G ++W LG AL E G+
Sbjct  551   EGLHITDSQVTIGSGSITWTLGVALSEAGK  580



>ref|XP_007156349.1| hypothetical protein PHAVU_003G279000g [Phaseolus vulgaris]
 ref|XP_007156350.1| hypothetical protein PHAVU_003G279000g [Phaseolus vulgaris]
 gb|ESW28343.1| hypothetical protein PHAVU_003G279000g [Phaseolus vulgaris]
 gb|ESW28344.1| hypothetical protein PHAVU_003G279000g [Phaseolus vulgaris]
Length=707

 Score =   239 bits (610),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 168/507 (33%), Positives = 271/507 (53%), Gaps = 40/507 (8%)
 Frame = -1

Query  1787  HTLRMEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKR  1608
             H L  +P + S SK   +  + +P+  KC+  + +++ +L+L+  Y         Y  + 
Sbjct  32    HGLLRDPSNASFSKTKPLQ-LPTPVRRKCLAPIAIMALLLLLLLLY-------TFYSHQA  83

Query  1607  ASYFTVVLDCGSTGSRVNIYE---WMPNNGEFPILVNTYPGNLTR--SDGCKYHCVQTEP  1443
             +  + VVLDCGSTG+RV +Y+     P++   PI + +    L +  + G  Y  ++TEP
Sbjct  84    SPKYYVVLDCGSTGTRVYVYKAQVQQPHSTNLPIAIQSLKDGLRKDPASGRAYDRMETEP  143

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL   + N +GL+ +LKPL++ A+K +P      T + + ATAG+RRLP +D+  +++  
Sbjct  144   GLDKLLHNLTGLKTALKPLLKWAQKQIPEPSHRSTSLLLYATAGVRRLPFDDSKWLLDNA  203

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               ++K   F  R+D+++++SG EEAY+GW+ALNY   +LG      T G LDLGGSSLQV
Sbjct  204   WNVLKGSPFVCRRDWVKIISGTEEAYFGWIALNYDSGILGVEPQKETYGALDLGGSSLQV  263

Query  1082  VTEIDEFRE--DEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRES---  918
               E ++ +    E     RIGSV H L AYSL  +G NEAFD+++A + +      +   
Sbjct  264   TFEGNKQQHLNSETSLYVRIGSVNHHLTAYSLAGYGLNEAFDKSVARVFKEFGYGIADVM  323

Query  917   RGEIFKVRHPCLSSGFVQNHTCRGC-----FGQKPsssedssSRMMTCELNSILVL-GDP  756
             +G + +++HPCL SG+   +TC  C      G+ P    + +       + +++ L G P
Sbjct  324   KGNL-ELKHPCLQSGYKARYTCSHCGALENGGESPKVEGNGNVSGKKTGIKTMVTLVGAP  382

Query  755   NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFF  576
             NW+KC  LA +VA N S    +  A    +    +      NL      +  ++ +SGFF
Sbjct  383   NWQKCNALA-KVAVNLSEWSDASPALDCEI----HPCALRHNLP---RPMGHFYVISGFF  434

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDAL  417
              VY   NLS+ A L  + E G+  C + W         Q      CFR  Y+ASL+++ L
Sbjct  435   VVYRFFNLSAEATLEDVLEKGREFCEKRWNVAKKSVAPQPFIEQYCFRAPYIASLLREGL  494

Query  416   CLSNLEIIFGPGDVSWALGAALIEGGE  336
              +++  I  G G ++W LG AL+E G+
Sbjct  495   HITDKSITVGSGSITWTLGVALLEAGK  521



>gb|EPS73668.1| nucleoside phosphatase family protein, partial [Genlisea aurea]
Length=507

 Score =   233 bits (595),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 157/440 (36%), Positives = 237/440 (54%), Gaps = 37/440 (8%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNN---GEFPILVNTYPGNLTR-SDGCKYHCVQTEPGLAM  1431
             F VV+DCGSTG+RV +Y    N+    + PI + + P +  R S G  Y+  +TEPGL  
Sbjct  1     FYVVIDCGSTGNRVYVYRASVNHEKGDDLPISLKSLPESFERRSSGRAYNRKETEPGLDK  60

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
              V + + L+ +LKPLI+ AEK +P+     T +F+ ATAG+RRLP  D+  ++   + I+
Sbjct  61    LVNDVARLKKALKPLIKWAEKQIPARSHENTSLFLYATAGVRRLPRSDSDWLLRNSLSIL  120

Query  1250  KEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEI  1071
             K   F  + ++I++++G EEAYYGW+ALNY   +LG+     T G LDLGGSSLQV  E 
Sbjct  121   KSSRFSCKPEWIKIITGMEEAYYGWIALNYHAGVLGSVPKRETFGALDLGGSSLQVTFEG  180

Query  1070  DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA-----ILSQTQARRESRGEI  906
             +   + E      IG+V+H++ AYSL  +G N+AFD+++A      L        S+G +
Sbjct  181   NA--DTETSLNLSIGAVKHQVSAYSLAGYGLNDAFDKSVARVFFRTLPDAGNADPSKGTV  238

Query  905   FKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAM  726
              +V+HPCL SG+   ++C  C G  P  +E         E  S+ ++G PNW+KC  LA 
Sbjct  239   -EVKHPCLHSGYEAKYSCALC-GSVPQKNETGRGN----ERASVRLVGSPNWDKCVELA-  291

Query  725   EVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH---EVTRYHALSGFFAVYNMLN  555
             E+A N S          +C         +     L+ H      R++ +SGF+ VY   N
Sbjct  292   ELAVNMSEWSDRGGPAVDC---------KSHPCALDGHLPRPAGRFYVMSGFYVVYRFFN  342

Query  554   LSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSNLEI  396
             L+  A+L  + E G+  C + W         Q      CFR  Y   L+++ L +S+ +I
Sbjct  343   LTGDASLNAVLEKGREFCGKPWDAARSSVAPQPLIEQYCFRAPYAVLLLREGLQISDSQI  402

Query  395   IFGPGDVSWALGAALIEGGE  336
               G G ++W LG AL E G+
Sbjct  403   SVGSGSITWTLGVALFEAGK  422



>ref|XP_011076655.1| PREDICTED: probable apyrase 7 [Sesamum indicum]
Length=770

 Score =   238 bits (607),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 159/449 (35%), Positives = 238/449 (53%), Gaps = 39/449 (9%)
 Frame = -1

Query  1604  SYFTVVLDCGSTGSRVNIYEWMPNN---GEFPILVNTYPGNLTRSDGCK----YHCVQTE  1446
             S F VVLDCGSTG+RV +Y+   N+   G  PIL+ + P +  R  G +    Y+ ++TE
Sbjct  149   SRFYVVLDCGSTGTRVYVYQASINHKKYGNLPILLKSLPDSFQRKSGSQSGRAYNRMETE  208

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PGL   + N SGL  +++PLI+ AEK +P      T +F+ ATAG+RRLP  D+  ++  
Sbjct  209   PGLDKLLRNISGLSEAIQPLIQWAEKQIPRRSHKTTSLFLYATAGVRRLPSSDSEWLLNN  268

Query  1265  VVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQ  1086
                I+K   F  +K+++++++G EEAYYGW+ALNY    LG++    T G LDLGGSSLQ
Sbjct  269   AWSILKSSRFLCKKEWVKIITGVEEAYYGWIALNYHTESLGSSPEKETYGALDLGGSSLQ  328

Query  1085  VVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI  906
             V  E ++   DE   +  +G VEH L AYSL  +G N+AFD+++A L +   R      +
Sbjct  329   VTFEGEQGDHDEMSLKLSLGPVEHHLTAYSLAGYGLNDAFDKSVAHLLKRLPRVSDADLV  388

Query  905   ---FKVRHPCLSSGFVQNHTCRGCF------GQKPsssedssSRMMTCELNSILVLGDPN  753
                 ++ HPCL SG+ +   C  C       G  P+  +D +    T     + ++G PN
Sbjct  389   SGKVEINHPCLQSGYKEEFMCSHCSSIHLQDGSSPTGGKDMAKGKKTG--IPVQLIGVPN  446

Query  752   WEKCKVLAMEVATNSSNLERSKVA---EQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
             W +C  LA +VA N S           E     L        +NL        +++A+SG
Sbjct  447   WAECSKLA-KVAVNLSEWSDHSPGIDCELKPCAL-------AENLP---RPAGQFYAMSG  495

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKD  423
             F+ VY   NL+  A L  + E G+  C  +W       V Q      CFR  Y+  L+++
Sbjct  496   FYVVYRFFNLTPDAALDDVLEKGREFCEMNWDAAKKSVVPQPFIEQYCFRSPYVVLLLRE  555

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGE  336
              L +++  +I G G ++W LG AL E G+
Sbjct  556   GLHITDSHVIIGSGSITWTLGVALFEAGK  584



>ref|XP_004291300.1| PREDICTED: probable apyrase 7-like [Fragaria vesca subsp. vesca]
Length=763

 Score =   237 bits (605),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 159/466 (34%), Positives = 246/466 (53%), Gaps = 37/466 (8%)
 Frame = -1

Query  1655  GYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPNNGE----FPILVNTYPG  1494
             G+  +  S+++Y    K    + +VLDCGSTG+RV +Y+   ++ E    FPI++ +   
Sbjct  124   GFLVYLVSMLVYSYWFKGEPKYYIVLDCGSTGTRVYVYQASADDNEKGNSFPIVMKSLTE  183

Query  1493  NLTRSD----GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFV  1326
              L R      G  Y  ++TEPGL   V N SGL+A++KPL++ AEK +P      T +F+
Sbjct  184   GLQRKPNAHTGRAYDRMETEPGLDKLVHNVSGLKAAIKPLVQWAEKQIPKDAHKTTSLFL  243

Query  1325  LATAGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRML  1146
              ATAG+RRLP  D+  +++    I+K   F  ++D++R +SG EEAY+GW+ALN+   M 
Sbjct  244   YATAGVRRLPSNDSKWLLDNAWSILKRSPFLCQRDWVRTISGLEEAYFGWIALNHHRGMF  303

Query  1145  GNTsgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAF  966
             G      T G LDLGGSSLQV  E +E  + +   + RIG+V H L AYSL  +G N+AF
Sbjct  304   GAGPRKPTFGSLDLGGSSLQVTFESNEHVQQDTSLKIRIGTVYHHLTAYSLAGYGLNDAF  363

Query  965   DRALAILSQTQARRES------RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssS  804
             D+++  L +             +GE+   +HPCL +G+ + + C  C  +        + 
Sbjct  364   DKSVGRLFERLPEVNKTELVNGKGEL---KHPCLQTGYKEQYICSQCVSKIQEGGPVIAK  420

Query  803   RMMTCELNS---ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQ  633
             + +     S   + ++G PNWE+C  LA  VA N S       A  +C        D + 
Sbjct  421   KNLGKGGRSGVPLKLVGAPNWEECGKLA-RVAVNLSEWSNITPA-MDCDVQPCALPDGLP  478

Query  632   NLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTD  474
               + N      + A+SGFF VY   NL+S ++L  + E G+  C R+W         Q  
Sbjct  479   RPSGN------FFAISGFFVVYRFFNLTSESSLDDVLEKGRLFCERTWEVAKKSVAPQPF  532

Query  473   ANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                 CFR  Y+A L+++ L + + +I  G G ++W  G AL+E G+
Sbjct  533   IEQYCFRAPYIAFLLREGLHIIDKQITIGSGSITWTQGVALLEAGK  578



>ref|XP_010692947.1| PREDICTED: probable apyrase 7 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   236 bits (603),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 174/494 (35%), Positives = 253/494 (51%), Gaps = 56/494 (11%)
 Frame = -1

Query  1604  SYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNLTRSDGCK---YHCVQTEP  1443
             S F VVLDCGSTG+RV IYE       N   PI++ +Y G   +  G     Y+ ++TEP
Sbjct  147   SKFYVVLDCGSTGTRVYIYEASVAHKKNSNLPIVLTSYSGAYKKPKGQSGRAYNRMETEP  206

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL   V N++GL+ ++KPL+R AEK +P      T +F+ ATAG+RRL   D+  ++   
Sbjct  207   GLDKLVRNSTGLKGAIKPLLRWAEKQIPKNSHKSTSLFLYATAGVRRLRKPDSDWILNHA  266

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQV  1083
               I+K   F  ++++I+++SG EEAYYGW+ALNY+  +LG      T G LDLGGSSLQV
Sbjct  267   WSILKSSRFSCQREWIKIISGMEEAYYGWIALNYETSVLGAMPKKPTFGALDLGGSSLQV  326

Query  1082  VTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAILSQTQARRESR  915
               E  E  +++      IG V H L AYSL  +G N+AFD++    L  + +      + 
Sbjct  327   TFESKEPVQNKTNLNLSIGPVNHHLSAYSLSGYGLNDAFDKSVVHLLKGMPKVTKEDLAH  386

Query  914   GEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS-------ILVLGDP  756
             G + ++RHPCL SG+   ++C  C      + E  S R    +L         + ++G P
Sbjct  387   GNV-EIRHPCLHSGYKSEYSCSQC---ASLNQEAGSPRYGEKDLGKGGKPGVPVWLIGAP  442

Query  755   NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNS---HEVTRYHAL  588
             NW +C  +A +VA N S               LS G D  +Q   L+    H   ++ A+
Sbjct  443   NWSECSAVA-KVAVNLSEWSD-----------LSPGIDCDVQPCALSEDLPHPRGQFFAM  490

Query  587   SGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLI  429
             SGFF VY   NLSS A L  + E G   C ++W         Q      CFR  Y  SL+
Sbjct  491   SGFFVVYRFFNLSSEATLDDVLEKGHQYCDQTWEVAYKSVPPQPFIEQYCFRAPYTVSLL  550

Query  428   KDALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLF  249
             ++ L +++ +I+ G G  +W  G AL+E G+     A  +R +  + Q   M    + LF
Sbjct  551   REGLHITDGQIMIGSGGTTWTQGVALVEAGK-----AFATRTELHSLQLFEMKIDPVILF  605

Query  248   -------IVLVCVL  228
                     VLVC L
Sbjct  606   AVLLISSFVLVCAL  619



>ref|XP_009588053.1| PREDICTED: probable apyrase 7 [Nicotiana tomentosiformis]
 ref|XP_009588054.1| PREDICTED: probable apyrase 7 [Nicotiana tomentosiformis]
 ref|XP_009588055.1| PREDICTED: probable apyrase 7 [Nicotiana tomentosiformis]
Length=766

 Score =   236 bits (602),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 159/487 (33%), Positives = 255/487 (52%), Gaps = 42/487 (9%)
 Frame = -1

Query  1604  SYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTRSD----GCKYHCVQTE  1446
             S F VVLDCGSTG+RV +Y+  PN   + + PI++ + P    R+     G  Y+ ++TE
Sbjct  145   SKFYVVLDCGSTGTRVYVYQSSPNYKKDSDLPIVLRSLPEGFQRNSRLQSGRAYNRMETE  204

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PG    V N SGLR ++KPLI+ A K +P      T +++ ATAG+RRLP  D+  ++  
Sbjct  205   PGFDKLVHNTSGLRKAIKPLIKWAVKQIPKHAHKSTYLYLYATAGVRRLPNSDSEWLLNN  264

Query  1265  VVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQ  1086
                I+K   F  ++++++ ++G EEAYYGW+A+NY   +LG      T G LDLGGSSLQ
Sbjct  265   AWSILKSSPFTCKREWVKTITGMEEAYYGWIAMNYHTGILGAKPKKGTFGALDLGGSSLQ  324

Query  1085  VVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI  906
             V  E  E   DE      IG+V H L AYSL  +G N+AFD+++  L ++  +  S  ++
Sbjct  325   VTFESKENLPDETSLELNIGAVNHHLTAYSLAGYGLNDAFDKSVVQLLKSLPKI-SNADL  383

Query  905   ----FKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS----ILVLGDPNW  750
                  +++HPCL+SG+ + + C  C          ++ R ++ +       + ++G P W
Sbjct  384   TSGNLEIKHPCLNSGYKEQYICTHCVSLYQEGGNPTTGREVSGKGGKPGVRVQLVGAPKW  443

Query  749   EKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH---EVTRYHALSGF  579
             E+C  LA +VA N S     K    +C          +Q   L  +      +++A+SGF
Sbjct  444   EECNSLA-KVAVNLSEWS-GKNPGIDC---------ELQPCALAENLPRPYGQFYAMSGF  492

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDA  420
             + VY   NL+  A L  + E GQ  C ++W         Q      CFR  Y+  L+++ 
Sbjct  493   YVVYRFFNLTPDAALDDVLEKGQEFCEKTWDVAKTSVAPQPFIEQYCFRAPYVVFLLREG  552

Query  419   LCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVL  240
             L +++ ++  G G ++W LG AL+E G+     A  +  + ++ +   M    I LF +L
Sbjct  553   LHITDSQVTIGSGSITWTLGVALLEAGK-----AVSTGVELISYKLLLMKMHPIILFAIL  607

Query  239   VCVLMIV  219
                L ++
Sbjct  608   FASLAVL  614



>ref|XP_009804492.1| PREDICTED: probable apyrase 7 [Nicotiana sylvestris]
Length=766

 Score =   235 bits (600),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 160/487 (33%), Positives = 252/487 (52%), Gaps = 42/487 (9%)
 Frame = -1

Query  1604  SYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTRSD----GCKYHCVQTE  1446
             S F VVLDCGSTG+RV +Y+  PN   + + PI++ + P    R+     G  Y+ ++TE
Sbjct  145   SKFYVVLDCGSTGTRVYVYQSSPNYKKDSDLPIVLRSLPEGFQRNSRLQSGRAYNRMETE  204

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PG    V N SGLR ++KPLI+ A K +P      T +++ ATAG+RRLP  D+  ++  
Sbjct  205   PGFDKLVHNTSGLRKAIKPLIKWAVKQIPKHAHKSTYLYLYATAGVRRLPNSDSEWLLNN  264

Query  1265  VVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQ  1086
                I+K   F  ++++++ ++G EEAYYGW+A+NY   +LG      T G LDLGGSSLQ
Sbjct  265   AWSILKSSPFMCKREWVKTITGMEEAYYGWIAMNYHTGILGAKPKKGTFGALDLGGSSLQ  324

Query  1085  VVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA----LAILSQTQARRES  918
             V  E  E   DE      IG+V H L AYSL  +G N+AFD++    L  L +      +
Sbjct  325   VTFESKENLPDETSLELNIGAVNHHLTAYSLAGYGLNDAFDKSVVQLLKRLPKISNADLT  384

Query  917   RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS----ILVLGDPNW  750
              G I +++HPCL+SG+ + + C  C          ++ R ++ +       + ++G P W
Sbjct  385   SGNI-EIKHPCLNSGYKEQYICTHCVSLYQEGGNPTTGREVSGKGGKPGVRVQLVGAPKW  443

Query  749   EKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH---EVTRYHALSGF  579
             E+C  LA +VA N S     K    +C          +Q   L  +      +++ +SGF
Sbjct  444   EECNSLA-KVAVNLSEWS-GKNPGIDC---------ELQPCALAENLPRPYGQFYGMSGF  492

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDA  420
             + VY   NL+  A L  + E GQ  C ++W         Q      CFR  Y+  L+++ 
Sbjct  493   YVVYRFFNLTPDAALDDVLEKGQEFCEKTWDIAKTSVAPQPFIEQYCFRAPYVVFLLREG  552

Query  419   LCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVL  240
             L +++ ++  G G ++W LG AL+E G+     A  +  + ++ +   M    I LF +L
Sbjct  553   LHITDSQVTIGSGSITWTLGVALLEAGK-----AVSTGVEFISYKLLLMKMHPIILFAIL  607

Query  239   VCVLMIV  219
                L ++
Sbjct  608   FASLAVL  614



>ref|XP_004239949.1| PREDICTED: probable apyrase 7 [Solanum lycopersicum]
Length=766

 Score =   235 bits (599),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 156/451 (35%), Positives = 245/451 (54%), Gaps = 39/451 (9%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPGNLTRSD----GCKYHCVQ  1452
             R S + VVLDCGSTG+RV +Y+  PN   + + PI++ + P +  R+     G  Y+ ++
Sbjct  143   RDSKYYVVLDCGSTGTRVYVYQASPNYVKDNDLPIVLRSLPESFQRNSRLQSGRAYNRME  202

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
             TEPG    V N +GL+ ++KPLI+ A K +P      T +++ ATAG+RRLP  D+  ++
Sbjct  203   TEPGFDKLVHNTTGLKRAIKPLIKWAAKQIPRHAHKTTYLYLHATAGVRRLPNSDSEWLL  262

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggss  1092
                  I+K   F  ++++++ ++G EEAY+GW+A+NY   +LG      T G LDLGGSS
Sbjct  263   NNAWSILKSSPFLCKREWVKTITGMEEAYFGWIAMNYHTGVLGAKPKKGTFGALDLGGSS  322

Query  1091  LQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE---  921
             LQV  E      DE      IG+V H L AYSL+ +G N+AFD+++  L +   +     
Sbjct  323   LQVTFESKGSLPDETSLELNIGAVNHHLTAYSLEGYGLNDAFDKSVVQLVKRLPKISDAD  382

Query  920   -SRGEIFKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSRMMTCELNSILVLGD  759
              + G I +++HPCL+SG+ + + C  CF     G  PSS  + +S+     +   LV G 
Sbjct  383   LTSGNI-EIKHPCLNSGYKEQYICTHCFSLYQEGGNPSSGREVASKGGKPGVRVQLV-GA  440

Query  758   PNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH---EVTRYHAL  588
             P WE+C  LA + A N S    +K +  +C          +Q   L  +      +++A+
Sbjct  441   PKWEECSSLA-KFAVNISEWS-NKSSGIDC---------ELQPCALAENLPRPFGQFYAM  489

Query  587   SGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLI  429
             SGFF VY   NL+  A L  + E G+  C ++W         Q      CFR  Y+ SL+
Sbjct  490   SGFFVVYRFFNLTPDAALDDVLEKGREFCDKTWDVAKTSVAPQPFIEQYCFRAPYIVSLL  549

Query  428   KDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             ++ L +++ ++  G G ++W LG AL E G+
Sbjct  550   REGLHITDSQVTIGSGSITWTLGVALSEAGK  580



>gb|EMT02116.1| Ectonucleoside triphosphate diphosphohydrolase 8 [Aegilops tauschii]
Length=608

 Score =   230 bits (586),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 146/439 (33%), Positives = 238/439 (54%), Gaps = 37/439 (8%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE---FPILVNTYPGNLTRSDGCK----  1467
             +++ + +S + V+LDCGSTG+RV +YEW  N+ +   FPI +    GN  +    K    
Sbjct  91    VFLSEGSSEYYVILDCGSTGTRVYVYEWSINHNDGNSFPIALKPL-GNAPKKKSGKLIGR  149

Query  1466  -YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPGL+  V N +G++ +++PL++ AE+ +P      TP+F+ ATAG+R+LP  
Sbjct  150   AYQRMETEPGLSKLVHNETGMKKAIEPLLQMAERQIPRRAHKHTPVFLYATAGVRKLPTA  209

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +M+    ++K   F   +D ++++SG EEAYYGWVALN+ + MLG +S +  +   
Sbjct  210   DSEWLMDKAWDVLKNSSFSCSRDRVKIISGMEEAYYGWVALNHHLNMLGTSSSASEMTYG  269

Query  1109  dlgg--ssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
              L    SSLQV  E D+  + +      IGSV H+L AYSL  +G N+AFD+++A L + 
Sbjct  270   SLDLGGSSLQVTFETDKAVQGDTGVGLTIGSVNHQLSAYSLSGYGLNDAFDKSVAHLVKM  329

Query  935   QARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN--SILVLG  762
                    G++ +V+HPCL +G+ +++ C  C   K   S   S++    E    ++ ++G
Sbjct  330   LGGTAGNGKV-QVKHPCLQTGYREDYVCSYCQPLKQDGSPSVSAKTTGKEKQGTAVELIG  388

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNS---HEVTRYH  594
              P W++C  LA +V  N S    S           S G D  +Q   L S       +++
Sbjct  389   APQWKECSDLA-KVTVNLSEWSNS-----------SSGLDCNLQPCALASTFPQPHGQFY  436

Query  593   ALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMAS  435
             A+SGF+ V+   NL+  A L  + + GQ  C + W         Q      CFR  Y+ S
Sbjct  437   AMSGFYVVFKFFNLTPDATLVDVLKRGQEFCEKPWDVARSSVPPQPFIEQYCFRAPYITS  496

Query  434   LIKDALCLSNLEIIFGPGD  378
             L+++ L + + ++I G GD
Sbjct  497   LLREGLQIKDNQVIIGSGD  515



>gb|AET03506.2| GDA1/CD39 nucleoside phosphatase family protein [Medicago truncatula]
Length=727

 Score =   231 bits (589),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 167/456 (37%), Positives = 240/456 (53%), Gaps = 52/456 (11%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIY--EWMPNNGE---FPILVNTYPGNLTRSDGCK----YHCVQTE  1446
             + VVLD GSTG+RV +Y  E      E    PI V +    L +  G +    Y  ++TE
Sbjct  102   YYVVLDSGSTGTRVYVYKAEIQTQKNEHTSLPISVTSLRNGLKKKSGSQSGRAYDRMETE  161

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PGL   V N +GL+ +LKPL++ A K +P      T +F+ ATAG+RRLP ED+  +++ 
Sbjct  162   PGLDKLVHNVTGLKGALKPLLKWAMKQIPEDFHKSTSLFLYATAGVRRLPNEDSKWLLDN  221

Query  1265  VVGIV-KEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssL  1089
                +V K  GF  RKD+++++SG EEAY+GW+ALNY   +LG      T G LDLGGSSL
Sbjct  222   AWNVVRKSSGFACRKDWVKIISGTEEAYFGWIALNYDSGILGVKPRKDTYGALDLGGSSL  281

Query  1088  QVVTEIDEFR-EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRG  912
             QV  E D+ R   E     RIG V H L AYSL  +G NEAFD+++A +     ++   G
Sbjct  282   QVTFESDQERLNGETSLFVRIGDVNHHLTAYSLAGYGLNEAFDKSVAYV----FKKGKVG  337

Query  911   EIFKVRHPCLSSGFVQNHTC-------RGCFGQKPsssedssSRMMTCEL-----NSILV  768
                 V+HPCL +GF   +TC       RG  G+ P  +   S  ++           + +
Sbjct  338   LGGVVKHPCLQNGFKNQYTCSRCLVGERGNGGESPKVNGSGSGNVVGGGGKVVMKTPVTL  397

Query  767   LGDPNWEKCKVLAMEVATNSSNLERSKVA-----EQNCVGLLSYGSDRMQNLTLNSHEVT  603
             +G PNW++C  +A +VA N S  E S V      E N   L        +NL      + 
Sbjct  398   VGAPNWQECSAIA-KVAVNLS--EWSDVGQGLDCEVNPCAL-------RENL---PRPLG  444

Query  602   RYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILY  444
              ++ +SGFF VY   NL+S A +  + E G+  C + W         Q      CFR  Y
Sbjct  445   HFYVISGFFVVYRFFNLTSEATIDDVLEKGREFCEKKWDVAKKSVAPQPFIEQYCFRGPY  504

Query  443   MASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             +ASL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  505   VASLLREGLHITDRHITVGSGSITWTLGVALLEAGK  540



>ref|XP_003629030.1| Ectonucleoside triphosphate diphosphohydrolase [Medicago truncatula]
Length=760

 Score =   231 bits (589),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 167/456 (37%), Positives = 240/456 (53%), Gaps = 52/456 (11%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIY--EWMPNNGE---FPILVNTYPGNLTRSDGCK----YHCVQTE  1446
             + VVLD GSTG+RV +Y  E      E    PI V +    L +  G +    Y  ++TE
Sbjct  102   YYVVLDSGSTGTRVYVYKAEIQTQKNEHTSLPISVTSLRNGLKKKSGSQSGRAYDRMETE  161

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PGL   V N +GL+ +LKPL++ A K +P      T +F+ ATAG+RRLP ED+  +++ 
Sbjct  162   PGLDKLVHNVTGLKGALKPLLKWAMKQIPEDFHKSTSLFLYATAGVRRLPNEDSKWLLDN  221

Query  1265  VVGIV-KEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssL  1089
                +V K  GF  RKD+++++SG EEAY+GW+ALNY   +LG      T G LDLGGSSL
Sbjct  222   AWNVVRKSSGFACRKDWVKIISGTEEAYFGWIALNYDSGILGVKPRKDTYGALDLGGSSL  281

Query  1088  QVVTEIDEFR-EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRG  912
             QV  E D+ R   E     RIG V H L AYSL  +G NEAFD+++A +     ++   G
Sbjct  282   QVTFESDQERLNGETSLFVRIGDVNHHLTAYSLAGYGLNEAFDKSVAYV----FKKGKVG  337

Query  911   EIFKVRHPCLSSGFVQNHTC-------RGCFGQKPsssedssSRMMTCEL-----NSILV  768
                 V+HPCL +GF   +TC       RG  G+ P  +   S  ++           + +
Sbjct  338   LGGVVKHPCLQNGFKNQYTCSRCLVGERGNGGESPKVNGSGSGNVVGGGGKVVMKTPVTL  397

Query  767   LGDPNWEKCKVLAMEVATNSSNLERSKVA-----EQNCVGLLSYGSDRMQNLTLNSHEVT  603
             +G PNW++C  +A +VA N S  E S V      E N   L        +NL      + 
Sbjct  398   VGAPNWQECSAIA-KVAVNLS--EWSDVGQGLDCEVNPCAL-------RENL---PRPLG  444

Query  602   RYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILY  444
              ++ +SGFF VY   NL+S A +  + E G+  C + W         Q      CFR  Y
Sbjct  445   HFYVISGFFVVYRFFNLTSEATIDDVLEKGREFCEKKWDVAKKSVAPQPFIEQYCFRGPY  504

Query  443   MASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             +ASL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  505   VASLLREGLHITDRHITVGSGSITWTLGVALLEAGK  540



>ref|XP_009136998.1| PREDICTED: LOW QUALITY PROTEIN: probable apyrase 7 [Brassica 
rapa]
Length=723

 Score =   230 bits (586),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 157/441 (36%), Positives = 236/441 (54%), Gaps = 35/441 (8%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPNN---GEFPILVNTYPGNLTR-SDGCKYHCVQTEPG  1440
              S + VV DCGSTG+R  +Y    N       PI++ +     +R + G  Y  ++TEPG
Sbjct  141   GSRYYVVFDCGSTGTRAYVYRASINYRKVSSLPIVMKSLTEGFSRKTSGRAYDRMETEPG  200

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
                 V N SGL+ ++KPLI+ AEK +P      T +FV ATAG+RRL   D+S ++  V 
Sbjct  201   FDKLVNNRSGLKTAIKPLIQWAEKQIPKHAHRTTSLFVYATAGVRRLRATDSSWLLGNVW  260

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              ++ +  F  R+++++++SG  EAY+GW ALNY+  MLG      T G LDLGGSSLQV 
Sbjct  261   FVLAKSPFTCRREWVKIISGTXEAYFGWTALNYQTSMLGAVPKKATFGALDLGGSSLQVT  320

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA---RRESRGE  909
              E +E   +E     RIGSV H L  YSL  +G N+ F+ ++  L + Q    + +  G 
Sbjct  321   FENEEQTHNETNLNLRIGSVNHHLSVYSLAGYGLNDVFEWSVVNLIKRQTYVNKSDLIGG  380

Query  908   IFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLA  729
               +++HPCL+SG+   + C  C    PS     + +        I ++G PNW +C  LA
Sbjct  381   KLEMKHPCLNSGYKGQYICSQC---APSVRRRKNGKTGV----PIKLVGAPNWGECSALA  433

Query  728   MEVATNS--SNLERSKVAE-QNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNML  558
               V  +S  SN E     + Q C   L  G  R            +++A+SGFF VY   
Sbjct  434   KIVVNSSEWSNTEHGADCDLQPCA--LPDGYPRPHG---------QFYAVSGFFVVYRFF  482

Query  557   NLSSRANLTKMWETGQGLCSRSW-VDQTDANG------LCFRILYMASLIKDALCLSNLE  399
             NLS  A+L  + E G+  C ++W V +T  +        CFR  Y+ SL+++ L +++ +
Sbjct  483   NLSVEASLDDVLERGRDFCEKAWQVTRTSVSPQPFIEQYCFRAPYIVSLLREGLYITDKQ  542

Query  398   IIFGPGDVSWALGAALIEGGE  336
             I+ G G ++W LG AL+E G+
Sbjct  543   IVIGSGSITWTLGVALLEAGK  563



>ref|XP_003517106.1| PREDICTED: probable apyrase 7-like isoformX1 [Glycine max]
 ref|XP_006573501.1| PREDICTED: probable apyrase 7-like isoform X2 [Glycine max]
Length=690

 Score =   229 bits (583),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 151/446 (34%), Positives = 230/446 (52%), Gaps = 33/446 (7%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTY--PGNLTRSDGCKYHC  1458
             +    ++ + VVLDCGSTG+RV +Y        +   PI + +   P +     G  Y  
Sbjct  74    WAHASSAKYYVVLDCGSTGTRVYVYRASVRFNRHTTLPIAITSLRNPSHKKPPTGRAYDR  133

Query  1457  VQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASR  1278
             ++TEPG+   V N SGL  +LKPL+R A+K +P      T +F+ ATAG+RRLP+ D+  
Sbjct  134   IETEPGIDKLVNNVSGLNNALKPLLRWAKKQIPVRAHKSTFLFLYATAGVRRLPVSDSRW  193

Query  1277  VMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlgg  1098
             +++    ++K+  F  ++D+++ + G EEAY+GW+ALNY   +LG      T G LDLGG
Sbjct  194   LLDNAWSVLKDSPFVCQRDWVKTILGPEEAYFGWIALNYDSGILGVRPRKATYGALDLGG  253

Query  1097  ssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQ-----  933
             SSLQV  E D+    E     RIGSV H L AYSL  +G NEAF +++  L + +     
Sbjct  254   SSLQVTFESDQQLNSETSLYVRIGSVSHHLTAYSLPGYGLNEAFGKSVVYLFRKEFGLGD  313

Query  932   ARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPN  753
                 S G I +++HPCL  G+ + + C  C   K                  ++++G PN
Sbjct  314   VDVGSGGNI-ELKHPCLQEGYREEYLCSRCLSSK-------KGGNGGFGGTPLVLVGAPN  365

Query  752   WEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFA  573
             W +C  LA +VA N S       A  +C        D +            ++ +SGF+ 
Sbjct  366   WGECSTLA-KVAVNLSEWS-DHGAGLDCGAQPCALGDNL------PRPYGHFYVISGFYV  417

Query  572   VYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALC  414
             VY   NL+S A L  +   G+G C + W         Q      CFR  Y+ASL+++ L 
Sbjct  418   VYRFFNLTSEATLDDVLVRGKGFCGKRWDVAKRSVAPQPFIEQYCFRAPYIASLLREGLH  477

Query  413   LSNLEIIFGPGDVSWALGAALIEGGE  336
             +++ +I  G G+++W LG AL+E G+
Sbjct  478   INDNQITVGSGNITWTLGVALLEAGK  503



>ref|XP_003547875.1| PREDICTED: probable apyrase 7-like [Glycine max]
Length=717

 Score =   229 bits (584),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 158/466 (34%), Positives = 243/466 (52%), Gaps = 50/466 (11%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE----FPILVNTYPGNLTR--SDGCKY  1464
             LY    +  + VVLDCGSTG+RV +Y     + +     PI + +    L +  S G  Y
Sbjct  79    LYSHHSSPKYYVVLDCGSTGTRVYVYRAQIQHNDKKTTLPISIQSLKDGLRKNPSSGRAY  138

Query  1463  HCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDA  1284
               ++TEPGL   + N +GL+ +L PL++ A+K +P      T +F+ ATAG+RRLP +D+
Sbjct  139   DRMETEPGLDKLLHNRTGLKTALVPLLKWAQKQIPETSHKTTSLFLYATAGVRRLPFDDS  198

Query  1283  SRVMEGVVGIVKEHG-FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
               +++     +K    F  ++D+++++SG EEAY+GW+ALNY   +LG      T G LD
Sbjct  199   KWLLDNAWSFLKSSSPFVCKRDWVKIISGTEEAYFGWIALNYDSGILGVKPRRETYGALD  258

Query  1106  lggssLQVVTEIDEFREDEHVFRS------RIGSVEHKLLAYSLQAFGFNEAFDRALA-I  948
             LGGSSLQV  E +  +E +H+F S      RIGSV H L AYSL  +G NEAFD+++A +
Sbjct  259   LGGSSLQVTFEGNSNKEPQHLFNSETSLYVRIGSVNHHLTAYSLAGYGLNEAFDKSVAHV  318

Query  947   LSQTQARRES--RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS-  777
               +     E   +G + +V+HPCL  G+ + ++C  C     SS+       +  E N  
Sbjct  319   FKEFGYGMEDVVKGNL-EVKHPCLQIGYKERYSCSHC-----SSAVKKGGESLMVEGNGN  372

Query  776   ------------ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQ  633
                         + ++G PNW KC  LA +VA N S     +      V   +   +  Q
Sbjct  373   VVGKKEGGSRTVVTLVGAPNWLKCSTLA-KVAVNLSEWSDVRPGLDCEVHPCALRGNLPQ  431

Query  632   NLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTD  474
              +         ++ +SGFF VY   NL++ A L  + E G+  C + W         Q  
Sbjct  432   PM-------GHFYVISGFFVVYRFFNLTAEATLEDVLEKGREFCDKRWDVARKSVAPQPF  484

Query  473   ANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
                 CFR  Y+ASL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  485   IEQYCFRAPYIASLLREGLHITDKHITVGSGSITWTLGVALLEAGK  530



>ref|XP_007158059.1| hypothetical protein PHAVU_002G120700g [Phaseolus vulgaris]
 ref|XP_007158060.1| hypothetical protein PHAVU_002G120700g [Phaseolus vulgaris]
 gb|ESW30053.1| hypothetical protein PHAVU_002G120700g [Phaseolus vulgaris]
 gb|ESW30054.1| hypothetical protein PHAVU_002G120700g [Phaseolus vulgaris]
Length=705

 Score =   229 bits (583),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 156/438 (36%), Positives = 229/438 (52%), Gaps = 30/438 (7%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEW---MPNNGEFPILVNTYPGNL-TRSDGCKYHCVQTEPGLAM  1431
             + VVLDCGSTG+RV +Y            PI V +    L  +  G  Y  V+TEPG+  
Sbjct  94    YYVVLDCGSTGTRVYVYHASIRFQRRSSLPIAVKSLRNTLHKKPSGRAYDRVETEPGIDK  153

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
              V N SGL  +LKPL+R A+K +P      T +F+ ATAG+RRLP+ D++ +++    ++
Sbjct  154   LVRNVSGLNNALKPLLRWAKKQIPVHAHKSTSLFLYATAGVRRLPVIDSTWLLDNAWSVL  213

Query  1250  KEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEI  1071
             K   F   +D+++++SG EEAY+GW+ALNY   +LG      T G LDLGGSSLQV  E 
Sbjct  214   KNSPFVCERDWVKIISGPEEAYFGWIALNYDSGILGVRPRKATYGALDLGGSSLQVTFES  273

Query  1070  DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQ-----ARRESRGEI  906
             DE    E      IGSV H L AYSL  +G NEAF +++  L + +         S G I
Sbjct  274   DEQMNSETSLYVSIGSVSHHLTAYSLPGYGLNEAFGKSVEYLYRKEFALGNVDVGSGGNI  333

Query  905   FKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAM  726
              +++HPCL  G+   + C  C        E      +   L   +++G PNW++C  LA 
Sbjct  334   -ELKHPCLQDGYRDEYFCSRCSSNNKGGKELGGDGGVGTPL---VLVGAPNWKECSALA-  388

Query  725   EVATNSSNLERSKV-AEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLS  549
             +VA N S  E S + A  +C        D +            ++ +SGF+ VY   NL+
Sbjct  389   KVAVNLS--EWSDLGAGLDCGAQPCALRDNL------PRPYGHFYVISGFYVVYRFFNLT  440

Query  548   SRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSNLEIIF  390
             S A L  +   G+  C + W         Q      CFR  Y+ASL+++ L +++ +I  
Sbjct  441   SEATLDDVLAKGKNFCEKRWDVAKKNVAPQPFIEQYCFRAPYIASLLREGLHINDNQITV  500

Query  389   GPGDVSWALGAALIEGGE  336
             G G+++W LG AL+E G+
Sbjct  501   GSGNITWTLGVALLEAGK  518



>gb|KHN12488.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Glycine soja]
Length=714

 Score =   226 bits (577),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 157/464 (34%), Positives = 241/464 (52%), Gaps = 49/464 (11%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE----FPILVNTYPGNLTRSDGCKYHC  1458
             LY    +  + VVLDCGSTG+RV +Y     + +     PI + +    L  S G  Y  
Sbjct  79    LYSHHSSPKYYVVLDCGSTGTRVYVYRAQIQHNDKKTTLPISIQSLKDGLP-SSGRAYDR  137

Query  1457  VQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASR  1278
             ++TEPGL   + N +GL+ +L PL++ A+K +P      T +F+ ATAG+RRLP +D+  
Sbjct  138   METEPGLDKLLHNRTGLKTALVPLLKWAQKQIPETSHKTTSLFLYATAGVRRLPFDDSKW  197

Query  1277  VMEGVVGIVKEHG-FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlg  1101
             +++     +K    F  ++D+++++SG EEAY+GW+ALNY   +LG      T G LDLG
Sbjct  198   LLDNAWSFLKSSSPFVCKRDWVKIISGTEEAYFGWIALNYDSGILGVKPRRETYGALDLG  257

Query  1100  gssLQVVTEIDEFREDEHVFRS------RIGSVEHKLLAYSLQAFGFNEAFDRALA-ILS  942
             GSSLQV  E +  +E + +F S      RIGSV H L AYSL  +G NEAFD+++A +  
Sbjct  258   GSSLQVTFEGNSNKEPQQLFNSETSLYVRIGSVNHHLTAYSLAGYGLNEAFDKSVAHVFK  317

Query  941   QTQARRES--RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS---  777
             +     E   +G + +V+HPCL  G+ + ++C  C     SS+       +  E N    
Sbjct  318   EFGYGMEDVVKGNL-EVKHPCLQIGYKERYSCSHC-----SSAVKKGGESLMVEGNGNVV  371

Query  776   ----------ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNL  627
                       + ++G PNW KC  LA +VA N S     +      V   +   +  Q +
Sbjct  372   GKKEGGSRTVVTLVGAPNWLKCSTLA-KVAVNLSEWSDVRPGLDCEVHPCALRGNLPQPM  430

Query  626   TLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDAN  468
                      ++ +SGFF VY   NL++ A L  + E G+  C + W         Q    
Sbjct  431   -------GHFYVISGFFVVYRFFNLTAEATLEDVLEKGREFCDKRWDVARKSVAPQPFIE  483

Query  467   GLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
               CFR  Y+ASL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  484   QYCFRAPYIASLLREGLHITDKHITVGSGSITWTLGVALLEAGK  527



>ref|XP_006599123.1| PREDICTED: probable apyrase 7-like isoform X3 [Glycine max]
Length=645

 Score =   224 bits (570),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 157/464 (34%), Positives = 242/464 (52%), Gaps = 44/464 (9%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIY--EWMPNNGE--FPILVNTYPGNLTR--SDGCKY  1464
             LY    +  + VVLDCGSTG+RV +Y  +  PN+ +   PI + +    L +  S G  Y
Sbjct  89    LYSHHSSPKYYVVLDCGSTGTRVYVYKAQIQPNDQKTTLPISIESLKDGLRKNPSSGRAY  148

Query  1463  HCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDA  1284
               ++TEPGL   + N +GL+ +L+PL++ A+K +P      T +F+ ATAG+RRLP +D+
Sbjct  149   DRMETEPGLDKLLHNRTGLKTALEPLLKWAQKQIPETSHKTTSLFLYATAGVRRLPFDDS  208

Query  1283  SRVMEGVVGIVKEHG-FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
               +++     +K    F  ++D+++++SG EEAY GW+ALNY   +LG      T G LD
Sbjct  209   KWLLDNAWSFLKSSSPFVCKRDWVKIISGTEEAYLGWIALNYDSGILGVKPRKETYGALD  268

Query  1106  lggssLQVVTEIDEFRED--------EHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA  951
             LGGSSLQV  E +  +E         E     RIGS+ H L AYSL  +G NEAFD+++A
Sbjct  269   LGGSSLQVTFEGNRNKEQQNQQLLNSETSLYVRIGSMNHHLTAYSLAGYGLNEAFDKSVA  328

Query  950   ILSQTQARRESRGEIFK----VRHPCLSSGFVQNHTCRGCF------GQKPsss-edssS  804
              + +         ++FK    V HPCL SG+ + ++C  C       G+ P+     +  
Sbjct  329   YVFKKYGY--GMEDVFKGNVEVNHPCLQSGYKERYSCSHCSNAVKKGGESPTVEGNGNVL  386

Query  803   RMMTCELNSILVL-GDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNL  627
                   L +++ L G PNW +C  LA +VA N S     +    +C        D +   
Sbjct  387   GKKDGGLRTVVTLIGAPNWLECSALA-KVAVNLSEWSDVRPG-MDCEVHPCALRDNL---  441

Query  626   TLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDAN  468
                   +  ++ +SGFF VY   NL++ A L  + E G+  C + W         Q    
Sbjct  442   ---PRPMGHFYVISGFFVVYRFFNLTAEATLEDVLEKGREFCEKRWDVARKSVAPQPFIE  498

Query  467   GLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
               CFR  Y+ASL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  499   QYCFRAPYIASLLREGLHITDKHITVGSGSITWTLGVALLEAGK  542



>ref|XP_003538924.1| PREDICTED: probable apyrase 7-like [Glycine max]
Length=695

 Score =   224 bits (570),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 154/449 (34%), Positives = 233/449 (52%), Gaps = 35/449 (8%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEW---MPNNGEFPILV----NTYPGNLTRSD--GC  1470
             Y    ++ + VVLDCGSTG+RV +Y        +   PI V    N  P N  +    G 
Sbjct  75    YWNHGSAKYYVVLDCGSTGTRVYVYRASVRFNRHTTLPIAVTSLRNASPKNNKKKPPTGR  134

Query  1469  KYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  ++TEPG+   V N SGL  +LKPL+R A+K +P      T +F+ ATAG+RRLP+ 
Sbjct  135   AYDRIETEPGIDKLVNNVSGLNNALKPLLRWAKKQIPVRAHRSTFLFLYATAGVRRLPVS  194

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
             D+  +++    ++K+  F  ++D+++++SG EEAY+GW+ALNY   +LG      T G L
Sbjct  195   DSRWLLDNAWSVLKDSPFVCQRDWVKIISGPEEAYFGWIALNYDGGILGVRPRKATYGAL  254

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             DLGGSSLQV  E D+    E     RIGSV H L AYSL  +G NEAF +++  L + + 
Sbjct  255   DLGGSSLQVTFESDQQLNSETSLYVRIGSVSHHLTAYSLPGYGLNEAFGKSVVYLFRKEF  314

Query  929   RRES----RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
                +     G   +++HPCL  G+ + ++C          S              ++++G
Sbjct  315   GSGNVDVGSGGNVELKHPCLQDGYREEYSCS-------RCSSSKKGGNGGLGGTQLVLVG  367

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
              PNW +C  LA +VA N S       A  +C        D +       H    ++ +SG
Sbjct  368   APNWGECSALA-KVAVNLSEWT-DLGAGLDCGAQPCALGDNL------PHPYGHFYVISG  419

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKD  423
             F+ VY   NL+S A L  +   G+G C + W         Q      CFR  Y+ASL+++
Sbjct  420   FYVVYRFFNLTSEATLDDVLAKGKGFCEKRWDVAKRSVAPQPFIEQYCFRAPYIASLLRE  479

Query  422   ALCLSNLEIIFGPGDVSWALGAALIEGGE  336
              L +++ +I  G G+++W LG AL+E G+
Sbjct  480   GLHINDNQITVGSGNITWTLGVALLEAGK  508



>ref|XP_001778140.1| predicted protein [Physcomitrella patens]
 gb|EDQ57030.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   218 bits (556),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 149/455 (33%), Positives = 230/455 (51%), Gaps = 44/455 (10%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE-FPILV----NTY----PGNLTRSDGC  1470
             Y+ +    F +VLD GSTG+RV+++ W  +  +  P++V    NT+    P  +      
Sbjct  38    YLHRETLQFAIVLDGGSTGTRVHVHGWARSPKDPLPVMVDPTTNTHMPGAPMQVVNGQQR  97

Query  1469  KYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
              Y  V+TEPGL     N +G+ ++L PL+  A + +P      T IF+LATAG+R+LP E
Sbjct  98    LYKRVETEPGLDKLYHNRTGIESALGPLLDWAGRHIPRHAYPNTQIFLLATAGLRKLPKE  157

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
              +  ++E    ++ +  F  ++  ++V+ G EEAYYGW+ALNYK   LGN       G L
Sbjct  158   QSDWILEQAWTVLAKSPFRCKRSSVKVIKGIEEAYYGWIALNYKFGRLGNVPRKSNYGTL  217

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQ-  933
             DLGGSSL+V  E  +  + +H     +GS +H L A S   FG N+AF++++A+L +++ 
Sbjct  218   DLGGSSLEVTFEPRDVPQGDHGMNLSVGSTDHHLYAASHAGFGLNDAFEKSVAVLLRSRN  277

Query  932   ----ARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMT---CELNSI  774
                 +R+     +  V HPCL +G+  +  C       P  S  S  +  +     +  I
Sbjct  278   VTKMSRKGRNSNVVDVEHPCLQTGYRAHFKCSTHCVLPPLPSRGSGRKAPSTGEATVAQI  337

Query  773   LVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEV---T  603
              ++G PNW+ C+ LA ++  +SS         Q C          +    L  H+     
Sbjct  338   ELVGAPNWDACQALAEDIINSSS--------AQGCT---------LPPCALGKHQPYPQG  380

Query  602   RYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW------VD-QTDANGLCFRILY  444
              ++ L+GF+ VY    LS  A L  +   GQ  C   W      VD Q      CFR  Y
Sbjct  381   TFYGLAGFYVVYKFFGLSQSAPLDDLLAKGQDFCKLPWKEAERSVDPQPSIEQYCFRSPY  440

Query  443   MASLIKDALCLSNLEIIFGPGDVSWALGAALIEGG  339
             +++L++D L L + +I  G GD SW LGAAL E G
Sbjct  441   VSALLRDGLHLQDNQIQIGSGDFSWTLGAALWEAG  475



>ref|XP_006599122.1| PREDICTED: probable apyrase 7-like isoform X2 [Glycine max]
Length=687

 Score =   223 bits (567),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 157/464 (34%), Positives = 242/464 (52%), Gaps = 44/464 (9%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIY--EWMPNNGE--FPILVNTYPGNLTR--SDGCKY  1464
             LY    +  + VVLDCGSTG+RV +Y  +  PN+ +   PI + +    L +  S G  Y
Sbjct  89    LYSHHSSPKYYVVLDCGSTGTRVYVYKAQIQPNDQKTTLPISIESLKDGLRKNPSSGRAY  148

Query  1463  HCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDA  1284
               ++TEPGL   + N +GL+ +L+PL++ A+K +P      T +F+ ATAG+RRLP +D+
Sbjct  149   DRMETEPGLDKLLHNRTGLKTALEPLLKWAQKQIPETSHKTTSLFLYATAGVRRLPFDDS  208

Query  1283  SRVMEGVVGIVKEHG-FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
               +++     +K    F  ++D+++++SG EEAY GW+ALNY   +LG      T G LD
Sbjct  209   KWLLDNAWSFLKSSSPFVCKRDWVKIISGTEEAYLGWIALNYDSGILGVKPRKETYGALD  268

Query  1106  lggssLQVVTEIDEFRED--------EHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA  951
             LGGSSLQV  E +  +E         E     RIGS+ H L AYSL  +G NEAFD+++A
Sbjct  269   LGGSSLQVTFEGNRNKEQQNQQLLNSETSLYVRIGSMNHHLTAYSLAGYGLNEAFDKSVA  328

Query  950   ILSQTQARRESRGEIFK----VRHPCLSSGFVQNHTCRGCF------GQKPsss-edssS  804
              + +         ++FK    V HPCL SG+ + ++C  C       G+ P+     +  
Sbjct  329   YVFKKYGY--GMEDVFKGNVEVNHPCLQSGYKERYSCSHCSNAVKKGGESPTVEGNGNVL  386

Query  803   RMMTCELNSILVL-GDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNL  627
                   L +++ L G PNW +C  LA +VA N S     +    +C        D +   
Sbjct  387   GKKDGGLRTVVTLIGAPNWLECSALA-KVAVNLSEWSDVRPG-MDCEVHPCALRDNL---  441

Query  626   TLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDAN  468
                   +  ++ +SGFF VY   NL++ A L  + E G+  C + W         Q    
Sbjct  442   ---PRPMGHFYVISGFFVVYRFFNLTAEATLEDVLEKGREFCEKRWDVARKSVAPQPFIE  498

Query  467   GLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
               CFR  Y+ASL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  499   QYCFRAPYIASLLREGLHITDKHITVGSGSITWTLGVALLEAGK  542



>ref|XP_003548590.1| PREDICTED: probable apyrase 7-like isoform X1 [Glycine max]
Length=729

 Score =   223 bits (568),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 157/464 (34%), Positives = 242/464 (52%), Gaps = 44/464 (9%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIY--EWMPNNGE--FPILVNTYPGNLTR--SDGCKY  1464
             LY    +  + VVLDCGSTG+RV +Y  +  PN+ +   PI + +    L +  S G  Y
Sbjct  89    LYSHHSSPKYYVVLDCGSTGTRVYVYKAQIQPNDQKTTLPISIESLKDGLRKNPSSGRAY  148

Query  1463  HCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDA  1284
               ++TEPGL   + N +GL+ +L+PL++ A+K +P      T +F+ ATAG+RRLP +D+
Sbjct  149   DRMETEPGLDKLLHNRTGLKTALEPLLKWAQKQIPETSHKTTSLFLYATAGVRRLPFDDS  208

Query  1283  SRVMEGVVGIVKEHG-FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
               +++     +K    F  ++D+++++SG EEAY GW+ALNY   +LG      T G LD
Sbjct  209   KWLLDNAWSFLKSSSPFVCKRDWVKIISGTEEAYLGWIALNYDSGILGVKPRKETYGALD  268

Query  1106  lggssLQVVTEIDEFRED--------EHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA  951
             LGGSSLQV  E +  +E         E     RIGS+ H L AYSL  +G NEAFD+++A
Sbjct  269   LGGSSLQVTFEGNRNKEQQNQQLLNSETSLYVRIGSMNHHLTAYSLAGYGLNEAFDKSVA  328

Query  950   ILSQTQARRESRGEIFK----VRHPCLSSGFVQNHTCRGCF------GQKPsss-edssS  804
              + +         ++FK    V HPCL SG+ + ++C  C       G+ P+     +  
Sbjct  329   YVFKKYGY--GMEDVFKGNVEVNHPCLQSGYKERYSCSHCSNAVKKGGESPTVEGNGNVL  386

Query  803   RMMTCELNSILVL-GDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNL  627
                   L +++ L G PNW +C  LA +VA N S     +    +C        D +   
Sbjct  387   GKKDGGLRTVVTLIGAPNWLECSALA-KVAVNLSEWSDVRPG-MDCEVHPCALRDNL---  441

Query  626   TLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDAN  468
                   +  ++ +SGFF VY   NL++ A L  + E G+  C + W         Q    
Sbjct  442   ---PRPMGHFYVISGFFVVYRFFNLTAEATLEDVLEKGREFCEKRWDVARKSVAPQPFIE  498

Query  467   GLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
               CFR  Y+ASL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  499   QYCFRAPYIASLLREGLHITDKHITVGSGSITWTLGVALLEAGK  542



>gb|KHN16963.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Glycine soja]
Length=731

 Score =   221 bits (563),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 155/464 (33%), Positives = 240/464 (52%), Gaps = 44/464 (9%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE----FPILVNTYPGNLTR--SDGCKY  1464
             LY    +  + VVLDCGSTG+RV +Y+    + +     PI + +    L +  S G  Y
Sbjct  91    LYSHHSSPKYYVVLDCGSTGTRVYVYKAQIQHNDQKATLPISIESLKDGLRKNPSSGRAY  150

Query  1463  HCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDA  1284
               ++TEPGL   + N +GL+ +L+PL++ A+K +P      T +F+ ATAG+RRLP +D+
Sbjct  151   DRMETEPGLDKLLHNRTGLKTALEPLLKWAQKQIPETSHKTTSLFLYATAGVRRLPFDDS  210

Query  1283  SRVMEGVVGIVKEHG-FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
               +++     +K    F  ++D+++++SG EEAY GW+ALNY   +LG      T G LD
Sbjct  211   KWLLDNAWSFLKSSSPFVCKRDWVKIISGTEEAYLGWIALNYDSGILGVKPRKETYGALD  270

Query  1106  lggssLQVVTEIDEFRED--------EHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA  951
             LGGSSLQV  E +  +E         E     RIGS+ H L AYSL  +G NEAFD+++A
Sbjct  271   LGGSSLQVTFEGNRNKEQQNQQLLNSETSLYVRIGSMNHHLTAYSLAGYGLNEAFDKSVA  330

Query  950   ILSQTQARRESRGEIFK----VRHPCLSSGFVQNHTCRGCF------GQKPsss-edssS  804
              + +         ++FK    V HPCL SG+ + ++C  C       G+ P+     +  
Sbjct  331   YVFKKYGY--GMEDVFKGNVEVNHPCLQSGYKERYSCSHCSNAVKKGGESPTVEGNGNVL  388

Query  803   RMMTCELNSILVL-GDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNL  627
                   L +++ L G PNW +C  LA +VA N S     +    +C        D +   
Sbjct  389   GKKDGGLRTVVTLIGAPNWLECSALA-KVAVNLSEWSDVRPG-MDCEVHPCALRDNL---  443

Query  626   TLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDAN  468
                   +  ++ +SGFF VY   NL++ A L  + E G+  C + W         Q    
Sbjct  444   ---PRPMGHFYVISGFFVVYRFFNLTAEATLEDVLEKGREFCEKRWDVARKSVAPQPFIE  500

Query  467   GLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
               CFR  Y+ASL+++ L +++  I  G G ++W LG AL+E G+
Sbjct  501   QYCFRAPYIASLLREGLHITDKHITVGSGSITWTLGVALLEAGK  544



>emb|CAA16707.1| putative protein [Arabidopsis thaliana]
 emb|CAB78920.1| putative protein [Arabidopsis thaliana]
Length=1052

 Score =   222 bits (565),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 224/431 (52%), Gaps = 57/431 (13%)
 Frame = -1

Query  1571  TGSRVNIYEWMPN---NGEFPILVNTYPGNLTR-SDGCKYHCVQTEPGLAMFVGNASGLR  1404
             TG+R  +Y+   N   +   PI++ +    ++R S G  Y  ++TEPG    V N +GL+
Sbjct  532   TGTRAYVYQASINYKKDSSLPIVMKSLTEGISRKSRGRAYDRMETEPGFDKLVNNRTGLK  591

Query  1403  ASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHGFFYRK  1224
              ++KPLI+ AEK +P      T +FV ATAG+RRL   D+S ++  V  I+ +  F  R+
Sbjct  592   TAIKPLIQWAEKQIPKNAHRTTSLFVYATAGVRRLRPADSSWILGNVWSILAKSPFTCRR  651

Query  1223  DFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFREDEHV  1044
             ++++++SG EEAY+GW ALNY+  MLG      T G LDLGGSSLQV  E +E   +E  
Sbjct  652   EWVKIISGTEEAYFGWTALNYQTSMLGALPKKATFGALDLGGSSLQVTFENEERTHNETN  711

Query  1043  FRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI---FKVRHPCLSSG  873
                RIGSV H L AYSL  +G N+AFDR++  L +          I    +++HPCL+SG
Sbjct  712   LNLRIGSVNHHLSAYSLAGYGLNDAFDRSVVHLLKKLPNVNKSDLIEGKLEMKHPCLNSG  771

Query  872   FVQNHTCRGCF-----GQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNS  708
             +   + C  C      G+K  S              SI ++G PNW +C  LA       
Sbjct  772   YNGQYICSQCASSVQGGKKGKSGV------------SIKLVGAPNWGECSALA-------  812

Query  707   SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTK  528
                       +N    L  G  R            +++A+SGFF VY   NLS+ A+L  
Sbjct  813   ----------KNAPCALPDGYPRPHG---------QFYAVSGFFVVYRFFNLSAEASLDD  853

Query  527   MWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSW  369
             + E G+  C ++W         Q      CFR  Y+ SL+++ L +++ +II G G ++W
Sbjct  854   VLEKGREFCDKAWQVARTSVSPQPFIEQYCFRAPYIVSLLREGLYITDKQIIIGSGSITW  913

Query  368   ALGAALIEGGE  336
              LG AL+E G+
Sbjct  914   TLGVALLESGK  924



>ref|XP_001783110.1| predicted protein [Physcomitrella patens]
 gb|EDQ52047.1| predicted protein [Physcomitrella patens]
Length=481

 Score =   211 bits (537),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 147/464 (32%), Positives = 244/464 (53%), Gaps = 61/464 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEW--MPNNGEFPILVNTYPGNLTRSDGCK----------YHCV  1455
             + +V+D GSTG+RV++Y W   P +   P++V       +R D             Y  V
Sbjct  2     YAIVIDGGSTGTRVHVYAWGHSPKD-SLPVMVKP---TYSRDDSAPWFRVPGQQRAYKRV  57

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRV  1275
             +TEPGL   + N + ++ +L+PL+  AEK +P   RG T +F+LATAG+RRLP   +  +
Sbjct  58    ETEPGLDKTLNNVTAVQHALQPLLEWAEKQIPPYARGSTRVFLLATAGLRRLPRMQSESI  117

Query  1274  MEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggs  1095
             ++    ++++  F  ++ +++V+SG EEAYYGW+ALNY + +LG++     +G LDLGGS
Sbjct  118   LDDAFLVLQKSPFMCQRKWVKVISGVEEAYYGWIALNYNLGLLGHSPKLLNVGTLDLGGS  177

Query  1094  sLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQ-----A  930
             S QV  E +E  +   V  S +GS EH L A S   +G N+AF++++A L ++Q     A
Sbjct  178   SFQVTFEPEEVSQKYGVNVS-VGSTEHNLYAVSHAGYGLNDAFEKSVAQLLRSQNSGSSA  236

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPss--sedssSRMMTCELNSILVLGDP  756
                +R  + ++ HPC+  G+ + + C       P +  SE+   R+   EL     +G  
Sbjct  237   VVAARNGLVELEHPCMHKGYRRPYVCSTHCMLPPLAFGSENDGDRVSQVEL-----IGGS  291

Query  755   NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVT---RYHALS  585
              W++C+ L +E   NSS+                  +D   +  L  ++ +   +++ L+
Sbjct  292   KWKECQAL-VEKVVNSSH------------------ADDCPSCALGKYQPSSQGKFYGLA  332

Query  584   GFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVD-------QTDANGLCFRILYMASLIK  426
             GFF VY    L   A L ++ + GQ  C  +W +       Q   +  CFR  Y+A+L++
Sbjct  333   GFFVVYKFFGLKGNAPLGRLLKKGQKFCELNWKEAQAKVSPQPSIDQYCFRAPYVAALLR  392

Query  425   DALCLSNLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGL  294
               L L + ++  G GD +W LGAAL E G    LI  +S+ + +
Sbjct  393   QGLHLRDDQVTIGSGDFAWTLGAALWEAGA---LIPVQSQSEKI  433



>ref|XP_001784358.1| predicted protein [Physcomitrella patens]
 gb|EDQ50827.1| predicted protein [Physcomitrella patens]
Length=576

 Score =   211 bits (537),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 142/457 (31%), Positives = 222/457 (49%), Gaps = 47/457 (10%)
 Frame = -1

Query  1622  YVRKRASYFTVVLDCGSTGSRVNIYEWM--PNNGEFPILV----NTY----PGNLTRSDG  1473
             Y+R+    F +VLD GSTG+RV+++ W   P +   P++V    NT+    P  +     
Sbjct  54    YLRRATLQFAIVLDGGSTGTRVHVHGWARSPKD-SLPVMVDPTTNTHLPGAPMQVVNGKQ  112

Query  1472  CKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPI  1293
               Y  V+TEPGL     N++G+  +L PL+  A + +P      T +F+LATAG+RRLP+
Sbjct  113   RLYKRVETEPGLDKLYLNSTGIENALGPLLDWAGRHIPRHAYRNTQVFLLATAGLRRLPV  172

Query  1292  EDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgl  1113
             + +  +++    +++   F  ++  ++V+ G EEAYYGW+ALNYK   LGN     +   
Sbjct  173   DQSDWILDQAWTVLENSPFKCKRSSVKVIKGIEEAYYGWIALNYKFGRLGNVPKKLSNYG  232

Query  1112  ldlggssLQVVT-EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
                 G S   VT E  +    E+     +GS EH L A S    G N+AF++++A+L + 
Sbjct  233   TLDLGGSSLEVTFEPRDVPHGEYGMNLSVGSTEHHLYAASYAGLGLNDAFEKSVALLLRA  292

Query  935   Q-----ARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS--  777
             Q      R+     + +V HPCL +G+   + C       P  +  S     + ++ +  
Sbjct  293   QNATKRDRKRRSSNLLEVEHPCLQTGYRAPYKCSTHCVLPPLPARRSGRNAPSSDVGTAA  352

Query  776   -ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEV--  606
              + +LG PNW+ C+ LA ++  +SS         Q C               L  H+   
Sbjct  353   QVELLGAPNWDTCQALAEDIINSSS--------VQGC---------SFPPCALGKHQPYP  395

Query  605   -TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW------VD-QTDANGLCFRI  450
                ++ L+GF+ VY    LS  A L  +   GQ  C   W      VD Q      CFR 
Sbjct  396   QGTFYGLAGFYVVYKFFGLSQDAPLDDLLAKGQDFCKLPWKVAERSVDPQPSIEQYCFRS  455

Query  449   LYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGG  339
              Y+ +L+++ L L + +I  G GD SW LGAAL E G
Sbjct  456   PYVTTLLREGLHLQDNQIQIGSGDFSWTLGAALWEAG  492



>ref|XP_001752330.1| predicted protein [Physcomitrella patens]
 gb|EDQ83063.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   208 bits (529),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 142/443 (32%), Positives = 230/443 (52%), Gaps = 42/443 (9%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGE-FPILVNTYPGNLTRSDGCK----------YHCVQ  1452
             + +V+D GSTG+RV++Y W  +  +  P++V       +R D             Y  V+
Sbjct  2     YAIVIDGGSTGTRVHVYAWAHSPKDSLPVMVKP---TYSRDDSAPWYRVPGQQRAYKRVE  58

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
             TEPGL   + +   ++ +L+PL+  AEK +P   RG T +F+LATAG+RRLP   +  ++
Sbjct  59    TEPGLDKTLNDEIAVQHALQPLLDWAEKQIPPYARGSTRLFLLATAGLRRLPRTQSDSIL  118

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggss  1092
             +    +++   F  ++ +++V+SG EEAYYGW+ALNY +  LG+TS   ++G LDLGGSS
Sbjct  119   DSAFSVLQRSPFMCQRKWVKVISGVEEAYYGWIALNYNLGRLGHTSKVPSVGTLDLGGSS  178

Query  1091  LQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRES--  918
              QV  E +   +   V  S +G+ +H L A S   +G N+AF++++A L + QA   S  
Sbjct  179   FQVTFEPEGVTQAYGVNIS-VGTTDHNLYAVSHAGYGLNDAFEKSVAQLLRPQASGYSAV  237

Query  917   ---RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWE  747
                   + ++ HPCL  G+ + + C       P  +  S S  +   +  + ++G  NW+
Sbjct  238   VAATNGLVELEHPCLHKGYRRPYVC-STHCMLPPLAFGSQSDGLRDRVAQVELVGGANWK  296

Query  746   KCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVY  567
              C+ L +E   NSS++E   +       L  Y      N          ++ L+GFF VY
Sbjct  297   ACQAL-VEKVVNSSHME---ICPSASCALGKYQPSSEGN----------FYGLAGFFVVY  342

Query  566   NMLNLSSRANLTKMWETGQGLCSRSWVD-------QTDANGLCFRILYMASLIKDALCLS  408
                 L   A L ++ + GQ  C  +W +       Q   +  CFR  Y+A+L++  L L 
Sbjct  343   KFFGLKGNAPLGRLLKKGQKYCELNWKEVQAKVGAQPSIDQYCFRAPYVAALLRQGLHLR  402

Query  407   NLEIIFGPGDVSWALGAALIEGG  339
             + ++  G GD +W LGAAL E G
Sbjct  403   DDQVTIGSGDFAWTLGAALWEAG  425



>emb|CDY01587.1| BnaC07g35770D [Brassica napus]
Length=691

 Score =   207 bits (526),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 147/461 (32%), Positives = 229/461 (50%), Gaps = 72/461 (16%)
 Frame = -1

Query  1658  FGYFAFSPSLILYVR--KRASYFTVVLDCGSTGSRVNIYEWMPN---NGEFPILVNTYPG  1494
             F    +  S+ +Y    + AS + VV DCGSTG+R  +Y+   N   +   PI++ +   
Sbjct  109   FALLVYIVSMYVYTNWSRGASRYYVVFDCGSTGTRAYVYQASINYRKDSSLPIVMKSLTE  168

Query  1493  NLTR-SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLAT  1317
              ++R + G  Y  ++TEPG    V N SGL+ ++KPLI+ AEK +P      T +FV AT
Sbjct  169   GISRKTSGRAYDRMETEPGFDKLVNNRSGLKTAIKPLIQWAEKQIPKHAHRTTSLFVFAT  228

Query  1316  AGMRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             AG+RRL   D+S ++  V  I+ +  F  R+++++++ G                     
Sbjct  229   AGVRRLRATDSSWLLGNVWSILAKSPFTCRREWVKIIGG---------------------  267

Query  1136  sgshtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
                         GSSLQV  E +E   +E     RIGSV H L AYSL  +G N+AF+R+
Sbjct  268   ------------GSSLQVTFENEERTHNETNLNLRIGSVNHHLSAYSLAGYGLNDAFERS  315

Query  956   LAILSQTQA---RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCE  786
             +  L + Q    + +  G   +++HPCL+SG+   + C  C    PS       +     
Sbjct  316   VVNLLKRQPDVNKSDLIGGKLEMKHPCLNSGYKGQYICSQC---APSVRRRKKGKTGV--  370

Query  785   LNSILVLGDPNWEKCKVLAMEVATNSS---NLERSKVAE-QNCVGLLSYGSDRMQNLTLN  618
                I ++G PNW +C  LA ++A NSS   N ER    + Q C   L  G  R       
Sbjct  371   --PIKLVGAPNWGECSALA-KIAVNSSEWSNTERGADCDLQPCA--LPDGYPRPHG----  421

Query  617   SHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLC  459
                  +++A+SGFF VY   NLS+ A+L  + E G+  C ++W         Q      C
Sbjct  422   -----QFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPFIEQYC  476

Query  458   FRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEGGE  336
             FR  Y+ SL+++ L +++ +I+ G G ++W LG AL+E G+
Sbjct  477   FRAPYIVSLLREGLYITDKQIVIGSGSITWTLGVALLEAGK  517



>gb|KHN41783.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=1017

 Score =   207 bits (527),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 145/432 (34%), Positives = 222/432 (51%), Gaps = 35/432 (8%)
 Frame = -1

Query  1571  TGSRVNIYEW---MPNNGEFPILV----NTYPGNLTRSD--GCKYHCVQTEPGLAMFVGN  1419
             TG+RV +Y        +   PI V    N  P N  +    G  Y  ++TEPG+   V N
Sbjct  414   TGTRVYVYRASVRFNRHTTLPIAVTSLRNASPKNNKKKPPTGRAYDRIETEPGIDKLVNN  473

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
              SGL  +LKPL+R A+K +P      T +F+ ATAG+RRLP+ D+  +++    ++K+  
Sbjct  474   VSGLNNALKPLLRWAKKQIPVRAHRSTFLFLYATAGVRRLPVSDSRWLLDNAWSVLKDSP  533

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F  ++++++++SG EEAY+GW+ALNY   +LG      T G LDLGGSSLQV  E D+  
Sbjct  534   FVCQRNWVKIISGPEEAYFGWIALNYDSGILGVRPRKATYGALDLGGSSLQVTFESDQQL  593

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRES----RGEIFKVRH  891
               E     RIGSV H L AYSL  +G NEAF +++  L + +    +     G   +++H
Sbjct  594   NSETSLYVRIGSVSHHLTAYSLPGYGLNEAFGKSVVYLFRKEFGSGNVDVGSGGNAELKH  653

Query  890   PCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATN  711
             PCL  G+ + ++C          S              ++++G PNW +C  LA +VA N
Sbjct  654   PCLQDGYREEYSCS-------RCSSSKKGGNGGLGGTQLVLVGAPNWGECSALA-KVAVN  705

Query  710   SSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLT  531
              S       A  +C        D +       H    ++ +SGF+ VY   NL+S A L 
Sbjct  706   LSEWTDLG-AGLDCGAQPCALGDNL------PHPYGHFYVISGFYVVYRFFNLTSEATLD  758

Query  530   KMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSNLEIIFGPGDVS  372
              +   G+G C + W         Q      CFR  Y+ASL+++ L +++ +I  G G+++
Sbjct  759   DVLAKGKGFCEKRWDVAKRSVAPQPFIEQYCFRAPYIASLLREGLHINDNQITVGSGNIT  818

Query  371   WALGAALIEGGE  336
             W LG AL+E G+
Sbjct  819   WTLGVALLEAGK  830



>gb|KDO72274.1| hypothetical protein CISIN_1g039222mg [Citrus sinensis]
Length=659

 Score =   199 bits (505),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/376 (35%), Positives = 196/376 (52%), Gaps = 33/376 (9%)
 Frame = -1

Query  1403  ASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG-FFYR  1227
             A++KPL++ AEK +P      T +F+ ATAG+RRLP  D+  +++    I+K++  F  +
Sbjct  113   AAIKPLLQWAEKQIPEHAHKTTSLFIYATAGVRRLPTSDSKWLLDNAWSILKKNSPFLCQ  172

Query  1226  KDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFREDEH  1047
             +D+++++SG EEAYYGW ALNY+  MLG      T G LDLGGSSLQV  E  E   +E 
Sbjct  173   RDWVKIISGTEEAYYGWTALNYRTGMLGAIPKKETFGSLDLGGSSLQVTFESKEHMHNET  232

Query  1046  VFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI---FKVRHPCLSS  876
                 RIG+V H L AYSL  +G N+AFD+++  L +      +   +    +++HPCL S
Sbjct  233   NLNLRIGAVNHHLSAYSLSGYGLNDAFDKSVVKLLKRIPNVTTSDLVNGKVEIKHPCLQS  292

Query  875   GFVQNHTCRGCFGQ-----KPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATN  711
             G+ + + C  C         P        +       ++ + G PNWE+C  LA  V   
Sbjct  293   GYKEQYVCSHCASSPAENGSPVVGGKKLVKGRKSG-TTVQLTGAPNWEECSALAKTVVNL  351

Query  710   SSNLERSKVAEQNCVGLLSYGSD-RMQNLTLNS---HEVTRYHALSGFFAVYNMLNLSSR  543
             S  L             +S G D  MQ   L         +++A+SGFF VY   NL+S 
Sbjct  352   SEWLN------------ISPGVDCDMQPCALPDGLPRPFGQFYAISGFFVVYRFFNLTSE  399

Query  542   ANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSNLEIIFGP  384
             A+L  + E G+  C ++W         Q      CFR  Y+  L+++ L +++  II G 
Sbjct  400   ASLDDVLEKGREFCEKTWDIARVSVPPQPFIEQYCFRSPYVVLLLREGLHITDKNIIVGS  459

Query  383   GDVSWALGAALIEGGE  336
             G ++W LG AL+E G+
Sbjct  460   GSITWTLGVALLEAGK  475



>ref|XP_009593921.1| PREDICTED: uncharacterized protein LOC104090517 [Nicotiana tomentosiformis]
Length=142

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = -1

Query  1775  MEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRAS-Y  1599
             M+P+ PSKSK++V G   +P   K   + + I FI VLI G F FSPSL+  V K +S Y
Sbjct  1     MDPRWPSKSKLYVSGTNHNPRMQKIGIIAVSIVFIFVLIGGCFVFSPSLVYNVEKSSSSY  60

Query  1598  FTVVLDCGSTGSRVNIYEW-----MPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             FTVV+DCGS+G++VNIYEW     + NNG+ PIL+NTY GNLT+SDG +YHC+QTEPGL
Sbjct  61    FTVVVDCGSSGTKVNIYEWKLQGRLYNNGDLPILLNTYLGNLTKSDGYQYHCIQTEPGL  119



>gb|KFM25933.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Auxenochlorella 
protothecoides]
Length=563

 Score =   125 bits (315),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 121/440 (28%), Positives = 193/440 (44%), Gaps = 57/440 (13%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWM--PNNGEFPILVNTYPGNLT-------RSDGCKYHCV  1455
             A  + +V+D GS+G+R++ YEW   P     P +    P           ++    Y  V
Sbjct  64    APRYVLVIDAGSSGTRLHAYEWRASPGAASAPRVRAIPPSAAAALVPRRAKAARRAYQRV  123

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRG-AEKWVPSGKRGVTPIFVLATAGMRRLPIEDASR  1278
             +TEP L  ++G+ +GL A+    +   AE  VP+  RG TP+F+  TAG+RRL   D + 
Sbjct  124   ETEPALDAWLGDPAGLAAAALGPLLAWAEAVVPARARGATPLFLAGTAGVRRLAEADQAA  183

Query  1277  VMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlgg  1098
             ++     ++   GF ++  +   +SG+EE  YGWVALNY+ + L +++   TLG LDLGG
Sbjct  184   LLGDARRVLAVSGFLFQPGWASTISGQEEGVYGWVALNYEEQRLAHSATLPTLGSLDLGG  243

Query  1097  ssLQVVTEID-EFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE  921
             SSL+V  E + E          ++    + L  +    FG N+AF R+ A          
Sbjct  244   SSLEVCFEAEPEAMPPPSRVAIQVLGRSYSLFCHVHHGFGLNDAFSRSAA----------  293

Query  920   SRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKC  741
                   +V HPCL +G+                    + R       ++ +LG P+W  C
Sbjct  294   ---SAVEVLHPCLPAGYASPRPV--------------AHREPGVPTRALRLLGAPDWPAC  336

Query  740   KVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNM  561
               LA  VAT  +    S  A   C    + GS + +           + ALSGF+ V++ 
Sbjct  337   VRLAAGVATRGNA---SSCAAPPC----ALGSPQPRPRAGQE-----FVALSGFYVVHHF  384

Query  560   LNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLSNL  402
               L        +   G+  C+  W        D+      CFR  Y+ +L++  L L + 
Sbjct  385   FGLGVEEGPAALEGAGRAFCATPWRASAARHADELLVEHYCFRAPYVRALLRRGLGLEDR  444

Query  401   EIIFGPGDVSWALGAALIEG  342
              +    G   WA  A  ++G
Sbjct  445   AVHGLRGRWLWARAALRVDG  464



>dbj|BAJ96922.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   124 bits (310),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 84/303 (28%), Positives = 145/303 (48%), Gaps = 31/303 (10%)
 Frame = -1

Query  1088  QVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGE  909
             QV  E D+  + +      IGSV H+L AYSL  +G N+AFD+++A L +        G+
Sbjct  18    QVTFETDKAVQGDTGVGLTIGSVNHQLSAYSLSGYGLNDAFDKSVAHLVKMLGGTAGNGK  77

Query  908   IFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV--LGDPNWEKCKV  735
             + +V+HPCL +G+ +++ C  C   K   S   S +    E     V  +G P W++C  
Sbjct  78    V-QVKHPCLQTGYREDYVCSYCHPLKQDGSPSVSGKTTGKEKQGTAVELIGAPQWKECSD  136

Query  734   LAMEVATNSSNLERSKVAE----QNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVY  567
             LA +V  N S    S        Q C    S+     Q           ++A+SGF+ V+
Sbjct  137   LA-KVTVNLSEWSNSSSGLDCNLQPCALANSFPQPHGQ-----------FYAMSGFYVVF  184

Query  566   NMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALCLS  408
                NL+  A L  + + GQ  C + W         Q      CFR  Y+ SL+++ L + 
Sbjct  185   KFFNLTPDATLVDVLKRGQEFCEKPWDVARSSVPPQPFIEQYCFRSPYITSLLREGLQIK  244

Query  407   NLEIIFGPGDVSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFIVLVCVL  228
             + ++I G G ++W LG AL+E G+      ++   +G    H+  ++ +I + + L+ ++
Sbjct  245   DNQVIIGSGSITWTLGVALLEAGQ----ALSKMDIQGYILLHR-EINPNILIVLFLISIV  299

Query  227   MIV  219
             +++
Sbjct  300   LVI  302



>gb|EYU28756.1| hypothetical protein MIMGU_mgv1a004089mg [Erythranthe guttata]
Length=544

 Score =   121 bits (303),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 114/434 (26%), Positives = 200/434 (46%), Gaps = 51/434 (12%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + VV+D GSTG+R++++++   NG   +L  +  G ++         ++  PGL+ +  N
Sbjct  76    YGVVIDGGSTGTRIHVFKYEVRNGNL-VLDFSEKGLVS---------MRVNPGLSAYAQN  125

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                  A++  L+  A++ VP      T + ++ATAGMR L  ED  R++    G+++  G
Sbjct  126   PEMAGAAMAELMDFAKRTVPREHWAETKVRLMATAGMRLLKNEDQERILNACRGMLRNSG  185

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R D+  ++SG +E  Y WV  NY +  LG    + T G+++LGG+S QV    +E  
Sbjct  186   FMFRDDWASIISGSDEGLYAWVVANYALGTLG-AEPAQTTGIIELGGASAQVTFVSNEAM  244

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFD-RALAILSQTQARRESRGEIFKVRHPCL  882
               E   + + G+  + L ++SL  FG N AF+    +++S+ Q          K   PC 
Sbjct  245   PAEFSRKVKFGNFTYYLYSHSLLNFGQNVAFELLKDSLISEGQDSVTESFNKGKPIDPCT  304

Query  881   SSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSN  702
               G+  N   +      PSS  + +  + T       +L + N+ +C+  ++++      
Sbjct  305   PRGYSSN---KEALKLSPSSLTEKNKYLST-------LLPNGNFSECRSASLKLLQK---  351

Query  701   LERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMW  522
              ++ K + Q C      GS  M  L        ++ A   FF       L  RA L+ + 
Sbjct  352   -DQDKCSYQTCY----IGSTFMPKLQ------GKFLATENFFHTSKFFGLGQRALLSDLV  400

Query  521   ETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLSNLEIIFGPGD---  378
               GQ  C   W         +D+ D    CF   Y+ +L+ D+L +S  +   G  +   
Sbjct  401   VAGQQFCGEDWSKLTQKYNFLDEEDLLRYCFSSAYIVALLHDSLGISLNDQRIGYANEVH  460

Query  377   ---VSWALGAALIE  345
                + WALGA ++E
Sbjct  461   NVPLDWALGAFILE  474



>ref|XP_002876854.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53113.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=553

 Score =   117 bits (294),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 119/460 (26%), Positives = 198/460 (43%), Gaps = 62/460 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ F  +
Sbjct  85    YSVVIDGGSTGTRIHVFGYRIESGK-PVF---------EFRGANYASLKLHPGLSAFADD  134

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A+  +P G    T + ++ATAGMR L +    +++     ++K  G
Sbjct  135   PDGASVSLTELVEFAKGRIPKGMWMETEVRLMATAGMRLLELPVQEKILGVARRVLKSSG  194

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV     E  
Sbjct  195   FLFRDEWASVISGSDEGVYAWVVANFALGSLG-ADPLKTTGIVELGGASAQVTFVSSEPM  253

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E       G+V + L ++S   FG N A D+   +L +     A   +R +IF    P
Sbjct  254   PPEFSRTISFGNVSYNLYSHSFLHFGQNAAHDKLWGSLLLRDHNPAMESTREKIFT--DP  311

Query  887   CLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNS  708
             C   G+  +        QK  S   +    ++    +       N+ +C+  A+ +    
Sbjct  312   CAPRGYNLDANT-----QKHLSGLLAEESRISDSFQA-----GGNYSQCRSAALNILQEG  361

Query  707   SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTK  528
             +     K + Q+C    S GS      T       R+ A   FF       L  +A L+K
Sbjct  362   NE----KCSYQHC----SIGS------TFTPKLRGRFLATENFFYTSKFFGLGEKAWLSK  407

Query  527   MWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKD--ALCLSNLEIIFG--  387
             M   G+  C   W         +D+ D    CF   Y+ SL+ D   + L +  I F   
Sbjct  408   MISAGERFCGEDWSKLRVKDPSLDEEDILRYCFSSAYIVSLLHDTFGIPLDDERIGFANQ  467

Query  386   PGDV--SWALGAALIEGGEHSRLIATESRRKGLATQHKWM  273
              GD+   WALGA +++        ATE+ +   +    W 
Sbjct  468   AGDIPLDWALGAFILQ-------TATETSQHSSSDNLHWF  500



>ref|XP_010425073.1| PREDICTED: probable apyrase 6 [Camelina sativa]
Length=554

 Score =   117 bits (293),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 118/460 (26%), Positives = 193/460 (42%), Gaps = 62/460 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+RV+++ +   +G+ P+             G  Y  ++  PGL+ F  +
Sbjct  86    YSVVIDGGSTGTRVHVFGYRVESGK-PVF---------EFRGANYASLKLHPGLSAFADD  135

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A+  VP G    T + ++ATAGMR L +    +++     ++K  G
Sbjct  136   PDGASVSLTELVEFAKGKVPKGVWMETEVRLMATAGMRLLELPVQEKILRVTRRVLKSSG  195

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV    +E  
Sbjct  196   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTTGIVELGGASAQVTFVSNEPM  254

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E       G+V + L ++S   FG N A D+   +L       A   +R  IF    P
Sbjct  255   PAEFSRTISFGNVSYNLYSHSFLHFGQNAAHDKLWGSLLSRDHNSAVEPTRKRIFS--DP  312

Query  887   CLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNS  708
             C   G+  +        QK  S   +     +   ++       N+ +C+  A+ +    
Sbjct  313   CAPKGYSLDTNT-----QKHLSGLLALESGFSDSFHA-----GGNYSECRSAALTILQEG  362

Query  707   SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTK  528
             +     K   Q+C    S GS     L        ++ A   FF       L  +A L+ 
Sbjct  363   NE----KCTYQHC----SIGSAFTPKLQ------GKFLATENFFHTSKFFGLGEKAWLSN  408

Query  527   MWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL----SNLEIIFG  387
             M   G+  C   W         +   D    CF   Y+ SL+ D L +      +E    
Sbjct  409   MISAGERFCGEDWSKLRVKDPSLRDEDLLRYCFSSAYIVSLLHDTLGIPLDDERIEFAIQ  468

Query  386   PGDV--SWALGAALIEGGEHSRLIATESRRKGLATQHKWM  273
              GD+   WALGA +++        ATE+ +    + H W 
Sbjct  469   AGDIPLDWALGAFILQ-------TATETSQHAAISNHHWF  501



>ref|XP_010939489.1| PREDICTED: probable apyrase 6 isoform X1 [Elaeis guineensis]
Length=542

 Score =   115 bits (289),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 122/492 (25%), Positives = 208/492 (42%), Gaps = 69/492 (14%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTE  1446
             +Y    +S F +++D GSTGSR++++ +    G  P+L           D      ++  
Sbjct  70    VYRSSGSSKFGIIVDGGSTGSRIHVFGYTNRQGALPVL-----------DFGVMASMKAS  118

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PGL+ + G+  G   SL  L+   +  VP  + G T I ++ATAG+R L    A R+++ 
Sbjct  119   PGLSAYSGDPEGAGRSLVELLEFGKARVPRDQWGETEIRLMATAGLRLLDAGVAERILDS  178

Query  1265  VVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQ  1086
                +++  GF ++ D+  V+SG +E  Y WVA NY +  LG      T G+++LGG+S Q
Sbjct  179   CRKVLRSSGFQFQDDWATVISGSDEGIYAWVAANYALGSLGGD-PGKTTGIIELGGASAQ  237

Query  1085  VVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT--QARRESRG  912
             V     E    E       G   + L ++S    G N A++    +LS    ++  ES+ 
Sbjct  238   VTFVSSEPLSPEFSHVLNFGETTYNLYSHSFLHLGQNVAYESLHELLSSRVLKSSAESQQ  297

Query  911   EIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS-----ILVLGDPNWE  747
             E    R PC   G+  +H+                 ++    LNS      +     N+ 
Sbjct  298   EPI-YRDPCTPRGY--SHSVESL-------------KLSAGVLNSRTEYRPVAHATGNFS  341

Query  746   KCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVY  567
             +C+  ++E+       E+ K   Q+C      GS  M  L        R  A   FF   
Sbjct  342   ECRSASLELLQK----EKDKCLHQSCY----LGSALMPKLH------GRLLATENFFYTA  387

Query  566   NMLNLSSRANLTKMWETGQGLCSRSWV---------DQTDANGLCFRILYMASLIKDALC  414
                 L   + L+ +   G+  C   W+         D+ D    CF   Y+ +L+ D+L 
Sbjct  388   KFFGLGPTSFLSDLMLAGEQFCGEDWLKLKGNYHSTDEDDLLRYCFSSAYIVALLHDSLG  447

Query  413   LSNLEIIFGPGD------VSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITL  252
             ++  E   G  +      + WALGA +++     ++        G  T      SS ++L
Sbjct  448   IALDEKRIGFANQVGGIPLDWALGAFIMQ-----KMPKQSPEHSGWITAIVGNDSSILSL  502

Query  251   FIVLVCVLMIVY  216
             F+V   ++M  +
Sbjct  503   FLVPSVLIMTAW  514



>ref|XP_008802602.1| PREDICTED: probable apyrase 6 isoform X2 [Phoenix dactylifera]
Length=555

 Score =   115 bits (289),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 114/490 (23%), Positives = 204/490 (42%), Gaps = 77/490 (16%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMF  1428
             +S F +++D GSTG+R++++ +    G  P+L           D      ++  PGL+ +
Sbjct  76    SSKFGIIIDGGSTGTRIHVFRYSNRRGAMPVL-----------DFGVMASMKVSPGLSAY  124

Query  1427  VGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK  1248
              GN  G R SL  L+   +  VP  + G T I ++ATAG+R L +  A R+++    +++
Sbjct  125   SGNPEGARRSLVELLEFGKGRVPRNQWGETEIRLMATAGLRLLDVGVAERILDSCRKVLR  184

Query  1247  EHGFFYRKDFIRVLSGREEAYYGWVALNYKMRML-GNTsgshtlglldlggssLQVVTEI  1071
                F ++ D+  V+SG +E  Y WVA NY +  L G+   +  +  L    + +  V+  
Sbjct  185   SSVFQFQDDWATVISGSDEGIYAWVAANYALGSLGGDPEKTTGIVELGGASAQVTFVSSE  244

Query  1070  DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESR-GEIFKVR  894
                 E  HV + R     + L ++S    G N A++    +LS    +  +  G+    R
Sbjct  245   PLPPEFSHVLKFR--ETTYNLYSHSFLHLGQNVAYEALHELLSSRVLKSSAESGQEPIYR  302

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS-----ILVLGDPNWEKCKVLA  729
              PC   G   +H+                 ++   +LNS      +     N+ +C++ +
Sbjct  303   DPCTPRG--HSHSVE-------------LLKLSAGDLNSKTEYRPVAHATGNFSECRLAS  347

Query  728   MEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYH----ALSGFFAVYNM  561
             +E+       E+ K   Q+C               L S  + + H    A   FF     
Sbjct  348   LELLQK----EKDKCLHQSC--------------DLGSAFIPKLHGKLLATENFFYTAKF  389

Query  560   LNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS  408
               L   + L+ +   G+  C   W         VD+ D    CF   Y+ +L+ D+L +S
Sbjct  390   FGLGPTSFLSDLMLAGEQFCGEDWLKLKSIYHSVDEEDLLRYCFSSAYIMALLHDSLGIS  449

Query  407   NLEIIFGPGD------VSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFI  246
               E   G  +      + WALGA +++     ++        G  T      SS ++LF+
Sbjct  450   LDEKRIGFANQVGNIPLDWALGAFIMQ-----KMPRQSPEHSGWITAIVGNDSSILSLFV  504

Query  245   VLVCVLMIVY  216
             V   ++M  +
Sbjct  505   VPSVLIMAAW  514



>ref|XP_008802601.1| PREDICTED: probable apyrase 6 isoform X1 [Phoenix dactylifera]
Length=601

 Score =   115 bits (288),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 114/490 (23%), Positives = 204/490 (42%), Gaps = 77/490 (16%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMF  1428
             +S F +++D GSTG+R++++ +    G  P+L           D      ++  PGL+ +
Sbjct  76    SSKFGIIIDGGSTGTRIHVFRYSNRRGAMPVL-----------DFGVMASMKVSPGLSAY  124

Query  1427  VGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK  1248
              GN  G R SL  L+   +  VP  + G T I ++ATAG+R L +  A R+++    +++
Sbjct  125   SGNPEGARRSLVELLEFGKGRVPRNQWGETEIRLMATAGLRLLDVGVAERILDSCRKVLR  184

Query  1247  EHGFFYRKDFIRVLSGREEAYYGWVALNYKMRML-GNTsgshtlglldlggssLQVVTEI  1071
                F ++ D+  V+SG +E  Y WVA NY +  L G+   +  +  L    + +  V+  
Sbjct  185   SSVFQFQDDWATVISGSDEGIYAWVAANYALGSLGGDPEKTTGIVELGGASAQVTFVSSE  244

Query  1070  DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESR-GEIFKVR  894
                 E  HV + R     + L ++S    G N A++    +LS    +  +  G+    R
Sbjct  245   PLPPEFSHVLKFR--ETTYNLYSHSFLHLGQNVAYEALHELLSSRVLKSSAESGQEPIYR  302

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS-----ILVLGDPNWEKCKVLA  729
              PC   G   +H+                 ++   +LNS      +     N+ +C++ +
Sbjct  303   DPCTPRG--HSHSVE-------------LLKLSAGDLNSKTEYRPVAHATGNFSECRLAS  347

Query  728   MEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYH----ALSGFFAVYNM  561
             +E+       E+ K   Q+C               L S  + + H    A   FF     
Sbjct  348   LELLQK----EKDKCLHQSC--------------DLGSAFIPKLHGKLLATENFFYTAKF  389

Query  560   LNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS  408
               L   + L+ +   G+  C   W         VD+ D    CF   Y+ +L+ D+L +S
Sbjct  390   FGLGPTSFLSDLMLAGEQFCGEDWLKLKSIYHSVDEEDLLRYCFSSAYIMALLHDSLGIS  449

Query  407   NLEIIFGPGD------VSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSSITLFI  246
               E   G  +      + WALGA +++     ++        G  T      SS ++LF+
Sbjct  450   LDEKRIGFANQVGNIPLDWALGAFIMQ-----KMPRQSPEHSGWITAIVGNDSSILSLFV  504

Query  245   VLVCVLMIVY  216
             V   ++M  +
Sbjct  505   VPSVLIMAAW  514



>ref|XP_010502309.1| PREDICTED: probable apyrase 6 [Camelina sativa]
Length=554

 Score =   114 bits (286),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 120/460 (26%), Positives = 194/460 (42%), Gaps = 62/460 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ F  +
Sbjct  86    YSVVIDGGSTGTRIHVFGYRVESGK-PVF---------EFRGANYASLKLHPGLSAFADD  135

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A+  VP G    T + ++ATAGMR L +    +++     ++K  G
Sbjct  136   PDGASVSLTELVEFAKGKVPKGVWMETEVRLMATAGMRLLELPVQEKILRVTRRVLKSSG  195

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV    +E  
Sbjct  196   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTTGIVELGGASAQVTFVSNEPM  254

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E       G+V + L ++S   FG N A D+   +L       A   +R  IF    P
Sbjct  255   PAEFSRTISFGNVSYNLYSHSFLHFGQNAAHDKLWGSLLSRDHKSAVEPTRKRIFT--DP  312

Query  887   CLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNS  708
             C   G+  +        QK  S   +     +   ++       N+ +C+  A+ +    
Sbjct  313   CAPKGYSLDTNT-----QKHLSGLLALESGFSDSFHA-----GGNYSECRSAALTILQEG  362

Query  707   SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTK  528
             +     K + Q+C    S GS     L        R+ A   FF       L  +A L+ 
Sbjct  363   NE----KCSYQHC----SIGSAFTPKLR------GRFLATENFFHTSKFFGLGEKAWLSN  408

Query  527   MWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIFG--  387
             M   G+  C   W         +   D    CF   Y+ SL+ D L   L +  I F   
Sbjct  409   MISAGERFCGEDWSKLRVKDPSLRDEDLLRYCFSSAYIVSLLHDTLGIPLDDERIGFAIQ  468

Query  386   PGDV--SWALGAALIEGGEHSRLIATESRRKGLATQHKWM  273
              GD+   WALGA +++        ATE+ +      H W 
Sbjct  469   AGDIPLDWALGAFILQ-------TATETSQHAAIGNHHWF  501



>ref|XP_010514066.1| PREDICTED: probable apyrase 6 [Camelina sativa]
Length=554

 Score =   114 bits (286),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 115/460 (25%), Positives = 195/460 (42%), Gaps = 62/460 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ F  +
Sbjct  86    YSVVIDGGSTGTRIHVFGYRVESGK-PVF---------EFSGANYASLKLHPGLSAFADD  135

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G  ASL  L+  A+  VP G    T + ++ATAGMR L +    +++     ++K  G
Sbjct  136   PDGASASLTELVEFAKGKVPKGMWMETEVRLMATAGMRLLELPVQEKILRVTRRVLKSSG  195

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV    +E  
Sbjct  196   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTTGIVELGGASAQVTFVSNEPM  254

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E       G+V + L ++S   FG N A D+   +L       A   +R  IF    P
Sbjct  255   PAEFSRTISFGNVSYNLYSHSFLHFGQNAAHDKLWGSLLSRDHNSAVEPTRERIFT--DP  312

Query  887   CLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNS  708
             C   G+  +        QK  S   +     +   ++       N+ +C+  A  +    
Sbjct  313   CAPKGYSLDTNT-----QKHLSGLLALENGFSDSFHA-----GGNYSECRSAARTILQEG  362

Query  707   SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTK  528
             +     K + Q+C  + S  + ++Q          ++ A   FF       L  +A L+ 
Sbjct  363   NE----KCSYQHC-SIGSAFTPKIQG---------KFLATENFFHTSKFFGLGEKAWLSN  408

Query  527   MWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL----SNLEIIFG  387
             M   G+  C   W         +   D    CF   Y+ SL+ D L +      ++    
Sbjct  409   MISAGERFCGEDWSKLRVKDPSLRDEDLLRYCFSSAYIVSLLHDTLGIPLDDERIQFAIQ  468

Query  386   PGDV--SWALGAALIEGGEHSRLIATESRRKGLATQHKWM  273
              GD+   WALGA +++        ATE+ +      H W 
Sbjct  469   VGDIPLDWALGAFILQ-------TATETSQHAAIGSHHWF  501



>ref|XP_006290845.1| hypothetical protein CARUB_v10016956mg [Capsella rubella]
 gb|EOA23743.1| hypothetical protein CARUB_v10016956mg [Capsella rubella]
Length=553

 Score =   114 bits (285),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 119/460 (26%), Positives = 195/460 (42%), Gaps = 62/460 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ F  N
Sbjct  85    YSVVIDGGSTGTRIHVFGYPIESGK-PVF---------EFRGANYASLKLHPGLSAFADN  134

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A+  VP G    T + ++ATAGMR L +    ++++    ++K  G
Sbjct  135   PDGASVSLTELVEFAKGKVPKGMWMETEVRLMATAGMRLLELPVQEKILQVTRRVLKSSG  194

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV    +E  
Sbjct  195   FMFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTTGIVELGGASAQVTFVSNEPM  253

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E       G+V + L ++S   FG N A D+   +L       A   ++  IF    P
Sbjct  254   PAEFSRTVSFGNVSYNLYSHSFLHFGQNAAHDKLWGSLLSKDHKSAVETAQERIFT--DP  311

Query  887   CLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNS  708
             C   G+  +        QK  S   +     +   ++       N+ +C+  A+ +    
Sbjct  312   CAPKGYKLDTNT-----QKHLSGLLAEESRFSDSFHA-----GGNYSECRSAALTILQEG  361

Query  707   SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTK  528
             +     K + Q+C    S GS     L        R+ A   FF       L  +A L+ 
Sbjct  362   NE----KCSYQHC----SIGSAFTPKLQ------GRFLATENFFHTSKFFGLGEKAWLSN  407

Query  527   MWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKD--ALCLSNLEIIFG--  387
             M   G+  C   W         +   D    CF   Y+ SL+ D   + L +  I F   
Sbjct  408   MISAGERFCGEDWSKLRVKDPSLRDEDLLRYCFSSAYIVSLLHDTFGIPLDDERIGFAIQ  467

Query  386   PGDV--SWALGAALIEGGEHSRLIATESRRKGLATQHKWM  273
              GD+   WALGA +++        ATE+ +      H W 
Sbjct  468   AGDIPLDWALGAFILQ-------TATETSQHEAIGNHHWF  500



>ref|XP_009773397.1| PREDICTED: probable apyrase 6 [Nicotiana sylvestris]
Length=541

 Score =   114 bits (284),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 113/457 (25%), Positives = 199/457 (44%), Gaps = 68/457 (15%)
 Frame = -1

Query  1649  FAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGC  1470
             F FS  +   V+K+   + +V+D GSTG+R++++E+   +G  P+      G ++     
Sbjct  62    FVFSSKIRFSVKKK---YGIVIDGGSTGTRIHVFEYEFRDGVGPVFDFGEKGLVS-----  113

Query  1469  KYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
                 ++  PGL+ +         S+  L+   +K VP      T I ++ATAGMR L ++
Sbjct  114   ----MRVNPGLSAYAEEPEMASESVAELVEFGKKIVPKEYWSETEIRLMATAGMRLLDLD  169

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
                +++E    ++++ GF +  D+  V+SG +E  Y WV  NY +  LG +    T G++
Sbjct  170   VQEKILEVCRKVLRDSGFKFMNDWASVISGSDEGLYAWVIANYALGTLG-SDPLQTTGII  228

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             +LGG+S QV    DE    E+    +  +  +K+ +YSL  FG N AFD  L + S   +
Sbjct  229   ELGGASAQVTFVSDEPMPQEYSRTIKFRNFTYKIYSYSLLQFGQNVAFD--LLLESLVAS  286

Query  929   RRESRGEIFKVRHPCLSSGFVQN----HTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
              ++   +  K+  PC   G+  N          F  K                N  L   
Sbjct  287   SQDQAAQSVKLMDPCSPRGYTHNLRSLKLSPSSFADK----------------NKFLSAL  330

Query  761   DP--NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSY-GSDRMQNLTLNSHEVTRYHA  591
              P  N+ +C+         S++L   +  +++C     Y GS  M  L        ++ A
Sbjct  331   YPSGNFSECR---------SASLSLLQKGKESCPYKSCYIGSTFMPKLQ------GKFLA  375

Query  590   LSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMA  438
                FF       L  +A L+ +   G+  C   W         + + D +  CF   Y+ 
Sbjct  376   TENFFHTSKFFGLPPKAFLSDLMAAGKSFCEEDWSRLKSKYHSLQEQDLHRYCFSSAYIL  435

Query  437   SLIKDALCLSNLEIIFGPGD------VSWALGAALIE  345
             +L+ D+L +   +   G  +      + WALGA +++
Sbjct  436   ALLHDSLGIGLDDDRIGYANQVENIPLDWALGAFILQ  472



>ref|XP_008802603.1| PREDICTED: probable apyrase 6 isoform X3 [Phoenix dactylifera]
Length=491

 Score =   113 bits (282),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 106/447 (24%), Positives = 188/447 (42%), Gaps = 72/447 (16%)
 Frame = -1

Query  1607  ASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMF  1428
             +S F +++D GSTG+R++++ +    G  P+L           D      ++  PGL+ +
Sbjct  76    SSKFGIIIDGGSTGTRIHVFRYSNRRGAMPVL-----------DFGVMASMKVSPGLSAY  124

Query  1427  VGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK  1248
              GN  G R SL  L+   +  VP  + G T I ++ATAG+R L +  A R+++    +++
Sbjct  125   SGNPEGARRSLVELLEFGKGRVPRNQWGETEIRLMATAGLRLLDVGVAERILDSCRKVLR  184

Query  1247  EHGFFYRKDFIRVLSGREEAYYGWVALNYKMRML-GNTsgshtlglldlggssLQVVTEI  1071
                F ++ D+  V+SG +E  Y WVA NY +  L G+   +  +  L    + +  V+  
Sbjct  185   SSVFQFQDDWATVISGSDEGIYAWVAANYALGSLGGDPEKTTGIVELGGASAQVTFVSSE  244

Query  1070  DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESR-GEIFKVR  894
                 E  HV + R     + L ++S    G N A++    +LS    +  +  G+    R
Sbjct  245   PLPPEFSHVLKFR--ETTYNLYSHSFLHLGQNVAYEALHELLSSRVLKSSAESGQEPIYR  302

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS-----ILVLGDPNWEKCKVLA  729
              PC   G   +H+                 ++   +LNS      +     N+ +C++ +
Sbjct  303   DPCTPRG--HSHSVE-------------LLKLSAGDLNSKTEYRPVAHATGNFSECRLAS  347

Query  728   MEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYH----ALSGFFAVYNM  561
             +E+       E+ K   Q+C               L S  + + H    A   FF     
Sbjct  348   LELLQK----EKDKCLHQSC--------------DLGSAFIPKLHGKLLATENFFYTAKF  389

Query  560   LNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS  408
               L   + L+ +   G+  C   W         VD+ D    CF   Y+ +L+ D+L +S
Sbjct  390   FGLGPTSFLSDLMLAGEQFCGEDWLKLKSIYHSVDEEDLLRYCFSSAYIMALLHDSLGIS  449

Query  407   NLEIIFGPGD------VSWALGAALIE  345
               E   G  +      + WALGA +++
Sbjct  450   LDEKRIGFANQVGNIPLDWALGAFIMQ  476



>gb|KFK33476.1| hypothetical protein AALP_AA5G018300 [Arabis alpina]
Length=552

 Score =   112 bits (280),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 120/488 (25%), Positives = 209/488 (43%), Gaps = 75/488 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +    G+ P+             G  Y  ++  PGL+ +  +
Sbjct  82    YSVVIDGGSTGTRIHVFRYRIEFGK-PVF---------EFRGGDYASLKLHPGLSAYSDD  131

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A+  +P G    T + ++ATAGMR + +    +++     ++K  G
Sbjct  132   PDGASLSLMELVEFAKGRIPKGLWKETEVRLMATAGMRLVELSVQEKILGVARRVLKSSG  191

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV     E  
Sbjct  192   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTTGIVELGGASAQVTFVSSEPV  250

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E      IG+V + L ++S   FG N A ++   +L    Q  A   +R  IF    P
Sbjct  251   PPEFSRTISIGNVSYNLYSHSFLHFGQNAAHEKLWGSLVSKDQNSAVESTRKGIFT--DP  308

Query  887   CLSSGF-----VQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             C   G+      Q     G   ++              + ++ L  G  N+ +C+  A+ 
Sbjct  309   CAPKGYNLDTIAQKQHLSGFLAEE-------------SKFSASLQAGG-NYSECRSAALT  354

Query  722   VATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
             +    ++    K + Q+C    S GS     L        R+ A   FF       L  +
Sbjct  355   ILQEGND----KCSYQHC----SIGSSLTPKLQ------GRFLATENFFYTSKFFGLGEK  400

Query  542   ANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALC--LSNLEI  396
             + L+ M   G+  C   W         +D+ D    CF   Y+ SL+ D L   L +  +
Sbjct  401   SWLSNMISAGEKFCGEDWSKLRVKDPSLDEEDLLRYCFSSAYIVSLLHDTLGVPLDDERV  460

Query  395   IFG--PGD---VSWALGAALIEGGEHSRLIATESRRKGLATQHKWM----VSSSITLFIV  243
              +    GD   + WALGA +++        A  S+  G +  H +       S+  L+++
Sbjct  461   KYANQAGDNIPLDWALGAFILQTA------AETSQHTGSSNLHSFYALFGTDSNTLLYLI  514

Query  242   LVCVLMIV  219
              + +L+ V
Sbjct  515   GIPILITV  522



>ref|XP_006395745.1| hypothetical protein EUTSA_v10003943mg [Eutrema salsugineum]
 gb|ESQ33031.1| hypothetical protein EUTSA_v10003943mg [Eutrema salsugineum]
Length=550

 Score =   112 bits (279),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 117/455 (26%), Positives = 197/455 (43%), Gaps = 57/455 (13%)
 Frame = -1

Query  1649  FAFSPSLILYV---RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRS  1479
             F F   LIL+    R+    ++VV+D GSTG+R++++ +   +GE P+            
Sbjct  63    FLFVCYLILFSDGNRRGRLRYSVVIDGGSTGTRIHVFGYRIESGE-PVF---------EF  112

Query  1478  DGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRL  1299
              G  Y  ++  PGL+ +  +  G   SL  L+  A+  +P G    T + ++ATAGMR L
Sbjct  113   RGANYASLKLHPGLSAYADDPDGASVSLTELVEFAKGRIPKGMWKETEVRLMATAGMRLL  172

Query  1298  PIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtl  1119
              +   + +++    ++   GF +R ++  V+SG +E  Y WV  N+ +  LG      T 
Sbjct  173   EVSVQANILKVTRRVLMSSGFMFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTT  231

Query  1118  glldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQ  939
             G+++LGG+S QV     E    E       G+V + L ++S   FG N A ++  + L  
Sbjct  232   GIVELGGASAQVTFVSSEPMPPEFSRTISFGNVSYNLYSHSFLHFGQNAAHEKLWSSLVS  291

Query  938   TQARRESRGE-IFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
                  E  G+ IF    PC   G+  +   +    ++ S      SR++           
Sbjct  292   KDQNSEPTGQGIFT--DPCAPKGYDPDRNTQ----KRLSGFLSEESRLLAS------FQA  339

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
               N+ +C+  A+ +    +     K + Q+C    S GS      T       R+ A   
Sbjct  340   GGNYSECRAAALTILQEGNE----KCSYQHC----SIGS------TFTPKLRGRFLATEN  385

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLI  429
             FF       L  +A L+ M   G+  C   W         +++ D    CF   Y+ SL+
Sbjct  386   FFYTSKFFGLGEKAWLSNMISAGERFCGEDWSKLRVKDPSLEEDDLLRYCFSSAYIVSLL  445

Query  428   KDAL--CLSNLEIIFG--PGD---VSWALGAALIE  345
              D L   L +  + F    GD   + WALGA +++
Sbjct  446   HDTLGIPLDDERVGFASQAGDNIPLDWALGAFILQ  480



>gb|KFK33477.1| hypothetical protein AALP_AA5G018300 [Arabis alpina]
Length=551

 Score =   110 bits (276),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 121/487 (25%), Positives = 212/487 (44%), Gaps = 74/487 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +    G+ P+             G  Y  ++  PGL+ +  +
Sbjct  82    YSVVIDGGSTGTRIHVFRYRIEFGK-PVF---------EFRGGDYASLKLHPGLSAYSDD  131

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A+  +P G    T + ++ATAGMR + +    +++     ++K  G
Sbjct  132   PDGASLSLMELVEFAKGRIPKGLWKETEVRLMATAGMRLVELSVQEKILGVARRVLKSSG  191

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV     E  
Sbjct  192   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTTGIVELGGASAQVTFVSSEPV  250

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRAL-AILSQTQARRES-RGEIFKVRHPC  885
               E      IG+V + L ++S   FG N A ++   +++S+ Q   ES R  IF    PC
Sbjct  251   PPEFSRTISIGNVSYNLYSHSFLHFGQNAAHEKLWGSLVSKDQNSVESTRKGIFT--DPC  308

Query  884   LSSGF-----VQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
                G+      Q     G   ++              + ++ L  G  N+ +C+  A+ +
Sbjct  309   APKGYNLDTIAQKQHLSGFLAEE-------------SKFSASLQAGG-NYSECRSAALTI  354

Query  719   ATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRA  540
                 ++    K + Q+C    S GS     L        R+ A   FF       L  ++
Sbjct  355   LQEGND----KCSYQHC----SIGSSLTPKLQ------GRFLATENFFYTSKFFGLGEKS  400

Query  539   NLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALC--LSNLEII  393
              L+ M   G+  C   W         +D+ D    CF   Y+ SL+ D L   L +  + 
Sbjct  401   WLSNMISAGEKFCGEDWSKLRVKDPSLDEEDLLRYCFSSAYIVSLLHDTLGVPLDDERVK  460

Query  392   FG--PGD---VSWALGAALIEGGEHSRLIATESRRKGLATQHKWM----VSSSITLFIVL  240
             +    GD   + WALGA +++        A  S+  G +  H +       S+  L+++ 
Sbjct  461   YANQAGDNIPLDWALGAFILQTA------AETSQHTGSSNLHSFYALFGTDSNTLLYLIG  514

Query  239   VCVLMIV  219
             + +L+ V
Sbjct  515   IPILITV  521



>ref|NP_565293.1| probable apyrase 6 [Arabidopsis thaliana]
 sp|O80612.2|APY6_ARATH RecName: Full=Probable apyrase 6; Short=AtAPY6; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
6 [Arabidopsis thaliana]
 gb|AAC32915.2| putative nucleoside triphosphatase [Arabidopsis thaliana]
 gb|AEC05650.1| probable apyrase 6 [Arabidopsis thaliana]
 gb|AEJ38087.1| nucleoside triphosphate diphosphohydrolase 6 [Arabidopsis thaliana]
Length=555

 Score =   110 bits (276),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 120/465 (26%), Positives = 195/465 (42%), Gaps = 72/465 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ F  +
Sbjct  87    YSVVIDGGSTGTRIHVFGYRIESGK-PVF---------EFRGANYASLKLHPGLSAFADD  136

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A+  VP G    T + ++ATAGMR L +    +++     ++K  G
Sbjct  137   PDGASVSLTELVEFAKGRVPKGMWIETEVRLMATAGMRLLELPVQEKILGVARRVLKSSG  196

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV     E  
Sbjct  197   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTTGIVELGGASAQVTFVSSEPM  255

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E       G+V + L ++S   FG N A D+   +L       A   +R +IF    P
Sbjct  256   PPEFSRTISFGNVTYNLYSHSFLHFGQNAAHDKLWGSLLSRDHNSAVEPTREKIFT--DP  313

Query  887   CLSSGF-----VQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             C   G+      Q H   G   ++               L+     G  N+ +C+  A+ 
Sbjct  314   CAPKGYNLDANTQKH-LSGLLAEE-------------SRLSDSFQAGG-NYSQCRSAALT  358

Query  722   VATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
             +  + +     K + Q+C    S GS      T       R+ A   FF       L  +
Sbjct  359   ILQDGNE----KCSYQHC----SIGS------TFTPKLRGRFLATENFFYTSKFFGLGEK  404

Query  542   ANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEI  396
             A L+ M   G+  C   W         + + D    CF   Y+ SL+ D L   L +  I
Sbjct  405   AWLSNMISAGERFCGEDWSKLRVKDPSLHEEDLLRYCFSSAYIVSLLHDTLGIPLDDERI  464

Query  395   IFG--PGDV--SWALGAALIEGGEHSRLIATESRRKGLATQHKWM  273
              +    GD+   WALGA + +        ATE+ +   +    W 
Sbjct  465   GYANQAGDIPLDWALGAFIQQ-------TATETSQHAASGNLHWF  502



>ref|XP_009616750.1| PREDICTED: probable apyrase 6 [Nicotiana tomentosiformis]
Length=541

 Score =   110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 113/458 (25%), Positives = 199/458 (43%), Gaps = 60/458 (13%)
 Frame = -1

Query  1649  FAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGC  1470
             F FS  L   V+K+   + +V+D GSTG+R++++E+   +G  P+      G ++     
Sbjct  62    FVFSSKLRFSVKKK---YGIVIDGGSTGTRIHVFEYEVRDGVGPVFDFGEKGLVS-----  113

Query  1469  KYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
                 ++  PGL+ +         S+  L+   +K VP      T I ++ATAGMR L ++
Sbjct  114   ----MRVNPGLSAYAEEPEMASESVAELVEFGKKSVPKEYWSETEIRLMATAGMRLLDLD  169

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
                +++E    ++++ GF +  D+  V+SG +E  Y WV  NY +  LG +    T G++
Sbjct  170   VQEKILEVCRKVLRDSGFKFMNDWASVISGSDEGLYAWVIANYALGTLG-SDPLQTTGII  228

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             +LGG+S QV    DE    E+    +  +  +K+ ++SL  FG N AFD  L + S    
Sbjct  229   ELGGASAQVTFVSDEPMPHEYSRTIKFRNFTYKIYSHSLLQFGQNVAFD--LLLESLVAR  286

Query  929   RRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDP--  756
              ++   +  K+  PC   G+  N                  S     + N  L    P  
Sbjct  287   GQDQAAQSVKLMDPCSPRGYTHN------------LRSLKLSPSSLADKNRFLSALYPSG  334

Query  755   NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSY-GSDRMQNLTLNSHEVTRYHALSGF  579
             N+ +C+         S++L   +  +++C     Y GS  M  L        ++ A   F
Sbjct  335   NFSECR---------SASLSLLQKGKESCPYKSCYIGSTFMPKLQ------GKFLATENF  379

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIK  426
             F       L  +A L+ +   G+  C   W         + + D +  CF   Y+ +L+ 
Sbjct  380   FHTSKFFGLPPKAFLSDLMAAGKSFCEEDWSRLKSKYHSLQEEDLHRYCFSSAYILALLH  439

Query  425   DALCLSNLEIIFGPGD------VSWALGAALIEGGEHS  330
             D+L +   +   G  +      + WALGA +++    S
Sbjct  440   DSLGIGLDDDRIGYANQVENIPLDWALGAFILQSTAES  477



>gb|AAK62457.1|AF387012_1 putative nucleoside triphosphatase [Arabidopsis thaliana]
Length=555

 Score =   110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 120/465 (26%), Positives = 195/465 (42%), Gaps = 72/465 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ F  +
Sbjct  87    YSVVIDGGSTGTRIHVFGYRIESGK-PVF---------EFRGANYASLKLHPGLSAFADD  136

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A+  VP G    T + ++ATAGMR L +    +++     ++K  G
Sbjct  137   PDGASVSLTELVEFAKGRVPKGMWIETEVRLMATAGMRLLELPVQEKILGVARRVLKSSG  196

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV     E  
Sbjct  197   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PLKTTGIVELGGASAQVTFVSSEQM  255

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E       G+V + L ++S   FG N A D+   +L       A   +R +IF    P
Sbjct  256   PPEFSRTISFGNVTYNLYSHSFLHFGQNAAHDKLWGSLLSRDHNSAVEPTREKIFT--DP  313

Query  887   CLSSGF-----VQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             C   G+      Q H   G   ++               L+     G  N+ +C+  A+ 
Sbjct  314   CAPKGYNLDANTQKH-LSGLLAEE-------------SRLSDSFQAGG-NYSQCRSAALT  358

Query  722   VATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
             +  + +     K + Q+C    S GS      T       R+ A   FF       L  +
Sbjct  359   ILQDGNE----KCSYQHC----SIGS------TFTPKLRGRFLATENFFYTSKFFGLGEK  404

Query  542   ANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEI  396
             A L+ M   G+  C   W         + + D    CF   Y+ SL+ D L   L +  I
Sbjct  405   AWLSNMISAGERFCGEDWSKLRVKDPSLHEEDLLRYCFSSAYIVSLLHDTLGIPLDDERI  464

Query  395   IFG--PGDV--SWALGAALIEGGEHSRLIATESRRKGLATQHKWM  273
              +    GD+   WALGA + +        ATE+ +   +    W 
Sbjct  465   GYANQAGDIPLDWALGAFIQQ-------TATETSQHAASGNLHWF  502



>ref|XP_010554315.1| PREDICTED: probable apyrase 6 isoform X2 [Tarenaya hassleriana]
Length=530

 Score =   110 bits (274),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 113/439 (26%), Positives = 190/439 (43%), Gaps = 64/439 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ +  +
Sbjct  65    YSVVIDGGSTGTRIHVFGYRIESGK-PVF---------DFRGHNYASLKVNPGLSAYADD  114

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
              +G   SL  L+  A++ +P G R  + I ++ATAGMR L +    R++E V  +++  G
Sbjct  115   PNGAAVSLSELVEFAKRRIPKGLRMESEIRLMATAGMRLLELPAQERILEVVRRVLRSSG  174

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R D+  V+SG +E  Y WV  NY +  LG      T G+++LGG+S QV     E  
Sbjct  175   FKFRDDWASVISGSDEGIYAWVIANYALGSLGGD-PLQTTGIIELGGASAQVTFVSSEPV  233

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR---HP  888
               E       G++ + L ++S   FG N A ++    L    A   S  E    R    P
Sbjct  234   PSEFSRTISFGNISYSLYSHSFLHFGQNAAHEKLWESL--VSADHNSAAESLPKRIFIDP  291

Query  887   CLSSGFVQNHT----CRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             C   G+  +        G    K               L+S+   G  ++ +C+  A+ +
Sbjct  292   CTPKGYDLDMNWPKLLSGLLADK-------------NRLSSLRAGG--SFSQCRSAALTI  336

Query  719   ATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRA  540
                     +     + C    S GS     L  N      + A   FF       L  +A
Sbjct  337   LQEG----KETCTYRQC----SVGSTFTPKLRGN------FLATENFFYTSKFFGLGEKA  382

Query  539   NLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS--NLEII  393
             +L+ +   G+  C   W         ++  D    CF   Y+A+L+ D+L +S  +  I+
Sbjct  383   SLSDLISAGEKFCGEDWSKLRVKNPSLEDEDLLRYCFSSAYIAALLHDSLGISPDDGRIM  442

Query  392   F----GPGDVSWALGAALI  348
             F    G   + WALGA ++
Sbjct  443   FTNQAGDMPLDWALGAFIL  461



>ref|XP_009152223.1| PREDICTED: probable apyrase 6 [Brassica rapa]
Length=553

 Score =   110 bits (274),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 120/490 (24%), Positives = 211/490 (43%), Gaps = 60/490 (12%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ +  +
Sbjct  84    YSVVIDGGSTGTRIHVFGYRIESGK-PVF---------EFRGANYASLKLHPGLSAYAED  133

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G  A+L+ L+  A+  VP G    T + ++ATAGMR L +    +++     ++   G
Sbjct  134   PEGASAALRELVEFAKGRVPRGMWVETEVRLMATAGMRLLEVSVQEKILGVARRVLGSSG  193

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV     E  
Sbjct  194   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PIKTTGIVELGGASAQVTFVSSEPM  252

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRH--PC  885
               E       G+V + L ++S   FG N A ++    L  ++ R  +   I + +H  PC
Sbjct  253   PSEFSRTVSFGNVSYSLYSHSFLHFGQNAAHEKLWGSLV-SRDRNSAVEPIREGKHADPC  311

Query  884   LSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSS  705
                G+  +        QK  S   +    +     ++      N+ +C+  A+ +    +
Sbjct  312   APKGYNLD-----TITQKHLSGFLAEESKLASSFQAV-----GNYSECRSAALSILQEGN  361

Query  704   NLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKM  525
             +    K + Q+C    S GS      T       R+ A   FF       L  ++ L+ M
Sbjct  362   D----KCSYQHC----SIGS------TFTPKLQGRFLATENFFYTSKFFGLGEKSWLSNM  407

Query  524   WETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALC--LSNLEIIFG--P  384
                G+  C   W         +++ D    CF   Y+ SL+ D L   L +  + F    
Sbjct  408   ISAGERFCGEDWSKLRVKDPSLEEEDLLRYCFSSAYIVSLLHDTLGVPLDDERVGFANQA  467

Query  383   GD---VSWALGAALIEGGEHSRLIATESRRK------GLATQHKWMVSSSITLFIVLVCV  231
             GD   + WALGA +++    +   A+ S         G+ +Q          L  VLVC+
Sbjct  468   GDDIPLDWALGAFILQTEASTSQHASSSHLHWFYALFGIDSQTLLYFIGVPILMTVLVCL  527

Query  230   LMIVYRSQIK  201
             +    + Q+K
Sbjct  528   ISKWRKPQLK  537



>ref|XP_010554314.1| PREDICTED: probable apyrase 6 isoform X1 [Tarenaya hassleriana]
Length=548

 Score =   109 bits (273),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 113/439 (26%), Positives = 190/439 (43%), Gaps = 64/439 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ +  +
Sbjct  83    YSVVIDGGSTGTRIHVFGYRIESGK-PVF---------DFRGHNYASLKVNPGLSAYADD  132

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
              +G   SL  L+  A++ +P G R  + I ++ATAGMR L +    R++E V  +++  G
Sbjct  133   PNGAAVSLSELVEFAKRRIPKGLRMESEIRLMATAGMRLLELPAQERILEVVRRVLRSSG  192

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R D+  V+SG +E  Y WV  NY +  LG      T G+++LGG+S QV     E  
Sbjct  193   FKFRDDWASVISGSDEGIYAWVIANYALGSLGGD-PLQTTGIIELGGASAQVTFVSSEPV  251

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR---HP  888
               E       G++ + L ++S   FG N A ++    L    A   S  E    R    P
Sbjct  252   PSEFSRTISFGNISYSLYSHSFLHFGQNAAHEKLWESL--VSADHNSAAESLPKRIFIDP  309

Query  887   CLSSGFVQNHT----CRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             C   G+  +        G    K               L+S+   G  ++ +C+  A+ +
Sbjct  310   CTPKGYDLDMNWPKLLSGLLADK-------------NRLSSLRAGG--SFSQCRSAALTI  354

Query  719   ATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRA  540
                     +     + C    S GS     L  N      + A   FF       L  +A
Sbjct  355   LQEG----KETCTYRQC----SVGSTFTPKLRGN------FLATENFFYTSKFFGLGEKA  400

Query  539   NLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS--NLEII  393
             +L+ +   G+  C   W         ++  D    CF   Y+A+L+ D+L +S  +  I+
Sbjct  401   SLSDLISAGEKFCGEDWSKLRVKNPSLEDEDLLRYCFSSAYIAALLHDSLGISPDDGRIM  460

Query  392   F----GPGDVSWALGAALI  348
             F    G   + WALGA ++
Sbjct  461   FTNQAGDMPLDWALGAFIL  479



>ref|XP_005842970.1| hypothetical protein CHLNCDRAFT_141807 [Chlorella variabilis]
 gb|EFN50868.1| hypothetical protein CHLNCDRAFT_141807 [Chlorella variabilis]
Length=325

 Score =   107 bits (266),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 124/236 (53%), Gaps = 11/236 (5%)
 Frame = -1

Query  1631  LILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGE-FPILVNTYPGNLTRSDGCK----  1467
             LIL+       + +V+D GS+G+R+  Y W   +G     L+   P +       +    
Sbjct  24    LILHGGSAEPRYVLVIDAGSSGTRMYAYTWHDGSGAGVAPLLAAVPSSAAAHKVPRRAMP  83

Query  1466  ----YHCVQTEPGLAMFVGNASGLRA-SLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRR  1302
                 Y  V+TEPGL  FVG+  GL+A +L PL+  AE  VP  +   TP+F+  TAG+RR
Sbjct  84    GRRAYQRVETEPGLDQFVGDGQGLQAKALGPLLEWAEAVVPRWQWKQTPMFLFGTAGLRR  143

Query  1301  LPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRML-GNTsgsh  1125
             L       ++EGV  +++   F +   + R++SG +E  YGWVALNY    L  + +G+ 
Sbjct  144   LSAAQQEGLLEGVRDVLQHSVFRFSPPWARIISGVDEGVYGWVALNYMEGTLRRDNTGAD  203

Query  1124  tlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRA  957
             TLG LDLGGSSL+V          E    + +    H+L A+    +G N+AFDR+
Sbjct  204   TLGALDLGGSSLEVTFAAHSVPWPEDAVNATVLGASHQLYAHVHHHYGLNDAFDRS  259



>ref|XP_011075504.1| PREDICTED: probable apyrase 6 [Sesamum indicum]
Length=542

 Score =   109 bits (272),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 113/462 (24%), Positives = 207/462 (45%), Gaps = 63/462 (14%)
 Frame = -1

Query  1646  AFSPSLILYV--------RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGN  1491
             +FS +L+L+          + +  + VV+D GSTG+R++++++   NG   +L  +  G 
Sbjct  52    SFSVALVLFCYILFFGDKNQESKRYGVVIDGGSTGTRIHVFKYEVRNGSL-VLDFSEKGL  110

Query  1490  LTRSDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAG  1311
             ++         ++  PGL+ +        A++  L+  A++ +P  K   T + ++ATAG
Sbjct  111   VS---------MRVNPGLSAYAEEPEKAGAAVAELMEFAKRNIPREKWAYTEVRLMATAG  161

Query  1310  MRRLPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsg  1131
             MR L      R++     I+K  GF +  D+  V+SG +E  Y WV  NY +  LG    
Sbjct  162   MRLLKHGYQERILNACRKILKASGFKFHDDWAAVISGSDEGLYAWVVANYALGTLG-AEP  220

Query  1130  shtlglldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFD---R  960
             + T G+++LGG+S QV    +E    E   + + G+  + L ++SL  FG N AFD    
Sbjct  221   AQTTGIIELGGASAQVTFVSNEPMPPEFSRKVKFGNFTYNLYSHSLLHFGQNVAFDLLKE  280

Query  959   ALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELN  780
             +L    Q  A    R E  K+  PC   G+  N   +      P+S  + +  + T    
Sbjct  281   SLVSGGQELATESIRRE--KLMDPCTPRGYAPN---KDTLKLSPTSLIEKNRYLST----  331

Query  779   SILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTR  600
                +L   N+ +C+  A+++       ++ + +   C      GS  +  L        +
Sbjct  332   ---LLASGNFSECRSAALKLLQK----DQDRCSYPTCY----IGSTFIPKLK------GK  374

Query  599   YHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRIL  447
             + A   FF       L  RA L+ +  +GQ  C+  W         +++ D    CF   
Sbjct  375   FLATENFFHTSKFFGLDQRAFLSDLVVSGQQFCAEDWSKLAQKYNSLEEEDLLRYCFSSA  434

Query  446   YMASLIKDALCLSNLEIIFGPGD------VSWALGAALIEGG  339
             Y+ +++ D+L ++  +   G  +      + WALGA +++  
Sbjct  435   YIVAMLHDSLGIALDDQRIGYANQVHDIPLDWALGAFILQSA  476



>ref|XP_010939490.1| PREDICTED: probable apyrase 6 isoform X2 [Elaeis guineensis]
Length=479

 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 107/422 (25%), Positives = 180/422 (43%), Gaps = 58/422 (14%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTE  1446
             +Y    +S F +++D GSTGSR++++ +    G  P+L           D      ++  
Sbjct  70    VYRSSGSSKFGIIVDGGSTGSRIHVFGYTNRQGALPVL-----------DFGVMASMKAS  118

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PGL+ + G+  G   SL  L+   +  VP  + G T I ++ATAG+R L    A R+++ 
Sbjct  119   PGLSAYSGDPEGAGRSLVELLEFGKARVPRDQWGETEIRLMATAGLRLLDAGVAERILDS  178

Query  1265  VVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQ  1086
                +++  GF ++ D+  V+SG +E  Y WVA NY +  LG      T G+++LGG+S Q
Sbjct  179   CRKVLRSSGFQFQDDWATVISGSDEGIYAWVAANYALGSLGGD-PGKTTGIIELGGASAQ  237

Query  1085  VVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT--QARRESRG  912
             V     E    E       G   + L ++S    G N A++    +LS    ++  ES+ 
Sbjct  238   VTFVSSEPLSPEFSHVLNFGETTYNLYSHSFLHLGQNVAYESLHELLSSRVLKSSAESQQ  297

Query  911   EIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS-----ILVLGDPNWE  747
             E    R PC   G+  +H+                 ++    LNS      +     N+ 
Sbjct  298   EPI-YRDPCTPRGY--SHSVESL-------------KLSAGVLNSRTEYRPVAHATGNFS  341

Query  746   KCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVY  567
             +C+  ++E+       E+ K   Q+C      GS  M  L        R  A   FF   
Sbjct  342   ECRSASLELLQK----EKDKCLHQSCY----LGSALMPKLH------GRLLATENFFYTA  387

Query  566   NMLNLSSRANLTKMWETGQGLCSRSWV---------DQTDANGLCFRILYMASLIKDALC  414
                 L   + L+ +   G+  C   W+         D+ D    CF   Y+ +L+ D+L 
Sbjct  388   KFFGLGPTSFLSDLMLAGEQFCGEDWLKLKGNYHSTDEDDLLRYCFSSAYIVALLHDSLG  447

Query  413   LS  408
             ++
Sbjct  448   IA  449



>emb|CDY03024.1| BnaC07g22030D [Brassica napus]
Length=552

 Score =   108 bits (269),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 117/490 (24%), Positives = 210/490 (43%), Gaps = 60/490 (12%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ +  +
Sbjct  83    YNVVIDGGSTGTRIHVFGYRIESGK-PVF---------EFRGANYASLKLHPGLSAYADD  132

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G  A+L  L+  A+  VP G    T + ++ATAGMR L      +++     ++   G
Sbjct  133   PEGASAALTELVEFAKGRVPRGMWVETEVRLMATAGMRLLEAPAQEKILGVARSVLGSSG  192

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV    +E  
Sbjct  193   FLFRDEWASVISGSDEGVYAWVVANFALGSLGGD-PIKTTGIVELGGASAQVTFVSNEPV  251

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRH--PC  885
               E       G+V + L ++S   FG N A ++    L  ++ R  +     + +H  PC
Sbjct  252   PSEFSRTISFGNVSYSLYSHSFLHFGQNAAHEKLWGSLV-SRDRNSAVEPTLEGKHADPC  310

Query  884   LSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSS  705
                G+  +        QK  S   +    +     ++      N+ +C+  A+ +    +
Sbjct  311   APKGYSLD-----AITQKHLSGFLAEESKLASSFQAV-----GNYSECRSAALSILQEGN  360

Query  704   NLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKM  525
             +    K + Q+C  + S  + ++Q          R+ A   FF       L  ++ L+ M
Sbjct  361   D----KCSYQHC-SIGSMFTPKLQG---------RFLATENFFYTSKFFGLGEKSWLSNM  406

Query  524   WETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALC--LSNLEIIFG--P  384
                G+  C   W         +++ D    CF   Y+ SL+ D L   L +  + F    
Sbjct  407   ISAGERFCGEDWSKLRVKDPSLEEEDLLRYCFSSAYIVSLLHDTLGVPLDDERVGFANQA  466

Query  383   GD---VSWALGAALIEGGEHSRLIATESRRK------GLATQHKWMVSSSITLFIVLVCV  231
             GD   + WALGA +++    +   A+ S         G+ +Q          L  VLVC+
Sbjct  467   GDDIPLDWALGAFILQTEASTSQHASSSHLHWFYALFGIDSQTLLYFIGVPILMTVLVCL  526

Query  230   LMIVYRSQIK  201
             +    + Q+K
Sbjct  527   ISKWRKPQLK  536



>ref|XP_010527907.1| PREDICTED: probable apyrase 6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010527908.1| PREDICTED: probable apyrase 6 isoform X2 [Tarenaya hassleriana]
Length=550

 Score =   107 bits (267),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 108/436 (25%), Positives = 191/436 (44%), Gaps = 58/436 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+R++++ +   +G+ P+             G  Y  ++  PGL+ +  +
Sbjct  83    YSVVIDGGSTGTRIHVFGYRIESGK-PVF---------DFRGQNYASLKVNPGLSAYAED  132

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL  L+  A++ +P G    + I ++ATAGMR L +    R++E    +++  G
Sbjct  133   PDGADVSLSELVEFAKRRIPKGLWIESEIRLMATAGMRLLELPVQERILEVTRRVLRTSG  192

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  NY +  LG      T G+++LGG+S QV     E  
Sbjct  193   FKFRDEWSSVISGSDEGIYAWVVANYALGTLGGD-PLQTTGIIELGGASAQVTFLSSEPV  251

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDR---ALAILSQTQARRESRGEIFKVRHP  888
               E       G+  + L ++S   FG N A ++   +L    Q  A    +  IF    P
Sbjct  252   PPEFSRTVSFGNFSYSLYSHSFLHFGQNAAHEKLWGSLVSAEQNSAAESVQKRIFM--DP  309

Query  887   CLSSGF-VQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATN  711
             C+  G+ +  ++ +   G             +  +     V    N+ +C+  A+ +  +
Sbjct  310   CIPKGYDLDTNSPKLLSG------------FLAGKNTFTAVQAGGNFSECRSAALAILQD  357

Query  710   SSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLT  531
                  +     Q+C    S GS      T       ++ A   FF       L  +A+L+
Sbjct  358   G----KDACPYQHC----SVGS------TFTPKLRGKFLATENFFYTSKFFGLGEKASLS  403

Query  530   KMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS--NLEIIF--  390
              +   G+  C   W         ++  D    CF   Y+A+L+ D+L +S  +  +IF  
Sbjct  404   DLIFAGEKFCGEDWSKLRVKNPSLEDEDLLRYCFSSAYIAALLHDSLGISPDDGRVIFTN  463

Query  389   --GPGDVSWALGAALI  348
               G   + WALGA ++
Sbjct  464   QAGEIPLDWALGAFIL  479



>ref|XP_010258343.1| PREDICTED: probable apyrase 6 isoform X1 [Nelumbo nucifera]
Length=549

 Score =   107 bits (267),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 119/485 (25%), Positives = 212/485 (44%), Gaps = 71/485 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             F +VLD GSTG+R++++ +  N    P+      G            ++  PGL+ +  N
Sbjct  84    FAIVLDGGSTGTRIHVFRFSINGKGVPLFDFGKDG---------LASMRVNPGLSSYSAN  134

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                  +SL  L++ A++ +P    G T I ++ATAG+RRL ++   R+++    ++ +  
Sbjct  135   PENAASSLLKLLKFAKERIPKDHWGETEIRLMATAGLRRLDLDIQERILDSCRKVLSDSD  194

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R  +  V++G +E  Y WVA NY +  LG     +T G+++LGG+S QV     E  
Sbjct  195   FLFRDHWASVITGSDEGLYAWVAANYALGTLGGD-PQNTTGIIELGGASAQVTFVSSEPL  253

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQAR--RESRGEIFKVRHPC  885
               E     + G+  + L ++SL  FG N A+D    +L+    +   +S GE   +  PC
Sbjct  254   PPEFSHTLKFGNFTYNLYSHSLLHFGQNVAYDSLQELLASRDWKFSAQSVGETVSI-DPC  312

Query  884   LSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSS  705
                G+  +H  +  F   P +  D  S+     L ++   G  N+ +C+  A+ +     
Sbjct  313   SPKGY--SHEVQ--FQSLPPAVLDEKSKY----LPTLHARG--NFSECRSAALMLLQKG-  361

Query  704   NLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKM  525
                + K   Q+C      GS  +  L        ++ A   F+       L   A L+ +
Sbjct  362   ---KEKCPFQHCY----IGSTFIPKLQ------GKFLATENFYHTSKFFRLPETAFLSNL  408

Query  524   WETGQGLCSR---------SWVDQTDANGLCFRILYMASLIKDALCLS-NLEIIFGPGDV  375
               TGQ  C           S + + D    CF   Y+ +L+ D L +S + + I     V
Sbjct  409   MXTGQQFCEEDRSALKKKYSSLSEDDLLRYCFSSSYIVALLHDTLGISLDDQRILVANQV  468

Query  374   S-----WALGAALIEGGEHSRLIATESRRKGLATQHKWMVSSS-------ITLFIVLVCV  231
             +     WALGA +++    S +            +  W+V++        ++LF V + V
Sbjct  469   ANMPLDWALGAFILQNTAESGM------------EVDWIVTNVSDDSSMLVSLFFVFIMV  516

Query  230   LMIVY  216
             +   +
Sbjct  517   IFTAW  521



>ref|XP_010258344.1| PREDICTED: probable apyrase 6 isoform X2 [Nelumbo nucifera]
Length=518

 Score =   106 bits (264),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 113/440 (26%), Positives = 196/440 (45%), Gaps = 52/440 (12%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             F +VLD GSTG+R++++ +  N    P+      G            ++  PGL+ +  N
Sbjct  84    FAIVLDGGSTGTRIHVFRFSINGKGVPLFDFGKDG---------LASMRVNPGLSSYSAN  134

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                  +SL  L++ A++ +P    G T I ++ATAG+RRL ++   R+++    ++ +  
Sbjct  135   PENAASSLLKLLKFAKERIPKDHWGETEIRLMATAGLRRLDLDIQERILDSCRKVLSDSD  194

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R  +  V++G +E  Y WVA NY +  LG     +T G+++LGG+S QV     E  
Sbjct  195   FLFRDHWASVITGSDEGLYAWVAANYALGTLGGD-PQNTTGIIELGGASAQVTFVSSEPL  253

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQAR--RESRGEIFKVRHPC  885
               E     + G+  + L ++SL  FG N A+D    +L+    +   +S GE   +  PC
Sbjct  254   PPEFSHTLKFGNFTYNLYSHSLLHFGQNVAYDSLQELLASRDWKFSAQSVGETVSI-DPC  312

Query  884   LSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSS  705
                G+  +H  +  F   P +  D  S+     L ++   G  N+ +C+  A+ +     
Sbjct  313   SPKGY--SHEVQ--FQSLPPAVLDEKSKY----LPTLHARG--NFSECRSAALMLLQKG-  361

Query  704   NLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKM  525
                + K   Q+C      GS  +  L        ++ A   F+       L   A L+ +
Sbjct  362   ---KEKCPFQHCY----IGSTFIPKLQ------GKFLATENFYHTSKFFRLPETAFLSNL  408

Query  524   WETGQGLCSR---------SWVDQTDANGLCFRILYMASLIKDALCLS-NLEIIFGPGDV  375
               TGQ  C           S + + D    CF   Y+ +L+ D L +S + + I     V
Sbjct  409   MXTGQQFCEEDRSALKKKYSSLSEDDLLRYCFSSSYIVALLHDTLGISLDDQRILVANQV  468

Query  374   S-----WALGAALIEGGEHS  330
             +     WALGA +++    S
Sbjct  469   ANMPLDWALGAFILQNTAES  488



>ref|XP_005773354.1| hypothetical protein EMIHUDRAFT_435744 [Emiliania huxleyi CCMP1516]
 gb|EOD20925.1| hypothetical protein EMIHUDRAFT_435744 [Emiliania huxleyi CCMP1516]
Length=461

 Score =   105 bits (262),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 111/434 (26%), Positives = 191/434 (44%), Gaps = 70/434 (16%)
 Frame = -1

Query  1592  VVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGNAS  1413
             +V D GS+G+RV++Y W    G          G+    D      ++ +PGL+ F G   
Sbjct  33    LVFDAGSSGTRVHVYSWKIGGG----------GSKDSFDLIADDLLKIKPGLSSFKGEPE  82

Query  1412  GLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHGFF  1233
                ASL+PL+  A++ VP+     TP+F++ATAG+R +       ++  V   + + GF 
Sbjct  83    QAGASLRPLLAYAKEKVPAAAVPATPVFLMATAGLRLVGEGAKDAILASVCDELGKSGFR  142

Query  1232  YRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDE--FR  1059
             +R ++  +L G +E  YGWV +NY +  L   + +  +G +DLGG S+QVV    E    
Sbjct  143   FRCEWATLLGGEDEGLYGWVTVNYLLGALYPPAKTPAVGTIDLGGGSVQVVFATSEPVPN  202

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLS  879
              DE    +  G+ +H L   S   +G +EA  +AL  L     R E + E F  RHPCL 
Sbjct  203   PDESQLLT-FGARQHSLYVKSHLGYGLDEARRKALDSL--VSRRAEDKPEPF--RHPCLP  257

Query  878   SGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNL  699
              G    H  +                          ++GD +W +C  +   +       
Sbjct  258   RGASLEHGGKS-------------------------LVGDADWARCLRVMGRLFPQPFAA  292

Query  698   ERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFF-----AVYNMLNLSSRANL  534
              + K+A++      SY  DR   + L   +  ++ +++  +     A  ++  LS+    
Sbjct  293   GQPKLADRFYG--FSYMYDRTAAIGLLDGQPRQFGSVAMSYNDIAAAGESLCRLSAEETA  350

Query  533   TKMWETGQGLCSRSWVDQTDANGLCFRILYMASLIK-------DALCLSN-LEIIFGPGD  378
             T+   T          D   +N  C  + Y+A+L+K        ++ ++N +E +    +
Sbjct  351   TRFANT---------QDAAKSNNYCGDVAYVAALLKALGFEGDTSITMTNKIEKV----E  397

Query  377   VSWALGAALIEGGE  336
             + W LGA L +  E
Sbjct  398   LVWTLGAMLAKSAE  411



>gb|KHN12207.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Glycine soja]
Length=537

 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 110/454 (24%), Positives = 195/454 (43%), Gaps = 65/454 (14%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNG-EFPILVNTYPGNLTRSD  1476
             Y+AFS  +  +       + +++D GSTG+RV+++++      EF              D
Sbjct  65    YYAFSSPMANF------RYRIIVDGGSTGTRVHVFKYRSGRSLEFG------------RD  106

Query  1475  GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
             G K   ++  PGL+ F  +  G   S+  L   A++W+P    G T I ++ATAG+R L 
Sbjct  107   GLK--SMRVNPGLSAFAEDPQGAGGSVAELTEFAKRWIPRESWGETEIRLMATAGLRMLD  164

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg  1116
                  R++     ++++ GF +R ++  V++G +E  Y WV  NY +  LG      T G
Sbjct  165   AAAQERILASCRKVLRDSGFKFRDEWASVITGSDEGMYAWVVANYALGTLGGD-PLETTG  223

Query  1115  lldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFD--RALAILS  942
             +++LGG+S QV     E          +  +  + L ++S   FG N A D  +   +L 
Sbjct  224   IIELGGASAQVTFVSREVVLPSFSRTVKFANTTYNLYSHSFLHFGLNAAHDSWKEALVLG  283

Query  941   QTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
             +     +S  E  ++  PC  +G+  N      +   PS+  +   +         +V  
Sbjct  284   EFNLASQSLQEGLRI-DPCTPTGYSYNVE---SWKFPPSTESEKKHQS--------IVQT  331

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
               N+ +C+  A+ +        +   + Q+C      GS  +  L        ++ A   
Sbjct  332   RGNFSECRSAALTLLQKG----KESCSYQHC----DIGSTFIPKLQ------GKFLATEN  377

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSWV---------DQTDANGLCFRILYMASLI  429
             FF       L SRA L+K+   GQ  C   W+         D+ D    CF   Y+ +L+
Sbjct  378   FFYTSKFFGLRSRAYLSKLMSVGQEFCGEDWLRLKKKYVSHDEDDLLRYCFSSAYIVALL  437

Query  428   KDALCLS------NLEIIFGPGDVSWALGAALIE  345
              D+L ++       +    G   + WALGA +++
Sbjct  438   HDSLGIALDDERVKVANQVGSIPLDWALGAFILQ  471



>emb|CDY49103.1| BnaA06g09030D [Brassica napus]
Length=471

 Score =   105 bits (261),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 109/440 (25%), Positives = 191/440 (43%), Gaps = 77/440 (18%)
 Frame = -1

Query  1610  RASY-FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLA  1434
             R+S+ ++VV+D GS+GSR +++ +   +G+ P+       +    +   Y  ++  PGL+
Sbjct  72    RSSFRYSVVIDAGSSGSRAHVFRYWLESGK-PVF------DFGEEN---YASLKLSPGLS  121

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
              +  N  G   S+K L+  A+  VP      + I ++ATAGMR L +     ++E   G+
Sbjct  122   SYADNPQGASVSVKELVEFAKGRVPKDVLKKSEIRLMATAGMRLLDVSVQEEILEVTRGV  181

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             ++  GF ++ ++  V+SG +E  Y WV  NY +  LG     HT G+++LGG+S QV   
Sbjct  182   LRSSGFKFQDEWASVISGFDEGMYAWVVANYALGSLGGD-PLHTTGIVELGGASAQVTFV  240

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR  894
               E            G V +K+ ++S   +G +EA +  L  L  + A ++       V 
Sbjct  241   SSETAPPGFSRTISYGGVSYKIYSHSFLHYGQDEAQEEILKSLQNSAASKDGI-----VT  295

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
              PC   G++ ++                         NS+   G  N+  C+        
Sbjct  296   DPCTPKGYIYDN-------------------------NSVQAAG--NYSACR--------  320

Query  713   NSSNLERSKVAEQNCV-GLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
              S+ L + +  ++NC     S GS    +L        ++ A   F+       L  +  
Sbjct  321   -SATLAKLQDGKENCAYAHCSIGSTFTPDLQ------GKFLATENFYHTSKFFGLDEKDW  373

Query  536   LTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIF  390
             L++M   G+  C   W           +   +G CF   Y+ SL+ D+L   L +  I F
Sbjct  374   LSEMISAGKSFCGEEWSKLKEKYPTTKEKYLDGYCFSSAYIISLLHDSLGFALDDERIEF  433

Query  389   G--PGD----VSWALGAALI  348
                 G+    + WALGA ++
Sbjct  434   ANKAGEKGIALDWALGAFIL  453



>ref|XP_005783080.1| hypothetical protein EMIHUDRAFT_423944 [Emiliania huxleyi CCMP1516]
 gb|EOD30651.1| hypothetical protein EMIHUDRAFT_423944 [Emiliania huxleyi CCMP1516]
Length=461

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 111/434 (26%), Positives = 191/434 (44%), Gaps = 70/434 (16%)
 Frame = -1

Query  1592  VVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGNAS  1413
             +V D GS+G+RV++Y W    G          G+    D      ++ +PGL+ F G   
Sbjct  33    LVFDAGSSGTRVHVYSWKIGGG----------GSKDSFDLIADDLLKIKPGLSSFKGEPE  82

Query  1412  GLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHGFF  1233
                ASL+PL+  A++ VP+     TP+F++ATAG+R +       ++  V   + + GF 
Sbjct  83    QAGASLRPLLAYAKEKVPAAAVPSTPVFLMATAGLRLVGEGAKDAILASVCDELGKSGFR  142

Query  1232  YRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDE--FR  1059
             +R ++  +L G +E  YGWV +NY +  L   + +  +G +DLGG S+QVV    E    
Sbjct  143   FRCEWATLLGGEDEGLYGWVTVNYLLGALYPPAKTPAVGTIDLGGGSVQVVFATSEPVPN  202

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLS  879
              DE    +  G+ +H L   S   +G +EA  +AL  L     R E + E F  RHPCL 
Sbjct  203   PDESQLLT-FGARQHSLYVKSHLGYGLDEARRKALDSL--VSRRAEDKPEPF--RHPCLP  257

Query  878   SGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNL  699
              G    H  +                          ++GD +W +C  +   +       
Sbjct  258   RGASLEHGGKS-------------------------LVGDADWARCLRVMGRLFPQPFAA  292

Query  698   ERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFF-----AVYNMLNLSSRANL  534
              + K+A++      SY  DR   + L   +  ++ +++  +     A  ++  LS+    
Sbjct  293   GQPKLADRFYG--FSYMYDRTAAIGLLDGQPRQFGSVAMSYNDIAAAGESLCRLSAEETA  350

Query  533   TKMWETGQGLCSRSWVDQTDANGLCFRILYMASLIK-------DALCLSN-LEIIFGPGD  378
             T+   T          D   +N  C  + Y+A+L+K        ++ ++N +E +    +
Sbjct  351   TRFANT---------QDAAKSNNYCGDVAYVAALLKALGFEGDTSITMTNKIEKV----E  397

Query  377   VSWALGAALIEGGE  336
             + W LGA L +  E
Sbjct  398   LVWTLGAMLAKSAE  411



>ref|XP_003518729.1| PREDICTED: probable apyrase 6-like isoform 1 [Glycine max]
Length=537

 Score =   105 bits (262),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 110/454 (24%), Positives = 195/454 (43%), Gaps = 65/454 (14%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNG-EFPILVNTYPGNLTRSD  1476
             Y+AFS  +  +       + +++D GSTG+RV+++++      EF              D
Sbjct  65    YYAFSSPMANF------RYRIIVDGGSTGTRVHVFKYRSGRSLEFG------------RD  106

Query  1475  GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
             G K   ++  PGL+ F  +  G   S+  L   A++W+P    G T I ++ATAG+R L 
Sbjct  107   GLK--SMRVNPGLSAFAEDPQGAGGSVAELAEFAKRWIPRESWGETEIRLMATAGLRMLD  164

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg  1116
                  R++     ++++ GF +R ++  V++G +E  Y WV  NY +  LG      T G
Sbjct  165   AAAQERILASCRKVLRDSGFKFRDEWASVITGSDEGMYAWVVANYALGTLGGD-PLETTG  223

Query  1115  lldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFD--RALAILS  942
             +++LGG+S QV     E          +  +  + L ++S   FG N A D  +   +L 
Sbjct  224   IIELGGASAQVTFVSREVVLPSFSRTVKFANTTYNLYSHSFLHFGLNAAHDSWKEALVLG  283

Query  941   QTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
             +     +S  E  ++  PC  +G+  N      +   PS+  +   +         +V  
Sbjct  284   EFNLASQSLQEGLRI-DPCTPTGYSYNVE---SWKFPPSTESEKKHQS--------IVQT  331

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
               N+ +C+  A+ +        +   + Q+C      GS  +  L        ++ A   
Sbjct  332   RGNFSECRSAALTLLQKG----KESCSYQHC----DIGSTFIPKLQ------GKFLATEN  377

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSWV---------DQTDANGLCFRILYMASLI  429
             FF       L SRA L+K+   GQ  C   W+         D+ D    CF   Y+ +L+
Sbjct  378   FFYTSKFFGLRSRAYLSKLMSVGQEFCGEDWLRLKKKYVSHDEDDLLRYCFSSAYIVALL  437

Query  428   KDALCLS------NLEIIFGPGDVSWALGAALIE  345
              D+L ++       +    G   + WALGA +++
Sbjct  438   HDSLGIALDDERVKVANQVGSIPLDWALGAFILQ  471



>gb|KDO82926.1| hypothetical protein CISIN_1g009360mg [Citrus sinensis]
Length=536

 Score =   105 bits (262),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 111/454 (24%), Positives = 196/454 (43%), Gaps = 76/454 (17%)
 Frame = -1

Query  1646  AFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCK  1467
             +F PS + Y         V+LD GSTG+R++++ +      F   + +            
Sbjct  72    SFPPSSVKY--------GVLLDGGSTGTRIHVFSYDTETNHFDFDLGS------------  111

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
                ++  PGL+ +  N +    SLK L+  A++ VP      T I ++ATAG+R + +  
Sbjct  112   ---MRLNPGLSSYAVNPTNAGDSLKDLLDFAKRKVPPAFWADTEIRLMATAGLRLVDVVV  168

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
               ++++    +++  GF +  D+  V++G +E  Y W+  NY +  LG    S T G+++
Sbjct  169   QDKILDSCRRVLRVSGFRFADDWATVITGSDEGVYAWIVANYALGTLGGD-PSETTGIIE  227

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILS----Q  939
             LGG+S+QV    DE    E     + G+V + L ++S   FG N AF+    +LS     
Sbjct  228   LGGASVQVTFVSDEPLPQEFSRTLKFGNVTYNLYSHSFLHFGQNVAFETLRELLSSGDFN  287

Query  938   TQARRESRGEIFKVRHPCLSSGFVQN-HTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
             T A    +G       PC   G++ +  +  G    K              +L+++   G
Sbjct  288   TAAESLQKGTYID---PCSPKGYLHHVESSPGSLAAK-------------IDLSTLQAGG  331

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
               N+ +C+  A+ +  N     + K + ++C      GS  M  L        ++ A   
Sbjct  332   --NFSECRSAALTLLQNG----KEKCSYKSCY----LGSTFMPKLR------GKFLATEN  375

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLI  429
             FF       L  RA L+ +   G+  C   W         +D  D    CF   Y+ +L+
Sbjct  376   FFHTSKFFGLHQRAFLSHLLMAGEQFCGEDWSKLKKKHQSLDDEDLLRYCFSSAYIVALL  435

Query  428   KDALCLSNLEIIFGPGD------VSWALGAALIE  345
              D+L +S  +   G  +      + WALGA +++
Sbjct  436   HDSLGISLDDERIGFANQVENIPLDWALGAFILQ  469



>ref|XP_009148706.1| PREDICTED: probable apyrase 4 [Brassica rapa]
 emb|CDY49104.1| BnaA06g09020D [Brassica napus]
Length=490

 Score =   104 bits (259),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 112/442 (25%), Positives = 193/442 (44%), Gaps = 59/442 (13%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+ +  ++VV+D GS+G+RV+++ +  ++G  P+       +    DG  Y  ++  PGL
Sbjct  70    RRVSLRYSVVIDGGSSGTRVHVFGYRIDSGN-PVF------DFIGDDG--YASLKLSPGL  120

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + + G+  G   S+  L+  A+  VP GK     I ++ATAGMR L +    R++E    
Sbjct  121   SSYAGDPEGASVSVAELVEFAKGRVPKGKLKECEIRLMATAGMRLLDVSVQERILEVTRR  180

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF +R +   V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV  
Sbjct  181   VLRSSGFKFRDESASVISGSDEGIYAWVVANHALGSLGGD-PLQTTGIVELGGASTQVTF  239

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKV  897
                E    E +     G+V +++ ++S    G + A ++    L+   A    +G    V
Sbjct  240   VSSEHVPSEFLRTITYGNVSYRIYSHSFLNLGQDAAHEKLWESLNNLAANSTEKG---IV  296

Query  896   RHPCLSSGFV--QNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
               PC   G++  +N T  G    + S              +S+   G  N+ KC+  A  
Sbjct  297   TDPCTPKGYILDKNSTVEGIVLPEESKFT-----------DSLQAAG--NFSKCRSAAFN  343

Query  722   VATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
             +        + K   ++C    S GS    NL         + A   FF       L  +
Sbjct  344   ILQEG----KEKCHFKHC----SIGSTFTPNLR------GSFLATENFFHTSKFFGLREK  389

Query  542   ANLTKMWETGQGLCSRSWVDQ-------TDANGL--CFRILYMASLIKDALCLS----NL  402
               L+ M   G+  C   W           D + L  CF   Y+ S++ D+L ++     +
Sbjct  390   DWLSAMISAGESFCGDDWSKLKVKHPTFKDESLLRYCFSSAYIVSMLHDSLGVALDDQRV  449

Query  401   EIIFGPGD----VSWALGAALI  348
             E     G+    + WALGA ++
Sbjct  450   EFASEAGEKGIPLDWALGAFIL  471



>gb|KDP41200.1| hypothetical protein JCGZ_15607 [Jatropha curcas]
Length=524

 Score =   104 bits (260),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 117/454 (26%), Positives = 199/454 (44%), Gaps = 62/454 (14%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDG  1473
             YF F     L  RK    + +V+D GSTG+R++++ +  + G+ P+            DG
Sbjct  47    YFLFRARGSLASRKT---YGIVIDGGSTGTRIHVFAYRIDGGK-PVF--------DFGDG  94

Query  1472  CKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPI  1293
                  ++  PGL+ +  + +G   SL+ L+   +  VP    G T I ++ATAGMR L +
Sbjct  95    A----MRVNPGLSAYAEDPAGAGRSLEDLLEFGKGRVPKELWGETEIRLMATAGMRLLDL  150

Query  1292  EDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgl  1113
             E   R++E    +++  GF ++ D+  V++G +E  Y WV  NY +  LG      T G+
Sbjct  151   EVQERILESCRKVLRRSGFKFKDDWASVITGSDEGVYAWVVANYALGSLGGD-PRQTTGI  209

Query  1112  ldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFN---EAFDRALAILS  942
             ++LGG+S QV    DE    E     + G+V + + ++S   FG N   EAF  +L  + 
Sbjct  210   IELGGASAQVTFVSDEPVPPEFSRTIKFGNVTYSIYSHSFLHFGQNAAFEAFRESLMSVD  269

Query  941   QTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
                A       I  V  PC   G++ +      +   PSS++          L+S+   G
Sbjct  270   HESASESPEKGI--VIDPCTPKGYLHDIE---SWKSSPSSTKKDKF------LSSVHSRG  318

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
               N+ +C+  A+ +        +   +  +C    S GS  +  L        ++ A   
Sbjct  319   --NFSECRSAALMLLQKG----KETCSYHHC----SIGSTFIPKLQ------GKFLATEN  362

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLI  429
             FF       L  +A L+ +   G+  C   W         +D  D    CF   Y+ +L+
Sbjct  363   FFYTSKFFGLGPKAFLSDLIMAGEHFCGEDWSRLKKKHQSLDDDDLMRYCFSSAYIVALL  422

Query  428   KDAL--CLSNLEIIF----GPGDVSWALGAALIE  345
              D+L   L +  I +    G   + WALG  +++
Sbjct  423   HDSLGIALDDGRIGYVNNVGNLPLDWALGTFILQ  456



>ref|XP_002961510.1| hypothetical protein SELMODRAFT_63506, partial [Selaginella moellendorffii]
 gb|EFJ36770.1| hypothetical protein SELMODRAFT_63506, partial [Selaginella moellendorffii]
Length=417

 Score =   103 bits (256),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 108/435 (25%), Positives = 181/435 (42%), Gaps = 65/435 (15%)
 Frame = -1

Query  1592  VVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGNAS  1413
             +V+D GS+GSR++I+ +   N  FP +           D      ++T+PGL+ F  N  
Sbjct  27    IVIDAGSSGSRLHIFSYKVEN-LFPHI-----------DTQDIPSLKTKPGLSSFSSNPQ  74

Query  1412  GLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHGFF  1233
                 SL  L+  A   +    RG T ++++ATAG+RRL       ++E    ++++  F 
Sbjct  75    QAGESLVELLDFANARIAKKDRGQTRLYLMATAGLRRLEKNIQEDIIESCRSVLRQSDFM  134

Query  1232  YRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFRED  1053
             +   +  V++G EE  + WV+ NY +  LG      T G+++LGG+S QV    D     
Sbjct  135   FEDSWASVITGTEEGIFAWVSANYALGTLGGD-PHATTGIVELGGASAQVTFVPDSPFPP  193

Query  1052  EHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLSSG  873
             E +     G V +KL  YS   FG   A+D  L +L    A+         V  PC  +G
Sbjct  194   EFLHSLDFGGVNYKLYTYSFLHFGQEAAWDNLLQLLLSGAAKPGV------VIDPCTPAG  247

Query  872   FVQNHTCRGCFG---QKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSN  702
             +V N           Q P+            ++    VL   N+ +C+  A E+      
Sbjct  248   YVMNSELLEKIANTLQGPN------------QVKVSTVLSSGNFSECRRAAQELL-----  290

Query  701   LERSKVAEQNCVG-LLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKM  525
                 ++ E  C+    + GS  + +L        ++ A   FF       L +  +L  +
Sbjct  291   ----QMGEDQCLHERCAIGSTFVPDLR------GKFFATENFFYTSEFFGLPATTSLADV  340

Query  524   WETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIF----  390
                G   C   W         + + D    CF   Y+ +L+ D L   + +  + F    
Sbjct  341   EAAGDFYCGEQWTKLKNKHVGIQEEDLLKYCFSTAYIVALLHDRLGIAMHDERVRFTNKV  400

Query  389   GPGDVSWALGAALIE  345
             G   + WALGA +++
Sbjct  401   GNVPLDWALGALMVK  415



>emb|CDY39331.1| BnaC05g10480D [Brassica napus]
Length=470

 Score =   103 bits (256),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 109/440 (25%), Positives = 190/440 (43%), Gaps = 77/440 (18%)
 Frame = -1

Query  1610  RASY-FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLA  1434
             R+S+ ++VV D GS+GSR +++ +   +G+ P+       +    +   Y  ++  PGL+
Sbjct  71    RSSFRYSVVFDAGSSGSRAHVFRYWLESGK-PVF------DFGEEN---YASLKLSPGLS  120

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
              +  N  G   S+  L+  A+  VP      + I ++ATAGMR L +     ++E   G+
Sbjct  121   SYADNPQGASVSVAELVEFAKGRVPKEMLKKSEIRLMATAGMRLLDVSVQEEILEVTRGV  180

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             ++  GF ++ ++  V+SG +E  Y WV  NY +  LG     HT G+++LGG+S QV   
Sbjct  181   LRSSGFKFQDEWASVISGFDEGMYAWVVANYALGSLGGD-PLHTTGIVELGGASAQVTFV  239

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR  894
               E            G V +K+ ++S   +G +EA +  L  L  + A ++       V 
Sbjct  240   SSETAPPGFSRTISYGGVSYKIYSHSFLHYGQDEAQEEILKSLQNSAANKDGI-----VT  294

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
              PC   G+V ++                         NS+L  G  N+  C+        
Sbjct  295   DPCTPKGYVYDN-------------------------NSVLAAG--NYSACR--------  319

Query  713   NSSNLERSKVAEQNCV-GLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
              S  L + +  ++NC     S GS    +L        ++ A   F+       L  +  
Sbjct  320   -SVTLAKLQDGKENCAFEQCSIGSTFTPDLQ------GKFLATENFYHTSKFFGLDEKDW  372

Query  536   LTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIF  390
             L++M + G+  C   W           +   +G CF   Y+ S++ D+L   L +  I F
Sbjct  373   LSEMIKAGKSFCGEEWSKLKEKYPTTKEKYLDGYCFSSAYIISMLHDSLGFALDDERIEF  432

Query  389   G--PGD----VSWALGAALI  348
                 G+    + WALGA ++
Sbjct  433   ANKAGEKGIALDWALGAFIL  452



>ref|XP_002971296.1| hypothetical protein SELMODRAFT_94922 [Selaginella moellendorffii]
 gb|EFJ27894.1| hypothetical protein SELMODRAFT_94922 [Selaginella moellendorffii]
Length=541

 Score =   103 bits (257),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 104/432 (24%), Positives = 182/432 (42%), Gaps = 53/432 (12%)
 Frame = -1

Query  1592  VVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGNAS  1413
             +V+D GS+GSR++I+ +      FP +           D      ++T+PGL+ F  N  
Sbjct  83    IVIDAGSSGSRLHIFSYKVEK-LFPHI-----------DTQDIPSLKTKPGLSSFSSNPQ  130

Query  1412  GLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHGFF  1233
                 SL  L+  A   +    RG T ++++ATAG+RRL       ++E    ++++  F 
Sbjct  131   QAGESLVELLDFANARIAKKDRGQTRLYLMATAGLRRLEKNIQDDIIESCRSVLRKSDFM  190

Query  1232  YRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFRED  1053
             +   +  V++G EE  + WV+ NY +  LG      T G+++LGG+S QV    D     
Sbjct  191   FEDSWASVITGTEEGIFAWVSANYALGTLGGD-PHATTGIVELGGASAQVTFVPDSPFPP  249

Query  1052  EHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLSSG  873
             E +     G V +KL  YS   FG   A+D  L +L     +   + +   V  PC  +G
Sbjct  250   EFLHSLEFGGVNYKLYTYSFLHFGQEAAWDNLLQLLLSGAVKPRLKAKPGVVIDPCTPAG  309

Query  872   FVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLER  693
             +V N              + +++     ++    VL   N+ +C+  A E+         
Sbjct  310   YVMNSEL---------LEKIANTLPGPNQVKVSTVLSSGNFSECRRAAQELL--------  352

Query  692   SKVAEQNCVG-LLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWET  516
              ++ E  C+    + GS  + +L        ++ A   FF       L +  +L  +   
Sbjct  353   -QMGEDQCLHERCAIGSTFVPDLR------GKFFATENFFYTSEFFGLPATTSLADVEAA  405

Query  515   GQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIF----GPG  381
             G   C   W         + + D    CF   Y+ +L+ D L   + +  + F    G  
Sbjct  406   GDFYCGEQWTKLKDKHVGIQEEDLLKYCFSTAYIVALLHDRLGIAMHDERVRFTNKVGNV  465

Query  380   DVSWALGAALIE  345
              + WALGA +++
Sbjct  466   PLDWALGALMVK  477



>ref|XP_009398170.1| PREDICTED: LOW QUALITY PROTEIN: probable apyrase 6 [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   103 bits (257),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 109/437 (25%), Positives = 192/437 (44%), Gaps = 58/437 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             F +++D GS+G+R++++     +G  P LV   PG+           ++  PGL+ F G+
Sbjct  63    FGIIIDAGSSGTRIHVFGSKGESGAIPSLV---PGSTA--------VMRVTPGLSAFSGD  111

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                  ASL+ L+  A+  V   +   T + ++ATAG+R + +    R++E    +++  G
Sbjct  112   PERAGASLEELLEFAKGKVAKDRWRDTEVRLMATAGLRMVDMGPRERILESCRRVLRLSG  171

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F ++ ++  V+ G +E  Y WVA NY +  LG      T G+++LGG+S QV     E  
Sbjct  172   FRFKNEWATVIPGSDEGTYAWVAANYALGSLGGD-PEKTTGIMELGGASAQVTFVSSETL  230

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE--SRGEIFKVRHPC  885
               E       G   + L + S   FG N A +    +L+    +    SR E   V  PC
Sbjct  231   PSEFSRMLTFGKTTYNLYSNSFLHFGQNAAHESLRKLLNSRDIKTSDVSRQEGTLV-DPC  289

Query  884   LSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVL-GDPNWEKCKVLAMEVATNS  708
                G+         F             ++   L+  L L    N+ +C+  A+ +    
Sbjct  290   SPKGYSHGEXSLAFFPD-----------VINTYLDHKLGLHAGGNFSECRSTALSL----  334

Query  707   SNLERSKVAEQNCVGLLSY-GSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLT  531
               L++ K    NC+  L + GS  +  +  N      + A   FF       LS  ++L+
Sbjct  335   --LQKEK---DNCLYQLCHLGSTFIPKMQGN------FIATENFFYTSKFFGLSPTSSLS  383

Query  530   KMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDA--LCLSNLEIIF--  390
             +M   G+  C + W          D+ D +  CF   Y+ +L+ D+  + L +  I +  
Sbjct  384   EMMHAGEEYCEQDWSKTKKKYHSADEEDLSRYCFSAAYIVALLHDSFGIPLDDKRIEYTN  443

Query  389   --GPGDVSWALGAALIE  345
               G  ++ WALGA +++
Sbjct  444   QVGDMEIDWALGAYIVQ  460



>ref|XP_004973524.1| PREDICTED: probable apyrase 6-like isoform X3 [Setaria italica]
Length=529

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 112/444 (25%), Positives = 184/444 (41%), Gaps = 69/444 (16%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNI--YEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFV  1425
             + V++D GSTGSRV++  Y   P  G  P L           D  +   ++  PGL+ F 
Sbjct  67    YGVIIDAGSTGSRVHVIAYRTGPGRGLPPQL-----------DWARTASLKANPGLSSFA  115

Query  1424  GNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKE  1245
              +  G   SL PL+  A + VP  +   T + ++ATAG+R L    A  V+E   G++++
Sbjct  116   ADPDGAGLSLAPLVDFARRRVPRERWADTEVRLMATAGLRLLDAAVAESVLESCRGVLRQ  175

Query  1244  HGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDE  1065
              GF ++  +  V+SG EE  Y WVA NY +  LG      T G+++LGG+S+QV     E
Sbjct  176   SGFLFQDKWATVISGAEEGIYAWVAANYALGTLGGD-PHDTTGIIELGGASVQVTFVTGE  234

Query  1064  FREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRH--  891
                 E     + G V + L + S    G N A++    +LS    +  +   I + ++  
Sbjct  235   PLPPEFSHVLKFGDVSYNLYSNSFLQLGLNVAYESLHDLLSSPGLKSMATHLITQTKYKD  294

Query  890   PCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATN  711
             PC   GF                        M   +   + + DP     KV     A  
Sbjct  295   PCTPRGFTS----------------------MVGSVKLPVSVLDP-----KVGYRPFAHA  327

Query  710   SSNLERSKVAEQNCVGLLSYGSD-------RMQNLTLNSHEVTRYHALSGFFAVYNMLNL  552
               N    + A    + LL  G D       R+    +   E  ++ A   F+       L
Sbjct  328   VGNFSECRSA---ALTLLQKGKDGCAYHECRLGAAFVPELE-GKFLATENFYHTSKFFGL  383

Query  551   SSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL----  411
              S++ L+ +   G+  C   W          D+ +    CF   Y+ +L+ D+L +    
Sbjct  384   HSKSFLSDLMVAGEKFCHGDWSKIKKKYSSFDEGELLLFCFSSAYIIALLHDSLKMPLDH  443

Query  410   SNLEII--FGPGDVSWALGAALIE  345
               ++++       V WALGA +++
Sbjct  444   KRIDVVNQIHGVPVDWALGAFIVQ  467



>ref|XP_004973523.1| PREDICTED: probable apyrase 6-like isoform X2 [Setaria italica]
Length=534

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 110/449 (24%), Positives = 188/449 (42%), Gaps = 79/449 (18%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNI--YEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFV  1425
             + V++D GSTGSRV++  Y   P  G  P L           D  +   ++  PGL+ F 
Sbjct  67    YGVIIDAGSTGSRVHVIAYRTGPGRGLPPQL-----------DWARTASLKANPGLSSFA  115

Query  1424  GNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKE  1245
              +  G   SL PL+  A + VP  +   T + ++ATAG+R L    A  V+E   G++++
Sbjct  116   ADPDGAGLSLAPLVDFARRRVPRERWADTEVRLMATAGLRLLDAAVAESVLESCRGVLRQ  175

Query  1244  HGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDE  1065
              GF ++  +  V+SG EE  Y WVA NY +  LG      T G+++LGG+S+QV     E
Sbjct  176   SGFLFQDKWATVISGAEEGIYAWVAANYALGTLGGD-PHDTTGIIELGGASVQVTFVTGE  234

Query  1064  FREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRH--  891
                 E     + G V + L + S    G N A++    +LS    +  +   I + ++  
Sbjct  235   PLPPEFSHVLKFGDVSYNLYSNSFLQLGLNVAYESLHDLLSSPGLKSMATHLITQTKYKD  294

Query  890   PCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDP------------NWE  747
             PC   GF                        M   +   + + DP            N+ 
Sbjct  295   PCTPRGFTS----------------------MVGSVKLPVSVLDPKVGYRPFAHAVGNFS  332

Query  746   KCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVY  567
             +C+  A+ +      L++ K     C    +Y   R+    +   E  ++ A   F+   
Sbjct  333   ECRSAALTL------LQKGK---DGC----AYHECRLGAAFVPELE-GKFLATENFYHTS  378

Query  566   NMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALC  414
                 L S++ L+ +   G+  C   W          D+ +    CF   Y+ +L+ D+L 
Sbjct  379   KFFGLHSKSFLSDLMVAGEKFCHGDWSKIKKKYSSFDEGELLLFCFSSAYIIALLHDSLK  438

Query  413   L----SNLEII--FGPGDVSWALGAALIE  345
             +      ++++       V WALGA +++
Sbjct  439   MPLDHKRIDVVNQIHGVPVDWALGAFIVQ  467



>ref|XP_004973522.1| PREDICTED: probable apyrase 6-like isoform X1 [Setaria italica]
Length=535

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 112/444 (25%), Positives = 184/444 (41%), Gaps = 69/444 (16%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNI--YEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFV  1425
             + V++D GSTGSRV++  Y   P  G  P L           D  +   ++  PGL+ F 
Sbjct  67    YGVIIDAGSTGSRVHVIAYRTGPGRGLPPQL-----------DWARTASLKANPGLSSFA  115

Query  1424  GNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKE  1245
              +  G   SL PL+  A + VP  +   T + ++ATAG+R L    A  V+E   G++++
Sbjct  116   ADPDGAGLSLAPLVDFARRRVPRERWADTEVRLMATAGLRLLDAAVAESVLESCRGVLRQ  175

Query  1244  HGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDE  1065
              GF ++  +  V+SG EE  Y WVA NY +  LG      T G+++LGG+S+QV     E
Sbjct  176   SGFLFQDKWATVISGAEEGIYAWVAANYALGTLGGD-PHDTTGIIELGGASVQVTFVTGE  234

Query  1064  FREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRH--  891
                 E     + G V + L + S    G N A++    +LS    +  +   I + ++  
Sbjct  235   PLPPEFSHVLKFGDVSYNLYSNSFLQLGLNVAYESLHDLLSSPGLKSMATHLITQTKYKD  294

Query  890   PCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATN  711
             PC   GF                        M   +   + + DP     KV     A  
Sbjct  295   PCTPRGFTS----------------------MVGSVKLPVSVLDP-----KVGYRPFAHA  327

Query  710   SSNLERSKVAEQNCVGLLSYGSD-------RMQNLTLNSHEVTRYHALSGFFAVYNMLNL  552
               N    + A    + LL  G D       R+    +   E  ++ A   F+       L
Sbjct  328   VGNFSECRSA---ALTLLQKGKDGCAYHECRLGAAFVPELE-GKFLATENFYHTSKFFGL  383

Query  551   SSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL----  411
              S++ L+ +   G+  C   W          D+ +    CF   Y+ +L+ D+L +    
Sbjct  384   HSKSFLSDLMVAGEKFCHGDWSKIKKKYSSFDEGELLLFCFSSAYIIALLHDSLKMPLDH  443

Query  410   SNLEII--FGPGDVSWALGAALIE  345
               ++++       V WALGA +++
Sbjct  444   KRIDVVNQIHGVPVDWALGAFIVQ  467



>ref|XP_005643034.1| hypothetical protein COCSUDRAFT_49229 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18490.1| hypothetical protein COCSUDRAFT_49229 [Coccomyxa subellipsoidea 
C-169]
Length=952

 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 91/165 (55%), Gaps = 9/165 (5%)
 Frame = -1

Query  1631  LILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPIL----VNTYPGNLTR---SDG  1473
             L L+ R+R  Y  +V+D GS+G+R+  Y+W  N  + P L    +      + R    D 
Sbjct  238   LGLHYRQRPEY-VLVIDSGSSGTRIFAYQWKDNGPKLPSLTAVSIQAAKHKIPRRAAGDK  296

Query  1472  CKYHCVQTEPGLAMFVGNASGL-RASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
               Y  ++TEPGL  FV +  GL R +L+PL+  AE  VP  +   TP+F+  TAG+R+LP
Sbjct  297   RAYERLETEPGLDKFVADPEGLERRALRPLLEWAEAVVPRRQWHRTPLFLFGTAGLRKLP  356

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNY  1161
              E  + +++ V   +    F +   +  V+SG EE  YGW+A+NY
Sbjct  357   PEGRAALLDDVRAALSRCEFRFEASYANVISGEEEGVYGWIAVNY  401


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 84/198 (42%), Gaps = 37/198 (19%)
 Frame = -1

Query  911  EIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVL  732
            E   V HPCL  G+   +      G+ P  +              + ++G P++E C  +
Sbjct  632  EPHVVEHPCLHKGYSSIYRRMVSHGKLPKPAM-------------VQLVGRPDYEACAAV  678

Query  731  AMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNL  552
            A  V      L        +CV     G+ + Q+        + + AL+GFF V++   L
Sbjct  679  AESV------LSTRDCGAAHCV----LGTAQPQS-------SSDFFALTGFFVVFHFFGL  721

Query  551  SSRANLTKMWETGQGLCSRSWV-------DQTDANGLCFRILYMASLIKDALCLSNLEII  393
             + A L  +   G+  C   W        ++   +  CFR+ Y+ +L++  L LS L I 
Sbjct  722  PAGAGLADLEREGRAHCGLDWDRLRLSRGEEVHVDQYCFRVPYIVALLRQGLALSELHIR  781

Query  392  FGPGDVSWALGAALIEGG  339
             G G+  W LGAAL EGG
Sbjct  782  VGSGNEGWTLGAALAEGG  799



>ref|XP_010683184.1| PREDICTED: probable apyrase 6 [Beta vulgaris subsp. vulgaris]
Length=550

 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 116/466 (25%), Positives = 195/466 (42%), Gaps = 76/466 (16%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNG--EFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFV  1425
             F +++D GSTGSR++++E+    G  +F    N             +  ++  PGL+ F 
Sbjct  88    FGIIIDGGSTGSRIHVFEYRIEGGVPKFDFGPN------------GHSSMRVSPGLSSFE  135

Query  1424  GNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKE  1245
              +      SL  L+  A++ VP    G T + ++ATAG+R L ++   R++E    +++ 
Sbjct  136   DDPERAGESLLELLDFAKRMVPKELWGDTEVRLMATAGLRLLDLKIQDRILESCRRLMRS  195

Query  1244  HGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDE  1065
              GF +R D+  V++G +E  Y W   NY +  LG      +  +   G S+   VT I  
Sbjct  196   AGFKFRDDWALVITGSDEGLYAWAVANYALGTLGGDPHLTSGIIELGGASAQ--VTFITR  253

Query  1064  FREDEHVFRSRI-GSVEHKLLAYSLQAFGFNEAFD--RALAILSQTQARRESRGEIFKVR  894
                     RS + G+V + L + SL  FG N AFD  + L + S  +   ++      + 
Sbjct  254   ESVPPEFSRSLVYGNVTYHLYSNSLLHFGQNVAFDSLKDLLVSSGVKLATDTPNRELTI-  312

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
              PC   G+ Q+          P SS  +        L++    G  N+ +C+  A+++  
Sbjct  313   DPCTPKGYAQS---MNSLNLSPDSSAKNY-------LSTFHAAG--NFSECRAAAVKL--  358

Query  713   NSSNLERSK--VAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRA  540
                 L R K   A  +C    S G+  M  L        R+ A   FF       LS +A
Sbjct  359   ----LHRGKEGCAYHHC----SLGTTFMPKLH------GRFLATENFFHTSQFFGLSPKA  404

Query  539   NLTKMWETGQGLCSRSWVD---------QTDANGLCFRILYMASLIKDALCLSNLEIIFG  387
              L+ + + GQ  C  +W +           D    CF   Y+ +L+ D+L ++  +   G
Sbjct  405   VLSDIMDAGQHFCEENWSNIRKRYSSLADEDILHYCFSSAYIVALLHDSLDIALDDRSIG  464

Query  386   PGD------VSWALGAALIEGGEHSRLIATESRRKGLATQHKWMVS  267
               +      + WALGA +++    S               H WM S
Sbjct  465   YTNKVDNVPLDWALGAFILQTTAASN-----------GANHGWMAS  499



>ref|XP_004238804.1| PREDICTED: probable apyrase 6 [Solanum lycopersicum]
Length=542

 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 116/453 (26%), Positives = 203/453 (45%), Gaps = 61/453 (13%)
 Frame = -1

Query  1649  FAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGC  1470
             F FS  +   V+++   + +V+D GSTG+R++++E+   NG  P+      G ++     
Sbjct  64    FVFSSHVRFSVKRK---YGIVIDGGSTGTRIHVFEYEVRNG-VPVYDFGDKGLVS-----  114

Query  1469  KYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
                 ++  PGL+ +         S+  L+   ++ VP      T I ++ATAGMR L   
Sbjct  115   ----MRVNPGLSAYAEQPEMASESVGKLVEFGKQNVPQEYWSSTEIRLMATAGMRLLDSG  170

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
                +++E    ++++ G  +R D+  V+SG +E  Y WV  NY +  LG +    T G++
Sbjct  171   VQEKILEVCRWVLRDSGLKFRDDWASVISGSDEGLYAWVIANYALGTLG-SDPLQTTGII  229

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             +LGG+S QV    DE    E+    +  +  +++ ++SL  FG N AFD    +L ++  
Sbjct  230   ELGGASAQVTFVSDEPMPPEYSRTIKFRNFTYRIYSHSLLQFGQNVAFD----LLQESLV  285

Query  929   RR--ESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDP  756
              R      E  K+  PC   G+ QN          PSS  D      T  L+S+   G  
Sbjct  286   ARGHHQAPESVKLMDPCSPRGYPQNLM---SLKLSPSSFLDR-----TRHLSSLYPSG--  335

Query  755   NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSY-GSDRMQNLTLNSHEVTRYHALSGF  579
             N+ +C+         S++L   +  +++C     Y GS  M  L  N      + A   F
Sbjct  336   NFSECR---------SASLSLLQKGKESCPYKSCYIGSTFMPKLQGN------FLATENF  380

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIK  426
             F       L  +A L+ +   G+  C   W         + + D +  CF   Y+ +L+ 
Sbjct  381   FYTSRFFGLPPKAFLSDLMAAGKSFCEEDWSSLKSKYPSLQEEDLHRYCFSSAYILALLH  440

Query  425   DALCLSNLEIIFGPGD------VSWALGAALIE  345
             D+L ++  +   G  +      + WALGA +++
Sbjct  441   DSLGIALDDDRIGYANQVENIPLDWALGAFILQ  473



>ref|XP_006438694.1| hypothetical protein CICLE_v10031190mg [Citrus clementina]
 gb|ESR51934.1| hypothetical protein CICLE_v10031190mg [Citrus clementina]
Length=536

 Score =   102 bits (253),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 114/456 (25%), Positives = 194/456 (43%), Gaps = 80/456 (18%)
 Frame = -1

Query  1646  AFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCK  1467
             +F PS + Y         V+LD GSTG+R++++ +      F   + +            
Sbjct  72    SFPPSSVKY--------GVLLDGGSTGTRIHVFSYDTETNHFDFDLGS------------  111

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
                ++  PGL+ +  N +    SLK L+  A++ VP      T I ++ATAG+R + +  
Sbjct  112   ---MRLNPGLSSYAVNPTNAGDSLKDLLDFAKRKVPPAFWADTEIRLMATAGLRLVDVVV  168

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
               ++++    +++  GF +  D+  V++G +E  Y W+  NY +  LG    S T G+++
Sbjct  169   QDKILDSCRRVLRVSGFRFADDWATVITGSDEGVYAWIVANYALGTLGGD-PSETTGIIE  227

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILS----Q  939
             LGG+S+QV    DE    E     + G+V + L ++S   FG N AF+     LS     
Sbjct  228   LGGASVQVTFVSDEPLPREFSRTLKFGNVTYNLYSHSFLHFGQNVAFETLRESLSSGDFN  287

Query  938   TQARRESRGEIFKVRHPCLSSGFVQN-HTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
             T A    +G       PC   G++    +  G    K              +L+++   G
Sbjct  288   TAAESLQKGTYID---PCSPKGYLHRVESSPGSLAAK-------------IDLSTLQAGG  331

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
               N+ +C+  A+ +       E+ K + ++C      GS  M  L        ++ A   
Sbjct  332   --NFSECRSAALTLLQK----EKEKCSYKSCY----LGSTFMPKLQ------GKFLATEN  375

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLI  429
             FF       L  RA L+ +   G+  C   W         +D  D    CF   Y+ +L+
Sbjct  376   FFHTSKFFGLHQRAFLSHLLMAGEQFCGEDWSKLKKKHRSLDDEDLLRYCFSSAYIVALL  435

Query  428   KDAL--CLSNLEIIFG------PGDVSWALGAALIE  345
              D+L   L +  I F       P D  WALGA +++
Sbjct  436   HDSLGISLDDERIRFANQVENIPLD--WALGAFILQ  469



>ref|XP_006483153.1| PREDICTED: probable apyrase 6-like [Citrus sinensis]
Length=536

 Score =   102 bits (253),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 114/456 (25%), Positives = 194/456 (43%), Gaps = 80/456 (18%)
 Frame = -1

Query  1646  AFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCK  1467
             +F PS + Y         V+LD GSTG+R++++ +      F   + +            
Sbjct  72    SFPPSSVKY--------GVLLDGGSTGTRIHVFSYDTETNHFDFDLGS------------  111

Query  1466  YHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED  1287
                ++  PGL+ +  N +    SLK L+  A++ VP      T I ++ATAG+R + +  
Sbjct  112   ---MRLNPGLSSYAVNPTNAGDSLKDLLDFAKRKVPPAFWADTEIRLMATAGLRLVDVVV  168

Query  1286  ASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglld  1107
               ++++    +++  GF +  D+  V++G +E  Y W+  NY +  LG    S T G+++
Sbjct  169   QDKILDSCRRVLRVSGFRFADDWATVITGSDEGVYAWIVANYALGTLGGD-PSETTGIIE  227

Query  1106  lggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILS----Q  939
             LGG+S+QV    DE    E     + G+V + L ++S   FG N AF+     LS     
Sbjct  228   LGGASVQVTFVSDEPLPREFSRTLKFGNVTYNLYSHSFLHFGQNVAFETLRESLSSGDFN  287

Query  938   TQARRESRGEIFKVRHPCLSSGFVQN-HTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
             T A    +G       PC   G++    +  G    K              +L+++   G
Sbjct  288   TAAESLQKGTYID---PCSPKGYLHRVESSPGSLAAK-------------IDLSTLQAGG  331

Query  761   DPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSG  582
               N+ +C+  A+ +       E+ K + ++C      GS  M  L        ++ A   
Sbjct  332   --NFSECRSAALTLLQK----EKEKCSYKSCY----LGSTFMPKLQ------GKFLATEN  375

Query  581   FFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLI  429
             FF       L  RA L+ +   G+  C   W         +D  D    CF   Y+ +L+
Sbjct  376   FFHTSKFFGLHQRAFLSHLLMAGEQFCGEDWSKLKKKHQSLDDEDLLRYCFSSAYIVALL  435

Query  428   KDAL--CLSNLEIIFG------PGDVSWALGAALIE  345
              D+L   L +  I F       P D  WALGA +++
Sbjct  436   HDSLGISLDDERIRFANQVENIPLD--WALGAFILQ  469



>ref|XP_010917046.1| PREDICTED: probable apyrase 6 isoform X1 [Elaeis guineensis]
Length=517

 Score =   101 bits (252),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 116/464 (25%), Positives = 198/464 (43%), Gaps = 62/464 (13%)
 Frame = -1

Query  1631  LILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQ  1452
             LI  +   +  F +V+D GS+G+R++++ +   +G  P +           D      ++
Sbjct  50    LIASLSSPSPRFGIVIDAGSSGTRIHVFGFNGESGMIPSI-----------DWGSTAVMR  98

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
               PGL+ F G     RASL  L+  A+  V   + G T + ++ATAG+R LP+E    ++
Sbjct  99    VTPGLSAFSGEPERARASLAELLEFAKGRVAKDQWGKTDVRLMATAGLRMLPVEVRDSIL  158

Query  1271  EGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggss  1092
             E    +++  GF ++ D+  V+ G +E  Y WVA NY +  LG      T G+++LGG+S
Sbjct  159   ESCRMVLRSSGFRFQDDWASVIPGSDEGIYAWVAANYALNTLGGD-PQKTTGIIELGGAS  217

Query  1091  LQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRG  912
              QV    +E    E +   + G   + L + S   +G N A               ES  
Sbjct  218   AQVTFVSNEALPAEFLHVLKFGETTYNLYSNSFLHYGQNAA--------------HESLQ  263

Query  911   EIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCEL-NSILVLGDPNWEKCKV  735
             ++ + R P  S+  VQ          K  S     + +   +L +  +     N+  C+ 
Sbjct  264   KLLRSRSPKASAESVQEGLLIDPCSPKGYSYVGEPADVPNSKLEHQPIGQAGGNFSACRS  323

Query  734   LAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLN  555
              A      S  L++ K   +NC+    Y    M +  +   + + + A   FF       
Sbjct  324   AA------SMLLQKEK---ENCL----YQKCHMGSTFIPKLQGS-FVATENFFFTTKFFG  369

Query  554   LSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLS  408
             LS  ++L+ +   G+  C   W         + + D +  CF   Y+ +L+ D+L   L 
Sbjct  370   LSPTSSLSDLMLAGEQFCGEDWSKLKEKYHTLAEEDLSRYCFSSAYIVALLHDSLGITLD  429

Query  407   NLEIIF----GPGDVSWALGAALIEGGEHSRLIATESRRKGLAT  288
             +  I F    G   V WALGA +++       +AT S   G  T
Sbjct  430   DRRIEFANQVGNIQVEWALGAFIMQ------TMATRSYHSGWIT  467



>gb|ELT89294.1| hypothetical protein CAPTEDRAFT_163643 [Capitella teleta]
Length=458

 Score =   100 bits (250),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 84/150 (56%), Gaps = 17/150 (11%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMP-NNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVG  1422
             + V++D GS+GSRV IY W P ++G  P             D  + H ++ +PG++ +  
Sbjct  25    YGVIIDAGSSGSRVRIYGWNPADDGGVP-------------DFREIHSMKAKPGISDYAD  71

Query  1421  NASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEH  1242
               S L   + PLI  A+K +PS + G TPI+++ATAGMR L  + A+ V++ +  + ++ 
Sbjct  72    KVSKLADYMDPLISEAKKIIPSDRHGDTPIYLMATAGMRLLLEDHANSVIDALNDVFEDK  131

Query  1241  G---FFYRKDFIRVLSGREEAYYGWVALNY  1161
                 FFY     R+LSG EE  + W+A NY
Sbjct  132   AKNPFFYETQHTRILSGEEEGVFAWIAANY  161



>ref|XP_009148707.1| PREDICTED: probable apyrase 5 [Brassica rapa]
 ref|XP_009148708.1| PREDICTED: probable apyrase 5 [Brassica rapa]
Length=472

 Score =   100 bits (250),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 108/440 (25%), Positives = 191/440 (43%), Gaps = 77/440 (18%)
 Frame = -1

Query  1610  RASY-FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLA  1434
             R+S+ ++VV+D GS+GSR +++ +   +G+ P+       +    +   Y  ++  PGL+
Sbjct  73    RSSFRYSVVIDAGSSGSRAHVFRYWFESGK-PVF------DFGEEN---YASLKLSPGLS  122

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
              +  N  G   S+K L+  A+  VP      + I ++ATAGMR L +    +++E    +
Sbjct  123   SYADNPQGASVSVKELVEFAKGRVPKDVLKKSEIRLMATAGMRLLDVSVQEQILEVTRCV  182

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             ++  GF ++ ++  V+SG +E  Y WV  NY +  LG     HT G+++LGG+S QV   
Sbjct  183   LRSSGFKFQDEWASVISGFDEGMYAWVVANYALGSLGGD-PLHTTGIVELGGASAQVTFV  241

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR  894
               E            G V +K+ ++S   +G +EA +  L  L  + A ++       V 
Sbjct  242   SSETAPPGFSRTISYGGVSYKIYSHSFLHYGQDEAQEEILKSLQNSAASKDGI-----VT  296

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
              PC   G++ ++                         NS+   G  N+  C+        
Sbjct  297   DPCTPKGYIYDN-------------------------NSVQAAG--NYSACR--------  321

Query  713   NSSNLERSKVAEQNCV-GLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
              S+ L + +  ++NC     S GS    +L        ++ A   F+       L  +  
Sbjct  322   -SATLVKLQDGKENCAYAHCSIGSTFTPDLQ------GKFLATENFYHTSKFFGLDEKDW  374

Query  536   LTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIF  390
             L++M   G+  C   W           +   +G CF   Y+ SL+ D+L   L +  I F
Sbjct  375   LSEMISAGKSFCGEEWSKLKEKYPTTKEKYLDGYCFSSAYIISLLHDSLGFALDDERIEF  434

Query  389   G--PGD----VSWALGAALI  348
                 G+    + WALGA ++
Sbjct  435   ANKAGEKGIALDWALGAFIL  454



>ref|XP_002946218.1| hypothetical protein VOLCADRAFT_78871 [Volvox carteri f. nagariensis]
 gb|EFJ53213.1| hypothetical protein VOLCADRAFT_78871 [Volvox carteri f. nagariensis]
Length=439

 Score =   100 bits (249),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 88/154 (57%), Gaps = 14/154 (9%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V D GSTGSR++++++   +G+  ++ +T+               Q +PGL+ +  +
Sbjct  41    YAIVFDAGSTGSRIHVFKFEQQDGQLKLISDTFE--------------QLKPGLSSYADD  86

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
              +   ASL+PL+  A K VP+G +G TPI + ATAG+R LP + A R+++ V  ++K+  
Sbjct  87    PAKAAASLQPLLDTALKTVPAGVQGSTPISLKATAGLRLLPGDKAERILQAVEDLLKKQP  146

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNT  1137
             F      + ++ G++E  + W+ LNY +  L  T
Sbjct  147   FKLAPGGVSIMDGKDEGAFAWLTLNYLLGRLSGT  180



>gb|EPH53877.1| hypothetical protein CAOG_08437, partial [Capsaspora owczarzaki 
ATCC 30864]
Length=525

 Score =   100 bits (249),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 136/250 (54%), Gaps = 14/250 (6%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V+D GS+GSRV +Y W     E  ++  +    L   +G K    + EPGL+ F  N
Sbjct  135   YGIVIDAGSSGSRVYLYSWPQELNEQGLVTLS---QLYDENG-KPLVRKQEPGLSTFANN  190

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRL-PIEDASRVMEGVVGIVKEH  1242
              +    S+ PL++ A +++P  +   TP+F+ ATAGMR L P +  + +++ V  I K  
Sbjct  191   PTEAFESIFPLLKFASQYIPVEEHERTPLFIYATAGMRLLQPHQSDAIILDIVASIPKHF  250

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNYKM----RMLGNTsgshtlglldlggssLQVVTE  1074
              F ++   ++++SG  E  Y WVA+NY +    R     SG  T G +++GG+S+Q+  E
Sbjct  251   SFNFQPSNMQIISGAMEGVYSWVAVNYALGRFSRSHSRGSGPTTAGSVEMGGASIQITFE  310

Query  1073  ID--EFREDEHVFRSRIGS-VEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIF  903
             +D  E   +E++   ++G   E++L A +   +G NEA  R L  L   +AR  +R  I 
Sbjct  311   VDSKESVPEEYLQVVQMGEGREYRLYATTFLRYGANEARTRYLEKLVHGEARDLARDGI-  369

Query  902   KVRHPCLSSG  873
              +  PCL++G
Sbjct  370   -IEDPCLTAG  378



>ref|XP_006417038.1| hypothetical protein EUTSA_v10007501mg [Eutrema salsugineum]
 gb|ESQ35391.1| hypothetical protein EUTSA_v10007501mg [Eutrema salsugineum]
Length=483

 Score =   100 bits (248),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 120/454 (26%), Positives = 198/454 (44%), Gaps = 64/454 (14%)
 Frame = -1

Query  1649  FAFSPSLILYVRKRASY-FTVVLDCGSTGSRVNIYE-WMPNNGEFPILVNTYPGNLTRSD  1476
             F F   L      R+S+ ++VV+D GS+G+R +++  W+ ++G+ P+       +  + +
Sbjct  56    FVFYSVLFSGWNHRSSFRYSVVIDAGSSGTRAHVFRYWLESSGK-PVF------DFGKEN  108

Query  1475  GCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
                Y  ++  PGL+ +  N      SLK L+  A+  VP      + I ++ATAGMR L 
Sbjct  109   ---YASLKLNPGLSSYADNPEEASVSLKELVEFAKGRVPKRMLKNSDIRLMATAGMRLLQ  165

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg  1116
                  +++E   G+++  GF +R ++  V+SG +E  Y WV  NY +  LG      T G
Sbjct  166   ETVQEQILEVTRGVLRSSGFRFRDEWASVISGSDEGMYAWVVANYALGSLGGD-PLQTTG  224

Query  1115  lldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
             +++LGG+S QV     E    E       G+V +K+ ++S   +G + A    L  L   
Sbjct  225   IIELGGASAQVTFVSSEPVPPELSRTITYGNVSYKIYSHSFLHYGQDAAQKDHLESL---  281

Query  935   QARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDP  756
                 ++ GE   V  PC   G++ N         K SS        +T    S+   GD 
Sbjct  282   ----QNSGEGI-VTDPCTPKGYILNKNS-----HKDSSGFLVEEYKLTA---SVQAAGD-  327

Query  755   NWEKCKVLAMEVATNSSNLERSKVAEQNCVGL-LSYGSDRMQNLTLNSHEVTRYHALSGF  579
              + KC+         S+ L   +  ++NC     S GS    +L        R+ A   F
Sbjct  328   -YSKCR---------SATLAMLQEGKENCSSKHCSIGSTFTPDLQ------GRFLATENF  371

Query  578   FAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIK  426
             +     L L  +  L++M   G+  C   W           +    G CF   Y+ S++ 
Sbjct  372   YYTSKFLGLEEKNWLSEMISAGKSFCGEEWSTLKAKYPKTKEKYLRGYCFSSAYIISMLH  431

Query  425   DAL--CLSNLEIIF----GPGDVS--WALGAALI  348
             D+L   L +  I F    G   +S  WALGA ++
Sbjct  432   DSLGFALDDQRIKFANKAGEKGISLDWALGAFIL  465



>ref|XP_007157620.1| hypothetical protein PHAVU_002G084900g [Phaseolus vulgaris]
 gb|ESW29614.1| hypothetical protein PHAVU_002G084900g [Phaseolus vulgaris]
Length=530

 Score =   100 bits (249),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 110/456 (24%), Positives = 191/456 (42%), Gaps = 70/456 (15%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDG  1473
             Y+AFSPS      + +  + +++D GSTG+RV+++++               G   +   
Sbjct  59    YYAFSPS------ESSFRYQIIVDGGSTGTRVHVFKYRS-------------GVALQFGK  99

Query  1472  CKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPI  1293
                  ++  PGL+ F  +  G   S+  L+  A+  +P    G T I ++ATAG+R L  
Sbjct  100   EGLASMRVNPGLSAFAEDPDGAGGSVSELVEFAKGRIPRESWGETSIRLMATAGLRMLDA  159

Query  1292  EDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgl  1113
             E   R++E    +++  GF +  ++  V++G +E  Y WV  NY +  LG      T G+
Sbjct  160   EVQERILESCRKVLRNSGFKFMDNWASVITGSDEGVYAWVVANYALGTLGGD-PLDTTGI  218

Query  1112  ldlggssLQVVTEIDEFREDEHVFRS-----RIGSVEHKLLAYSLQAFGFNEAFDRALAI  948
             ++LGG+S QV      F   E V  S     + G++ + L ++S   FG N A D     
Sbjct  219   VELGGASAQVT-----FVSREPVLPSFSRTIKFGNITYNLYSHSFLHFGLNAAHDSWKEA  273

Query  947   LSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILV  768
             L       +S  E  ++  PC  +G+  N          PSS    +    T +      
Sbjct  274   LGAFNLASQSVQERLQI-DPCTPTGYSYNAE---SLKFPPSSVSGKTHYHSTVQTRG---  326

Query  767   LGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHAL  588
                 N+ +C+  A+ +        +   + Q+C      GS  + NL        ++ A 
Sbjct  327   ----NFSECRSAALMMLQKG----KESCSHQHC----DLGSTFIPNLQ------GKFLAT  368

Query  587   SGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWV---------DQTDANGLCFRILYMAS  435
               F+       L  RA L+K+   G+  C   W           + D    CF   Y+ +
Sbjct  369   ENFYHTSKFFGLRPRAYLSKLMTAGKEFCGEDWSWLKEKYVSHKEEDLLRYCFSSAYIVA  428

Query  434   LIKDALCLS------NLEIIFGPGDVSWALGAALIE  345
             L+ D+L ++       +    G   + WALGA +++
Sbjct  429   LLHDSLGIALDDERVKVANQVGSIPLDWALGAFIMQ  464



>ref|XP_006355131.1| PREDICTED: probable apyrase 6-like [Solanum tuberosum]
Length=542

 Score =   100 bits (249),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 113/452 (25%), Positives = 201/452 (44%), Gaps = 59/452 (13%)
 Frame = -1

Query  1649  FAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGC  1470
             F FS  +   V+++   + +V+D GSTG+R++++E+   NG  P+      G ++     
Sbjct  64    FVFSSHVRFSVKRK---YGIVIDGGSTGTRIHVFEYEVRNG-VPVYDFGDKGLVS-----  114

Query  1469  KYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIE  1290
                 ++  PGL+ +         S+  L+   ++ VP      T I ++ATAGMR L   
Sbjct  115   ----MRVNPGLSAYAEEPEMASESVGKLVEFGKQNVPQEYWSSTEIRLMATAGMRLLDSG  170

Query  1289  DASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlgll  1110
                +++E   G++++ G  +  D+  V+SG +E  Y WV  NY +  LG +    T G++
Sbjct  171   VQEKILEVCRGVLRDSGLKFMDDWASVISGSDEGLYAWVIANYALGTLG-SDPLQTTGII  229

Query  1109  dlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             +LGG+S QV    +E    E+    +  +  +++ ++SL  FG N AFD    +L    A
Sbjct  230   ELGGASAQVTFVSNEPMPPEYSRTIKFRNFTYRIYSHSLLQFGQNVAFD---LLLESLVA  286

Query  929   RRESRG-EIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPN  753
             R   +  E  K+  PC   G+  N                SS    T  L+S+   G  N
Sbjct  287   RGHHQAPESVKLMDPCSPKGYPHNLMS--------LKLSPSSLSDRTRHLSSLYPSG--N  336

Query  752   WEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSY-GSDRMQNLTLNSHEVTRYHALSGFF  576
             + +C+  ++ +      L++ K   ++C     Y GS  M  L  N      + A   FF
Sbjct  337   FSECRSASLSL------LQKDK---ESCPYKSCYIGSTFMPKLQGN------FLATENFF  381

Query  575   AVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKD  423
                    L  +A L+ +   G+  C   W         + + D +  CF   Y+ +L+ D
Sbjct  382   YTSRFFGLPPKAFLSDLMAAGKSFCEEDWSSLKSKYPSLQEEDLHRYCFSSAYILALLHD  441

Query  422   ALCLSNLEIIFGPGD------VSWALGAALIE  345
             +L ++  +   G  +      + WALGA +++
Sbjct  442   SLGIALDDDRIGYANQVENIPLDWALGAFILQ  473



>ref|NP_172877.1| probable apyrase 5 [Arabidopsis thaliana]
 sp|Q6NQA8.1|APY5_ARATH RecName: Full=Probable apyrase 5; Short=AtAPY5; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
5 [Arabidopsis thaliana]
 gb|AAQ65173.1| At1g14250 [Arabidopsis thaliana]
 dbj|BAD42898.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43282.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29131.1| probable apyrase 5 [Arabidopsis thaliana]
 gb|AEJ38086.1| nucleoside triphosphate diphosphohydrolase 5 [Arabidopsis thaliana]
Length=488

 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 113/461 (25%), Positives = 202/461 (44%), Gaps = 69/461 (15%)
 Frame = -1

Query  1649  FAFSPSLILY----VRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTR  1482
             F FS + +++    +R+ + +++V++D GS+G+R++++ +   +G+ P+       +   
Sbjct  50    FVFSSNSVMFSASFLRRSSLHYSVIIDAGSSGTRIHVFGYWFESGK-PVF------DFGE  102

Query  1481  SDGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRR  1302
                  Y  ++  PGL+ +  N  G   S+  L+  A+  +P GK   + I ++ATAGMR 
Sbjct  103   E---HYASLKLSPGLSSYADNPEGASVSVTKLVEFAKGRIPKGKLKKSDIRLMATAGMRL  159

Query  1301  LPIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgsht  1122
             L +    ++++    +++  GF ++ ++  V+SG +E  Y WV  N+ +  LG      T
Sbjct  160   LDVPVQEQILDVTRRVLRSSGFKFQDEWATVISGTDEGIYAWVVANHALGSLGGD-PLKT  218

Query  1121  lglldlggssLQVVTEIDEFREDEHV---FRSRI--GSVEHKLLAYSLQAFGFNEAFDRA  957
              G+++LGG+S QV      F   EHV   F   I  G+V + + ++S   FG + A D+ 
Sbjct  219   TGIVELGGASAQVT-----FVPSEHVPPEFSRTISYGNVSYTIYSHSFLDFGQDAAEDKL  273

Query  956   LAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNS  777
             L  L  + A     G    V  PC   G++ +        QK SS   S        L  
Sbjct  274   LESLQNSVAASTGDG---IVEDPCTPKGYIYD-----THSQKDSSGFLSEESKFKASLQ-  324

Query  776   ILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCV-GLLSYGSDRMQNLTLNSHEVTR  600
             +   GD  + KC+         S+ L   +  ++NC     S GS    N+         
Sbjct  325   VQAAGD--FTKCR---------SATLAMLQEGKENCAYKHCSIGSTFTPNIQ------GS  367

Query  599   YHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDA---------NGLCFRIL  447
             + A   FF       L  +  L++M   G+  C   W    +          +  CF   
Sbjct  368   FLATENFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKEKYPTTKDKYLHRYCFSSA  427

Query  446   YMASLIKDAL--CLSNLEIIFGPG------DVSWALGAALI  348
             Y+ S++ D+L   L +  I +          + WALGA ++
Sbjct  428   YIISMLHDSLGVALDDERIKYASKAGKENIPLDWALGAFIL  468



>ref|XP_002890045.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66304.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score = 99.4 bits (246),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 116/464 (25%), Positives = 209/464 (45%), Gaps = 71/464 (15%)
 Frame = -1

Query  1619  VRKRASY-FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHC-VQTE  1446
             +R+R +  ++V++D GS+G+RV+++ +   +G+ P+             G K++  ++  
Sbjct  64    LRRRCTLRYSVIIDAGSSGTRVHVFGYWFESGK-PVF----------DFGEKHYANLKLT  112

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PGL+ +  N  G   S+  L+  A+K +P+     + I ++ATAGMR L +    ++++ 
Sbjct  113   PGLSAYADNPEGASVSVTKLVEFAKKRIPTRMLRKSDIRLMATAGMRLLEVPVQEQILDV  172

Query  1265  VVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQ  1086
                +++  GF +R ++  V+SG +E  Y W+  NY +  LG T    T G+++LGG+S Q
Sbjct  173   TRRVLRSSGFMFRDEWATVISGSDEGIYAWIIANYALGSLG-TDPLETTGIVELGGASAQ  231

Query  1085  VVTEIDEFREDEHV---FRSRI--GSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE  921
             V      F   EHV   F   I  G+V + + ++S   +G + A  R L  L   Q    
Sbjct  232   VT-----FVSSEHVPPEFSRTISYGNVSYTIYSHSFLNYGKDAALKRLLETL---QNSAN  283

Query  920   SRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKC  741
             S GE   V  PC   G++ +   +    +  S      SR+      S+   G  N+ KC
Sbjct  284   STGEGI-VEDPCTPKGYIYDTNSK----KYSSGFLADESRLK----GSLEAAG--NFSKC  332

Query  740   KVLAMEVATNSSNLERSKVAEQNC-VGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYN  564
             +         S+     +  ++NC     S GS    +L         + A S F+    
Sbjct  333   R---------SATFALLQEGKENCQYEHCSIGSTFTPDLQ------GSFLATSNFYYTAK  377

Query  563   MLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--  417
                L  +  L+++   G+  C   W          D+    G CF   Y+ S++ D+L  
Sbjct  378   FFELEEKGWLSELIPAGKRYCGEEWSKLILEYPTTDEEYLRGYCFSSAYIISMLHDSLGI  437

Query  416   CLSNLEIIFG--PGD----VSWALGAALIEGGEHSRLIATESRR  303
              L +  I +    G+    + WALGA +++    +   + +SR+
Sbjct  438   ALDDERITYANEAGEKHIPLDWALGAFILDAVTPTSDYSGKSRK  481



>gb|ADG38761.1| AT4G19180-like protein [Capsella grandiflora]
Length=207

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/232 (30%), Positives = 111/232 (48%), Gaps = 45/232 (19%)
 Frame = -1

Query  977  NEAFDRA----LAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCF-----GQKPs  825
            N+AF+R+    L +L          G++ +++HPCL+SG+   + C  C      G+K  
Sbjct  1    NDAFERSVVHLLKMLPNVNKSDLIEGKL-EMKHPCLNSGYNGQYICSQCASSLKRGKKGK  59

Query  824  ssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE----QNCVGLL  657
            S               I ++G PNW +C  LA ++A NSS    +K+      Q C   L
Sbjct  60   SGV------------PIKLVGAPNWGECSSLA-KIAVNSSEWSNTKLGVDCDLQPCA--L  104

Query  656  SYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW----  489
              G  R            +++A+SGFF VY   NLS+ A+L  + E G+  C ++W    
Sbjct  105  PDGYPRPHG---------QFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVAR  155

Query  488  ---VDQTDANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEG  342
                 Q      CFR  Y+ SL+++ L +++ +I+ G G ++W LG AL+E 
Sbjct  156  TSVSPQPFIEQYCFRAPYIVSLLREGLYITDKQIVIGSGSITWTLGVALLEA  207



>ref|XP_006417036.1| hypothetical protein EUTSA_v10007616mg [Eutrema salsugineum]
 gb|ESQ35389.1| hypothetical protein EUTSA_v10007616mg [Eutrema salsugineum]
Length=450

 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 119/502 (24%), Positives = 203/502 (40%), Gaps = 107/502 (21%)
 Frame = -1

Query  1778  RMEPKSPSKSKIHVMGFIQSPITLKCvkvvllisfilvlIFGYFAFSPSLILYVRKRASY  1599
             + +PK P+KS I ++ F+   ITL                  +FAF    +++ R+ +  
Sbjct  29    KFKPK-PTKSII-LLTFVSVAITLAI----------------FFAFRS--VIFNRRSSFR  68

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GS+G+R +++ +   +G+ P+       +  + +   Y  ++  PGL+ +  N
Sbjct  69    YSVVIDAGSSGTRAHVFRYWLESGK-PVF------DFGKEN---YASLKLNPGLSSYADN  118

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                   SLK L+  A+  VP      + I ++ATAGMR L      +++E   G+++  G
Sbjct  119   PEEASVSLKELVEFAKGRVPKRMLKNSDIRLMATAGMRLLQETVQEQILEVTRGVLRSSG  178

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  N+ +  LG      T G++ LGG+S QV     E  
Sbjct  179   FRFRDEWASVISGSDEGIYAWVVANHALGSLGGD-PLQTTGIVTLGGASAQVTFVSSEPV  237

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLS  879
               E       G+V +K+ ++S    G NEA D+    L  +       G    V  PC  
Sbjct  238   PPELSRTITYGNVSYKIYSHSFLHLGQNEAHDKLWESLHNSAVNSTEDG---IVTDPCTP  294

Query  878   SGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCK--VLAMEVATNSS  705
              G++        F Q       +    +T  L +       N+ +C+    AM    N+S
Sbjct  295   KGYI--------FDQNSQKKNSTEESRLTASLQAA-----GNFTQCRSATFAMLQEGNAS  341

Query  704   NLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKM  525
                                                      F+       L  +  L++M
Sbjct  342   -----------------------------------------FYYTSKFFELHEKGWLSEM  360

Query  524   WETGQGLCSRSWVDQTDAN---------GLCFRILYMASLIKDAL--CLSNLEIIF----  390
                G+  C   W    D           G CF   Y+ S++ D+L   L +  I F    
Sbjct  361   IPAGKRFCKEEWSKLKDKYPTTNEEYLLGYCFSSAYIISMLHDSLGFALDDGRIEFASKA  420

Query  389   GPGDV--SWALGAALIEGGEHS  330
             G  D+   WALGA +++  ++S
Sbjct  421   GAKDIPLDWALGAFILKTSDYS  442



>gb|AEN82492.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82493.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82494.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82495.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82496.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82497.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82498.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82499.1| AT4G19180-like protein, partial [Capsella rubella]
Length=208

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 100/206 (49%), Gaps = 40/206 (19%)
 Frame = -1

Query  905  FKVRHPCLSSGFVQNHTCRGCF-----GQKPsssedssSRMMTCELNSILVLGDPNWEKC  741
             +++HPCL+SG+   + C  C      G+K  S               I ++G PNW +C
Sbjct  27   LEMKHPCLNSGYNGQYICSQCASSLKRGKKGKSGV------------PIKLVGAPNWGEC  74

Query  740  KVLAMEVATNSSNLERSKVAE----QNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFA  573
              LA ++A NSS    +K+      Q C   L  G  R            +++A+SGFF 
Sbjct  75   SSLA-KIAVNSSEWSNTKLGVDCDLQPCA--LPDGYPRPHG---------QFYAVSGFFV  122

Query  572  VYNMLNLSSRANLTKMWETGQGLCSRSW-------VDQTDANGLCFRILYMASLIKDALC  414
            VY   NLS+ A+L  + E G+  C ++W         Q      CFR  Y+ SL+++ L 
Sbjct  123  VYRFFNLSAEASLDDVLEKGREFCEKAWQVARTSVSPQPFIEQYCFRAPYIVSLLREGLY  182

Query  413  LSNLEIIFGPGDVSWALGAALIEGGE  336
            +++ +I+ G G ++W LG AL+E G+
Sbjct  183  ITDKQIVIGSGSITWTLGVALLEAGK  208



>ref|XP_009634621.1| PREDICTED: LOW QUALITY PROTEIN: ectonucleoside triphosphate diphosphohydrolase 
8 [Egretta garzetta]
Length=482

 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 112/478 (23%), Positives = 192/478 (40%), Gaps = 89/478 (19%)
 Frame = -1

Query  1634  SLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCV  1455
             S+I ++  R+ Y  +V D GST + + IY W       P+      G +++ +     C 
Sbjct  19    SIIXFLPPRSKY-GLVFDAGSTHTSLYIYRW-------PVDKENGTGIISQVE----TCT  66

Query  1454  QTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED---A  1284
              + PG++ +  N +G  ASLKP +  A K VP+ ++  TP ++ ATAGMR L  ++   A
Sbjct  67    VSGPGISSYADNPAGAGASLKPCLDKAMKIVPAEQQRETPTYLGATAGMRLLREQNDTKA  126

Query  1283  SRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldl  1104
              +V + V   + E+   +R    R+L+G EE  +GW+ +NY +  L       +      
Sbjct  127   KQVFDEVSKAIGEYPVDFRG--ARILTGNEEGSFGWITVNYLLETL----VKFSFAGKWE  180

Query  1103  ggssLQVVTEID----------------EFREDEHVFRSRIGSVEHKLLAYSLQAFGFNE  972
                  +VV  +D                E +++   F  R+    + L  +S   +G  +
Sbjct  181   HPRDTEVVGALDLGGASTQITFQPGVTIEDKDNSAFF--RLYGTNYSLYTHSYGCYGQTQ  238

Query  971   AFDRALAILSQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMT  792
             A    LA L Q     +      ++ HPC   G+ +N T                   M 
Sbjct  239   ALKMLLAALHQGSPPSQ------EISHPCYPKGYQENIT-------------------MA  273

Query  791   CELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSH  612
                NS  V         +VL +   T +   +    A Q      S G++R         
Sbjct  274   DLYNSPCVRAPSTPSPAQVLRV---TGTGKPDMCSTAIQKLFN-FSCGANRTCGFNGVYQ  329

Query  611   EVTR--YHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWV--------DQTDANGL  462
                R  + A +GF+  ++ LNL+S+ +L+ +  T Q  C ++W         D+      
Sbjct  330   PPVRGQFFAFAGFYYTFHFLNLTSQQSLSDVNSTVQAFCKKNWTELVETFPKDKRFLPTY  389

Query  461   CFRILYMASLIKDALCLSN---LEIIFGP----GDVSWALGAALIEGGEHSRLIATES  309
             C   +Y+ +L+ D    +      I F       D+ W LG  L      + +I TE+
Sbjct  390   CAGAIYILTLLLDGYKFNEHTWSSIRFSQQAANTDIGWTLGFML----NFTNMIPTEA  443



>gb|EPS67236.1| hypothetical protein M569_07539, partial [Genlisea aurea]
Length=525

 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 105/410 (26%), Positives = 186/410 (45%), Gaps = 62/410 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GSTG+RV+++E++  +G+  +L  +  G+++         ++  PGL+ +  N
Sbjct  77    YSVVIDGGSTGTRVHVFEYLIRDGKL-VLDFSERGSVS---------LRMIPGLSAYADN  126

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                  A +  L+  A K VP  +   T   ++ATAGMR L  +D  R++     +++  G
Sbjct  127   PERSGAVVAELVEFARKNVPRNQWQETEARLMATAGMRLLKNDDQERILNACRNVLRLSG  186

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F ++ D+  V+SG +E  YGWV  NY +  LG    S T G+++LGG+S QV    +E  
Sbjct  187   FIFQDDWATVISGSDEGVYGWVVANYALGTLG-AEPSQTSGIIELGGASAQVTFVPNEPI  245

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRAL-AILSQTQARRESRGEIFKVRHPCL  882
                   + + G+  + L ++SL  FG N AF+    +++S  Q          K+  PC 
Sbjct  246   PPAFSQKVKFGNFTYDLYSHSLLHFGQNVAFESLQDSLVSAGQKFVTESLRSGKLVDPCT  305

Query  881   SSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDP--NWEKCKVLAMEVATNS  708
               G+  +                      T ++  + VL +P  N+ +C+  ++++    
Sbjct  306   PRGYSSS----------------------TVKVRYVSVL-EPSGNFSECRSASVKL----  338

Query  707   SNLERSKVAEQNCVGLLSY-GSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLT  531
               L++ K     C+    Y GS  +  L         + A   FF       L  R  L+
Sbjct  339   --LQKGK---DKCLYATCYIGSTFIPKLR------GTFLATENFFHTSKFFGLGERFLLS  387

Query  530   KMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS  408
              +   GQ  CS  W         +D+ D    CF   Y+ +L+ D+L ++
Sbjct  388   DLVVAGQQFCSEEWSKLARKYTTIDEEDLLHYCFSSAYIVALLHDSLGIA  437



>gb|ADG38766.1| AT4G19180-like protein [Neslia paniculata]
Length=207

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 108/231 (47%), Gaps = 43/231 (19%)
 Frame = -1

Query  977  NEAFDRALAILSQTQARRESRGEI---FKVRHPCLSSGFVQNHTCRGCF-----GQKPss  822
            N+AF+R++  L +          I    +++HPCL++G+   + C  C      G+K  S
Sbjct  1    NDAFERSVVHLLKRLPNANKSDLIEGKLEMKHPCLNTGYKGQYICSQCASSLQGGKKGKS  60

Query  821  sedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSD  642
                           I ++G PNW +C  LA   A NSS    +K           +G D
Sbjct  61   GV------------PIKLVGAPNWGECSALAKN-AVNSSEWSNTK-----------HGVD  96

Query  641  -RMQNLTLNS---HEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-----  489
              +Q   L     H   +++A+SGFF VY   NLS+ A+L  + E G+  C ++W     
Sbjct  97   CDLQPCALPDGYPHPHGQFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART  156

Query  488  --VDQTDANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEG  342
                Q      CFR  Y+ SL+++ L +++ +II G G ++W LG AL+E 
Sbjct  157  SVSPQPFIEQYCFRAPYIVSLLREGLYITDKQIIIGSGSITWTLGVALLEA  207



>ref|XP_006827247.1| hypothetical protein AMTR_s00010p00262060 [Amborella trichopoda]
 gb|ERM94484.1| hypothetical protein AMTR_s00010p00262060 [Amborella trichopoda]
Length=540

 Score = 99.0 bits (245),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 115/455 (25%), Positives = 202/455 (44%), Gaps = 52/455 (11%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
             +A  F +V+D GSTG+R++++E+  + G  P             +G     ++  PGL+ 
Sbjct  72    QAKRFGIVIDGGSTGTRIHVFEF-SSKGGVPFF---------NFEGQGLSSMKINPGLSA  121

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             F  +  G   SL  L+  A+  VP+ + G T I ++ATAG+R L       ++E    ++
Sbjct  122   FEKDPEGAGDSLMDLLEFAKTRVPNDQWGDTEIRLMATAGLRILSPNSQQLILESCRNVL  181

Query  1250  KEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEI  1071
             +  GF ++ ++  V++G +E  Y WVA NY +  LG      T G+++LGG+S QV    
Sbjct  182   RMSGFRFQDEWASVITGSDEGLYAWVAANYALDTLGGD-PLETSGIIELGGASAQVTFVP  240

Query  1070  DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAIL-SQTQARRESRGEIFKVR  894
              E    E     R   V + L ++SL  FG N A+D    +L S+      S     K+ 
Sbjct  241   REPPPHEFSRTIRYRGVTYNLYSHSLLHFGQNVAYDSLQTLLISRGLKSASSSVRQRKLI  300

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
              PC  +G+  +          P ++           L S+  +G  N+ +C+  A+ +  
Sbjct  301   DPCTPTGYHHDLDMLKMSIVVPYAN--------NGSLPSVHAVG--NFTECRSAALML--  348

Query  713   NSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANL  534
                 L++ K  E+      + GS  +  L        ++ A   FF       L  +A+L
Sbjct  349   ----LQKGK--EECLYHHCNIGSAFIPELR------GKFLATENFFYTSKFFGLDPKASL  396

Query  533   TKMWETGQGLC-SRSWVDQTDAN-GL--------CFRILYMASLIKDALCLS----NLEI  396
             + + + G+  C   SW +    N GL        CF   Y+ +L+ D+L +S     ++ 
Sbjct  397   SDLVKAGKHFCEEESWSNLKKRNRGLNEDELLKYCFSSAYIVALLHDSLGISMYDKRIDF  456

Query  395   IFGPGDVS--WALGAALIEGGEHSRLIATESRRKG  297
             +    ++S  WALGA ++    ++ L     +  G
Sbjct  457   VNQIQNISLDWALGAFILHASSNTELAHPNHQTSG  491



>ref|NP_563942.1| probable apyrase 4 [Arabidopsis thaliana]
 sp|Q8H1D8.1|APY4_ARATH RecName: Full=Probable apyrase 4; Short=AtAPY4; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
4 [Arabidopsis thaliana]
 gb|AAN13015.1| putative nucleoside triphosphatase [Arabidopsis thaliana]
 gb|AEE29126.1| probable apyrase 4 [Arabidopsis thaliana]
 gb|AEJ38085.1| nucleoside triphosphate diphosphohydrolase 4 [Arabidopsis thaliana]
Length=503

 Score = 98.6 bits (244),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 112/455 (25%), Positives = 197/455 (43%), Gaps = 55/455 (12%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+ + +++V++D GS+G+RV+++ +   +G+ P+       +    +   Y  ++  PGL
Sbjct  75    RRVSLHYSVIIDGGSSGTRVHVFGYRIESGK-PVF------DFGEEN---YASLKLSPGL  124

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + +  N  G+  S+  L+  A+K V  GK   + I ++ATAGMR L +    ++++    
Sbjct  125   SAYADNPEGVSESVTELVEFAKKRVHKGKLKKSDIRLMATAGMRLLELPVQEQILDVTRR  184

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV  
Sbjct  185   VLRSSGFDFRDEWASVISGSDEGVYAWVVANHALGSLGGE-PLKTTGIVELGGASAQVTF  243

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKV  897
                E    E       G+V + L ++S   FG + A ++    L  + A     G    V
Sbjct  244   VSTELVPSEFSRTLAYGNVSYNLYSHSFLDFGQDAAQEKLSESLYNSAANSTGEG---IV  300

Query  896   RHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVA  717
               PC+  G++          QK      +     T  L +       N+ +C+  A  + 
Sbjct  301   PDPCIPKGYILETNL-----QKDLPGFLADKGKFTATLQAA-----GNFSECRSAAFAML  350

Query  716   TNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
                   E+ K   + C    S GS    NL         + A   FF       L  +  
Sbjct  351   QE----EKGKCTYKRC----SIGSIFTPNLQ------GSFLATENFFHTSKFFGLGEKEW  396

Query  536   LTKMWETGQGLCSRSWVDQ-------TDANGL--CFRILYMASLIKDAL--CLSNLEIIF  390
             L++M   G+  C   W           D N L  CF   Y+ S++ D+L   L +  I +
Sbjct  397   LSEMILAGKRFCGEEWSKLKVKYPTFKDENLLRYCFSSAYIISMLHDSLGVALDDERIKY  456

Query  389   ----GPGDV--SWALGAALIEGGEHSRLIATESRR  303
                 G  D+   WALGA ++     +   + +SR+
Sbjct  457   ASKAGEEDIPLDWALGAFILNTATATFDYSGKSRK  491



>gb|ADG38760.1| AT4G19180-like protein [Capsella grandiflora]
 gb|ADG38762.1| AT4G19180-like protein [Capsella grandiflora]
 gb|ADG38763.1| AT4G19180-like protein [Capsella grandiflora]
 gb|ADG38764.1| AT4G19180-like protein [Capsella grandiflora]
 gb|ADG38765.1| AT4G19180-like protein [Capsella grandiflora]
Length=207

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 109/231 (47%), Gaps = 43/231 (19%)
 Frame = -1

Query  977  NEAFDRALAILSQTQARRESRGEI---FKVRHPCLSSGFVQNHTCRGCF-----GQKPss  822
            N+AF+R++  L +          I    +++HPCL+SG+   + C  C      G+K  S
Sbjct  1    NDAFERSVVHLLKRLPNVNKSDLIEGKLEMKHPCLNSGYNGQYICSQCASSLKRGKKGKS  60

Query  821  sedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAE----QNCVGLLS  654
                           I ++G PNW +C  LA ++A NSS    +K+      Q C   L 
Sbjct  61   GV------------PIKLVGAPNWGECSSLA-KIAVNSSEWSNTKLGVDCDLQPCA--LP  105

Query  653  YGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW-----  489
             G  R            +++A+SGFF VY   NLS+ A+L  + E G+  C ++W     
Sbjct  106  DGYPRPHG---------QFYAVSGFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART  156

Query  488  --VDQTDANGLCFRILYMASLIKDALCLSNLEIIFGPGDVSWALGAALIEG  342
                Q      CFR  Y+ SL+++ L +++ +I+ G G ++W LG AL+E 
Sbjct  157  SVSPQPFIEQYCFRAPYIVSLLREGLYITDKQIVIGSGSITWTLGVALLEA  207



>ref|XP_010257480.1| PREDICTED: probable apyrase 6 [Nelumbo nucifera]
Length=548

 Score = 98.6 bits (244),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 113/453 (25%), Positives = 195/453 (43%), Gaps = 57/453 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             F++++D GSTG+R++++ +  N    P+      G ++         ++  PGL+ F  N
Sbjct  82    FSIIIDGGSTGTRIHVFRFSINEKGMPLFSFGKDGLVS---------MRVNPGLSSFSAN  132

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                   SL  L+  A++ VP      + I ++ATAG+RRL ++   R+++    I++  G
Sbjct  133   PKDAGNSLLGLLDFAKQRVPKDYWEESEIRLMATAGLRRLDLDVQERILDSCRKILRRSG  192

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F ++ D+  V++G +E  Y WVA NY +  LG      T G+++LGG+S QV     E  
Sbjct  193   FKFQDDWASVITGSDEGIYAWVAANYALGSLGGD-PQKTTGIIELGGASAQVTFASSETL  251

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFD--RALAILSQTQARRESRGEIFKVRHPC  885
               E     + G   + L ++SL  FG N A++  +   I    +   ES  E   +  PC
Sbjct  252   PPEFSHTLKFGKFTYNLYSHSLLHFGQNVAYESLQESLISKNWKLSAESVQEAISI-DPC  310

Query  884   LSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSS  705
                G+         +G +  S            L +    G  N+ +C+  A  +     
Sbjct  311   SPKGY--------SYGLQSWSLAPGMLDGKNKFLPTRHASG--NFSECRSAAFMLLQKG-  359

Query  704   NLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKM  525
                + K + ++C      GS  +  L        ++ A   FF       L+  A+L+ +
Sbjct  360   ---KEKCSYRHCY----IGSTFIPRLQ------GKFLATENFFYTSKFFGLAPTASLSDL  406

Query  524   WETGQGLCSRSWVD---------QTDANGLCFRILYMASLIKDALCLSNLEIIFG----P  384
                GQ  C   W +         + D    CF   Y+ +L+ D+L +S  +   G     
Sbjct  407   MLAGQQFCEDDWSNLKKKYGALAENDLQRYCFSSAYIVALLHDSLGISLDDKRIGFTNQV  466

Query  383   GDV--SWALGAALIEGG-----EHSRLIATESR  306
             GD+   WALG  +++       E S  IAT +R
Sbjct  467   GDIPLDWALGTFILQNTANLDVELSDWIATIAR  499



>ref|XP_006417035.1| hypothetical protein EUTSA_v10009320mg [Eutrema salsugineum]
 gb|ESQ35388.1| hypothetical protein EUTSA_v10009320mg [Eutrema salsugineum]
Length=470

 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 111/459 (24%), Positives = 192/459 (42%), Gaps = 77/459 (17%)
 Frame = -1

Query  1652  YFAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDG  1473
             +FAF P    + R     ++VV+D GS+G+R +++ +   +G+ P+             G
Sbjct  49    FFAFRPRESSFER-----YSVVIDAGSSGTRAHVFRYWLESGK-PVF----------DFG  92

Query  1472  CKYHCVQTE-PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLP  1296
                +  ++E PGL+ +  N  G   S+  L++ A+  VP G    + I ++ATAG+R L 
Sbjct  93    KDNYAKESENPGLSSYADNPKGANVSVAELVKFAKGRVPEGMWEKSDIRLMATAGLRLLN  152

Query  1295  IEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlg  1116
                  +++E    +++  GF +R D+  V++G +E  Y WV  NY +  LG      T  
Sbjct  153   ETVMEQILEVTREVLRSSGFNFRDDWAWVITGSDEGKYSWVVANYALGSLGGEPLQTTGI  212

Query  1115  lldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
             +   G S+           ED     +  G+V + L ++S    G N A D+    L  +
Sbjct  213   VELGGASAQVTFVSSQPMPEDLSQTIT-YGNVAYSLYSHSFLHLGQNAAHDKLWEALHNS  271

Query  935   QARRESRGEIFKVRHPCLSSGFV-----QNHTCRGCFGQKPsssedssSRMMTCELNSIL  771
              A   +  EI  V  PC   G++     QN T                   +T  L +  
Sbjct  272   AAHS-TEDEI--VTDPCTPEGYIFVSKRQNST---------------EESRLTASLQAA-  312

Query  770   VLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHA  591
                  N+ +C+   + +        +   A ++C    S GS    +L        R+ A
Sbjct  313   ----GNFTECRTATLAMLHEG----KENCASEHC----SIGSTFTPDLQ------GRFLA  354

Query  590   LSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVD-------QTDANGL--CFRILYMA  438
              + F+       L  +  L++M   G+  C  +W +       + D + L  CF   Y+ 
Sbjct  355   TASFYYTSKFFELHEKDWLSEMIPAGKRFCGENWSELKVQYPTEQDKHLLNYCFSSAYII  414

Query  437   SLIKDAL--CLSNLEIIF----GPGDV--SWALGAALIE  345
             S++ D+L   L +  I F    G  D+   WALGA ++E
Sbjct  415   SMLHDSLGFALDDGRIEFASKAGAKDIPLDWALGAFILE  453



>ref|XP_010713029.1| PREDICTED: LOW QUALITY PROTEIN: ectonucleoside triphosphate diphosphohydrolase 
7 [Meleagris gallopavo]
Length=619

 Score = 98.6 bits (244),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 84/149 (56%), Gaps = 4/149 (3%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + VV+DCGS+GSRV +Y W P+NG    L++       R    +   ++ +PG+++    
Sbjct  64    YGVVVDCGSSGSRVFVYVWPPHNGHPHDLLDI---RQMRDPSSRPVVMKVKPGISVAAAA  120

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK-EH  1242
                  A L+PL+R A   VP+GK   TP++VL TAGMR LP    + ++E +V  V  E 
Sbjct  121   PERATAYLRPLLRFAAAHVPAGKHKETPLYVLCTAGMRLLPERLQAAILENLVKNVPLEF  180

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNYKM  1155
              F + K    V+SG++E  Y W+ +N+ +
Sbjct  181   DFLFSKSHAEVISGKQEGVYAWIGINFVL  209



>gb|AAK76563.1| putative nucleoside triphosphatase [Arabidopsis thaliana]
Length=503

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 112/455 (25%), Positives = 197/455 (43%), Gaps = 55/455 (12%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+ + +++V++D GS+G+RV+++ +   +G+ P+       +    +   Y  ++  PGL
Sbjct  75    RRVSLHYSVIIDGGSSGTRVHVFGYRIESGK-PVF------DFGEEN---YASLKLSPGL  124

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + +  N  G+  S+  L+  A+K V  GK   + I ++ATAGMR L +    ++++    
Sbjct  125   SAYADNPEGVSESVTELVEFAKKRVHKGKLKKSDIRLMATAGMRLLELPVQEQILDVTRR  184

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV  
Sbjct  185   VLRSSGFDFRDEWASVISGSDEGVYAWVVANHALGSLGGE-PLKTTGIVELGGASAQVTF  243

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKV  897
                E    E       G+V + L ++S   FG + A ++    L  + A     G    V
Sbjct  244   VSTELVPSEFSRTLAYGNVSYNLYSHSFLDFGQDAAQEKLSESLYNSAANSTGEG---IV  300

Query  896   RHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVA  717
               PC+  G++          QK      +     T  L +       N+ +C+  A  + 
Sbjct  301   PDPCIPKGYILETNL-----QKDLPGFLADKGKFTATLQAA-----GNFSECRSAAFAML  350

Query  716   TNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
                   E+ K   + C    S GS    NL         + A   FF       L  +  
Sbjct  351   RE----EKGKCTYKRC----SIGSIFTPNLQ------GSFLATENFFHTSKFFGLGEKEW  396

Query  536   LTKMWETGQGLCSRSWVDQ-------TDANGL--CFRILYMASLIKDAL--CLSNLEIIF  390
             L++M   G+  C   W           D N L  CF   Y+ S++ D+L   L +  I +
Sbjct  397   LSEMILAGKRFCGEEWSKLKVKYPTFKDENLLRYCFSSAYIISMLHDSLGVALDDERIKY  456

Query  389   ----GPGDV--SWALGAALIEGGEHSRLIATESRR  303
                 G  D+   WALGA ++     +   + +SR+
Sbjct  457   ASKAGEEDIPLDWALGAFILNTATATFDYSGKSRK  491



>emb|CDY39332.1| BnaC05g10470D [Brassica napus]
Length=490

 Score = 97.4 bits (241),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 109/440 (25%), Positives = 190/440 (43%), Gaps = 55/440 (13%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+ +  ++VV+D GS+G+RV+++ +   +G  P+       + +  DG  Y  ++  PGL
Sbjct  70    RRVSLRYSVVIDGGSSGTRVHVFGYRIESGN-PVF------DFSGDDG--YASMKLSPGL  120

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + +  +  G   S+  L+  A+  VP      + I ++ATAGMR L +    R+++    
Sbjct  121   SSYADDPEGASVSVAELVEFAKGRVPKRVLKESEIRLMATAGMRLLDVSVQERILQVTRR  180

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF +R D   V+SG +E  Y WV  NY +  LG      T G+++LGG+S QV  
Sbjct  181   VLRSSGFKFRDDSALVISGSDEGVYAWVVANYALGSLGGD-PLQTTGIVELGGASTQVTF  239

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKV  897
                E    E +     G+V +++ ++S    G + A ++    L+   A     G    V
Sbjct  240   VSSEHVPSEFLRTITYGNVSYRIYSHSFLNLGQDAAHEKLWESLNNLAANSTGEG---IV  296

Query  896   RHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVA  717
               PC   G++ +    G     P  S+ +         +S+   G  N+ KC+  A  + 
Sbjct  297   TDPCTPKGYIPDKNSTGEGVVLPGESKFT---------DSLQAAG--NFSKCRSAAFNIL  345

Query  716   TNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
                    + K   ++C    S GS    NL         + A   FF       L  +  
Sbjct  346   QEG----KEKCHYKHC----SIGSTFTPNLR------GSFLATENFFHTSKFFALREKDW  391

Query  536   LTKMWETGQGLCSRSWVDQ-------TDANGL--CFRILYMASLIKDALCLS----NLEI  396
             L+ M   G+  C   W           D + L  CF   Y+ S++ D+L ++     +E 
Sbjct  392   LSAMISAGESFCGDDWSKLKVKHPTFKDESLLRYCFSSAYIVSMLHDSLGVALDDQRVEF  451

Query  395   IFGPGD----VSWALGAALI  348
                 G+    + WALGA ++
Sbjct  452   ASEAGEKGIPLDWALGAFIL  471



>ref|XP_005797585.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 7-like 
[Xiphophorus maculatus]
Length=632

 Score = 98.2 bits (243),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 79/147 (54%), Gaps = 4/147 (3%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V+DCGS+GSRV +Y W P+NG    L++       R  G K    + +PG++     
Sbjct  112   YGIVVDCGSSGSRVFVYYWPPHNGNPHTLLDI---RQMRDSGSKPVVKKIKPGISTLANT  168

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK-EH  1242
              S     L+PL+  A   VP  K   TP+++L TAGMR LP    + ++E +V  V  E 
Sbjct  169   PSKASDYLEPLLSFAAAHVPKSKHKETPLYILCTAGMRLLPDSQQAAILEDLVMDVPLEF  228

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNY  1161
              F + +    V+SG++E  Y W+ +N+
Sbjct  229   DFLFSRSHAEVISGKQEGVYAWIGINF  255



>ref|XP_010458912.1| PREDICTED: probable apyrase 4 [Camelina sativa]
Length=508

 Score = 97.4 bits (241),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 111/433 (26%), Positives = 188/433 (43%), Gaps = 54/433 (12%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GS+G+RV+++ +   +G+ P+                Y   +  PGL+ +  N
Sbjct  84    YSVVIDGGSSGTRVHVFGYRVESGK-PVFDFGEE---------SYASFKLSPGLSAYGDN  133

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G+  S+  L+  A++ VP      + I ++ATAGMR L +    R++E    +++  G
Sbjct  134   PEGVSESVTELVEFAKRRVPKRVLEESDIRLMATAGMRLLELSVQERILEVTRRVLRSSG  193

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +++++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV     E  
Sbjct  194   FAFQEEWASVISGSDEGVYAWVVANHALGSLGGE-PLKTTGIVELGGASAQVTFVSSELV  252

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLS  879
               E       G+V +KL ++S   FG + A ++ L  L  + A     G +     PC+ 
Sbjct  253   PPEFSRTLAYGNVSYKLYSHSFLHFGQDSAQEKLLDSLHNSSANSTEEGIL---TDPCVP  309

Query  878   SGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNL  699
              G++ +        QK SS   +     T  L +    GD  + KC+   + +       
Sbjct  310   RGYILDK-----ISQKDSSGSLAEKSRFTASLQAA---GD--FSKCRSATLAMLQEG---  356

Query  698   ERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWE  519
              + K   ++C    S GS    NL         + A   FF       L  +  L++M  
Sbjct  357   -KEKCPYKHC----SIGSIFTPNLR------GSFLATENFFHTSKFFGLGEKDWLSEMIL  405

Query  518   TGQGLCSRSWVDQ-------TDANGL--CFRILYMASLIKDAL--CLSNLEIIFGPG---  381
              G+  C   W           D N L  CF   Y+ S++ D+L   L +  I F      
Sbjct  406   AGKRFCGEEWSKLKVKYPTFKDENLLRYCFSSAYIVSMLHDSLGVALDDERIGFASKAGQ  465

Query  380   --DVSWALGAALI  348
                + WALGA ++
Sbjct  466   DIPLDWALGAFIL  478



>ref|XP_007424809.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 1 isoform 
X1 [Python bivittatus]
Length=504

 Score = 97.4 bits (241),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 115/509 (23%), Positives = 205/509 (40%), Gaps = 101/509 (20%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGC--KYHCVQTE-PG  1440
             R S + +VLD GS+ + V +YEW              P     + G   + H  + E PG
Sbjct  44    RNSKYGIVLDAGSSHTNVYVYEW--------------PAEKENNTGVVRQIHVCEVEGPG  89

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMR--RLPIED-ASRVME  1269
             ++ +          LK  +  A++ VP GK   TP+++ ATAGMR  RL  ED A RV+ 
Sbjct  90    ISSYANAVENASVPLKHCMDSAKEIVPQGKHQETPVYLGATAGMRLLRLKNEDVAGRVLS  149

Query  1268  GVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKM---------RMLGNTsgshtlg  1116
              V   ++ + F ++    R+L G EE  YGW+ LNY +         ++LG+T       
Sbjct  150   AVGETLRMYPFKFQG--ARILGGDEEGVYGWITLNYLLGKFTESIWPKVLGHTFFKSRTT  207

Query  1115  lldlggssLQVVTEIDEFREDE--HVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILS  942
                  G +   +T + +   +E     +  +   E+ +  +S   +G ++A    L +L 
Sbjct  208   GALDLGGASTQITFVPDPNNNESADTVKVHLYGKEYMVYTHSFLCYGKDQALH--LKLLH  265

Query  941   QTQARRESRGEIFKVRHPCLSSGFVQ--------NHTCRGCFGQKPsssedssSRMMTCE  786
                + +  R     ++ PC   G+ +         + C  C               +T  
Sbjct  266   DVFSSKTDR-----LQDPCFHQGYTRTLNVFDLTTNPCTAC--------------RITVS  306

Query  785   LNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEV  606
              + + + GD N+EKC + +++   N+ +                + S    N T      
Sbjct  307   HSQMQIQGDGNYEKC-LASIQRIFNTPD---------------CFYSSCTFNRTFLPEVS  350

Query  605   TRYHALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFR  453
               + A S F+ V N LN + +  + ++ +T +  CS+SW         V +   +  CF 
Sbjct  351   GEFVAFSAFYYVMNFLNATQKP-MDQVIQTVKSFCSKSWNEVKVEFPKVKEKYLSEYCFS  409

Query  452   ILYMASLIKDALCLS-----NLEII--FGPGDVSWALGAALIEGGEHSRLIATESRRKGL  294
              +Y+ SL+      +     N+  +      D  W LG  L      + +I  E   + L
Sbjct  410   GVYIISLLGQRYNFTEEKWRNIHFLKKIQNSDAGWTLGYML----NLTNMIPAEQPYRHL  465

Query  293   ATQHKWMVSSSI--TLFIVLVCVLMIVYR  213
              +   ++    I  TL + L+ V  ++YR
Sbjct  466   LSHASYISLMVICSTLVVSLLFVGWMIYR  494



>gb|KFK43668.1| hypothetical protein AALP_AA1G157400 [Arabis alpina]
Length=497

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 107/440 (24%), Positives = 188/440 (43%), Gaps = 54/440 (12%)
 Frame = -1

Query  1619  VRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPG  1440
              R+ +  ++VV+D GS+G+RV+++     +G+ P+             G  Y  ++  PG
Sbjct  69    TRRNSLRYSVVIDGGSSGTRVHVFGHRIESGK-PVF---------DFGGANYASLKLSPG  118

Query  1439  LAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVV  1260
             L+ +  N  G   S+  L+  A++ VP+G    + + ++ATAGMR L  +   ++++   
Sbjct  119   LSAYGDNPDGASVSVTELVEFAKRRVPNGMLKESDVRLMATAGMRLLEGDVQEQILQVTR  178

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
              +++  GF +R ++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV 
Sbjct  179   RVLRSSGFKFRDEWASVISGSDEGVYAWVVANHALGSLGGD-PLQTTGIVELGGASAQVT  237

Query  1079  TEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFK  900
                 E    E       G+V + L ++S    G + A ++ L  L  + A     G    
Sbjct  238   FVSSELVPPEFSRTISYGNVSYNLYSHSFLHLGQDAAHEKFLESLHNSAANSTEEG---I  294

Query  899   VRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             V  PC   G++ +        +  S      +R     L+S+   G  N+ KC+     +
Sbjct  295   VTDPCTPKGYILDKNSH----KDSSGFLADENRF----LSSVQAAG--NFSKCRSATFTM  344

Query  719   ATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRA  540
                     + K   ++C    S GS    NL         + A   F        L  + 
Sbjct  345   LQEG----KEKCLYKHC----SIGSTFTPNLQ------GSFLATENFVHTSKFFGLGEKD  390

Query  539   NLTKMWETGQGLCSRSWVDQ-------TDANGL--CFRILYMASLIKDALCLSNLEIIFG  387
              L++M + G+  C   W           D N L  CF   Y+ S++ D+L  +  +   G
Sbjct  391   WLSEMIKAGKSFCGDDWSKLKVKYPTFKDENLLRYCFSSAYILSMLHDSLGFAIDDERIG  450

Query  386   PGD-------VSWALGAALI  348
               D       + WALGA ++
Sbjct  451   FADKAGEDIPLDWALGAFIL  470



>emb|CDH13994.1| probable Guanosine-diphosphatase [Zygosaccharomyces bailii ISA1307]
Length=528

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 125/256 (49%), Gaps = 26/256 (10%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             F +++D GSTGSRV+IYE+          V T P  L             +PGL+ F  +
Sbjct  103   FVIMIDAGSTGSRVHIYEFD---------VCTQPPTLIEET-----FKMLKPGLSSFKTD  148

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV-VGIVKEH  1242
             A+G   SL PL+  A + VP  KR  TP+ V ATAG+R L    + +++E V   + KE+
Sbjct  149   ATGAALSLDPLLDRALEVVPEKKRSCTPVAVKATAGLRLLGAAKSDKILEAVREHLEKEY  208

Query  1241  GF-FYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEI--  1071
              F     D I ++SG EE  Y WV  NY +  +G  + + T  + DLGG S Q+V E   
Sbjct  209   PFPVVEGDGISIMSGEEEGVYAWVTTNYLLGNIGGRARTPTAAVFDLGGGSTQIVFEPTF  268

Query  1070  ---DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRES--RGEI  906
                ++  E EH F    G  ++ L  +S   +G  +  ++  ++L +T  +  +  +G+ 
Sbjct  269   PPNEKMAEGEHKFELSFGGEQYILYQFSHLGYGLMQGRNKINSLLVETAIKEGTIQKGDT  328

Query  905   FKVRH---PCLSSGFV  867
               V     PCL    V
Sbjct  329   ATVHELISPCLPPQVV  344



>ref|XP_010066911.1| PREDICTED: probable apyrase 6 isoform X1 [Eucalyptus grandis]
 gb|KCW64958.1| hypothetical protein EUGRSUZ_G02502 [Eucalyptus grandis]
Length=575

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 108/457 (24%), Positives = 195/457 (43%), Gaps = 62/457 (14%)
 Frame = -1

Query  1649  FAFSPSLILYVRKRASYFTVVLDCGSTGSRVNIYE---WMPNNGEFPILVNTYPGNLTRS  1479
             +AF  S    +  R  Y  +V+D GSTG+R++++    W  +N  F    N         
Sbjct  93    YAFLSSRGFSILARRKY-AIVIDGGSTGTRIHVFSYGIWSGSNAAFDFGENGLA------  145

Query  1478  DGCKYHCVQTEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRL  1299
                    ++  PGL+ +  +     ASL  L+  A++ VP    G T + ++ATAGMR L
Sbjct  146   ------SLRVNPGLSAYAEDPEEAGASLAELLGFAKRKVPREFWGETEVRLMATAGMRML  199

Query  1298  PIEDASRVMEGVVGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtl  1119
                   ++++    +++  GF ++ ++  V++G +E  Y WV  NY +  LG     HT 
Sbjct  200   ERRVQDQILDSCRKVLRASGFQFQDEWASVITGSDEGVYAWVVANYALGALGGD-PRHTT  258

Query  1118  glldlggssLQVVTEIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA-ILS  942
             G+++LGG+S QV          E     + G++ + L ++S   FG N AF+     +LS
Sbjct  259   GIIELGGASAQVTFSSSAPLPPEFSRTVKFGNITYNLYSHSFLQFGQNVAFESLKELLLS  318

Query  941   QTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLG  762
             + +   +   ++  +  PC   G+      +   G                E   +L   
Sbjct  319   EEKNLADESHQMGMLVDPCTPKGYSHAEQLKLTPG-------------AVDEKERLLSTF  365

Query  761   DP--NWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHAL  588
             D   N+ +C+  A ++       E+ K A + C  + S  + ++Q          R+ A 
Sbjct  366   DSKGNFSECRSAAFKLLQK----EKDKCAYRQCY-IGSTFTPKLQG---------RFLAT  411

Query  587   SGFFAVYNMLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMAS  435
               FF       L+ +A L+ +   G+  C   W         +++ D    CF   Y+ +
Sbjct  412   ENFFHTSKFFGLTQKAVLSDLMLAGEHFCGEYWSILKKRHHLLNEEDLLRYCFSSAYIVA  471

Query  434   LIKDAL--CLSNLEIIF----GPGDVSWALGAALIEG  342
              + D+L   L++  I F    G   + WALGA +++ 
Sbjct  472   FLHDSLGIALNDDRIAFSNQVGSVPLDWALGAFILQA  508



>ref|XP_003686251.1| hypothetical protein TPHA_0F03360 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE63817.1| hypothetical protein TPHA_0F03360 [Tetrapisispora phaffii CBS 
4417]
Length=583

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 112/453 (25%), Positives = 195/453 (43%), Gaps = 73/453 (16%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
             + + F +++D GS+GSR+++Y++          V T P  L      K + +   PGL+ 
Sbjct  146   KENKFVIIIDAGSSGSRMHLYKFD---------VCTSPATL-----IKEYFLGVSPGLSA  191

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             F  NA     SL+PL++ A + +P  +R  TPI V ATAG+R    E A+ ++  V  ++
Sbjct  192   FPDNAIEAANSLEPLLKRALEVIPEAQRACTPITVKATAGLRLTGDEVATEILAAVRNLL  251

Query  1250  KEHGFF--YRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +    F     + I ++SG +E    W++ NY +  +G +    T  + DLGG S Q+V 
Sbjct  252   ETKYPFPIIETNGIEIMSGTDEGINAWISTNYLLGNIGTSKKVGTSAVFDLGGGSTQIVF  311

Query  1076  EIDEFREDE-----HVFRSRIGSVEHKLLAYSLQAFGFNEAFDR-ALAILSQTQ----AR  927
             E    +  +     H F      + + L  YS   +G +EA  + ++ ++ Q +      
Sbjct  312   EPSYPKRGKLPNGVHRFDLPFSGIYYTLYQYSHLGYGLSEARKKISVKLMEQYKLGGIVT  371

Query  926   RESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLG--DPN  753
                 G   ++ HPC+ S             QK         ++ + E+ ++  LG  D N
Sbjct  372   EADVGRNLELNHPCIPSKM-------QFLNQK--------VKVSSGEIYTVDFLGSTDSN  416

Query  752   WEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFA  573
              E+C+ L   V       ++S  + + C    S+      +L +N  E+   + +S FF 
Sbjct  417   PERCRNLITSV------FDKSSCSTKPC----SFDGVHQPSLEMNFPEIDDLYIISFFFD  466

Query  572   VYNMLNLSSRANLTKMWETGQGLCS------------RSWVDQTDANGL-CFRILYMASL  432
                 L L     L +M E    +C              S + +  A+ L C  + Y  +L
Sbjct  467   RTYNLGLPKSFTLREMKEFADTICGGPETYHDSFAGVPSIIGKARASSLNCLDLQYEVAL  526

Query  431   IKDALC------LSNLEIIFGPGDVSWALGAAL  351
             ++          L   + I G  +V+W LGAAL
Sbjct  527   LETGYGIPLDRELRTAQKISG-SEVTWCLGAAL  558



>gb|AAQ10658.1| apyrase 2 [Solanum tuberosum]
 gb|ABV26544.1| apyrase 2 [Solanum tuberosum]
Length=283

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 85/157 (54%), Gaps = 13/157 (8%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
              + ++ V+ D GSTGSRV+++ +    G  PI      GN           ++T PGL+ 
Sbjct  42    ESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPI------GNNIE------FFMETNPGLSS  89

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             +  N      SL+PL+ GAE  VP   +  TP+ + ATAG+R L  + A ++++ V  +V
Sbjct  90    YAKNPKAAANSLEPLLDGAEGVVPQELQYETPLELGATAGLRMLKGDAAEKILQAVRDLV  149

Query  1250  KEHGFFYRKD-FIRVLSGREEAYYGWVALNYKMRMLG  1143
             K    F+ KD ++ +L G +E  Y WVA+NY +  LG
Sbjct  150   KNQSTFHSKDQWVTILDGTQEGSYMWVAMNYLLGNLG  186



>gb|EEC83627.1| hypothetical protein OsI_29353 [Oryza sativa Indica Group]
Length=503

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 108/448 (24%), Positives = 189/448 (42%), Gaps = 63/448 (14%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+R   + VV+D GSTGSRV++  +           ++    L R D  +   ++  PGL
Sbjct  33    RRRPHEYGVVIDAGSTGSRVHVIAYR-------SSSSSPASALPRIDWARTASMKAAPGL  85

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + F  +  G   SL PL+  A + VP      T + ++ATAG+R L    A  V++    
Sbjct  86    SSFASDPGGAGRSLAPLLEFARRRVPPESWAETDVRLMATAGLRLLDAAVAEAVLDSCRV  145

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF ++ D+  V+SG EE  Y W+A NY +  LG+     T G+++LGG+S+QV  
Sbjct  146   LLRGSGFQFQDDWATVISGAEEGMYAWIAANYALGTLGDD-SQDTTGIIELGGASVQVTF  204

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI--F  903
               D+    E     + G   + L ++S    G N A++    +LS    +  +   I   
Sbjct  205   VTDKPLPPEFSHTLKFGDATYNLYSHSFLQLGQNVAYESLHDMLSTPGHKSMATHLISQA  264

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSIL-------VLGDPNWEK  744
             K R PC   GF               S  + + ++    L S +        +G  N+ +
Sbjct  265   KYRDPCTPRGF---------------SPMEGAVKLPASVLESKVEYRPYAHAVG--NFSE  307

Query  743   CKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYN  564
             C+  A+ +        R +     C      G+  + +L        ++ A   F+    
Sbjct  308   CRSAALTLLQKG----REECRYHEC----RMGAAFVPDLD------GKFLATENFYHTSK  353

Query  563   MLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL  411
                L S++ L+ +   G+  C   W          ++ +    CF   Y+ +L+ D L +
Sbjct  354   FFRLRSKSFLSDLMLAGEKFCRGDWSKIKKEYRSFNEGELLLFCFSSAYIVALLHDTLKV  413

Query  410   S------NLEIIFGPGDVSWALGAALIE  345
                    ++    G   V WALGA +++
Sbjct  414   PLDDKMIDVANQIGGVPVDWALGAFIVQ  441



>ref|XP_001756852.1| predicted protein [Physcomitrella patens]
 gb|EDQ78449.1| predicted protein [Physcomitrella patens]
Length=455

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 102/437 (23%), Positives = 192/437 (44%), Gaps = 54/437 (12%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V+D GS+GSR++++ +    G  P +      +L    G +   ++  PGL+ F  +
Sbjct  4     YGIVIDAGSSGSRIHVFRY--KQGLIPEV------DLI---GLESLSLKRTPGLSSFADS  52

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
              +   +SLK  +  A+  VP+ +R  T ++++ATAG+RRL  +    V++    +++  G
Sbjct  53    PNLAGSSLKEQLEFAKTKVPAKERSQTRVYLMATAGLRRLDKKIQEAVLDSCRNVLRASG  112

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV+ NY +  L       T G+++LGG+S QV     E  
Sbjct  113   FLFRDEWASVISGTDEGVYAWVSANYALDSL-QGDPRQTTGIVELGGASAQVTFIPKEPP  171

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLS  879
                +     +G   + L  YS   FG   A+D  L +++   +R            P L 
Sbjct  172   PPAYRHNLELGGRSYSLYTYSFLNFGQEAAWDSLLELITAGASR------------PGLK  219

Query  878   SGFVQNHTCRGCFGQKPsssedssSRMMTCELNSI-LVLGDPNWEKCKVLAMEVATNSSN  702
              G   +      + +    +   S+ + T   +S+  V+   N+ +C+  A  +  +  +
Sbjct  220   EGVAIDPCTPRGYKRSLEENARHSATVSTATHSSVSRVVSGGNFSECRTAAYSLLQHGHD  279

Query  701   LERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMW  522
                       C+    Y    + N  +   + T + A   FF       L ++ +L  + 
Sbjct  280   A---------CL----YPKCAIGNAYIPELQGT-FFATENFFYTSEFFKLPAKTSLANLM  325

Query  521   ETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS----NLEIIFGPG  381
             + G+  C  +W         V++ D    CF   Y+ +L+ D+L +S     +       
Sbjct  326   DAGEHYCGENWANLRVKHKEVEEKDLLKYCFSTAYIVALMHDSLGISMHDDRVRFTNKVH  385

Query  380   DV--SWALGAALIEGGE  336
             DV   WALGA +++  E
Sbjct  386   DVPLDWALGALIVKLSE  402



>ref|XP_002890044.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66303.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 112/455 (25%), Positives = 194/455 (43%), Gaps = 54/455 (12%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+ +  +++++D GS+G+RV+++ +   +GE P+       +        Y  ++  PGL
Sbjct  75    RRVSLRYSIIIDGGSSGTRVHVFGYRIQSGE-PVF------DFGEE---SYGSLKLSPGL  124

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + +  N  G+  S+  L+  A++ VP GK   + I ++ATAGMR L +    ++++    
Sbjct  125   SAYAENPEGVSESVTELVEFAKRRVPKGKLKKSDIRLMATAGMRLLELPVQEQILDVTRR  184

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF +R+++  V+SG +E  Y WV  N+ +  LG      T G+++LGG+S QV  
Sbjct  185   VLRSSGFEFREEWASVISGSDEGVYAWVVANHALGSLGG-EPLKTTGIVELGGASTQVTF  243

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKV  897
                E    E       G+V + L ++S   FG  +A    L+      A   S GE   V
Sbjct  244   VSSELVPSEFSRTLDYGNVSYNLYSHSFLDFG-QDAAQEKLSEFLHNSAAANSTGEGI-V  301

Query  896   RHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVA  717
               PC   G++          QK      +        L +       N+ +C+  A  + 
Sbjct  302   PDPCTPKGYILKTNL-----QKDLPGFLADKGKFIATLQAA-----GNFSECRSAAFAML  351

Query  716   TNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
                    + K   ++C    S GS    NL         + A   FF       L  +  
Sbjct  352   QEG----KWKCTYKHC----SIGSIFTPNLQ------GSFLATENFFHTSKFFGLGEKDW  397

Query  536   LTKMWETGQGLCSRSWVDQ-------TDANGL--CFRILYMASLIKDAL--CLSNLEIIF  390
             L++M   G   C   W           D N L  CF   Y+ S++ D+L   L +  I +
Sbjct  398   LSEMILAGNRFCGEDWSKLKVKYPTFKDENLLRYCFSSAYIISMLHDSLGVALDDKRIKY  457

Query  389   ----GPGDV--SWALGAALIEGGEHSRLIATESRR  303
                 G  D+   WALGA ++     +   + +SR+
Sbjct  458   ASKAGDDDIPLDWALGAFILNTATATFDYSGKSRK  492



>ref|XP_002444398.1| hypothetical protein SORBIDRAFT_07g021350 [Sorghum bicolor]
 gb|EES13893.1| hypothetical protein SORBIDRAFT_07g021350 [Sorghum bicolor]
Length=526

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 102/436 (23%), Positives = 176/436 (40%), Gaps = 56/436 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + V++D GSTGSRV++  +    G            L + D  +   ++  PGL+ F  +
Sbjct  67    YGVIIDAGSTGSRVHVIAYRATAG------------LPQLDWARTASMKATPGLSSFAAD  114

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G   SL PL+  A + VP    G T + ++ATAG+R L    A  V++    +++  G
Sbjct  115   PRGAGLSLAPLVEFARRRVPRESWGQTEVRLMATAGLRLLDSAVAESVLQSCREVLRGSG  174

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLG-NTsgshtlglldlggssLQVVTEIDEF  1062
             F ++ ++  V+SG EE  Y WVA NY +  LG +   +  +  L      + +VT     
Sbjct  175   FQFQDEWATVISGAEEGIYAWVAANYALGTLGSDPKDTTGIIELGGASVQVTLVTSEPVP  234

Query  1061  REDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI--FKVRHP  888
              E  HV   + G V + L ++S    G N A++    +LS       +   I   K + P
Sbjct  235   PEFSHVL--KFGDVSYNLYSHSFLQLGLNVAYESFHDLLSSPGLSLMATHLISQAKYKDP  292

Query  887   CLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNS  708
             C   GF   H                  R     +         N+ +C+  A+ +    
Sbjct  293   CTPRGF--THIAGSVKLPVSVLEPKVEYRPFAHAVG--------NFSECRSAALTL----  338

Query  707   SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTK  528
               L++ K   + C    +Y   R+    +   E  ++ A   F+       L S++ L+ 
Sbjct  339   --LQKGK---EGC----TYHECRLGAAFVPELE-GKFLATENFYHTSKFFGLHSKSFLSD  388

Query  527   MWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL----SNLEII--  393
             +   G+  C   W          D       CF   Y+ +L+ D L +      ++++  
Sbjct  389   LMAAGEKFCHGDWSKIKKKYSSFDDGQLLLFCFSSAYIIALLHDTLKMPLDHKRIDVVNQ  448

Query  392   FGPGDVSWALGAALIE  345
                  V WALGA +++
Sbjct  449   IHGVPVDWALGAFIVQ  464



>gb|EGU12671.1| hypothetical protein RTG_01221 [Rhodotorula glutinis ATCC 204091]
Length=927

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 87/159 (55%), Gaps = 14/159 (9%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPN---------NGEFPILVNTYPGNLTRSDGCKYHCVQTE  1446
             + VV+D GS+GSR+ +Y W+            G+   +++     +   DG  +H ++ E
Sbjct  14    YGVVIDAGSSGSRIQVYSWVDPEIAKHDRKAKGQSVDVLSKVEKGVEEGDG--WH-LKVE  70

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PG++ F  N +G+   L+PLI  A   +P+ K   TPI++LATAGMR LP E  S V+  
Sbjct  71    PGISTFGSNPAGVPDYLRPLIEFAASVIPADKLPSTPIYLLATAGMRLLPPEQQSAVLSS  130

Query  1265  VVGIVKEHGFFYRK--DFIRVLSGREEAYYGWVALNYKM  1155
                 ++   F      + IR++SG EE  YGWVA+NY M
Sbjct  131   TCDYLRTFPFHLPDCGEQIRIISGEEEGLYGWVAVNYLM  169



>ref|XP_007267593.1| nucleoside phosphatase GDA1/CD39, partial [Fomitiporia mediterranea 
MF3/22]
 gb|EJD02177.1| nucleoside phosphatase GDA1/CD39, partial [Fomitiporia mediterranea 
MF3/22]
Length=505

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 123/262 (47%), Gaps = 25/262 (10%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEW----MPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
             F +V+D GS+GSR+ IY W    +  + + P      P     ++       + EPG++ 
Sbjct  16    FGIVIDAGSSGSRLQIYSWRDPRLVRHEQGPKAYYALPDVGKGTENADDWVRKVEPGISS  75

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             F  N  G+   L PL+  A + +P      TPIF+LATAGMR LP      +++     +
Sbjct  76    FGENPDGVAVYLAPLLDHAREHIPPSLHHETPIFLLATAGMRLLPTSQQEAILDAACDFI  135

Query  1250  KEHGFFYRKD----------FIRVLSGREEAYYGWVALNYKM-RMLGNTsgshtlglldl  1104
             + H  F R D           +R++SG EE  +GWVA+NY M +  GN     T G LD+
Sbjct  136   RFHSHF-RVDNESAAGHCGSSVRIISGEEEGLFGWVAVNYLMDQFTGNDDDKTTYGFLDM  194

Query  1103  ggssLQVVTEIDEFRE-------DEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALA-I  948
             GG+S Q+  E  E          D H+       + H++   +   +G N+A +R +   
Sbjct  195   GGASTQIAFEPSEEERTKTKNLIDVHLRLIGGEDIHHRVFVTTWLGYGTNQARERYVGKT  254

Query  947   LSQTQARRESRGEIFKVRHPCL  882
             +++ +  + + G    V  PCL
Sbjct  255   ITEYETSQHAEGH-GPVPDPCL  275



>gb|EMG46023.1| Guanosine-diphosphatase [Candida maltosa Xu316]
Length=518

 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 123/252 (49%), Gaps = 25/252 (10%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNT--YPGNLTRSDGCKYHCVQTEPGLAMFV  1425
             + V++D GSTGSRV++YE+           NT   P  L      K      +PGL+ F 
Sbjct  148   YVVMVDAGSTGSRVHVYEF-----------NTCIQPPKL-----IKETFEMLKPGLSSFD  191

Query  1424  GNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKE  1245
              +  G   SL PL++ A   VP  K+  TPI V ATAG+R L  E ++  +  V   ++ 
Sbjct  192   TDVVGAAKSLDPLLKIAMDTVPVEKQKQTPIAVKATAGLRLLGEEKSTNTLNQVKTHLQT  251

Query  1244  HGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDE  1065
             +  F  +D I V++G EEA Y W  +NY +  +G      T  + DLGG S Q+V E+D+
Sbjct  252   NYPFKIQD-ISVITGEEEASYSWFTINYLLGNIGGKEKVPTAAVFDLGGGSTQIVYEVDK  310

Query  1064  ---FRED--EHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAIL-SQTQARRESRGEIF  903
                  +D  + +     G   +KL   S   FG   A    + +L  +  A++ ++    
Sbjct  311   DTAVNDDSVDGLMEYTYGDASYKLYQNSYLGFGLMSARQSIIKLLMKEEDAKQTTKDTNV  370

Query  902   KVRHPCLSSGFV  867
             +V HPCL+ G V
Sbjct  371   EVVHPCLAPGAV  382



>ref|XP_004297301.1| PREDICTED: probable apyrase 6-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=500

 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 111/445 (25%), Positives = 195/445 (44%), Gaps = 61/445 (14%)
 Frame = -1

Query  1613  KRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLA  1434
             + +  + +V+D GSTGSR++++ +  + G    + +         +G   H V   PGL+
Sbjct  78    RNSERYGIVIDGGSTGSRIHVFRYSVDGGSNSAVFDF------GKEGLASHRVN--PGLS  129

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
              F  +      SLK L+  A+  +P  + G T + ++ATAG+R L ++  SR++E    +
Sbjct  130   SFAEDPKAAGGSLKELVEFAKGRIPKEQWGNTEVRLMATAGLRLLDLDVQSRILESCRKV  189

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             ++  GF ++ ++  V++G +E  Y WV  N+ +  LG      T+G+++LGG+S QV   
Sbjct  190   LRSSGFKFQDEWASVITGSDEGLYAWVVANHALGTLGGD-PLKTIGIIELGGASAQVTFV  248

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE--SRGEIFK  900
              +E    +     ++G+V + L ++S   +G N A++     L +T A  +  S  E  +
Sbjct  249   SNEPMPPQFARPVKVGNVTYNLYSHSFLHYGQNVAYES----LKETLASGDFSSASETLQ  304

Query  899   VR---HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSIL--VLGDPNWEKCKV  735
              R    PC   G++          + P  S  S       E N  L  +    N+ +C+ 
Sbjct  305   KRMTIDPCTPKGYLYER-------ESPKLSPSSLG-----EKNRYLSALQSGGNFSECRS  352

Query  734   LAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLN  555
              A  +        + K + Q C  + S  + ++Q + L         A   FF       
Sbjct  353   AANMMLQKG----KEKCSYQPC-NIGSTFTPKLQGMFL---------ATENFFHTSKFFG  398

Query  554   LSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS-N  405
             L  RA L+ +   GQ  C   W          D       CF   Y  +L+ D L +S +
Sbjct  399   LGPRAYLSNLMIAGQQFCGEDWSKLKKRYQAFDDEALLQYCFSSAYSVALLHDNLGISLD  458

Query  404   LEII-----FGPGDVSWALGAALIE  345
              E I      G   + WALGA +++
Sbjct  459   DERIRVANQIGSIPLDWALGAFILQ  483



>emb|CDP00335.1| unnamed protein product [Coffea canephora]
Length=531

 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 117/453 (26%), Positives = 198/453 (44%), Gaps = 65/453 (14%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEW-MPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVG  1422
             F +V+D GSTG+R++++++ +  +G   IL   +  N   S       ++  PGL+ F  
Sbjct  65    FGIVIDGGSTGTRIHVFKYEVEKDG---ILRYDFGKNGLAS-------MKVNPGLSAFAE  114

Query  1421  NASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEH  1242
                   +++  L+    K VP      T I ++ATAGMR L      R++E    +++  
Sbjct  115   EPERAASAVAELVEFGRKRVPREYWRETEIRLMATAGMRMLEKGVQDRILEACRTVLRGS  174

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEF  1062
             GF +  D+  V+SG +E  Y WV  NY +  LG      T G+++LGG+S QV    DE 
Sbjct  175   GFRFYDDWASVISGSDEGVYAWVVANYALGTLGGD-PKQTTGIIELGGASAQVTFVSDEP  233

Query  1061  REDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFD--RALAILSQTQARRESRGEIFKVRHP  888
                E+  + + G+  + L ++SL  +G N AF+  R   I+   +      G   K+  P
Sbjct  234   LPPEYSRKVKYGNFTYILYSHSLLQYGQNVAFELLRESLIMRSEELDTLQNG---KLMDP  290

Query  887   CLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNS  708
             C+  G+  +       G+    S    SR +     S L  G  N+ +C+  ++ +    
Sbjct  291   CIPRGYTHDTGS----GKLSPGSLAEKSRYL-----SALQPGG-NFSECRSASLMLLQK-  339

Query  707   SNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTK  528
                ++ K +  NC      GS  +  L        ++ A   FF       L  +A L+ 
Sbjct  340   ---DKEKCSYINCY----VGSTFIPKLQ------GKFLATENFFHTSKFFGLGRQAFLSD  386

Query  527   MWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIFG--  387
             +   G+  C   W         +D  D    CF   Y+ +L+ D+L   L +  I++   
Sbjct  387   LVVAGERFCEDDWSKLKMKYYSLDDDDLLRYCFSSAYIVALLHDSLGIALDDERIVYANQ  446

Query  386   ----PGDVSWALGAALIEGG-----EHSRLIAT  315
                 P D  WALGA +++       EHS  +A+
Sbjct  447   VENIPLD--WALGAFILQSRTSTDYEHSPSVAS  477



>ref|XP_010476473.1| PREDICTED: probable apyrase 3 [Camelina sativa]
Length=488

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 108/443 (24%), Positives = 193/443 (44%), Gaps = 70/443 (16%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYE-WMPNNGEFPILVNTYPGNLTRSDGCKYHC-VQTEPGLAMFV  1425
             ++VV+D GS+G+RV+++  W    GE P+             G K++  ++  PGL+ + 
Sbjct  72    YSVVIDAGSSGTRVHVFAYWFDQYGE-PVF----------DFGEKHYADMKLTPGLSAYA  120

Query  1424  GNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKE  1245
              N  G    +K L+  A+  +P  K   + I ++ATAGMR L +    ++++    +++ 
Sbjct  121   DNPEGASVLVKKLVEFAKNRIPKRKLRKSDIRLMATAGMRLLEVPVQEQILDVTRRVLRS  180

Query  1244  HGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDE  1065
              GF +R ++  V+SG +E  Y WV  N+ +  LG +    T G+++LGG+S QV      
Sbjct  181   SGFIFRHEWATVISGSDEGIYAWVIANHALGSLG-SDPLETTGIVELGGASAQVT-----  234

Query  1064  FREDEHV---FRSRIG--SVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFK  900
             F   EHV   F   I   +V + + ++S   +G + A  R L  L    A     G    
Sbjct  235   FVSSEHVPPEFSRTIAYKNVSYTIYSHSFLHYGKDAALKRLLESLQNLAANSTGDG---I  291

Query  899   VRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEV  720
             V  PC   G++ + +      QK SS   +    +   L +       N+ KC+      
Sbjct  292   VDDPCTPKGYIYDTSS-----QKYSSGFLADESKLKGSLQAA-----GNFSKCR------  335

Query  719   ATNSSNLERSKVAEQNCV-GLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSR  543
                S+  +  +  ++NC+    S GS    +L         + A S F+       L  +
Sbjct  336   ---SATFQLLQEGKENCLYKHCSIGSTFTPDLQ------GSFLATSNFYYTAEFFELREK  386

Query  542   ANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEI  396
               L+++   G+  C   W          ++    G CF   Y+ +++ D+L   L +  I
Sbjct  387   GWLSELIPAGKKYCGEEWSKLKLEYPTTEEEFLRGYCFSSAYIIAMLHDSLGIALDDERI  446

Query  395   IFGPG------DVSWALGAALIE  345
              +          + WALGA +++
Sbjct  447   KYASNAGEKHIPLDWALGAFILD  469



>ref|NP_001061886.1| Os08g0436100 [Oryza sativa Japonica Group]
 dbj|BAD10140.1| putative ectonucleoside triphosphate diphosphohydrolase [Oryza 
sativa Japonica Group]
 dbj|BAF23800.1| Os08g0436100 [Oryza sativa Japonica Group]
 dbj|BAG89345.1| unnamed protein product [Oryza sativa Japonica Group]
Length=537

 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 108/448 (24%), Positives = 189/448 (42%), Gaps = 63/448 (14%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+R   + VV+D GSTGSRV++  +           ++    L R D  +   ++  PGL
Sbjct  67    RRRPHEYGVVIDAGSTGSRVHVIAYR-------SSSSSPASALPRIDWARTASMKAAPGL  119

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + F  +  G   SL PL+  A + VP      T + ++ATAG+R L    A  V++    
Sbjct  120   SSFASDPGGAGRSLAPLLEFARRRVPPESWAETDVRLMATAGLRLLDAAVAEAVLDSCRV  179

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF ++ D+  V+SG EE  Y W+A NY +  LG+     T G+++LGG+S+QV  
Sbjct  180   LLRGSGFQFQDDWATVISGAEEGMYAWIAANYALGTLGDD-SQDTTGIIELGGASVQVTF  238

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI--F  903
               D+    E     + G   + L ++S    G N A++    +LS    +  +   I   
Sbjct  239   VTDKPLPPEFSHTLKFGDATYNLYSHSFLQLGQNVAYESLHDMLSTPGHKSMATHLISQA  298

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSIL-------VLGDPNWEK  744
             K R PC   GF               S  + + ++    L S +        +G  N+ +
Sbjct  299   KYRDPCTPRGF---------------SPMEGAVKLPASVLESKVEYRPYAHAVG--NFSE  341

Query  743   CKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYN  564
             C+  A+ +        R +     C      G+  + +L        ++ A   F+    
Sbjct  342   CRSAALTLLQKG----REECRYHEC----RMGAAFVPDLD------GKFLATENFYHTSK  387

Query  563   MLNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL  411
                L S++ L+ +   G+  C   W          ++ +    CF   Y+ +L+ D L +
Sbjct  388   FFRLRSKSFLSDLMLAGEKFCRGDWSKIKKEYRSFNEGELLLFCFSSAYIVALLHDTLKV  447

Query  410   S------NLEIIFGPGDVSWALGAALIE  345
                    ++    G   V WALGA +++
Sbjct  448   PLDDKRIDVANQIGGVPVDWALGAFIVQ  475



>emb|CDX81623.1| BnaC08g39780D [Brassica napus]
Length=484

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 110/450 (24%), Positives = 192/450 (43%), Gaps = 61/450 (14%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GS+GSRV+++ +   +G+ P+             G  Y  ++  PGL+ +  +
Sbjct  75    YSVVIDAGSSGSRVHVFRYWFQSGK-PVY---------DFSGDNYANLKLNPGLSSYADH  124

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                   S+  L+  A+  VP      + I ++ATAGMR L ++   ++++ V  +++  G
Sbjct  125   PEEASVSVTKLVEFAKGRVPKASLKRSDIRLMATAGMRLLEVDVQEQILDVVRRVLRSSG  184

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R ++  V+SG +E  Y WV  NY +  LG      T G+++LGG+S QV     E  
Sbjct  185   FKFRGEWASVISGSDEGIYAWVTANYALGSLGGD-PLKTTGIVELGGASAQVTFVSSENV  243

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLS  879
               E +     G+V +K+ ++S    G NEA ++  A L  +        E   V  PC  
Sbjct  244   PPEFLRTLSYGNVSYKIYSHSFLHLGQNEAHEKLWASLHNSAVNSP---EDVVVTDPCTP  300

Query  878   SGF-VQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSN  702
              G+ +  ++    F +            +T  L +       N+ KC+     +    + 
Sbjct  301   KGYNLDKNSHTDSFEEG----------RLTGSLQAA-----GNFTKCRSATYAMLQEGNE  345

Query  701   LERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMW  522
                 K   ++C    S GS    +L         + A S F+       L  +  L +M 
Sbjct  346   ----KCPYKHC----SIGSTFTPDLQ------GHFLATSNFYYTSKFFELDEKDWLAEMI  391

Query  521   ETGQGLCSRSWVDQTDAN---------GLCFRILYMASLIKDAL--CLSNLEIIF----G  387
               G+  C   W +    +         G CF   Y+ S++ D+L   L +  I F    G
Sbjct  392   PAGKRYCKEKWSELKAEHPTTKEEYLLGYCFSSAYIISMLHDSLGFALDDGRIEFASKAG  451

Query  386   PGDV--SWALGAALIEGGEHSRLIATESRR  303
               D+   WALGA +++    +   A  SR+
Sbjct  452   EKDIPLEWALGAFILKTSSATFDYAGLSRK  481



>ref|NP_001147985.1| LOC100281594 [Zea mays]
 gb|ACG29319.1| hydrolase [Zea mays]
 tpg|DAA48970.1| TPA: putative nucleoside phosphatase GDA1/CD39 family protein 
[Zea mays]
Length=530

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 109/447 (24%), Positives = 184/447 (41%), Gaps = 66/447 (15%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+    + V++D GSTGSRV++  +    G            L + D  +   ++  PGL
Sbjct  61    RRVPPTYGVIIDAGSTGSRVHVLAYRSTAG------------LPQLDWARMASMKATPGL  108

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + F  +  G   SL PL+  A + VP    G T + ++ATAG+R L    A  +++    
Sbjct  109   SSFAADPRGAGLSLAPLLEFARRRVPRESWGETEVRLMATAGLRLLDSAVAESILQSCRE  168

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF ++ ++  V+SG EE  Y WVA NY +  LG    + T G+++LGG+S+QV  
Sbjct  169   VLRGSGFQFQDEWATVISGAEEGIYAWVAANYALGTLGGD-PNDTTGIIELGGASIQVTL  227

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI--F  903
                E    +     + G V + L ++S    G N A++    +LS    R  +   I   
Sbjct  228   VTGEPVPPKFSHMLKFGDVSYNLYSHSFLHLGLNVAYESLHDLLSSPGLRSMATHLISQA  287

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             K + PC   GF                      R+       + VL      + KV    
Sbjct  288   KYKDPCTPRGFT---------------------RIAGSAKLPVGVL------EPKVEYRP  320

Query  722   VATNSSNLERSKVAEQNCVGLLSYGSD--RMQNLTLNSHEVT----RYHALSGFFAVYNM  561
              A ++ N    + A    + LL  G++        L +  V     ++ A   F+     
Sbjct  321   FAHSAGNFSECRSA---ALTLLQKGNEGCTYHECRLGAAFVPELEGKFLATENFYHTSKF  377

Query  560   LNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL-  411
               LSS+  L+ +   G+  C   W          D       CF   Y+ +L+ D L + 
Sbjct  378   FGLSSKPFLSDLMVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIALLHDTLKMP  437

Query  410   ---SNLEII--FGPGDVSWALGAALIE  345
                  ++++       V WALGA +++
Sbjct  438   LDHKRIDVVNQIHGVPVDWALGAFIVQ  464



>ref|XP_008675061.1| PREDICTED: LOC100281594 isoform X3 [Zea mays]
Length=526

 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 109/447 (24%), Positives = 184/447 (41%), Gaps = 66/447 (15%)
 Frame = -1

Query  1616  RKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGL  1437
             R+    + V++D GSTGSRV++  +    G            L + D  +   ++  PGL
Sbjct  61    RRVPPTYGVIIDAGSTGSRVHVLAYRSTAG------------LPQLDWARMASMKATPGL  108

Query  1436  AMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
             + F  +  G   SL PL+  A + VP    G T + ++ATAG+R L    A  +++    
Sbjct  109   SSFAADPRGAGLSLAPLLEFARRRVPRESWGETEVRLMATAGLRLLDSAVAESILQSCRE  168

Query  1256  IVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVT  1077
             +++  GF ++ ++  V+SG EE  Y WVA NY +  LG    + T G+++LGG+S+QV  
Sbjct  169   VLRGSGFQFQDEWATVISGAEEGIYAWVAANYALGTLGGD-PNDTTGIIELGGASIQVTL  227

Query  1076  EIDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEI--F  903
                E    +     + G V + L ++S    G N A++    +LS    R  +   I   
Sbjct  228   VTGEPVPPKFSHMLKFGDVSYNLYSHSFLHLGLNVAYESLHDLLSSPGLRSMATHLISQA  287

Query  902   KVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAME  723
             K + PC   GF                      R+       + VL      + KV    
Sbjct  288   KYKDPCTPRGFT---------------------RIAGSAKLPVGVL------EPKVEYRP  320

Query  722   VATNSSNLERSKVAEQNCVGLLSYGSD--RMQNLTLNSHEVT----RYHALSGFFAVYNM  561
              A ++ N    + A    + LL  G++        L +  V     ++ A   F+     
Sbjct  321   FAHSAGNFSECRSA---ALTLLQKGNEGCTYHECRLGAAFVPELEGKFLATENFYHTSKF  377

Query  560   LNLSSRANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCL-  411
               LSS+  L+ +   G+  C   W          D       CF   Y+ +L+ D L + 
Sbjct  378   FGLSSKPFLSDLMVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIALLHDTLKMP  437

Query  410   ---SNLEII--FGPGDVSWALGAALIE  345
                  ++++       V WALGA +++
Sbjct  438   LDHKRIDVVNQIHGVPVDWALGAFIVQ  464



>ref|XP_002176263.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42757.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=607

 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 120/484 (25%), Positives = 205/484 (42%), Gaps = 84/484 (17%)
 Frame = -1

Query  1625  LYVRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRS-DGCKYHCVQT  1449
             L+  K  +   +++D GS G+R+++YE       FP  V T+  ++     G K     T
Sbjct  49    LHKVKEDTEHGMMIDAGSQGTRIHVYE-------FPARVLTHRNHVKHVVQGRKLTFPST  101

Query  1448  E--------PGLAMFV------GNASGLRASLKPLIRGAEKWVPSGKRG--VTPIFVLAT  1317
             +        PGL  F            +RA L+PLI  AE+ + + +      PI++ AT
Sbjct  102   DSRWTDRLKPGLDAFAFIEDEGSRREQVRAYLQPLIGFAEEVLETKRHHWLSYPIYLKAT  161

Query  1316  AGMRRLPIEDASRVMEGVVGIVKE---HGFFYRKDFIRVLSGREEAYYGWVALNYKMR-M  1149
              G+R LP    +R++E    + +    + FF+  +  RV+SG EEA YGW A+N+    +
Sbjct  162   GGLRTLPRPYRTRLVETTRSLFRNSTFNPFFFEDEHARVISGEEEAIYGWAAVNFVTNTL  221

Query  1148  LGNTsgshtlglldlggssLQV---VTEIDEFREDEHV----FRSRIGSVEH-KLLAYSL  993
             + N+ GS  +   ++    L++    T+I  F  +  V    F+ +IG+ +H  + A+S 
Sbjct  222   IANSEGSGEVLAPNVTYGVLEMGGASTQIGFFEPNGDVMANLFKLQIGAAKHWNVYAHSF  281

Query  992   QAFGFNEAFDRALAILSQTQARRESR---GEIFKVRHPCLSSGFVQNHTCRGCFGQKPss  822
               FG N AF R  A L Q     + R   G I  V +PCL  G     T           
Sbjct  282   LYFGVNGAFSRLNAQLVQEAELNQDRVLPGPIDGVYNPCLPVGSQYRFTS----------  331

Query  821   sedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLL-----  657
                   R+      S+L L  P         +  A   +N E +   +  CV ++     
Sbjct  332   ------RIHVLPDGSLLPLSSPENASTIEAKLYSAIMRNNKESADFGQ--CVSMVKLLLR  383

Query  656   -------SYGSDR--------MQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMW  522
                    ++  DR           L +N ++   + A S F+ V++ L L  R+ + ++ 
Sbjct  384   MEANSWCNFSHDRDCSFAGIYQPPLPINEYDFGEFIATSNFYHVWDFLGLEERSTVDEVL  443

Query  521   ETGQGLCSRSWVDQTDANGLCFRILYMASLIK-----DALCLSNLEIIFGPGDVSWALGA  357
             E  +    +   D  D    CFR  ++A L +         +++++ + G   + WALG+
Sbjct  444   EGARHNRPKPLSDD-DLIQYCFRATFVAELFRGWGFPGDYHITSVDQVNG-LKLGWALGS  501

Query  356   ALIE  345
              L E
Sbjct  502   MLYE  505



>gb|EMS25962.1| golgi apyrase [Rhodosporidium toruloides NP11]
 emb|CDR38306.1| RHTO0S03e08064g1_1 [Rhodosporidium toruloides]
Length=927

 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 87/159 (55%), Gaps = 14/159 (9%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPN---------NGEFPILVNTYPGNLTRSDGCKYHCVQTE  1446
             + VV+D GS+GSR+ +Y W+            G+   +++     +   DG  +H ++ E
Sbjct  14    YGVVIDAGSSGSRIQVYSWVDPEIAKHDRKAKGKSVDVLSKVEKGVEEGDG--WH-LKVE  70

Query  1445  PGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             PG++ F  N +G+   L+PLI  A   +P+ K   TPI++LATAGMR LP E  S V+  
Sbjct  71    PGISTFGSNPAGVPDYLRPLIEFAASVIPADKLPSTPIYLLATAGMRLLPPEQQSAVLSS  130

Query  1265  VVGIVKEHGFFYRK--DFIRVLSGREEAYYGWVALNYKM  1155
                 ++   F      + IR++SG EE  YGWVA+NY M
Sbjct  131   TCDYLRTFPFHLPDCGEQIRIISGEEEGLYGWVAVNYLM  169



>ref|XP_002507899.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69157.1| predicted protein [Micromonas sp. RCC299]
Length=464

 Score = 94.4 bits (233),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 89/161 (55%), Gaps = 18/161 (11%)
 Frame = -1

Query  1619  VRKRASYFTVVLDCGSTGSRVNIYEW-MPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEP  1443
             + +R   F VV+D GSTGSRV+++ + +   GE  ++ +T+               Q +P
Sbjct  63    IPERRYRFAVVIDAGSTGSRVHVFRFEVGARGELVLIDDTFE--------------QLKP  108

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             GL+ F        ASLKPL+  A + VP+ +R  T + V ATAG+R LP  +A  ++E V
Sbjct  109   GLSSFAKEPEKGAASLKPLLATALETVPAAQRASTSVEVRATAGLRMLPGSEADNLLEAV  168

Query  1262  VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGN  1140
             +  + E+ F + KD + +L G EE  + W+ +NY   +LGN
Sbjct  169   LISLDEYPFAFDKDSVSILDGAEEGAFQWLTMNY---LLGN  206



>emb|CCA67983.1| related to YND1-apyrase (NDPase/NTPase) [Piriformospora indica 
DSM 11827]
Length=749

 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 123/256 (48%), Gaps = 18/256 (7%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEW----MPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
             F +V+D GS+GSR+ +Y W    +      P  + T P   T +   +    + EPGL+ 
Sbjct  16    FGIVIDAGSSGSRIQLYSWRDARIVQTELSPAGLATLPIVETATKDPEDSIRKIEPGLST  75

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             F  +  G+   LKPLI+ A+  +P      TP+F+LATAGMR LP      V+  V    
Sbjct  76    FGTDPEGIFEYLKPLIQHAKAEIPPHLHAETPLFLLATAGMRLLPKPQQDAVLRKVCQYF  135

Query  1250  KEHGFFYRK---------DFIRVLSGREEAYYGWVALNYKMRMLGN-Tsgshtlglldlg  1101
             +++  F  +           +R++SG EE  +GW+A+NY M    N +  ++T G LD+G
Sbjct  136   RDYTTFKVERTSPLGHCGSSVRIISGEEEGLFGWIAVNYLMEAFSNGSKDANTYGFLDMG  195

Query  1100  gssLQVVTEIDEFREDEHVFRSRI---GSVEHKLLAYSLQAFGFNEAFDRALAILSQTQA  930
             G+S Q+  E  +   D    R R+     + H +   +   +G N+A  R +  L  T  
Sbjct  196   GASTQIAFEPRDQTSDLTRVRLRLLNGKDITHNVFVATWLGYGTNQARARYVGNLIDTVE  255

Query  929   RRESRGEIFKVRHPCL  882
              +E   +   +  PCL
Sbjct  256   EKEGHHDSI-IPDPCL  270



>ref|XP_007764454.1| hypothetical protein CONPUDRAFT_162097 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW84748.1| hypothetical protein CONPUDRAFT_162097 [Coniophora puteana RWD-64-598 
SS2]
Length=845

 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 132/276 (48%), Gaps = 41/276 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRS----------DGCKYHCVQT  1449
             F +V+D GS+GSR+ IY W     + P  +    G+  R           +G ++   + 
Sbjct  16    FGIVIDAGSSGSRLQIYSW-----KDPQTILREQGDAVRDLLPPVEKGVREGDEW-ITKA  69

Query  1448  EPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRL-PIEDASRVM  1272
             EPGL+ F  N  G+ A L+PLI  A   +P  K   TPIF+LATAGMR L PI+ A RV+
Sbjct  70    EPGLSSFADNPEGVAAYLEPLISHARAHIPPSKEADTPIFLLATAGMRLLTPIQQA-RVL  128

Query  1271  EGVVGIVKEHGFFYRK--------DFIRVLSGREEAYYGWVALNYKMR-MLGNTsgshtl  1119
                   ++   F              +++++G EE  +GW+A+NY M   +GN++   T 
Sbjct  129   AATCSYLRNTNFRLEDASEDGPCGSSVKIITGEEEGLFGWIAVNYLMDGFVGNSTSPSTN  188

Query  1118  gll----dlggssLQVVTEIDEFREDEH------VFRSRIGS---VEHKLLAYSLQAFGF  978
                    D+GG+S Q+  E  E   D+         R R+ S   + H++   +   +G 
Sbjct  189   KTTYGFLDMGGASTQIAFEPSEQEGDDLDSYNLVDVRLRLLSGQEIMHRVFVTTWLGYGT  248

Query  977   NEAFDRALAILSQTQARRESRGEIFKVRHPCLSSGF  870
             N+A +R +A + +T A  ++      +  PCL  G 
Sbjct  249   NQARERYVAQMIRTYAPHQANDRSV-LEDPCLPRGL  283



>ref|XP_008416447.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 7-like 
isoform X2 [Poecilia reticulata]
Length=497

 Score = 94.7 bits (234),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 78/147 (53%), Gaps = 4/147 (3%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V+DCGS+GSRV +Y W P+NG    L++       R    K    + +PG++     
Sbjct  84    YGIVVDCGSSGSRVFVYYWPPHNGNPHTLLDI---RQMRDSDSKPVVKKIKPGISTLANT  140

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK-EH  1242
              +     L+PL+  A   VP  K   TP+++L TAGMR LP    + ++E +V  V  E 
Sbjct  141   PTKASDYLEPLLSFAAAHVPQSKHKETPLYILCTAGMRLLPDSQQAAILEDLVMDVPLEF  200

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNY  1161
              F + +    V+SG++E  Y W+ +N+
Sbjct  201   DFLFSRSHAEVISGKQEGVYAWIGINF  227



>gb|ESW97388.1| Apyrase with wide substrate specificity [Ogataea parapolymorpha 
DL-1]
Length=691

 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 85/155 (55%), Gaps = 13/155 (8%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEW-----MPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLA  1434
             + +V+D GS+GSR+ IY+W     + N  + P ++++ P  + + D   Y   + + GL+
Sbjct  6     YGIVVDSGSSGSRIQIYKWKDPAGLQNESKDPAILSSVP-QIVQEDKWTY---KIDKGLS  61

Query  1433  MFVGNASGL-RASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG  1257
              F  +   +     +PLI+ AE+ VP  K   TPIFV ATAGMR +P +   +V++ V  
Sbjct  62    TFADHPEDVWEDHFEPLIKYAEQIVPEDKLASTPIFVQATAGMRLVPEKQREKVLKNVCK  121

Query  1256  IVKEHGFFYR---KDFIRVLSGREEAYYGWVALNY  1161
              +KE   F      D ++V+ G  E  YGW+ LNY
Sbjct  122   ALKEETHFQIDKCDDHVQVIDGETEGLYGWIGLNY  156



>ref|XP_002950854.1| hypothetical protein VOLCADRAFT_91259 [Volvox carteri f. nagariensis]
 gb|EFJ48169.1| hypothetical protein VOLCADRAFT_91259 [Volvox carteri f. nagariensis]
Length=558

 Score = 94.7 bits (234),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 9/150 (6%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMP----NNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
             + V++D GS+GSRV++Y + P      G        YP  + R  G + H V   PGL+ 
Sbjct  110   YAVLIDAGSSGSRVHVYSYRPAARSRRGHTAAATAPYP--VVRLPG-QIHRVT--PGLSE  164

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             F     G+  SL+PLI  A++ VP      TPI +LATAG+R LP E    V+  V  ++
Sbjct  165   FAPEGEGVVESLQPLITFAQQQVPPRLHTSTPIRLLATAGLRLLPEEQREAVLAAVRALL  224

Query  1250  KEHGFFYRKDFIRVLSGREEAYYGWVALNY  1161
                GF +R +++RV+SG EE  + WV +NY
Sbjct  225   GGSGFRFRAEWVRVISGDEEGLFAWVGINY  254



>ref|XP_007720865.1| apyrase [Capronia coronata CBS 617.96]
 gb|EXJ93371.1| apyrase [Capronia coronata CBS 617.96]
Length=713

 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 118/269 (44%), Gaps = 24/269 (9%)
 Frame = -1

Query  1619  VRKRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPG  1440
             V+K    + VVLD GS+G+RV IY W+PN+     L  T    L   +       +  PG
Sbjct  2     VKKADKRYGVVLDAGSSGTRVYIYRWLPNS--VARLDETTRHALPELETKDTWTKKVHPG  59

Query  1439  LAMFVGNASGLRAS-LKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             ++ F  +   +    LKPL++ A K VP      TPIF+LATAGMR LP E    V+  V
Sbjct  60    VSTFGTSPEAVGPKHLKPLLQHALKHVPKHAVPETPIFLLATAGMRLLPDEQQRDVLRNV  119

Query  1262  VGIVKEHGFFYRKD---FIRVLSGREEAYYGWVALNYKMRML--------GN---Tsgsh  1125
                ++    FY  D    ++V+ G  E  YGW+A NY +           GN   T G  
Sbjct  120   CSYIRAETNFYLPDCDVHVQVIPGETEGLYGWIAANYLLGSFNSPEEHDHGNDHHTYGFL  179

Query  1124  tlglldlggssLQVVTEIDEFREDEHVFRSRI---GSVEHKLLAYSLQAFGFNEAFDRAL  954
              +G      +     TE ++   D  + R R       E+++   +   FG NEA  R +
Sbjct  180   DMGGASAQIAFAPNATEAEKHANDLTLLRLRTVDGAPQEYRVFVTTWLGFGANEARRRYV  239

Query  953   AILSQTQARRESRGEIFKVRHPCLSSGFV  867
               L  T         + ++  PCL  G +
Sbjct  240   EDLKATYG----LDAVVEIPDPCLPKGVI  264



>emb|CEF59763.1| Nucleoside phosphatase GDA1/CD39 family-containing protein [Strongyloides 
ratti]
Length=498

 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 119/528 (23%), Positives = 222/528 (42%), Gaps = 100/528 (19%)
 Frame = -1

Query  1604  SYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTR--SDGCKYHCVQTEPGLAM  1431
             S + +V+D GSTGSR+ +Y+   + GE         GN+T    +  K    +  PGL+ 
Sbjct  22    SKYGIVIDAGSTGSRLFLYQIQQSYGE-------EMGNITPVLDEFTKPVVKKVSPGLSD  74

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV----  1263
             F          +KPL+    K++P       P+++ ATAGMR +PIE  +++++ +    
Sbjct  75    FADKPKEAVTYIKPLLDYVRKYIPDVVEHNVPVYIFATAGMRLIPIEKQNQILDNLRIHL  134

Query  1262  -----VGIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLG--NTsgshtlglldl  1104
                  + I+ E+        I+V+ G+ E  Y W+A+NY   +LG   +    T+G++++
Sbjct  135   PLISNLKILAEN--------IKVIEGKWEGIYSWLAVNY---ILGKFKSVNLPTVGMIEM  183

Query  1103  ggssLQVVTEIDEFRED---EHVFRSRIG-SVEHKLLAYSLQAFGFNEAFDRALAILSQT  936
             GG+S Q+  E+     D   EH     +G ++++KL   +   +G NE            
Sbjct  184   GGASCQIAYELPNGSSDFQSEHTEIISLGENLKYKLFVSTFLGYGVNEG-----------  232

Query  935   QARRESRGEIFKVRHPCLS---SGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVL  765
                 + + E + V++  ++   +   Q +    C  QK            +   NSI+ +
Sbjct  233   ----QKKYENYIVKNKLINIDQNNITQQNISDDCLPQK--------MSKPSTWNNSIIRV  280

Query  764   GDPNWEKC-KVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRY---  597
             G  +WEKC   ++  +  N SN         +C        + ++   +N++++  Y   
Sbjct  281   GTGDWEKCYNTISSIINENDSN---------SCPEFKKCYFNYIERPNINTNQIEFYGFS  331

Query  596   ---------HALSGFFAVYNMLNLSSRANLTKMWETGQGLCSRSWVDQTDANGL---CFR  453
                      + L G +  YN L  +S+    + W T        W    D + L   CF+
Sbjct  332   EFWYSFDNIYNLGGIYR-YNSLQTASKEYCKQQWPTILYKKKIHWYKNADIDRLRDNCFK  390

Query  452   ILYMASLIKDALCLSNLEIIF------GPGDVSWALGAALIEGGEHSRLIATESRRKGLA  291
               +  + +      +   I+F      G  +V WALGA L     H   I   ++     
Sbjct  391   TAWTMASLHRGFGFTTDNILFKSALTIGNQEVQWALGAILY----HMYNIIHSTKYNNST  446

Query  290   TQHKWMVSSSITLFIVLVCVLMIVYRSQIKLPMPGRKITSGRASLPSY  147
             T +K   SS +  +I+   + +I +   + + +   K+   +  LP+Y
Sbjct  447   TFYKNNNSSDVPSYILFFVITIICFSVVVFIFI---KMKKKQELLPTY  491



>ref|XP_004297300.1| PREDICTED: probable apyrase 6-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=551

 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 108/442 (24%), Positives = 193/442 (44%), Gaps = 65/442 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V+D GSTGSR++++ +  + G    + +         +G   H V   PGL+ F  +
Sbjct  83    YGIVIDGGSTGSRIHVFRYSVDGGSNSAVFDF------GKEGLASHRVN--PGLSSFAED  134

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                   SLK L+  A+  +P  + G T + ++ATAG+R L ++  SR++E    +++  G
Sbjct  135   PKAAGGSLKELVEFAKGRIPKEQWGNTEVRLMATAGLRLLDLDVQSRILESCRKVLRSSG  194

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F ++ ++  V++G +E  Y WV  N+ +  LG      T+G+++LGG+S QV    +E  
Sbjct  195   FKFQDEWASVITGSDEGLYAWVVANHALGTLGGD-PLKTIGIIELGGASAQVTFVSNEPM  253

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRE--SRGEIFKVR---  894
               +     ++G+V + L ++S   +G N A++     L +T A  +  S  E  + R   
Sbjct  254   PPQFARPVKVGNVTYNLYSHSFLHYGQNVAYES----LKETLASGDFSSASETLQKRMTI  309

Query  893   HPCLSSGFVQNHT----CRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAM  726
              PC   G++             G+K        +R ++       +    N+ +C+  A 
Sbjct  310   DPCTPKGYLYERESPKLSPSSLGEK--------NRYLSA------LQSGGNFSECRSAAN  355

Query  725   EVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSS  546
              +        + K + Q C  + S  + ++Q + L         A   FF       L  
Sbjct  356   MMLQKG----KEKCSYQPC-NIGSTFTPKLQGMFL---------ATENFFHTSKFFGLGP  401

Query  545   RANLTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDALCLS-NLEI  396
             RA L+ +   GQ  C   W          D       CF   Y  +L+ D L +S + E 
Sbjct  402   RAYLSNLMIAGQQFCGEDWSKLKKRYQAFDDEALLQYCFSSAYSVALLHDNLGISLDDER  461

Query  395   I-----FGPGDVSWALGAALIE  345
             I      G   + WALGA +++
Sbjct  462   IRVANQIGSIPLDWALGAFILQ  483



>ref|XP_002273709.1| PREDICTED: probable apyrase 6 isoform X2 [Vitis vinifera]
Length=523

 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 108/453 (24%), Positives = 185/453 (41%), Gaps = 67/453 (15%)
 Frame = -1

Query  1613  KRASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLA  1434
             +R   + +V+D GSTG+R++++ +  + G  P+      G            ++  PGL+
Sbjct  64    RRGKKYGIVIDGGSTGTRIHVFGFELDGGGRPVFDFGKKG---------LGSMRVSPGLS  114

Query  1433  MFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGI  1254
              +  + +    SL  L+   +  VP    G T I ++ATAG+RRL +     ++E    +
Sbjct  115   SYAEDPNRAGGSLVELLEFGKSRVPKEHWGDTEIRLMATAGLRRLELRVQEAILESCRRV  174

Query  1253  VKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTE  1074
             ++   F +R  +  V++G +E  Y WV  N+ +  LG      T G+++LGG+S QV   
Sbjct  175   LRVSSFQFRDSWASVITGSDEGIYAWVVANHALGSLGGD-PRETTGIIELGGASAQVTFV  233

Query  1073  IDEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVR  894
               E    E     R G+V + L ++SL  FG N A +     L  T        +   + 
Sbjct  234   SSEPVPPEFSHTLRFGNVTYNLYSHSLLDFGQNVALESLQKSLFSTDLMAAESLQKGILI  293

Query  893   HPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
              PC   G+  +       G+                  S  +    N+ +C+  A+ +  
Sbjct  294   DPCTPKGYSLD-------GKNEY---------------SSAIHAQGNFSECRAAALTLLQ  331

Query  713   NSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANL  534
                   + + +  +C+     GS  M  L        ++ A   FF       L SRA L
Sbjct  332   KG----KERCSYHHCL-----GSTFMPKLQ------GKFLATENFFYTSKFFGLGSRAFL  376

Query  533   TKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIFG  387
             + +   GQ  C   W          ++ D    CF   Y+ + + D+L   L +  I + 
Sbjct  377   SDLTVAGQHFCEEDWSKLKRKYYSFNEEDLLHYCFSSAYIVAFLHDSLGIALDDERIGYA  436

Query  386   P--GDV--SWALGAALIEG-----GEHSRLIAT  315
                GD+   WALGA +++       EHS  I T
Sbjct  437   NQVGDIPLDWALGAFILQSTTNLEAEHSDWITT  469



>ref|XP_008416439.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 7-like 
isoform X1 [Poecilia reticulata]
Length=604

 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 78/147 (53%), Gaps = 4/147 (3%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V+DCGS+GSRV +Y W P+NG    L++       R    K    + +PG++     
Sbjct  84    YGIVVDCGSSGSRVFVYYWPPHNGNPHTLLDI---RQMRDSDSKPVVKKIKPGISTLANT  140

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK-EH  1242
              +     L+PL+  A   VP  K   TP+++L TAGMR LP    + ++E +V  V  E 
Sbjct  141   PTKASDYLEPLLSFAAAHVPQSKHKETPLYILCTAGMRLLPDSQQAAILEDLVMDVPLEF  200

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNY  1161
              F + +    V+SG++E  Y W+ +N+
Sbjct  201   DFLFSRSHAEVISGKQEGVYAWIGINF  227



>gb|EPY51301.1| nucleoside diphosphatase Ynd1 [Schizosaccharomyces cryophilus 
OY26]
Length=573

 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 75/260 (29%), Positives = 117/260 (45%), Gaps = 36/260 (14%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEW-MPNN-------GEFPILVNTYPGNLTRSDGCKYHCVQTEP  1443
             + + +D GS+GSR+ IY W  P +          P++    PGN    D      ++  P
Sbjct  5     YGIFIDAGSSGSRLQIYSWAFPGDRNGVKREANLPLIE---PGNGDEGDWS----IKVHP  57

Query  1442  GLAMFVGNASGL-RASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEG  1266
             G++ F      + +  LK L+  AEK VP  K   TP+F+ ATAGMR LP +   ++++ 
Sbjct  58    GISSFAEQPKHVGKKHLKKLLDYAEKVVPDDKHEETPVFLSATAGMRLLPHKTQRKILDS  117

Query  1265  VVGIVKEHGFFYRKD---FIRVLSGREEAYYGWVALNYKMRMLGN------Tsgshtlgl  1113
                 +K+   F   D    +RV+ GR E  YGW+A NY   +LGN      TS       
Sbjct  118   ACHYIKKEYNFSLPDCASMVRVIDGRAEGMYGWLATNY---LLGNLDKSSATSTGFLDMG  174

Query  1112  ldlggssLQVVTEIDEFREDE----HVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAIL  945
                   + +V  E+ +   D     H+       +E+ L  Y+   FG ++A++R L  L
Sbjct  175   GASAQIAFEVSPEVQKAYGDSVSTVHLGLDNGEQIEYPLFVYTWLGFGTSQAYNRYLNAL  234

Query  944   SQTQARRESRGEIFKVRHPC  885
                +  R S  E   +  PC
Sbjct  235   --VEGNRNSPSET--IDEPC  250



>dbj|GAA96344.1| hypothetical protein E5Q_03010 [Mixia osmundae IAM 14324]
 gb|KEI38354.1| hypothetical protein L969DRAFT_95441 [Mixia osmundae IAM 14324]
Length=852

 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 91/162 (56%), Gaps = 19/162 (12%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNN---------GEFPILVNTYPGNLTR--SDGCKYHCVQ  1452
             F +V+D GS+GSR+ +Y W+ ++         GE    +++ P  +T+    G  +H ++
Sbjct  48    FGIVVDAGSSGSRLQVYSWLEHDLARQELRAKGEG---LSSMP-KVTKGVEKGDDWH-IK  102

Query  1451  TEPGLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVM  1272
              EPGL+    N +G+   L+PL+  A + VP  K   TPI VLATAGMR LP E    V+
Sbjct  103   VEPGLSSLGPNPAGVGDYLQPLLDHALRIVPPDKVASTPIHVLATAGMRLLPDEQRIAVL  162

Query  1271  EGVVGIVKEHGFFYRKD---FIRVLSGREEAYYGWVALNYKM  1155
             +     +++H  F   D    +RV++G EE  +GWVA+NY M
Sbjct  163   QETCRYIQKHADFRLTDCASQVRVITGEEEGVFGWVAVNYLM  204



>ref|XP_010562917.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 8 [Haliaeetus 
leucocephalus]
Length=507

 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 96/385 (25%), Positives = 174/385 (45%), Gaps = 53/385 (14%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V D GST + + IY+W       P       G +++ + C      + PG++ +  N
Sbjct  55    YGLVFDAGSTHTALYIYQW-------PADKENGTGIVSQVEACTV----SGPGISSYADN  103

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
             A+G  ASLKP +  A   +P+ ++  TP ++ ATAGMR L  +++++  +    + K  G
Sbjct  104   ATGAGASLKPCLDKAMTIIPAEQQRETPTYLGATAGMRLLREQNSTKAEQVFAEVAKAIG  163

Query  1238  FFYRKDF--IRVLSGREEAYYGWVALNYKMRML---------GNTsgshtlglldlggss  1092
               Y  DF   R+L+G EE  +GW+ +NY +  L          +   +  LG LDLGG+S
Sbjct  164   -EYPVDFRGARILTGNEEGSFGWITVNYLLETLVKFSFAEKWEHPQDTEVLGALDLGGAS  222

Query  1091  LQVVTEIDEFREDEH--VFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRES  918
              Q+  + +   ED++  VF  R+    + L  +S   +G  +A    LA L Q     + 
Sbjct  223   TQITFQPEVTIEDKNTSVFF-RLYGTNYSLYTHSYLCYGQTQALKMLLAALHQGSPSPQ-  280

Query  917   RGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCK  738
                  ++ HPC   G+ +N T    +         + S     ++ +++  GDP    C 
Sbjct  281   -----QISHPCYPKGYQENITTADLYNSP---CVRAPSTPSPAQVLTVMGTGDP--AACT  330

Query  737   VLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNML  558
                 ++   S    R+      C      G + +    +      ++ A +GF+  ++ L
Sbjct  331   TAIQKLFNFSCGANRT------C------GFNGVYQPPVRG----QFFAFAGFYYTFHFL  374

Query  557   NLSSRANLTKMWETGQGLCSRSWVD  483
             NL+S+ +L  +  T Q  C ++W +
Sbjct  375   NLTSKQSLNDINSTIQTFCQKNWTE  399



>ref|XP_003677655.1| hypothetical protein NCAS_0G04170 [Naumovozyma castellii CBS 
4309]
 emb|CCC71304.1| hypothetical protein NCAS_0G04170 [Naumovozyma castellii CBS 
4309]
Length=521

 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 125/251 (50%), Gaps = 26/251 (10%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + V++D GSTGSRV++YE+     + P L+N     L             +PGL+ F  +
Sbjct  96    YVVMIDAGSTGSRVHVYEF-DVCSQPPALINESFKML-------------KPGLSSFDTD  141

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVG-IVKEH  1242
             A G   SL PL++ A   VP  KR  TP+ V ATAG+R L    ++++++ V   + K++
Sbjct  142   AEGAAKSLDPLLQVALDAVPEKKRSCTPVAVKATAGLRLLGDTKSAKILQAVRSHLEKDY  201

Query  1241  GF-FYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEI--  1071
              F     D I ++SG EE  Y WV  NY +  +G  S   T  + DLGG S Q+V E   
Sbjct  202   PFAVVDGDGISIMSGDEEGVYAWVTTNYLLGNIGTGSKLATSAVFDLGGGSTQIVFEPTF  261

Query  1070  ---DEFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQT--QARRESRGEI  906
                +E  + EH +  R G  ++ L  +S   +G  E  ++   +L +T  +A    +G+ 
Sbjct  262   PPNEEMVDGEHKYELRFGGQDYSLYQFSHLGYGLMEGRNKINQLLVETAIKAGTIKKGDY  321

Query  905   ---FKVRHPCL  882
                  +  PCL
Sbjct  322   TPSVALHSPCL  332



>ref|XP_010476471.1| PREDICTED: probable apyrase 4 [Camelina sativa]
Length=506

 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 110/433 (25%), Positives = 188/433 (43%), Gaps = 55/433 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             ++VV+D GS+G+RV+++ +   +G+ P+                Y   +  PGL+ +  N
Sbjct  83    YSVVIDGGSSGTRVHVFGYRVESGK-PVFDFGEE---------SYASFKLSPGLSAYGDN  132

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
               G+  S+  L+  A++ VP      + I ++ATAGMR L +     ++E    +++  G
Sbjct  133   PEGVSESVTELVEFAKRRVPKRVLEESDIRLMATAGMRLLELSVQEWILEVTRRVLRSSG  192

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F +R+++  V+SG +E  Y WV  N+ + +LG      T G+++LGG+S QV     E  
Sbjct  193   FSFREEWASVISGSDEGIYAWVVANHALGLLGGE-PLKTTGIVELGGASAQVTFVSSELV  251

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLS  879
               E       G+V + L ++S   FG + A ++ L  L  + A    +G   +V  PC+ 
Sbjct  252   PLEFSRTLAYGNVSYNLYSHSFLHFGQDSAQEKLLDSLQNSSANSAGKG---RVTDPCVP  308

Query  878   SGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVATNSSNL  699
              G+    +      QK SS   +  R       S+   G  N+ KC+   + +       
Sbjct  309   RGYTLEKSS-----QKDSSGFLAEKRFTA----SLQAAG--NFSKCRSATLAMLQEG---  354

Query  698   ERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMWE  519
              + K   ++C    S GS    NL         + A   FF       L  +  L+++  
Sbjct  355   -KEKCPYKHC----SIGSIFTPNLR------GSFLATENFFHTSKFFGLGEKHWLSELIL  403

Query  518   TGQGLCSRSWVDQ-------TDANGL--CFRILYMASLIKDAL--CLSNLEIIFGPG---  381
              G+  C   W           D N L  CF   Y+ S++ D+L   L +  I F      
Sbjct  404   AGKRYCGEEWSKLKVKYPTFKDENLLRYCFSSAYIVSMLHDSLGIALDDERIGFASKAGQ  463

Query  380   --DVSWALGAALI  348
                + WALGA ++
Sbjct  464   DIPLDWALGAFIL  476



>ref|XP_009014335.1| hypothetical protein HELRODRAFT_191021 [Helobdella robusta]
 gb|ESO07724.1| hypothetical protein HELRODRAFT_191021 [Helobdella robusta]
Length=316

 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 81/147 (55%), Gaps = 4/147 (3%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + VV+DCGS+GSR+ +Y W  + GE   L++     + +    K    + EPGL+ +   
Sbjct  51    YGVVIDCGSSGSRLFVYYWQQHTGEPNQLLDI---KILKDTNNKTVVSKIEPGLSSYSKT  107

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV-VGIVKEH  1242
              S     + PL++ A+  +P  K   TP+++LATAGMR LP E+ + ++  +   I  + 
Sbjct  108   PSQASDYIAPLLKFAQDHIPVEKIKETPLYILATAGMRLLPKEEQTALLNDLRTDIGLDF  167

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNY  1161
              F +    I V+SG+ E  YGW A+N+
Sbjct  168   DFLFSPAHIEVISGKWEGIYGWTAVNH  194



>ref|XP_007475531.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 8-like 
isoform X4 [Monodelphis domestica]
Length=435

 Score = 93.6 bits (231),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 89/386 (23%), Positives = 166/386 (43%), Gaps = 46/386 (12%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             F +V D GS+ + + +Y+W P + E          N T        C  T  G++ +   
Sbjct  37    FGLVFDAGSSHTSLFMYQW-PADKE----------NDTGVVSQTMTCDVTGDGISSYAQK  85

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED---ASRVMEGVVGIVK  1248
                   SLKP +  A + +P+ +    P+++ ATAGMR L ++D   A++V+  V   ++
Sbjct  86    PEAAGKSLKPCLDKAMELIPAAQLTQVPVYLGATAGMRILSLQDPKAANQVLAEVSKTIQ  145

Query  1247  EHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEID  1068
             E+   +R    R++SG EE  YGW+ +NY   +L             +   + +++  +D
Sbjct  146   EYPMDFRG--ARIISGAEEGVYGWITINY---LLDTFIKYSVKNKGWIHPPATKMLGALD  200

Query  1067  EFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEA-FDRALAILSQTQARR--------ESR  915
                    +     GS+     A   + +GFN   +  +     Q QA++        ES+
Sbjct  201   LGGASTQISFFPSGSIADPTTASHFRLYGFNYTIYTHSYLCYGQAQAQKQVIVKLTQESQ  260

Query  914   GEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKV  735
             G   +++HPC   GF +  T +  +    ++    S   +  E+   +++G  N  KC+ 
Sbjct  261   GTPGRIQHPCFHKGFEEKVTAQSIYDSPCTAYLQPSGVNLNQEM---ILVGTGNVTKCR-  316

Query  734   LAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLN  555
              A+    N +          +C    +Y  D      +N     ++ A S F+  +  LN
Sbjct  317   QAIRAIFNFTACG----PHHSCAFNGTYQPD------VNG----QFFAFSAFYYTFAFLN  362

Query  554   LSSRANLTKMWETGQGLCSRSWVDQT  477
             ++S  +L ++    +  CSR+W D T
Sbjct  363   ITSGQSLAEVLNIIEHYCSRNWTDVT  388



>ref|XP_007575838.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 7-like 
[Poecilia formosa]
Length=604

 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 78/147 (53%), Gaps = 4/147 (3%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + +V+DCGS+GSRV +Y W P+NG    L++       R    K    + +PG++     
Sbjct  84    YGIVVDCGSSGSRVFVYYWPPHNGNPHTLLDI---RQMRDSDSKPVVKKIKPGISTLANT  140

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK-EH  1242
              +     L+PL+  A   VP  K   TP+++L TAGMR LP    + ++E +V  V  E 
Sbjct  141   PTKASDYLEPLLSFAAAHVPKSKHKETPLYILCTAGMRLLPESQQAAILEDLVMDVPLEF  200

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNY  1161
              F + +    V+SG++E  Y W+ +N+
Sbjct  201   DFLFSRSHAEVISGKQEGVYAWIGINF  227



>ref|XP_008806007.1| PREDICTED: probable apyrase 6 [Phoenix dactylifera]
Length=518

 Score = 94.0 bits (232),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 106/434 (24%), Positives = 181/434 (42%), Gaps = 56/434 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             F +V+D GS+G+R++++ +   +G  P +           D      ++  PGL+ F G+
Sbjct  61    FGIVIDAGSSGTRIHVFGFKGESGMVPSI-----------DWGSTAVMRVTPGLSAFSGD  109

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEHG  1239
                  ASL  L+  A+  V   +   T + ++ATAG+R L +E    ++E    +++  G
Sbjct  110   PERAGASLAELLEFAKGRVAKDQWEKTDVRLMATAGLRMLAVEVKESILESCRRVLRSSG  169

Query  1238  FFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEFR  1059
             F ++ D+  V+ G +E  Y WVA NY +  LG      T G+++LGG+S QV    +E  
Sbjct  170   FHFQDDWATVIPGSDEGTYAWVAANYALGTLGGD-PQKTTGIIELGGASAQVTFVSNEPL  228

Query  1058  EDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCLS  879
               E +   + G   + L + S   +G N A               ES  ++   R P  S
Sbjct  229   PAEFLQVLKFGETTYNLYSNSFLLYGQNVA--------------HESLQKLLSSRSPKAS  274

Query  878   SGFVQNHTCRGCFGQKPsssedssSRMMTCEL-NSILVLGDPNWEKCKVLAMEVATNSSN  702
             +  VQ          K  S     + +   EL +  +     N+  C+  A  +      
Sbjct  275   AESVQEGILIDPCSPKGYSYVGEPADVPNSELEHQPIAQAGGNFSACRSAASILLQK---  331

Query  701   LERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRANLTKMW  522
              E+     Q C      GS  +  L         + A   FF       LS  ++L+ + 
Sbjct  332   -EKDNCLYQKC----HMGSTFIPKLQ------GSFLATENFFFTTKFFGLSPTSSLSDLM  380

Query  521   ETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIF----G  387
               G+ +C   W         + + D +  CF   Y+ +L+ D+L   L +  I+F    G
Sbjct  381   LAGEQICGEYWSKLKEKYHTLAEEDLSRYCFSSAYIVALLHDSLGFALDDRRIVFANQAG  440

Query  386   PGDVSWALGAALIE  345
                V WALGA +++
Sbjct  441   NIQVEWALGAFIMQ  454



>ref|XP_007475529.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 8-like 
isoform X2 [Monodelphis domestica]
 ref|XP_007475530.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 8-like 
isoform X3 [Monodelphis domestica]
 ref|XP_001375161.3| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 8-like 
isoform X1 [Monodelphis domestica]
Length=491

 Score = 94.0 bits (232),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 101/444 (23%), Positives = 183/444 (41%), Gaps = 62/444 (14%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             F +V D GS+ + + +Y+W P + E          N T        C  T  G++ +   
Sbjct  37    FGLVFDAGSSHTSLFMYQW-PADKE----------NDTGVVSQTMTCDVTGDGISSYAQK  85

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED---ASRVMEGVVGIVK  1248
                   SLKP +  A + +P+ +    P+++ ATAGMR L ++D   A++V+  V   ++
Sbjct  86    PEAAGKSLKPCLDKAMELIPAAQLTQVPVYLGATAGMRILSLQDPKAANQVLAEVSKTIQ  145

Query  1247  EHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEID  1068
             E+   +R    R++SG EE  YGW+ +NY   +L             +   + +++  +D
Sbjct  146   EYPMDFRG--ARIISGAEEGVYGWITINY---LLDTFIKYSVKNKGWIHPPATKMLGALD  200

Query  1067  EFREDEHVFRSRIGSVEHKLLAYSLQAFGFNEA-FDRALAILSQTQARR--------ESR  915
                    +     GS+     A   + +GFN   +  +     Q QA++        ES+
Sbjct  201   LGGASTQISFFPSGSIADPTTASHFRLYGFNYTIYTHSYLCYGQAQAQKQVIVKLTQESQ  260

Query  914   GEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKV  735
             G   +++HPC   GF +  T +  +    ++    S   +  E+   +++G  N  KC+ 
Sbjct  261   GTPGRIQHPCFHKGFEEKVTAQSIYDSPCTAYLQPSGVNLNQEM---ILVGTGNVTKCR-  316

Query  734   LAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLN  555
              A+    N +          +C    +Y  D      +N     ++ A S F+  +  LN
Sbjct  317   QAIRAIFNFTACG----PHHSCAFNGTYQPD------VNG----QFFAFSAFYYTFAFLN  362

Query  554   LSSRANLTKMWETGQGLCSRSWVDQTDA---------NGLCFRILYMASLIKDALCLSN-  405
             ++S  +L ++    +  CSR+W D T +            C    Y+  L+ +    S  
Sbjct  363   ITSGQSLAEVLNIIEHYCSRNWTDVTASYPKQNLQWLQDYCANANYILILLLEGYKFSEK  422

Query  404   --LEIIF----GPGDVSWALGAAL  351
                 IIF       D+ W LG  L
Sbjct  423   SWTSIIFQQKASETDIGWTLGYML  446



>gb|EMD38143.1| hypothetical protein CERSUDRAFT_113288 [Ceriporiopsis subvermispora 
B]
Length=768

 Score = 94.7 bits (234),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 84/165 (51%), Gaps = 21/165 (13%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWM--------PNNGEFPILVNTYPGNLTRSDGCKYHCVQTEP  1443
             F VV+D GS+GSR+ IY W         PN G     ++T P     + G +    + EP
Sbjct  16    FGVVIDAGSSGSRLQIYSWKDARLARSDPNAGP----LDTLPRVEKGTQGGEDWSYKAEP  71

Query  1442  GLAMFVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGV  1263
             G++ F  +  G+ A L PL+  A   +P   +  TP+F+LATAGMR L  +  + V++  
Sbjct  72    GISSFGDDPEGVAAYLAPLLAHARTHIPPALQSETPLFLLATAGMRLLSPQQQADVLQAT  131

Query  1262  VGIVKEHGFFYRKD---------FIRVLSGREEAYYGWVALNYKM  1155
                +K H  F   D          +R+++G EE  +GW+A+NY M
Sbjct  132   CHFLKFHSNFRIDDPSPAGPCGSSVRIITGEEEGLFGWIAVNYLM  176



>gb|EOB05804.1| Ectonucleoside triphosphate diphosphohydrolase 1, partial [Anas 
platyrhynchos]
Length=506

 Score = 94.0 bits (232),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 107/456 (23%), Positives = 188/456 (41%), Gaps = 81/456 (18%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
             + + + +VLD GS+ + + +YEW       P       G + + + CK       PG++ 
Sbjct  42    KNTKYGIVLDAGSSHTNLYVYEW-------PAEKENDTGVVQQVEVCKVEG----PGISG  90

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIED---ASRVMEGVV  1260
             +  +      SL   +R A+  +PS +   TP+++ ATAGMR L +E+   A +V+  V 
Sbjct  91    YSHDTENAGHSLVQCLRQAQGVIPSKQHQETPVYLGATAGMRLLSLENKNAADKVLSSVE  150

Query  1259  GIVKEHGFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVV  1080
               ++   F ++    R++SG+EE  YGW+ +NY   +LGN   S    LL    S  +  
Sbjct  151   KTLRSAPFNFQG--ARIISGQEEGAYGWITINY---LLGNFKQSGWTKLLHSLKSVSETS  205

Query  1079  TEID--------EFREDEHVFRS-------RIGSVEHKLLAYSLQAFGFNEAFDRALAIL  945
               +D         F  DE    S       R+   ++++  +S   +G ++A  + LA  
Sbjct  206   GALDLGGASTQITFVSDESPSESPENLLYFRLYGKDYRVYTHSFLCYGKDQALQQKLA--  263

Query  944   SQTQARRESRGEIFKVRHPCLSSGFVQNHTCRGCFGQKPsssedssSRMMTCELNSILVL  765
                   R+ + +   +  PC   G+ +       F + P +S            + + V+
Sbjct  264   ------RDIQAKSNSIHDPCFHQGYQRTINISDLF-KNPCTSVGKK----QFPFSQLYVM  312

Query  764   GDPNWEKCKVLAMEVATNSSNLERSKVAEQNCVGLLSYGSDRMQNLTLNSHEVTRYHALS  585
             G+ N+EKC+     +   +S                 Y S     + L   +   + A S
Sbjct  313   GEGNYEKCRRSIQNLFNKTS---------------CPYSSCSFNGIYLPPLQ-GDFGAFS  356

Query  584   GFFAVYNMLNLSSRA--NLTKMWETGQGLCSRSWVDQTDA---------NGLCFRILYMA  438
              F+ V N LNL++     L K+    Q  C+R W +  +A         +  CF   Y+ 
Sbjct  357   AFYFVMNFLNLTNDNPFALDKVASAVQSFCARPWHEVKEAYHQIKEKYLSEYCFSGAYIL  416

Query  437   SLIKDALCLS--NLEII-----FGPGDVSWALGAAL  351
             SL+++    +  N + I      G  D  W LG  L
Sbjct  417   SLLENGYEFNKENWQRIHFLGKIGSSDAGWTLGYML  452



>ref|NP_001275348.1| apyrase precursor [Solanum tuberosum]
 gb|ABV26545.1| apyrase 3 [Solanum tuberosum]
Length=454

 Score = 93.6 bits (231),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 85/157 (54%), Gaps = 13/157 (8%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
              + ++ V+ D GSTGSRV+++ +    G  PI      GN         + + TEPGL+ 
Sbjct  42    ESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPI------GNNIE------YFMATEPGLSS  89

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             +  +      SL+PL+ GAE  VP   +  TP+ + ATAG+R L  + A ++++ V  +V
Sbjct  90    YAEDPKAAANSLEPLLDGAEGVVPQELQSETPLELGATAGLRMLKGDAAEKILQAVRNLV  149

Query  1250  KEHGFFYRKD-FIRVLSGREEAYYGWVALNYKMRMLG  1143
             K    F+ KD ++ +L G +E  Y W A+NY +  LG
Sbjct  150   KNQSTFHSKDQWVTILDGTQEGSYMWAAINYLLGNLG  186



>gb|ADN83844.1| putative apyrase AP5 [Solanum tuberosum]
Length=454

 Score = 93.6 bits (231),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 85/157 (54%), Gaps = 13/157 (8%)
 Frame = -1

Query  1610  RASYFTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAM  1431
              + ++ V+ D GSTGSRV+++ +    G  PI      GN         + + TEPGL+ 
Sbjct  42    ESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPI------GNNIE------YFMATEPGLSS  89

Query  1430  FVGNASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIV  1251
             +  +      SL+PL+ GAE  VP   +  TP+ + ATAG+R L  + A ++++ V  +V
Sbjct  90    YAEDPKAAANSLEPLLDGAEGVVPQELQSETPLELGATAGLRMLKGDAAEKILQAVRNLV  149

Query  1250  KEHGFFYRKD-FIRVLSGREEAYYGWVALNYKMRMLG  1143
             K    F+ KD ++ +L G +E  Y W A+NY +  LG
Sbjct  150   KNQSTFHSKDQWVTILDGTQEGSYMWAAINYLLGNLG  186



>ref|XP_427896.3| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 7 [Gallus 
gallus]
Length=601

 Score = 94.4 bits (233),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 82/149 (55%), Gaps = 4/149 (3%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHCVQTEPGLAMFVGN  1419
             + VV+DCGS+GSRV +Y W P+NG    L++       R    +   ++ +PG+++    
Sbjct  81    YGVVVDCGSSGSRVFVYVWPPHNGHPHDLLDI---RQMRDRNSRPVVMKVKPGISVAAAA  137

Query  1418  ASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVK-EH  1242
                  A L+PL+R A   VP  K   TP++VL TAGMR LP    + ++E +V  V  E 
Sbjct  138   PERATAYLRPLLRFAAAHVPEEKHKETPLYVLCTAGMRLLPERLQAAILENLVKNVPLEF  197

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNYKM  1155
              F + K    V+SG++E  Y W+ +N+ +
Sbjct  198   DFLFSKSHAEVISGKQEGVYAWIGINFVL  226



>ref|NP_172876.1| probable apyrase 3 [Arabidopsis thaliana]
 ref|NP_973822.2| probable apyrase 3 [Arabidopsis thaliana]
 ref|NP_001117284.1| probable apyrase 3 [Arabidopsis thaliana]
 sp|Q9XI62.1|APY3_ARATH RecName: Full=Probable apyrase 3; Short=AtAPY3; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
3 [Arabidopsis thaliana]
 gb|AAD39311.1|AC007576_34 Similar to nucleoside phosphatases [Arabidopsis thaliana]
 gb|AAO64935.1| At1g14240 [Arabidopsis thaliana]
 dbj|BAE99403.1| putative nucleoside triphosphatase [Arabidopsis thaliana]
 dbj|BAH20006.1| AT1G14240 [Arabidopsis thaliana]
 gb|AEE29127.1| probable apyrase 3 [Arabidopsis thaliana]
 gb|AEE29128.1| probable apyrase 3 [Arabidopsis thaliana]
 gb|AEE29130.1| probable apyrase 3 [Arabidopsis thaliana]
 gb|AEJ38084.1| nucleoside triphosphate diphosphohydrolase 3 [Arabidopsis thaliana]
Length=483

 Score = 93.6 bits (231),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 102/441 (23%), Positives = 188/441 (43%), Gaps = 68/441 (15%)
 Frame = -1

Query  1598  FTVVLDCGSTGSRVNIYEWMPNNGEFPILVNTYPGNLTRSDGCKYHC-VQTEPGLAMFVG  1422
             ++V++D GS+G+RV+++ +   +G+ P+             G K++  ++  PGL+ +  
Sbjct  70    YSVLIDAGSSGTRVHVFGYWFESGK-PVF----------DFGEKHYANLKLTPGLSSYAD  118

Query  1421  NASGLRASLKPLIRGAEKWVPSGKRGVTPIFVLATAGMRRLPIEDASRVMEGVVGIVKEH  1242
             N  G   S+  L+  A++ +P      + I ++ATAGMR L +    +++E    +++  
Sbjct  119   NPEGASVSVTKLVEFAKQRIPKRMFRRSDIRLMATAGMRLLEVPVQEQILEVTRRVLRSS  178

Query  1241  GFFYRKDFIRVLSGREEAYYGWVALNYKMRMLGNTsgshtlglldlggssLQVVTEIDEF  1062
             GF +R ++  V+SG +E  Y W+  NY +  LG T    T G+++LGG+S QV     E 
Sbjct  179   GFMFRDEWANVISGSDEGIYSWITANYALGSLG-TDPLETTGIVELGGASAQVTFVSSEH  237

Query  1061  REDEHVFRSRIGSVEHKLLAYSLQAFGFNEAFDRALAILSQTQARRESRGEIFKVRHPCL  882
                E+      G++ + + ++S   +G + A  + L  L Q  A     G    V  PC 
Sbjct  238   VPPEYSRTIAYGNISYTIYSHSFLDYGKDAALKKLLEKL-QNSANSTVDG---VVEDPCT  293

Query  881   SSGFVQNHTCR----GCFGQKPsssedssSRMMTCELNSILVLGDPNWEKCKVLAMEVAT  714
               G++ +   +    G    +                 S+   G  N+ KC+        
Sbjct  294   PKGYIYDTNSKNYSSGFLADESKLK------------GSLQAAG--NFSKCR--------  331

Query  713   NSSNLERSKVAEQNCV-GLLSYGSDRMQNLTLNSHEVTRYHALSGFFAVYNMLNLSSRAN  537
              S+     K  ++NC+    S GS    +L         + A + F+       L  +  
Sbjct  332   -SATFALLKEGKENCLYEHCSIGSTFTPDLQ------GSFLATASFYYTAKFFELEEKGW  384

Query  536   LTKMWETGQGLCSRSW---------VDQTDANGLCFRILYMASLIKDAL--CLSNLEIIF  390
             L+++   G+  C   W          D+    G CF   Y  S++ D+L   L +  I +
Sbjct  385   LSELIPAGKRYCGEEWSKLILEYPTTDEEYLRGYCFSAAYTISMLHDSLGIALDDESITY  444

Query  389   GPG------DVSWALGAALIE  345
                       + WALGA +++
Sbjct  445   ASKAGEKHIPLDWALGAFILD  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5763899892528