BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16089_g1_i1 len=794 path=[1664:0-39 298:40-287 546:288-321
1986:322-450 684:451-474 2138:475-793]

Length=794
                                                                      Score     E

gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         76.6    2e-14   Ipomoea batatas [batate]
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      73.2    3e-13   
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 72.0    6e-13   
ref|XP_003628979.1|  Defensin                                         72.0    6e-13   
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      71.6    1e-12   
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            68.9    8e-12   
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    68.2    2e-11   Vitis vinifera
ref|NP_001048853.1|  Os03g0130300                                     68.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        67.0    4e-11   Sorghum bicolor [broomcorn]
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          67.0    5e-11   
emb|CDP10468.1|  unnamed protein product                              66.6    6e-11   
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          66.2    1e-10   
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  65.9    1e-10   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    65.5    2e-10   
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               64.7    3e-10   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    64.7    4e-10   
gb|EMS65297.1|  Defensin SD2                                          64.7    4e-10   
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        64.3    4e-10   Sorghum bicolor [broomcorn]
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            64.3    4e-10   
ref|XP_003629332.1|  Defensin                                         64.3    5e-10   
dbj|BAK07043.1|  predicted protein                                    64.7    5e-10   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    63.9    6e-10   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    63.5    7e-10   
dbj|BAK07823.1|  predicted protein                                    64.3    8e-10   
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 63.5    1e-09   
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     63.5    1e-09   
gb|AAL85480.1|  defensin protein 1                                    63.5    1e-09   Prunus persica
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           63.2    1e-09   
ref|XP_003628978.1|  Defensin                                         63.2    1e-09   
gb|AGC82207.1|  defensin                                              63.2    1e-09   
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         63.2    1e-09   
gb|EMS65298.1|  Defensin-like protein 1                               63.2    1e-09   
gb|ACN93800.1|  defensin precursor                                    63.2    1e-09   Vigna unguiculata
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            62.8    1e-09   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            62.8    2e-09   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            62.8    2e-09   
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       62.4    2e-09   
gb|ACV84379.1|  defensin precursor                                    62.4    3e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 62.4    3e-09   
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           62.0    3e-09   
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  62.0    3e-09   Capsicum annuum
gb|ABS72000.1|  putative defensin protein 1                           61.6    3e-09   Olea europaea
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              62.0    3e-09   
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      62.0    4e-09   Castanea sativa
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 62.0    4e-09   
gb|AIA67010.1|  defensin                                              62.0    4e-09   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  61.6    4e-09   Petunia integrifolia [violet-flowered petunia]
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  61.6    4e-09   Capsicum annuum
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               61.6    5e-09   
gb|KHN06998.1|  Defensin-like protein                                 61.6    5e-09   
gb|EMT03365.1|  Defensin-like protein 1                               61.6    5e-09   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  61.2    6e-09   Capsicum annuum
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               61.2    6e-09   
gb|AIA67012.1|  defensin                                              61.2    6e-09   
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            60.8    8e-09   
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         60.8    8e-09   
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        60.8    9e-09   Sorghum bicolor [broomcorn]
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  60.5    1e-08   
dbj|BAA95697.1|  thionin like protein                                 60.8    1e-08   Nicotiana tabacum [American tobacco]
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    60.5    1e-08   
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    60.5    1e-08   
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 60.5    1e-08   
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    60.5    1e-08   
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               60.5    1e-08   
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     60.5    1e-08   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    60.5    1e-08   
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  60.8    1e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    60.5    1e-08   
gb|EMT03364.1|  Defensin SD2                                          60.5    1e-08   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       60.1    2e-08   
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   60.1    2e-08   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               59.7    2e-08   
ref|XP_010228361.1|  PREDICTED: defensin Tk-AMP-D1.1-like             59.3    3e-08   
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       59.3    3e-08   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  59.3    3e-08   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               59.3    3e-08   
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    59.3    4e-08   
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               59.3    4e-08   
gb|KHN23780.1|  Defensin SD2                                          58.9    5e-08   
ref|XP_003630421.1|  Defensin                                         58.9    5e-08   
gb|ACJ26760.1|  protease inhibitor-related protein                    58.9    5e-08   Solanum tuberosum [potatoes]
ref|NP_001234987.1|  protease inhibitor precursor                     58.9    5e-08   
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               58.9    5e-08   
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            59.7    5e-08   
gb|AAL14240.1|  proteinase inhibitor                                  58.2    5e-08   Musa acuminata [banana]
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               58.9    5e-08   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               58.9    5e-08   
gb|ADK87340.1|  defensin                                              58.9    6e-08   
ref|NP_001047493.1|  Os02g0629800                                     58.9    6e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AFW90621.1|  protease inhibitor-related protein                    58.5    6e-08   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            58.5    6e-08   
gb|AIA66989.1|  defensin                                              58.5    7e-08   
gb|AIT42150.1|  defensin-like protein                                 58.2    7e-08   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           58.5    7e-08   
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      58.5    7e-08   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            58.5    8e-08   
gb|AFK44299.1|  unknown                                               58.2    8e-08   
gb|ACV84381.1|  defensin precursor                                    58.5    8e-08   Triticum turgidum subsp. durum
gb|AHA50470.1|  defensin-like protein 1                               58.2    8e-08   
gb|AIT42147.1|  defensin-like protein                                 58.2    9e-08   
gb|AIT42148.1|  defensin-like protein                                 58.2    9e-08   
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    58.2    9e-08   
gb|AIT42152.1|  defensin-like protein                                 58.2    1e-07   
gb|ACV84384.1|  defensin precursor                                    58.2    1e-07   Triticum turgidum subsp. durum
gb|AIT42153.1|  defensin-like protein                                 58.2    1e-07   
gb|ACM50880.1|  defensin                                              57.4    1e-07   Capsicum frutescens [bird pepper]
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 57.8    1e-07   Jatropha curcas
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       57.8    1e-07   
ref|NP_001052199.1|  Os04g0189400                                     58.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        57.8    1e-07   Sorghum bicolor [broomcorn]
gb|EMT11359.1|  Defensin-like protein P322                            57.4    1e-07   
gb|AFD01290.1|  defensin 3                                            57.8    2e-07   
gb|ABA81896.1|  putative defensin                                     57.4    2e-07   Aquilegia formosa
ref|XP_003628977.1|  Defensin                                         57.4    2e-07   
gb|AHA50471.1|  defensin-like protein 4                               57.4    2e-07   
gb|EEC76838.1|  hypothetical protein OsI_14993                        57.4    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_007045353.1|  Defensin-like protein isoform 1                  57.4    2e-07   
sp|P81571.1|DEFD2_SPIOL  RecName: Full=Defensin D2; AltName: Full...  56.6    2e-07   Spinacia oleracea
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           57.4    2e-07   
gb|ABK23404.1|  unknown                                               57.4    2e-07   Picea sitchensis
gb|AAS13434.1|  defensin                                              56.6    2e-07   Nicotiana attenuata
ref|XP_010088525.1|  Defensin-like protein 2                          57.0    2e-07   
ref|XP_003630422.1|  Defensin                                         57.0    2e-07   
ref|NP_178320.1|  defensin-like protein 4                             57.0    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ACS96442.1|  defensin                                              57.0    3e-07   Jatropha curcas
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               57.0    3e-07   
gb|AFE88173.1|  g-thionin                                             56.6    3e-07   
gb|EMT00351.1|  Defensin-like protein                                 57.0    3e-07   
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 56.6    3e-07   
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               56.6    3e-07   
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               56.6    4e-07   
emb|CAA65045.1|  defensin                                             56.2    4e-07   
gb|AAA91049.1|  protease inhibitor II                                 56.6    4e-07   Brassica rapa
gb|AHA50473.1|  defensin-like protein 6                               56.2    4e-07   
gb|KHG09995.1|  Defensin-like protein 1                               56.2    4e-07   
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    56.2    5e-07   
gb|KEH35661.1|  Defensin                                              56.2    5e-07   
emb|CAH58740.1|  defensin                                             56.2    5e-07   Plantago major [cart-track plant]
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               56.2    5e-07   
emb|CDY48618.1|  BnaC09g20670D                                        55.8    6e-07   
ref|NP_176302.2|  defensin-like protein                               55.8    6e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28445.1|  unknown                                               55.8    6e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAA62761.1|  putative gamma-thionin protein                       55.8    7e-07   Picea abies
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           55.8    7e-07   
gb|ABK25062.1|  unknown                                               55.8    7e-07   Picea sitchensis
gb|ABA86586.1|  putative defensin 1                                   55.5    7e-07   Aquilegia formosa
gb|AAR84643.1|  defensin                                              55.8    7e-07   Picea glauca
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    55.8    7e-07   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               55.5    9e-07   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  55.5    9e-07   Solanum tuberosum [potatoes]
gb|AIA67004.1|  defensin                                              55.5    9e-07   
gb|EAY86781.1|  hypothetical protein OsI_08161                        59.3    9e-07   Oryza sativa Indica Group [Indian rice]
gb|AIT42149.1|  defensin-like protein                                 55.5    1e-06   
gb|AGT51228.1|  defensin                                              55.5    1e-06   
ref|NP_178319.1|  defensin-like protein 2                             55.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886566.1|  protease inhibitor II                            55.1    1e-06   
gb|AIA66994.1|  defensin                                              55.5    1e-06   
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               55.1    1e-06   
gb|ACB32234.1|  gamma-thionin/defensin                                55.1    1e-06   Solanum chacoense
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           55.1    1e-06   
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               55.1    1e-06   
gb|EMT06279.1|  Defensin-like protein 2                               55.1    1e-06   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 55.1    1e-06   
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           54.7    1e-06   
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           54.7    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003599384.1|  Defensin                                         55.1    1e-06   
gb|AIC35288.1|  defensin 4                                            55.1    2e-06   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       54.7    2e-06   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           54.7    2e-06   
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           54.7    2e-06   
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           54.7    2e-06   
gb|ABK21016.1|  unknown                                               54.7    2e-06   Picea sitchensis
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            54.7    2e-06   
ref|NP_178321.1|  defensin-like protein 1                             54.7    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AHA50472.1|  defensin-like protein 5                               54.7    2e-06   
gb|ADQ43197.1|  unknown                                               54.3    2e-06   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           54.3    2e-06   
gb|EMS49334.1|  Defensin-like protein                                 54.7    2e-06   
gb|ABK23037.1|  unknown                                               54.7    2e-06   Picea sitchensis
gb|ABA86589.1|  putative defensin 1                                   54.3    2e-06   Aquilegia pyrenaica
gb|ABA86587.1|  putative defensin 1                                   54.3    2e-06   Aquilegia chrysantha
gb|ABW99097.1|  defensin                                              53.9    3e-06   Capsicum chinense [Scotch bonnet]
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            54.3    3e-06   
gb|AIA66999.1|  defensin                                              54.3    3e-06   
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           55.5    3e-06   
gb|AIA66992.1|  defensin                                              54.3    3e-06   
gb|ABO36641.1|  defensin protein                                      53.9    3e-06   Solanum pimpinellifolium [currant tomato]
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          53.9    3e-06   
ref|NP_001234872.1|  gamma-thionin precursor                          53.9    3e-06   
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               53.9    3e-06   
gb|ABO36637.1|  defensin protein                                      53.9    3e-06   Solanum lycopersicum
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           53.9    3e-06   
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  53.9    4e-06   
gb|ABK20960.1|  unknown                                               53.9    4e-06   Picea sitchensis
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             53.9    4e-06   
gb|AGT51229.1|  defensin                                              53.9    4e-06   
gb|AAG51654.1|AC018908_20  unknown protein; 87272-87105               53.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDM85870.1|  unnamed protein product                              53.5    4e-06   
ref|XP_010229304.1|  PREDICTED: defensin Tk-AMP-D1.1-like             53.5    4e-06   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               53.5    4e-06   
ref|XP_010064921.1|  PREDICTED: uncharacterized protein LOC104452094  54.7    5e-06   
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               53.5    5e-06   
gb|EMS52277.1|  Defensin Tk-AMP-D1.1                                  53.5    5e-06   
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             53.5    5e-06   
gb|EMT22729.1|  Defensin Tk-AMP-D2                                    53.1    5e-06   
gb|EMT03363.1|  hypothetical protein F775_43918                       53.5    5e-06   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               53.1    6e-06   
gb|AAM62652.1|  protease inhibitor II                                 53.1    7e-06   Arabidopsis thaliana [mouse-ear cress]
sp|A4L7R8.1|DEF2_PINSY  RecName: Full=Defensin-2; Flags: Precursor    53.1    7e-06   Pinus sylvestris [Scotch pine]
ref|NP_001148158.1|  LOC100281766 precursor                           53.1    7e-06   Zea mays [maize]
ref|XP_009357110.1|  PREDICTED: defensin Ec-AMP-D1-like               53.1    7e-06   
gb|EMT26158.1|  Defensin-like protein                                 52.8    7e-06   
gb|ACG30752.1|  low-molecular-weight cysteine-rich protein LCR69 ...  53.1    7e-06   Zea mays [maize]
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           52.8    8e-06   
gb|AIA67000.1|  defensin                                              53.1    8e-06   
gb|EMS64594.1|  Defensin Tm-AMP-D1.2                                  53.1    8e-06   
emb|CEJ09690.1|  Defensin protein                                     52.8    8e-06   
emb|CDP10467.1|  unnamed protein product                              53.1    8e-06   
gb|KCW70075.1|  hypothetical protein EUGRSUZ_F03380                   52.8    8e-06   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      52.8    8e-06   
sp|A4L7R7.1|DEF1_PINSY  RecName: Full=Defensin-1; Flags: Precursor    52.8    9e-06   Pinus sylvestris [Scotch pine]
gb|ABK93231.1|  unknown                                               52.8    9e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               52.8    9e-06   
ref|XP_010497013.1|  PREDICTED: putative defensin-like protein 9      52.8    1e-05   
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  52.4    1e-05   Helianthus annuus
dbj|BAD25113.1|  hypothetical protein                                 52.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               52.8    1e-05   
gb|ABX84377.1|  amylase inhibitor-like protein                        52.8    1e-05   Triticum aestivum [Canadian hard winter wheat]
gb|ABX84378.1|  amylase inhibitor-like protein                        52.8    1e-05   Triticum aestivum [Canadian hard winter wheat]
gb|ADK91098.1|  PCP17C2                                               52.0    1e-05   
dbj|BAJ89304.1|  predicted protein                                    52.8    1e-05   
gb|ACV84382.1|  defensin precursor                                    52.4    1e-05   Triticum turgidum subsp. durum
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            52.4    1e-05   
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           52.4    1e-05   
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               52.8    1e-05   
ref|XP_010038383.1|  PREDICTED: uncharacterized protein LOC104426904  54.7    1e-05   
gb|AIA67013.1|  defensin                                              52.4    1e-05   
ref|XP_010481691.1|  PREDICTED: putative defensin-like protein 9      52.4    1e-05   
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               52.0    1e-05   
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  52.0    2e-05   Ricinus communis
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           52.4    2e-05   
gb|EMT22726.1|  Defensin Tm-AMP-D1.2                                  52.0    2e-05   
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               52.4    2e-05   
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           52.0    2e-05   
gb|AIA67014.1|  defensin                                              52.0    2e-05   
dbj|BAB64929.1|  defensin-like protein                                52.0    2e-05   Pyrus pyrifolia [sha li]
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           52.0    2e-05   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           52.0    2e-05   
gb|AFK47422.1|  unknown                                               52.0    2e-05   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               52.0    2e-05   
gb|ACG25019.1|  low-molecular-weight cysteine-rich protein LCR69 ...  52.0    2e-05   Zea mays [maize]
ref|NP_001147001.1|  LOC100280611 precursor                           52.0    2e-05   Zea mays [maize]
gb|EMT16291.1|  Defensin SD2                                          52.0    2e-05   
ref|XP_004976259.1|  PREDICTED: defensin-like protein-like            52.0    2e-05   
gb|ACB20518.1|  defensin precursor                                    51.6    2e-05   Saccharum officinarum [noble cane]
gb|EMS52097.1|  Defensin Tk-AMP-D1                                    51.6    2e-05   
gb|ABM89231.1|  defensin                                              51.6    2e-05   Setaria italica
emb|CAD41436.1|  OSJNBa0019D11.21                                     51.6    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002325734.2|  defensin-like family protein                     51.6    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002452484.1|  hypothetical protein SORBIDRAFT_04g026670        51.6    3e-05   Sorghum bicolor [broomcorn]
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          51.6    3e-05   
dbj|BAK06284.1|  predicted protein                                    51.6    3e-05   
gb|AIA66987.1|  defensin                                              51.2    3e-05   
gb|EPS67569.1|  gamma-thionin                                         50.4    4e-05   
gb|AEW08922.1|  hypothetical protein CL2287Contig1_03                 50.4    4e-05   
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  50.8    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               50.8    4e-05   
ref|NP_001031462.1|  low-molecular-weight cysteine-rich 75            50.8    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EMT22728.1|  Defensin Tm-AMP-D1.2                                  50.8    5e-05   
ref|NP_001149230.1|  LOC100282852 precursor                           50.8    5e-05   Zea mays [maize]
gb|EMT22721.1|  Defensin Tk-AMP-D2                                    50.8    5e-05   
gb|AIA66993.1|  defensin                                              50.8    5e-05   
gb|AAN40688.1|  putative plant defensin SPI1B                         50.8    5e-05   Picea abies
ref|XP_004306561.1|  PREDICTED: defensin D2-like                      50.4    6e-05   
gb|AGT51227.1|  defensin                                              50.4    6e-05   
gb|EYU27578.1|  hypothetical protein MIMGU_mgv1a026683mg              50.4    6e-05   
ref|XP_011086331.1|  PREDICTED: putative defensin-like protein 3      51.2    6e-05   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           50.4    7e-05   
gb|ADQ43196.1|  unknown                                               50.1    7e-05   
dbj|BAC10287.1|  defensin                                             50.4    7e-05   
ref|XP_007226225.1|  hypothetical protein PRUPE_ppa016594mg           50.4    7e-05   
emb|CEJ09689.1|  Defensin protein                                     50.1    7e-05   
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  50.1    8e-05   
dbj|BAD25507.1|  hypothetical protein                                 50.4    8e-05   
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    50.1    9e-05   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               50.1    9e-05   
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  50.8    1e-04   
gb|KHN09675.1|  Defensin-like protein                                 49.3    1e-04   
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    49.7    1e-04   
ref|NP_001172824.1|  Os02g0172500                                     50.1    1e-04   
gb|EMT03877.1|  Defensin Tk-AMP-D3                                    49.7    1e-04   
emb|CDO99915.1|  unnamed protein product                              49.7    1e-04   
gb|ADK36631.1|  defensin-like protein                                 48.9    1e-04   
emb|CAA79164.1|  seed-specific low molecular weight sulfur-rich p...  49.3    1e-04   
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     50.1    1e-04   
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       49.7    1e-04   
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            48.9    1e-04   
gb|ACV84385.1|  defensin precursor                                    49.3    2e-04   
gb|AAU04859.1|  defensin precursor                                    49.3    2e-04   
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               49.3    2e-04   
ref|XP_002446801.1|  hypothetical protein SORBIDRAFT_06g022870        49.3    2e-04   
ref|XP_007203247.1|  hypothetical protein PRUPE_ppa019504mg           49.3    2e-04   
gb|EPS66510.1|  kunitz trypsin inhibitor protein                      48.9    2e-04   
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            48.9    2e-04   
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           48.9    2e-04   
gb|AIA66990.1|  defensin                                              48.9    2e-04   
gb|AFQ69079.1|  defensin precursor                                    48.9    2e-04   
ref|XP_004975165.1|  PREDICTED: defensin-like protein 2-like          48.9    2e-04   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           48.9    2e-04   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   48.5    2e-04   
emb|CEJ09688.1|  Defensin protein                                     48.5    3e-04   
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    48.1    3e-04   
gb|EMS68062.1|  Defensin Tm-AMP-D1.2                                  48.5    3e-04   
ref|XP_004147317.1|  PREDICTED: defensin-like protein-like            48.5    3e-04   
gb|ADK91116.1|  PCP17C2                                               48.1    3e-04   
ref|XP_007033367.1|  Scorpion toxin-like knottin superfamily protein  48.5    3e-04   
gb|AIA67011.1|  defensin                                              48.1    3e-04   
ref|XP_009355481.1|  PREDICTED: defensin Tk-AMP-D1.1-like             48.5    4e-04   
gb|EYU40734.1|  hypothetical protein MIMGU_mgv11b023365mg             48.1    4e-04   
gb|ACV84383.1|  defensin precursor                                    48.1    4e-04   
ref|XP_009353671.1|  PREDICTED: defensin-like protein 2               48.5    4e-04   
dbj|BAH29762.1|  defensin-like cystein-rich peptide                   48.1    4e-04   
gb|AIA67015.1|  defensin                                              48.1    4e-04   
ref|XP_009345992.1|  PREDICTED: defensin-like protein 2               48.1    4e-04   
sp|P86519.1|DEF2_ECHCG  RecName: Full=Defensin Ec-AMP-D2              47.4    4e-04   
ref|XP_009353672.1|  PREDICTED: defensin-like protein 2               48.1    4e-04   
ref|XP_006410329.1|  hypothetical protein EUTSA_v10017942mg           47.8    5e-04   
ref|XP_006466198.1|  PREDICTED: defensin-like protein 6-like          47.8    5e-04   
ref|XP_002879355.1|  hypothetical protein ARALYDRAFT_482123           47.4    5e-04   
ref|XP_009370221.1|  PREDICTED: defensin-like protein 2               47.8    5e-04   
ref|XP_009598624.1|  PREDICTED: defensin-like protein                 48.1    5e-04   
gb|AAG38520.1|AF283535_1  proteinase inhibitor se60-like protein      47.8    5e-04   
emb|CDY04774.1|  BnaC05g18150D                                        48.5    5e-04   
ref|XP_009355482.1|  PREDICTED: defensin Tk-AMP-D1.1-like             47.8    6e-04   
gb|EAY84990.1|  hypothetical protein OsI_06352                        47.8    6e-04   
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  47.8    6e-04   
ref|XP_004975163.1|  PREDICTED: defensin-like protein-like            47.8    6e-04   
gb|EMS53152.1|  Defensin-like protein 2                               47.4    7e-04   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              47.4    7e-04   
dbj|BAK07467.1|  predicted protein                                    47.4    7e-04   
ref|XP_009137059.1|  PREDICTED: LOW QUALITY PROTEIN: defensin-lik...  47.0    9e-04   
ref|XP_009389205.1|  PREDICTED: defensin Tk-AMP-D2-like               47.0    9e-04   
gb|ACI02057.1|  fabatin precursor                                     47.0    0.001   
dbj|BAB64931.1|  defensin-like protein                                47.0    0.001   



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            LFMATELG N I+VAEA  CE  S KFKG C R   C ++C TEGF  G C+G R RC C
Sbjct  17   LFMATELGTNRIMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRRRCFC  76

Query  182  IKNC  193
             K C
Sbjct  77   TKPC  80



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +  ATE+G   I+VAEA  CE  S +FKG+C  ++ C S+C TEGFPDG+C+G+R RC C
Sbjct  18   VVFATEMG--PIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFC  75

Query  182  IKNC  193
            ++NC
Sbjct  76   LRNC  79



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +  ATE+G   ++VAEA  CE  S +FKG+C  ++ C S+C TEGFPDG+C+G+R RC C
Sbjct  14   VVFATEMG--PVMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFC  71

Query  182  IKNC  193
            ++NC
Sbjct  72   LRNC  75



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G   I+VAEA  CE PS  FKGLC     C S+C+TEGFP G C G R RC C
Sbjct  17   LLVATEMG--PIMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGFRQRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F   E+G   I+VAEA  CE  S +FKG+C  ++ C S+C TEGFPDG+C+G+R RC C
Sbjct  19   VFATEEMG--PIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFC  76

Query  182  IKNC  193
            ++NC
Sbjct  77   LRNC  80



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            LFMATE+G  TI  AEA  CE  S +F+GLC R K C ++C TEGF  G CRG+R RC C
Sbjct  17   LFMATEMGPMTI--AEARHCESQSQRFRGLCVREKNCAAVCETEGFSGGDCRGLRRRCFC  74

Query  182  IKNC  193
             + C
Sbjct  75   TRPC  78



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            LFMATE+G    +VAEA  CE  S +FKG C R   C ++C+TEGF  G CRG R RC C
Sbjct  17   LFMATEMG---PMVAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGFRRRCFC  73

Query  182  IKNC  193
             K+C
Sbjct  74   TKHC  77



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            E+G   ++VAEA  CE  S +FKG C R   C S+C TEGFPDG C G+R RCMC K C
Sbjct  23   EMG-GPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYCHGVRRRCMCTKPC  80



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE+G   + VAEA  C+  S +F+G C R + C ++CRTEGFPDG+CRG R RC C+ +
Sbjct  20   ATEIG--AVAVAEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGKCRGFRRRCFCLTH  77

Query  191  C  193
            C
Sbjct  78   C  78



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +AT +G N  +VAEA  CE  S KFKG C R   C S+C+TEGF  G CRG+R RC C
Sbjct  17   LLVATGMGPNA-MVAEARTCETLSHKFKGTCLRESNCASVCQTEGFTGGDCRGLRRRCFC  75

Query  182  IKNC  193
             K+C
Sbjct  76   TKHC  79



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            LFM+TE+  + + VAEA  CE  S +FKG C R   C ++C+TEGFP GQC G+R RC C
Sbjct  17   LFMSTEM--DPVRVAEARTCESLSHRFKGTCVRGSNCAAVCQTEGFPGGQCSGLRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   SKPC  78



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +AT +G NT +VAEA  CE  S KFKG C     C S+C+TEGF  G CRG+R RC C
Sbjct  17   LLVATGMGPNT-MVAEARTCESLSHKFKGTCLSETNCASVCKTEGFSGGDCRGLRRRCFC  75

Query  182  IKNC  193
             K+C
Sbjct  76   TKHC  79



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L + +++G  ++   EA KCE  S KFKGLC R+  C ++C+TEGF  G CRG+R RC C
Sbjct  17   LLITSDMGMTSV---EARKCESASHKFKGLCFRASNCANVCKTEGFHGGHCRGLRRRCFC  73

Query  182  IKNC  193
             K+C
Sbjct  74   TKHC  77



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  5    FMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCI  184
            F+   L  +T +VAEA KCE  S +FKG+C R   C ++C+TEGF  G CRG R RC C 
Sbjct  12   FVMLMLVFSTGMVAEARKCESQSHRFKGICLRKANCAAVCQTEGFHSGHCRGFRGRCFCT  71

Query  185  KNC  193
            K+C
Sbjct  72   KHC  74



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  29   NTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + ++VAEA  CE  S +F+G C R+  CR++C+TEGF DG+CRG R RC C+  C
Sbjct  25   DQMMVAEARTCESRSHRFRGPCMRASNCRNVCKTEGFQDGKCRGFRRRCFCVSQC  79



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L  ATE+G    +VA+A  CE  S +FKG C R   C ++C+TEGF  G CRGIR RC C
Sbjct  17   LVFATEMG---TMVADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCRGIRRRCFC  73

Query  182  IKNC  193
             K+C
Sbjct  74   TKHC  77



>gb|EMS65297.1| Defensin SD2 [Triticum urartu]
 gb|AIA67005.1| defensin [Triticum aestivum]
Length=78

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + VAEA +CE  S +F GLC R   C ++CRTEGFPDG+CRG R RC C  +C
Sbjct  25   VAVAEARRCESLSHRFAGLCLRGHNCANVCRTEGFPDGKCRGARRRCFCTTHC  77



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +2

Query  5    FMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCI  184
            +  T+LG  T+ +A   KCE PS +F+G C R   C ++CRTEGF  G+C+G+R RC C 
Sbjct  19   YTDTQLGPVTMALAR--KCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCT  76

Query  185  KNC  193
            K+C
Sbjct  77   KDC  79



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MATE+G  TI  AEA +CE  S +F+G C R K C ++C TEGF  G CRG+R RC C
Sbjct  17   LVMATEMGPMTI--AEARRCESKSQRFRGPCVREKNCAAVCETEGFSGGDCRGLRRRCFC  74

Query  182  IKNC  193
             + C
Sbjct  75   TRPC  78



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            + +ATE+G  +I+V EA KC   S  FKGLC   + C ++C TEGF DG+CRG R RC C
Sbjct  17   VLVATEMG--SIMVVEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDGRCRGFRQRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   SKPC  78



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC*F  199
            + VAEA +CE PS  F+G C R   C ++CRTEGFP G CRG+R RC C  +C +
Sbjct  50   VAVAEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTHCRY  104



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L  ATE+G    +VAEA  CE  S +FKG C R   C ++C+TEGF  G CRG R RC C
Sbjct  17   LIFATEMG---TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRCFC  73

Query  182  IKNC  193
             K+C
Sbjct  74   TKHC  77



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L  ATE+G    +VAEA  CE  S +FKG C R   C ++C+TEGF  G CRG R RC C
Sbjct  17   LVFATEMG---TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRCFC  73

Query  182  IKNC  193
             K+C
Sbjct  74   TKHC  77



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ELG   ++VAEA  CE  S +F+G C R   C ++C+TEGFPDG+CRG R RC C  +C
Sbjct  46   ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  103



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G+  +  AEA  CE  S +F G C R   C SIC+TEGF  G CRG R RC C
Sbjct  14   LLLATEMGQ--MSSAEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGNCRGFRRRCFC  71

Query  182  IKNC  193
             +NC
Sbjct  72   TRNC  75



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE+G   + VAEA  C   S KF+G C R   C ++CRTEGFPDG+CRG+R RC C  +
Sbjct  20   ATEVG-GPVGVAEARTCLSQSHKFRGPCVRRANCANVCRTEGFPDGKCRGLRRRCFCTTH  78

Query  191  C  193
            C
Sbjct  79   C  79



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +VAEA  CE  S +FKG C  +  C S+C+TEGFP G CRG R RC C K+C
Sbjct  28   MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  79



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +VAEA  CE  S +FKG C  +  C S+C+TEGFP G CRG R RC C K+C
Sbjct  27   MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G + +    A  CE PS  FKG C     C S+C+TEGFP G C+G R RC C
Sbjct  17   LIVATEMGPSMV---AARTCETPSNSFKGACFSDTNCASVCQTEGFPGGHCKGFRQRCFC  73

Query  182  IKNC  193
             K C
Sbjct  74   TKPC  77



>gb|AGC82207.1| defensin [Persea americana var. drymifolia]
Length=78

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L + +E+    +   EA  CE PS  F GLC RS  C S+C  E F DG+C+G+R RCMC
Sbjct  18   LVIVSEIAVTRV---EAATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMC  74

Query  182  IKNC  193
            +K C
Sbjct  75   LKPC  78



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L  ATE+G    +VAEA  CE  S +FKGLC     C S+C TEGF  G CRG R RC C
Sbjct  17   LVFATEMGP---MVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ELG   ++VAEA  CE  S +F+G C R   C ++C+TEGFPDG+CRG R RC C  +C
Sbjct  23   ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  80



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G    +VAEA  CE  S +FKG C     C S+CRTE F  G CRG R RC+C
Sbjct  17   LLVATEMG--PTMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRCLC  74

Query  182  IKNC  193
             K+C
Sbjct  75   TKHC  78



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MATE+G  TI  AEA  CE  S +FKG C R   C ++C TEGF  G CRG R RC C
Sbjct  17   LVMATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFC  74

Query  182  IKNC  193
             + C
Sbjct  75   TRPC  78



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +++E+G  T+  AEA  CE  S +FKG C R   C ++C+TEGF  G CRG R RC C
Sbjct  17   LLLSSEMG--TMSSAEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFC  74

Query  182  IKNC  193
             +NC
Sbjct  75   TRNC  78



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+    I+VAEA  CE  S  FKGLC R   C  +C+TEGF  GQC+G R RC C
Sbjct  17   LLVATEM--RPIMVAEARTCESLSYSFKGLCVRDHNCAVVCQTEGFTGGQCKGFRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   NKPC  78



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE G    +VAEA  CE  S +FKG+C R+  C +IC+TEGF  G CRG+R RC C K+
Sbjct  20   ATETG---PMVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTKH  76

Query  191  C  193
            C
Sbjct  77   C  77



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RC  175
            L +ATE+G  T+ VAEA  C   S  FKG C  S  C ++CRTE FPDG+C    +  +C
Sbjct  16   LLVATEMGTTTVKVAEARNCLSQSHNFKGACLSSSNCAAVCRTENFPDGECHAPHYERKC  75

Query  176  MCIKNC  193
             C + C
Sbjct  76   FCKRPC  81



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L ++TE+G   I  AEA  CE  S  FKG C R   C ++C+TEGF  G CRG R RC C
Sbjct  18   LLLSTEMG--PISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFC  75

Query  182  IKNC  193
             +NC
Sbjct  76   TRNC  79



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G    +VAEA  CE  S +FKG C     C S+CRTE F  G CRG R RC C
Sbjct  17   LLLATEMGPR--MVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRCFC  74

Query  182  IKNC  193
             K+C
Sbjct  75   TKHC  78



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+   L   T ++AEA  CE  SG FKGLC  S+ C ++CR EGF DG C G R +C C
Sbjct  11   IFLMMLLVFATDMMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFC  70

Query  182  IKNC  193
             K C
Sbjct  71   TKPC  74



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++VA+A  CE  S +FKG C     C ++C+TEGFPDG CRG R RC C K+C
Sbjct  4    LMVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRGFRRRCFCSKHC  56



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGK-CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCM  178
            LFM   L  +T +VAEA + CE  S +FKG+C R   C ++C+TEGF  G CRG R RC 
Sbjct  12   LFMVM-LVFSTGMVAEATRTCEAKSHRFKGICARKANCAAVCQTEGFHGGHCRGFRRRCF  70

Query  179  CIKNC  193
            C K+C
Sbjct  71   CTKHC  75



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +VAEA  CE  S +FKG C R   C S+C+TEGF  GQCRG R RC C K+C
Sbjct  27   MVAEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGGQCRGFRRRCFCTKHC  78



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G   +  AEA  CE  S +F G C R   C S+C+TEGF  G CRG+R RC C
Sbjct  14   LLLATEMG--PMSSAEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGNCRGLRRRCFC  71

Query  182  IKNC  193
             +NC
Sbjct  72   TRNC  75



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + VAEA  CE  S +F+G C R + C ++C+TEGFP G+CRG R RC C  +C
Sbjct  30   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  82



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            LF++TE+G  T   AEA  CE  S +F G C R   C S+C+TEGF  G CR  R RC C
Sbjct  17   LFLSTEMGPMT--SAEARTCESQSHRFHGTCVRESNCASVCQTEGFIGGNCRAFRRRCFC  74

Query  182  IKNC  193
             +NC
Sbjct  75   TRNC  78



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+   L   T +VAEA  CE  S +FKGLC     C S+C TEGF  G CRG R RC C
Sbjct  11   IFLMMMLVFATGMVAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFC  70

Query  182  IKNC  193
             ++C
Sbjct  71   TRHC  74



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            VAEA  CE  S +FKG+CGR   C ++C+ EGF  G CRG R RC C K+C
Sbjct  28   VAEARTCETRSHRFKGICGRKANCAAVCQAEGFQGGHCRGFRRRCFCTKHC  78



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G    +VAEA  CE  S +FKG C     C S+CRTEGF  G CRG   RC C
Sbjct  17   LLIATEMG--PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKEC  78



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + VAEA  CE  S +F+G C R + C ++C+TEGFP G+CRG R RC C  +C
Sbjct  28   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  80



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MATE+G   + + EA  CE  S +FKG+C     C S+C+TEGF  G CRG R RC C
Sbjct  17   LVMATEMG--PMRIVEARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRGFRRRCFC  74

Query  182  IKNC  193
             + C
Sbjct  75   TRPC  78



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            LF+ T  G     VAEA  CE  S +FKG+C R   C ++C+TEGF  G CRG R RC C
Sbjct  15   LFLLTATGMGP-KVAEARTCESQSHRFKGICVRKSNCAAVCQTEGFHGGHCRGFRRRCFC  73

Query  182  IKNC  193
             K+C
Sbjct  74   TKHC  77



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ELG   ++VAEA  CE  S +F+G C R   C ++CRTEGF DG+CRG R RC C  +C
Sbjct  23   ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTHC  80



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            MATE+G  TI  AEA  CE  S +FKG C R   C ++C TEGF  G CRG R RC C +
Sbjct  19   MATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTR  76

Query  188  NC  193
             C
Sbjct  77   PC  78



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L  A E+G    +VAEA  CE  S +FKGLC     C S+C TEGF  G CRG R RC C
Sbjct  17   LVFANEMGP---MVAEARTCESQSHRFKGLCISKSNCASVCHTEGFNGGHCRGFRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = +2

Query  20   LGRNT-----ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCI  184
            +G NT     I +A A KCE PS KF+G C R   C S+C TEGF  G+C+G+R RC C 
Sbjct  16   IGYNTETQGPITMALARKCESPSLKFRGPCSRDANCASVCLTEGFTGGECKGLRHRCFCT  75

Query  185  KNC  193
            ++C
Sbjct  76   RDC  78



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  20   LGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +    ++  E   CE  S +FKG C RS  C S+C+ EGFPDG+C G+R RCMC K C
Sbjct  20   IASEEMVAVEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  77



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L  ATE+G  TI  AEA  CE  S +FKG C R   C ++C TEGF  G CRG R RC C
Sbjct  17   LVTATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFC  74

Query  182  IKNC  193
             + C
Sbjct  75   TRPC  78



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +VAEA  CE PS  FKGLC     C +IC+TEGF  G CRG R RC C K+C
Sbjct  22   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFRRRCFCTKHC  73



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+   L   T +VAEA  CE  S KFKG C   + C S+C+TE FP G CRG R RC C
Sbjct  11   IFVFLLLLVATEMVAEARTCESKSQKFKGACVSDRNCASVCQTERFPGGHCRGFRRRCFC  70

Query  182  IKNC  193
              +C
Sbjct  71   TTHC  74



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE+G     VAEA  CE  S +FKG C     C S+C+TEGFP G C+G R RC C+K 
Sbjct  20   ATEMGPK---VAEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKP  76

Query  191  C  193
            C
Sbjct  77   C  77



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++VAEA  CE  S +F G+C RS  C S+C TEGF  G CRG R RC C K C
Sbjct  28   VMVAEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGGHCRGFRRRCFCTKPC  80



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +V EA  CE  S +FKG C  S  C S+C TEGFP G CRG R RC C K+C
Sbjct  23   MVGEARTCESLSHRFKGACVSSTNCASVCHTEGFPGGNCRGFRRRCFCTKHC  74



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +V EA  CE PS +FKGLC     C  +C+TEGF  G CRG R RC C K+C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +V EA  CE PS +FKGLC     C  +C+TEGF  G CRG R RC C K+C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|AAP80654.1|AF479035_1 proteinase inhibitor Rgpi9, partial [Triticum aestivum]
Length=90

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + VAEA KCE  S +F GLC R   C ++CRTEGFP G+CRG   RC C  +C
Sbjct  37   VAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTHC  89



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +VAEA  CE PS  FKGLC     C +IC+TEGF  G CRG R RC C K+C
Sbjct  25   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>gb|EMT03364.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA67006.1| defensin [Triticum aestivum]
Length=81

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + VAEA KCE  S +F GLC R   C ++CRTEGFP G+CRG   RC C  +C
Sbjct  28   VAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTHC  80



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RC  175
            L + TE+G N  +VAEA  C   S  +KGLC   + C ++CRTEGF +G CRG  F  RC
Sbjct  17   LLVVTEMGAN--MVAEARSCISKSFTYKGLCVHDRNCANVCRTEGFVEGHCRGFAFGSRC  74

Query  176  MCIKNC  193
             C K C
Sbjct  75   FCYKPC  80



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE G    +VAEA  CE  S +FKG+C R+  C +IC+TEGF  G CRG+R RC C   
Sbjct  20   ATETG---PMVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTMY  76

Query  191  C  193
            C
Sbjct  77   C  77



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +VAE   CE  S +FKG C     C ++C+TEGFP G CRG+R RC C K+C
Sbjct  24   MVAEGRTCESQSNRFKGTCVSKSNCAAVCQTEGFPGGNCRGLRRRCFCTKHC  75



>ref|XP_010228361.1| PREDICTED: defensin Tk-AMP-D1.1-like [Brachypodium distachyon]
Length=76

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   RNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            R  + VA A +C  PS KF G+C R   C +I  TEGF  G+C GIR RC C KNC
Sbjct  21   RTLVQVALARECGSPSHKFHGMCTRDSNCANIWLTEGFKTGKCVGIRHRCFCYKNC  76



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L M T++G   I+  EA  CE PS +FKG C   + C S+C TEGF  G CRG+R RC C
Sbjct  17   LVMDTKMGPMRII--EARICESPSQRFKGPCLTDRNCASVCETEGFTGGDCRGLRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKEC  78



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 3/61 (5%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE+G      AEA  C+  S +FKG+C R   C ++C+TEGF  G CRG   RC C K+
Sbjct  20   ATEMGPK---AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKH  76

Query  191  C  193
            C
Sbjct  77   C  77



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            L+AE   CE  S KFKG C     C S+C+TEGFP G CRG R RC C K+C
Sbjct  27   LLAEGRTCESQSRKFKGTCLSKTNCASVCQTEGFPGGNCRGFRRRCFCTKHC  78



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  29   NTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +T ++AEA  CE  S +FKGLC     C S+C TEGF  G CRG R RC C ++C
Sbjct  20   STGMIAEARTCESQSRRFKGLCFSKSNCGSVCHTEGFSGGHCRGFRRRCFCTRHC  74



>ref|XP_008389118.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=87

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 39/71 (55%), Gaps = 7/71 (10%)
 Frame = +2

Query  2    LFMATELG-------RNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRG  160
            L +ATE+G         +  V E   CE  SGKFKGLC  S  C+  C+ E F  G+CRG
Sbjct  17   LLVATEMGTMGVEARSKSSKVVEERTCEAASGKFKGLCFSSNNCKHTCKREQFTGGKCRG  76

Query  161  IRFRCMCIKNC  193
             R RCMC K C
Sbjct  77   FRRRCMCNKKC  87



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+   T +VAEA  CE  S +FKG C     C S+CRTE F  G CRG R RC C
Sbjct  17   LLVATEMMGPT-MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFC  75

Query  182  IKNC  193
             K+C
Sbjct  76   TKHC  79



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  32   TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
             +  AE  +CE  S KFKG C R   C S+CR EGF  G CRG R RC C +NC
Sbjct  21   AVKTAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MATE+G   + +AEA  CE  S +FKG C R   C S+C TE F  G C G R RC C
Sbjct  17   LVMATEMG--PMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+   T +VAEA  CE  S +FKG C     C S+CRTE F  G CRG R RC C
Sbjct  17   LLVATEMMGPT-MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFC  75

Query  182  IKNC  193
             K+C
Sbjct  76   TKHC  79



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+     +V EA  CE  S +FKG C     C S+C+TEGF  G CRG R RC C
Sbjct  17   LLVATEM---EPMVVEARTCESQSQRFKGACVSKTNCASVCQTEGFHGGHCRGFRRRCFC  73

Query  182  IKNC  193
             K+C
Sbjct  74   TKHC  77



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G    +VAEA  CE  S +FKG C     C S+CRTEGF  G CRG   RC C
Sbjct  17   LLIATEMG--PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRCFC  74

Query  182  IK  187
             K
Sbjct  75   TK  76



>gb|AAL14240.1| proteinase inhibitor [Musa acuminata AAA Group]
Length=49

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  47   EAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            E+  CE  S +FKG C RS  C S+C+ EGFPDG+C G+R RCMC K C
Sbjct  1    ESRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  49



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++AE   CE  S KFKG C     C S+C+TEGFP G CRG R RC C K+C
Sbjct  27   MLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            + +A+E+     ++ EA  CE  S KFKG C R+  C ++C+TEGF  G+CRG R RC C
Sbjct  17   IVVASEMA---TMMVEARTCESQSHKFKGPCLRASNCANVCKTEGFHGGKCRGFRRRCFC  73

Query  182  IKNC  193
             K+C
Sbjct  74   TKHC  77



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++AE   CE  S KFKG C     C S+C+TEGFP G CRG R RC C K+C
Sbjct  27   MLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 4/66 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCR--GIRFRC  175
            + +ATE+G  T  VAEA  C   S +FKG+C  S  C ++CRTE FPDG+C+  G+  +C
Sbjct  17   ILVATEMG--TTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKC  74

Query  176  MCIKNC  193
             C K C
Sbjct  75   FCKKVC  80



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MATE+G   + +AEA  CE  S +FKG C R   C S+C TE F  G C G R RC C
Sbjct  17   LVMATEMG--PMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            MATE+G  TI  AEA  CE    +FKG C R   C ++C TEGF  G CRG+R RC C +
Sbjct  19   MATEMGPMTI--AEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGDCRGLRRRCFCTR  76

Query  188  NC  193
             C
Sbjct  77   PC  78



>gb|AIA66989.1| defensin [Triticum aestivum]
Length=82

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIK  187
            TE+G  T+ +AEA  C   S KFKG C  S  C ++CRTE FPDG+C    F  +C C +
Sbjct  21   TEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  80

Query  188  NC  193
             C
Sbjct  81   AC  82



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L M+TE+G   + + EA  CE  S +FKG C   K C S+C TE F  G CRG R RC C
Sbjct  2    LVMSTEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFC  59

Query  182  IKNC  193
             K C
Sbjct  60   TKPC  63



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA KCE  S +FKG C     C+++C  EGF  G CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARKCESKSHRFKGKCLSETNCKNVCHNEGFTGGNCRGFRRRCFC  73

Query  182  IKNC  193
             +NC
Sbjct  74   TRNC  77



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 4/63 (6%)
 Frame = +2

Query  5    FMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCI  184
            F+A E+    ++  +A  C+ PS  F+GLC  ++ C + CR EGFPDG C+G+R RC C 
Sbjct  12   FVAEEM----VVHVDARMCDTPSRLFRGLCLINRNCDNTCRVEGFPDGHCKGLRRRCFCS  67

Query  185  KNC  193
            + C
Sbjct  68   RPC  70



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MATE+G   I+  EA  CE  S +FKG C   K C S+C TE F  G CRG R RC C
Sbjct  17   LVMATEMGPTRIV--EARHCESLSHRFKGPCVSDKNCASVCETERFSGGNCRGFRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G    +VAEA  CE  S +FKG C     C S+C  E F  G CRG R RC C
Sbjct  17   LLVATEMG--PTMVAEARDCESQSHRFKGPCVSDTNCASVCHGEKFSGGHCRGFRRRCFC  74

Query  182  IKNC  193
             K+C
Sbjct  75   TKHC  78



>gb|ACV84381.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCI  184
            ATE+G  T  VAEA  C   S  FKG C  S  C ++CRTE FPDG+C    F  +C C 
Sbjct  20   ATEMGATTTKVAEARDCVSQSHNFKGACLSSSNCPAVCRTENFPDGECHTPHFERKCFCK  79

Query  185  KNC  193
            + C
Sbjct  80   RPC  82



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +V +A  CE PS  FKGLC     C  +C+TEGF  G CRG R RC C K+C
Sbjct  22   MVTDARTCESPSRHFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            + MATE+G   + + EA  CE  S +FKG C   K C S+C TE F  G CRG R RC C
Sbjct  17   IVMATEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            + MATE+G   + +AEA  CE  S +FKG C R   C S+C TE F  G C G R RC C
Sbjct  17   IVMATEMG--PMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>ref|XP_006367122.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=71

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  44   AEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
             EA  CE PS +FKGLC  +  CR +C TE F  G C G+R RC+C K C
Sbjct  22   VEAKTCESPSRRFKGLCFNTWKCRFVCSTERFSSGHCNGLRHRCICTKQC  71



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MATE+G   + + EA  CE  S +FKG C   + C S+C TE F  G CRG R RC C
Sbjct  17   LVMATEMG--PMRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>gb|ACV84384.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIK  187
            TE+G  T+ +AEA  C   S KFKG C  S  C ++CRTE FPDG+C    F  +C C +
Sbjct  21   TEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  80

Query  188  NC  193
             C
Sbjct  81   PC  82



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L M+TE+G   + + EA  CE  S +FKG C   K C S+C TE F  G CRG R RC C
Sbjct  17   LVMSTEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>gb|ACM50880.1| defensin [Capsicum frutescens]
Length=53

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++AEA  CE  SG FKGLC  S+ C  +CR EGF DG C G R +C C K C
Sbjct  1    MMAEAKICEALSGNFKGLCLSSRNCGKVCRREGFTDGSCIGFRLQCFCTKPC  52



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            +ATE+G     +AEA  CE  S KFKG C     C ++C+TEGF  G CRG+R RC C +
Sbjct  19   VATEIGSK---MAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTR  75

Query  188  NC  193
            +C
Sbjct  76   HC  77



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 4/66 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCR--GIRFRC  175
            + +ATE+G  T  VAEA  C   S +FKG+C  S  C ++C+TE FPDG+C+  G+  +C
Sbjct  17   ILVATEMG--TTQVAEARHCLSQSHRFKGMCVSSNNCANVCKTENFPDGECKSHGLERKC  74

Query  176  MCIKNC  193
             C K C
Sbjct  75   FCKKLC  80



>ref|NP_001052199.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAF14113.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAG92412.1| unnamed protein product [Oryza sativa Japonica Group]
Length=111

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
             A+A +CE PS +FKG+C     C ++C TEGF  G+C G R RCMC K+C
Sbjct  61   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  111



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + VA A KC+  S KFKG C R + C ++C TEGF  G+CRG+R RC C ++C
Sbjct  26   VTVALARKCQSKSFKFKGPCSRDENCATVCLTEGFTSGKCRGLRRRCFCTRDC  78



>gb|EMT11359.1| Defensin-like protein P322 [Aegilops tauschii]
Length=76

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   RNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +  + VA A +C  PS KFKGLC     C S+C TE FP G+C GIR RC+C + C
Sbjct  21   QGAVQVALARECTSPSHKFKGLCVSDTNCASVCLTERFPGGKCDGIRQRCLCTEKC  76



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRC  175
            + +   +G   + VAE   C+ PSGKFKG C  S  C+++CRTEGFP G C       +C
Sbjct  17   VLLVITIGMMAVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPSGSCDFHVTSRKC  76

Query  176  MCIKNC  193
             C K C
Sbjct  77   YCYKPC  82



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 3/60 (5%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            TE+G   + VAEA  CE  S KFKG C R   C S+C++EGF  G CRG+  RC C   C
Sbjct  12   TEMG---LKVAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+   +     +VAEA  CE  S KFKG C     C S+C+TE F  G CRG R RC C
Sbjct  13   VFLLLLVATGPSMVAEARTCESQSHKFKGPCASDHNCASVCQTERFSGGHCRGFRRRCFC  72

Query  182  IKNC  193
              +C
Sbjct  73   TTHC  76



>gb|AHA50471.1| defensin-like protein 4 [Citrullus lanatus]
Length=75

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +V EA  CE  S  FKGLC  S  C +IC+TEGF  G CRG R RC C K+C
Sbjct  23   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGHCRGFRRRCFCTKHC  74



>gb|EEC76838.1| hypothetical protein OsI_14993 [Oryza sativa Indica Group]
 gb|EEE60570.1| hypothetical protein OsJ_13935 [Oryza sativa Japonica Group]
Length=72

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
             A+A +CE PS +FKG+C     C ++C TEGF  G+C G R RCMC K+C
Sbjct  22   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  72



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
             AEA  C+  S +FKG+C R   C ++C+TEGF  G CRG   RC C K+C
Sbjct  28   AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  78



>sp|P81571.1|DEFD2_SPIOL RecName: Full=Defensin D2; AltName: Full=Antimicrobial peptide 
D2; AltName: Full=So-D2, partial [Spinacia oleracea]
Length=52

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +  + KC+ PS  FKG+C R   C + CR EG+P G C+GIR RCMC K C
Sbjct  2    IFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC  52



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C     C+++C  EGF  G CRG+R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESKSHRFKGACLSETNCKNVCHNEGFRGGNCRGLRRRCFC  73

Query  182  IKNC  193
             +NC
Sbjct  74   TRNC  77



>gb|ABK23404.1| unknown [Picea sitchensis]
 gb|ABK23503.1| unknown [Picea sitchensis]
 gb|ABR17883.1| unknown [Picea sitchensis]
 gb|ACN40306.1| unknown [Picea sitchensis]
Length=83

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRC  175
            + +   +G   + +AEA  C+ PSGKFKG+C  S  C+++C+TEGFP G C       +C
Sbjct  17   VLLVISIGMIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKC  76

Query  176  MCIKNC  193
             C K C
Sbjct  77   YCSKPC  82



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +VAEA  CE  S +F+GLC     C S+C TEGF  G CRG R RC C ++C
Sbjct  1    MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            +A E+G     VA+A  C+  S +FKG C R+  C +ICRTEGF  G C+G R RC C K
Sbjct  18   VAAEMGPK---VADARTCQSASHRFKGTCVRNSNCANICRTEGFQGGNCQGFRRRCFCTK  74

Query  188  NC  193
            +C
Sbjct  75   HC  76



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +A ++   T   AE  +CE  S KFKG C     C S+CR EGF  G CRG+R RC C
Sbjct  14   LVLAADVAVKT---AEGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIGGDCRGVRHRCFC  70

Query  182  IKNC  193
             +NC
Sbjct  71   TRNC  74



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  C   S +FKG C     C ++C  EGFP G CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCASQSQRFKGKCVSDTNCENVCHNEGFPGGDCRGFRRRCFC  73

Query  182  IKNC  193
             +NC
Sbjct  74   TRNC  77



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            +ATE+G     +AEA  CE  + KFKG C     C ++C+TEGF  G CRG+R RC C +
Sbjct  19   VATEIGSK---MAEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTR  75

Query  188  NC  193
            +C
Sbjct  76   HC  77



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++AE   CE  S KFKG C     C ++C+TEGF  G C GIR RC C K+C
Sbjct  27   MLAEGRTCEAHSRKFKGHCHSKSNCATVCQTEGFQGGHCHGIRRRCFCTKHC  78



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    LFMATELGRNTIL-VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCM  178
            +FM   L   T L  AE   CE  S KFKG C     C ++C+TEGFP G+CRG R RC 
Sbjct  11   IFMVLMLLMATGLEPAEGRTCESQSHKFKGTCASGTNCANVCKTEGFPGGKCRGFRRRCF  70

Query  179  CIKNC  193
            C  +C
Sbjct  71   CTTHC  75



>gb|EMT00351.1| Defensin-like protein [Aegilops tauschii]
Length=82

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 2/63 (3%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCI  184
            ATE+G  T  VAEA  C   S KFKG C  S  C  +CRTE FPDG+C  + +  +C C 
Sbjct  20   ATEMGATTTKVAEARDCLSQSFKFKGACLSSSNCAGVCRTENFPDGECHRQHLERKCFCK  79

Query  185  KNC  193
            K C
Sbjct  80   KPC  82



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + EA  CE  S KFKG C     C S+C+TEGF  G CRG+R RC C +NC
Sbjct  23   MTEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 3/62 (5%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            M +E+G     VAEA  CE  S KF+G C R   C ++C+TEGF  G CRG+R RC C +
Sbjct  19   MPSEMGTK---VAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRGVRRRCFCTR  75

Query  188  NC  193
             C
Sbjct  76   LC  77



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C     CR++C  EGF  G CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESKSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>emb|CAA65045.1| defensin [Capsicum annuum]
Length=75

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+   L   T ++AEA  CE  SG FKGLC  S+ C ++CR EGF  G CRG   +C C
Sbjct  11   IFLMMMLVFATDMMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTSGVCRGFPLKCFC  70

Query  182  IK  187
             K
Sbjct  71   RK  72



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C  S  C ++C  EGF  G+CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRVRCYC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|AHA50473.1| defensin-like protein 6 [Citrullus lanatus]
Length=74

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +V EA  CE  S  FKGLC  S  C +IC+TEGF  G CRG R RC C K+C
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKHC  73



>gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum]
Length=75

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            V E   CE  S +FKG+C     C  +CR EGF DG CRG R RC C +NC
Sbjct  25   VVEGRICESKSHRFKGVCLSDHNCGLVCRNEGFLDGWCRGFRHRCFCTRNC  75



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            +++E+G     V EA  CE  S +FKG C R+  C ++C+TEGF  G CRG+R RC C K
Sbjct  19   ISSEMG---TKVVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTK  75

Query  188  NC  193
             C
Sbjct  76   RC  77



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = +2

Query  20   LGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            L    ++  E   CE  S +FKG+C     C S+C  EGFP G CRG R RC C K C
Sbjct  16   LASQMMVQTEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPGGNCRGFRRRCFCKKRC  73



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +V EA KC   S +FKG C     C S+C+TEGFP G C+G+R RC C  +C
Sbjct  21   MVGEARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGDCKGLRRRCFCETHC  72



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++AE   CE  S KFKG C     C S+C+TEGF  G CRG R RC C K+C
Sbjct  27   MLAEGRTCEAHSRKFKGTCLGKSNCASVCQTEGFHGGHCRGFRRRCFCTKHC  78



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+A+ +G  T+   EA  CE  S KF+GLC     C ++C  EGF  G+CRG R RC C
Sbjct  17   IFVASGMGPVTV---EARTCESKSHKFRGLCVSRHNCANVCHNEGFHGGKCRGFRRRCYC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            + +AT +G   ++  EA  CE  S  F G C  S  C ++C  EGF DG CRG R RC+C
Sbjct  16   MILATVMG---LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLC  72

Query  182  IKNC  193
             + C
Sbjct  73   TRPC  76



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            + +AT +G   ++  EA  CE  S  F G C  S  C ++C  EGF DG CRG R RC+C
Sbjct  16   MILATVMG---LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLC  72

Query  182  IKNC  193
             + C
Sbjct  73   TRPC  76



>emb|CAA62761.1| putative gamma-thionin protein [Picea abies]
Length=83

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRC  175
            + +   +G   + +AE   C+ PSGKFKG+C  S  C+++C+TEGFP G C       +C
Sbjct  17   VLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKC  76

Query  176  MCIKNC  193
             C K C
Sbjct  77   YCSKPC  82



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C     C+++C  EGF  G CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESKSHRFKGTCLSESNCKNVCHNEGFQGGNCRGFRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|ABK25062.1| unknown [Picea sitchensis]
Length=83

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRC  175
            + +   +G   + +AE   C+ PSGKFKG+C  S  C+++C+TEGFP G C       +C
Sbjct  17   VLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKC  76

Query  176  MCIKNC  193
             C K C
Sbjct  77   YCSKPC  82



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 3/60 (5%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            TE+G     VAEA  CE  S KFKG C R   C S+C++EGF  G CRG+  RC C   C
Sbjct  12   TEMGPK---VAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|AAR84643.1| defensin [Picea glauca]
Length=83

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCIKN  190
             +G   + +AEA  C+ PSGKFKG+C  S  C+++C+TEGFP G C       +C C K 
Sbjct  22   SIGMMQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKP  81

Query  191  C  193
            C
Sbjct  82   C  82



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            V EA  CE  S +FKG C R+  C ++C+TEGF  G CRG+R RC C K C
Sbjct  28   VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  78



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C     CR++C  EGF  G CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESQSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRRRCFC  73

Query  182  IKNC  193
             + C
Sbjct  74   TRYC  77



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +AT++G   + +AEA  CE  S +FKG C R   C S+C TE F  G C G R RC C
Sbjct  13   LVVATKMG--PMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFC  70

Query  182  IKNC  193
             K C
Sbjct  71   TKPC  74



>gb|AIA67004.1| defensin [Triticum aestivum]
Length=84

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCR--GIRFRCMCI  184
            ATE+G   +  A    CE  S +++G C R   C+ +C TEGFP G+C+  G   +C+C 
Sbjct  21   ATEMGTTRVAEARHRHCESQSHRYRGACWRDDNCKHVCNTEGFPSGKCKFHGFESKCVCT  80

Query  185  KNC  193
            K C
Sbjct  81   KPC  83



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 4/66 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCR--GIRFRC  175
            + +ATE+G  T  VAEA  C   S +FKG+C  S  C ++CRTE FPDG+C+  G+  +C
Sbjct  17   ILVATEMG--TTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKC  74

Query  176  MCIKNC  193
             C K C
Sbjct  75   FCKKPC  80



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MATE+G   + + EA  CE  S +FKG C   + C S+C TE F  G CRG R  C C
Sbjct  17   LVMATEMG--PMRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRLCFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C  S  C ++C  EGF  G+CRG R RC C
Sbjct  16   IFVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRRRCYC  72

Query  182  IKNC  193
             ++C
Sbjct  73   TRHC  76



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C  +  C ++C  EGF  G CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 34/64 (53%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            LFM    G   + V EA  CE  S  F G C  S  C ++C  EGF DG CRG R RC+C
Sbjct  14   LFMILATGIGPVTV-EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLC  72

Query  182  IKNC  193
             + C
Sbjct  73   TRPC  76



>gb|AIA66994.1| defensin [Triticum aestivum]
Length=82

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 35/64 (55%), Gaps = 2/64 (3%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMC  181
            +ATE+G      AEA  C   S KFKG C  S  C  +CRTE FPDG+C    F  +C C
Sbjct  19   VATEMGTTRTKTAEARDCLSQSHKFKGACLSSSNCAGVCRTENFPDGECHTHNFARKCFC  78

Query  182  IKNC  193
             + C
Sbjct  79   KRAC  82



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C  S  C ++C  EGF  G+CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRRRCYC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MAT   R    + EA  CE  S +FKG C   K C S+C TEGF  G CRG+R RC C
Sbjct  17   LVMATGPTR----IVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGLRRRCFC  72

Query  182  IKNC  193
             + C
Sbjct  73   TRPC  76



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C     C+++C  EGF  G CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESKSHRFKGKCFSETNCKNVCHNEGFTGGNCRGFRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            + EA  CE  S ++KG C R   C ++C+TEGF  G CRG R RC C K+C
Sbjct  23   LTEARTCESQSHRYKGPCVRKNNCANVCKTEGFSGGHCRGFRRRCFCAKHC  73



>gb|EMT06279.1| Defensin-like protein 2 [Aegilops tauschii]
Length=82

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 35/64 (55%), Gaps = 2/64 (3%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMC  181
            +ATE+G      AEA  C   S KFKG C  S  C  +CRTE FPDG+C    F  +C C
Sbjct  19   VATEMGTTRTKTAEARDCLSQSHKFKGACLSSSNCAGVCRTENFPDGECHTHNFARKCFC  78

Query  182  IKNC  193
             + C
Sbjct  79   KRAC  82



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +2

Query  44   AEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
             EA  CE  S  FKG C     C S+CRTEGF  G CRG R RC C +NC
Sbjct  27   VEARTCESQSHHFKGNCLSDTNCGSVCRTEGFTGGNCRGFRRRCFCTRNC  76



>ref|XP_007204040.1| hypothetical protein PRUPE_ppa021088mg [Prunus persica]
 gb|EMJ05239.1| hypothetical protein PRUPE_ppa021088mg [Prunus persica]
Length=73

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  59   CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            CE  S KFKGLC RS  C  IC+ EGF +G+C G R RC C K C
Sbjct  29   CESLSTKFKGLCFRSSNCADICKKEGFLEGKCAGFRLRCTCTKKC  73



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   RNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +  ++ AEA  C   S  FKG C R   C S+C+TEGFP G+C+G R RC C K C
Sbjct  19   QEMMVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L ++TE+    +   EA  C+  S  FKG+C     C ++C+TEGF  G C G R RC C
Sbjct  17   LLVSTEMQPTHVEEPEARTCDSQSHSFKGVCWIKHNCANVCKTEGFTGGHCHGFRRRCFC  76

Query  182  IKNC  193
             K C
Sbjct  77   SKPC  80



>gb|AIC35288.1| defensin 4 [Pinus sylvestris]
Length=83

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCIKN  190
             +G   + VAE   C+ PSGKFKG C  S  C+++CRTEGFP G C       +C C K 
Sbjct  22   SIGMMEVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKP  81

Query  191  C  193
            C
Sbjct  82   C  82



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G   I VAEA  C+  S  FKG C    +C  +C+TEGF  GQC G+R  C C
Sbjct  17   LLVATEMG--PIKVAEARICDSQSNTFKGPCVIDHSCAIVCQTEGFTGGQCEGLRRICFC  74

Query  182  IKNC  193
             K C
Sbjct  75   TKPC  78



>ref|XP_006301968.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
 gb|EOA34866.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
Length=72

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +  E   CE  S  F G C     C ++C TEGFPDG CRG R RCMC + C
Sbjct  21   VTVEGRTCESSSNLFSGPCLSESNCANVCNTEGFPDGDCRGFRRRCMCTRPC  72



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +  A+++G   ++ +EA  CE PS  FKGLC   + C ++C TEGF  G+C G R RC C
Sbjct  15   VIFASDMG---VMKSEARLCESPSHSFKGLCFNDRNCANVCLTEGFTGGKCEGARHRCFC  71

Query  182  IKNC  193
               C
Sbjct  72   TIIC  75



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 36/61 (59%), Gaps = 3/61 (5%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            A+E+G   +  AEA  CE  S +FKG C     C ++C+TEGF  G CRG R RC C K 
Sbjct  19   ASEMG---LRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKR  75

Query  191  C  193
            C
Sbjct  76   C  76



>gb|ABK21016.1| unknown [Picea sitchensis]
 gb|ABK23113.1| unknown [Picea sitchensis]
 gb|ACN39802.1| unknown [Picea sitchensis]
 gb|ACN40104.1| unknown [Picea sitchensis]
Length=83

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCIKN  190
             +G   + VAEA  C+ PS KFKG C  S  C+++CRTEGFP G C       +C C K 
Sbjct  22   SIGMMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKP  81

Query  191  C  193
            C
Sbjct  82   C  82



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L ++TE+G  +   AEA  CE  S  FKG C     C S+C+TEGF  G CRG+R +C C
Sbjct  17   LLLSTEMGPMSG-GAEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGDCRGLRRQCFC  75

Query  182  IKNC  193
             +NC
Sbjct  76   TRNC  79



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C  +  C ++C  EGF  G+CRG R RC C
Sbjct  17   VFIATGMGPVTV---EARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +V EA  CE  S  FKGLC  S  C +IC+TEGF  G CRG R RC C K C
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKPC  73



>gb|ADQ43197.1| unknown [Eutrema parvulum]
Length=72

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
 Frame = +2

Query  47   EAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            EA  CE PSGK+ G+C  +K C S+C +EGF  G C+ +  RC CIK C
Sbjct  26   EAKTCESPSGKYHGVCLNAKNCASVCPSEGFTGGHCKSL--RCYCIKTC  72



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +FKG C  +  C ++C  EGF  G+CRG R RC C
Sbjct  17   VFVATGMGPVTV---EARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|EMS49334.1| Defensin-like protein [Triticum urartu]
 gb|AIA66991.1| defensin [Triticum aestivum]
Length=82

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCIK  187
            TE+G  T  VAEA  C   S KFKG C  S  C ++CRTE FPDG+C  + +  +C C +
Sbjct  21   TEMGTTTTKVAEARDCLSQSFKFKGACLSSSNCAAVCRTEKFPDGECHRQHLERKCFCKR  80

Query  188  NC  193
             C
Sbjct  81   PC  82



>gb|ABK23037.1| unknown [Picea sitchensis]
 gb|ABR16956.1| unknown [Picea sitchensis]
Length=83

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCIKN  190
             +G   + VAEA  C+ PS KFKG C  S  C+++CRTEGFP G C       +C C K 
Sbjct  22   SIGMMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKP  81

Query  191  C  193
            C
Sbjct  82   C  82



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 3/60 (5%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            TE+G      AEA  CE  S KFKG C R   C S+C++EGF  G CRG+  RC C   C
Sbjct  12   TEMGPK---AAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 3/60 (5%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            TE+G   + VA A  CE  S KFKG C R   C S+C +EGF  G CRG+  RC C   C
Sbjct  12   TEMG---LKVAXARDCESQSHKFKGTCIRXSNCASVCXSEGFNGGHCRGVTRRCYCTAKC  68



>gb|ABW99097.1| defensin [Capsicum chinense]
Length=55

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++AEA  CE  SG FKGLC  S+ C ++CR EGF  G CRG   +C C K C
Sbjct  3    MMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTSGVCRGFPLKCFCRKPC  54



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +2

Query  44   AEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
             EA  CE  S  FKG C     C S+C TEGF  G CRG+R RC C +NC
Sbjct  27   VEARTCESKSHHFKGKCLSDTNCGSVCHTEGFTGGNCRGLRQRCFCTRNC  76



>gb|AIA66999.1| defensin [Triticum aestivum]
Length=82

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCI  184
            ATE+G  T+ VAEA  CE  S  FKG C     C S+C TE FP GQC    +  +C C 
Sbjct  22   ATEMG--TVKVAEARTCESQSHNFKGACFSDTNCASVCHTENFPRGQCHQHHVERKCYCE  79

Query  185  KNC  193
            ++C
Sbjct  80   RDC  82



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGK-CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCM  178
             FM   L  + ++V   G+ CE  S +FKG+C   + C S+C  EGF  G CRG R RC 
Sbjct  81   FFMLLILLASQMMVQTEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGNCRGFRRRCF  140

Query  179  CIKNC  193
            C ++C
Sbjct  141  CTRHC  145



>gb|AIA66992.1| defensin [Triticum aestivum]
Length=82

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 34/62 (55%), Gaps = 2/62 (3%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIK  187
            TE+G     VAEA  C   S KFKG C  S  C  +CRTE FPDG+C    F  +C C +
Sbjct  21   TEIGATRTKVAEARDCLSQSHKFKGACLSSSNCAGVCRTENFPDGECHTHNFARKCFCKR  80

Query  188  NC  193
             C
Sbjct  81   AC  82



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 35/64 (55%), Gaps = 4/64 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MAT      + + EA  CE  S +FKG C   K C S+C TEGF  G CRG R RC C
Sbjct  17   LVMAT----GPMKIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFC  72

Query  182  IKNC  193
             + C
Sbjct  73   TRPC  76



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGK-CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCM  178
             FM   L  + ++V   G+ CE  S +FKG+C     C S+C  EGF  G+CRG R RC 
Sbjct  9    FFMLLILLSSQMVVQTEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGKCRGFRRRCF  68

Query  179  CIKNC  193
            C ++C
Sbjct  69   CTRHC  73



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 35/64 (55%), Gaps = 4/64 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MAT      + + EA  CE  S +FKG C   K C S+C TEGF  G CRG R RC C
Sbjct  13   LVMAT----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFC  68

Query  182  IKNC  193
             + C
Sbjct  69   TRPC  72



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +VAE   C+  S +FKG C     C ++C+TEGF  G CRG R RC C K+C
Sbjct  26   MVAEGRTCDSQSHRFKGSCVSKSNCATVCQTEGFRGGHCRGFRRRCFCTKHC  77



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 35/64 (55%), Gaps = 4/64 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L MAT      + + EA  CE  S +FKG C   K C S+C TEGF  G CRG R RC C
Sbjct  17   LVMAT----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFC  72

Query  182  IKNC  193
             + C
Sbjct  73   TRPC  76



>ref|XP_007226630.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
 gb|EMJ27829.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
Length=87

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 7/71 (10%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGK-------CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRG  160
            L +A E+G   +   +A K       C+  S KFKG+C  + +C   C++EGF  GQCRG
Sbjct  17   LLVAAEMGPMAVEGRDAKKVEPKKKTCDSQSQKFKGMCFLTSSCVQSCKSEGFTGGQCRG  76

Query  161  IRFRCMCIKNC  193
             R RC C KNC
Sbjct  77   FRRRCFCSKNC  87



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L   T +G  T+   EA  CE  S  F G C  +  C ++C  EGFPDG CRG R RC+C
Sbjct  18   LVATTGIGPVTV---EARTCETSSQLFNGPCLSTTNCANVCHNEGFPDGDCRGFRRRCLC  74

Query  182  IKNC  193
             + C
Sbjct  75   SRPC  78



>gb|ABK20960.1| unknown [Picea sitchensis]
 gb|ABK25298.1| unknown [Picea sitchensis]
Length=83

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCIKN  190
             +G   + +AE   C+ PSGKFKG+C  S  C+++C+TEGFP G C       +C C K 
Sbjct  22   SIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKP  81

Query  191  C  193
            C
Sbjct  82   C  82



>ref|XP_003575412.1| PREDICTED: defensin Tm-AMP-D1.2-like [Brachypodium distachyon]
Length=80

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 4/62 (6%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCR--GIRFRCMCIK  187
            TE+G  T  VAEA  C   S KFKG C RS  C ++C+TE FPDG+C+  G+  +C C +
Sbjct  21   TEMG--TTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKR  78

Query  188  NC  193
             C
Sbjct  79   VC  80



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  ++   EA  CE  S +FKG C     C ++C  EGF  G+CRG+R RC C
Sbjct  17   IFVATGMGPVSV---EARTCESQSHRFKGPCVSDNNCANVCHNEGFGGGKCRGLRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|AAG51654.1|AC018908_20 unknown protein; 87272-87105 [Arabidopsis thaliana]
Length=55

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++  EA  CE  S  F G C  S  C ++C  EGF DG CRG R RC+C + C
Sbjct  3    LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  55



>emb|CDM85870.1| unnamed protein product [Triticum aestivum]
 emb|CDM85874.1| unnamed protein product [Triticum aestivum]
Length=74

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE  +  + VA A  C+  S KFKG+C R   C S+C TEGFP G+C+G  F C C K+
Sbjct  17   ATE-DQGPVQVALARDCKSQSYKFKGMCVRDDNCASVCLTEGFPRGKCKG--FACSCYKD  73

Query  191  C  193
            C
Sbjct  74   C  74



>ref|XP_010229304.1| PREDICTED: defensin Tk-AMP-D1.1-like [Brachypodium distachyon]
Length=75

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +  A+A  C+  SGKF GLC    +C + C TEGF  G+C GI  RCMC  +C
Sbjct  23   VAPAQAKDCQTASGKFHGLCFLDSSCTNACITEGFTSGECEGIHRRCMCKTSC  75



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            LF+AT +G  T+   EA  CE  S +F+G C     C ++C  EGF  G+CRG R RC C
Sbjct  17   LFVATGMGPVTV---EARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>ref|XP_010064921.1| PREDICTED: uncharacterized protein LOC104452094 [Eucalyptus grandis]
Length=135

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +2

Query  23   GRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            G   +   E   CE  S KF GLC   +TC  +C+ E F DG+CRG R RC C K C
Sbjct  79   GEEVVWRIEGRMCESQSHKFHGLCMSDRTCVVVCKEEDFDDGKCRGFRHRCFCRKPC  135



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  ++   EA  CE  S +FKG C     C ++C  EGF  G+CRG+R RC C
Sbjct  17   IFVATGMGPVSV---EARTCESQSHRFKGPCVSENNCANVCHNEGFGGGKCRGLRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|EMS52277.1| Defensin Tk-AMP-D1.1 [Triticum urartu]
Length=77

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE    ++ VA A  CE  S KF G C     C ++C+TEGF  G+C G++  C C K+
Sbjct  17   ATEEQGGSVQVALARDCESDSHKFHGACFSDTNCANVCQTEGFTAGKCVGVQRHCHCTKD  76

Query  191  C  193
            C
Sbjct  77   C  77



>ref|XP_008389117.1| PREDICTED: defensin Tk-AMP-D1.1-like [Malus domestica]
Length=87

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 7/71 (10%)
 Frame = +2

Query  2    LFMATELGRNTI-LVAEAGK------CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRG  160
            L  ATE+G  ++  + E+ K      CEVPS  FKGLC  S  C+  CR E F  G+C G
Sbjct  17   LLAATEMGPISVEAMTESNKAVEGKICEVPSTLFKGLCFSSNNCKHTCRKEQFTRGKCSG  76

Query  161  IRFRCMCIKNC  193
            +   CMC K C
Sbjct  77   LTRTCMCTKKC  87



>gb|EMT22729.1| Defensin Tk-AMP-D2 [Aegilops tauschii]
Length=76

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMC  181
            +ATE+G  T   AEA  CE  S KFKG C     C ++CRTE FP GQC    +  +C C
Sbjct  15   VATEMG--TTKTAEARTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNTHHVERKCYC  72

Query  182  IKNC  193
             ++C
Sbjct  73   ERDC  76



>gb|EMT03363.1| hypothetical protein F775_43918 [Aegilops tauschii]
Length=82

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ELG   ++VAEA  CE  S +F+G C R   C ++CRTEGF DG+CRG      C  +C
Sbjct  23   ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGECRGFPPPPFCTTHC  80



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+A+ +G  T+   EA  CE  S KF+G C     C ++C  EGF  G+CRG R RC C
Sbjct  17   IFVASGMGPVTV---EARTCESKSHKFRGPCVSRHNCANVCHNEGFHGGKCRGFRRRCYC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 35/64 (55%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            + +AT +G   +   EA  CE  S  F G C  S  C ++C  EGF DG CRG R RC+C
Sbjct  16   MILATVMGPVRV---EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLC  72

Query  182  IKNC  193
             + C
Sbjct  73   TRPC  76



>sp|A4L7R8.1|DEF2_PINSY RecName: Full=Defensin-2; Flags: Precursor [Pinus sylvestris]
 gb|ABO61349.1| defensin [Pinus sylvestris]
Length=83

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 2/60 (3%)
 Frame = +2

Query  20   LGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCIKNC  193
            +G   + VAE   C+ PS KFKG C  S  C+++CRTEGFP G C       +C C K C
Sbjct  23   IGMMEVQVAEGRMCKTPSAKFKGYCVSSTNCKNVCRTEGFPTGSCDFHITSRKCYCYKPC  82



>ref|NP_001148158.1| LOC100281766 precursor [Zea mays]
 ref|NP_001152925.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG25111.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG29960.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG46032.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG49139.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACN27540.1| unknown [Zea mays]
 tpg|DAA60145.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=78

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +2

Query  5    FMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCI  184
            +  T+ G  T++ A   KCE  S +FKG C R   C ++C TEGF  G C+G+R RC C 
Sbjct  18   YTGTQGGPVTMVSAR--KCESQSFRFKGPCSRDANCANVCLTEGFTGGVCKGLRHRCFCT  75

Query  185  KNC  193
            ++C
Sbjct  76   RDC  78



>ref|XP_009357110.1| PREDICTED: defensin Ec-AMP-D1-like [Pyrus x bretschneideri]
Length=81

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  59   CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            CE PS K++G+C RS  C + C+ EGF  G+C G R RC+C K C
Sbjct  37   CESPSHKYRGICFRSSNCATTCKKEGFMGGKCTGFRMRCVCTKKC  81



>gb|EMT26158.1| Defensin-like protein [Aegilops tauschii]
Length=74

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            ATE  +  + VA A  C+  S KFKG+C R   C S+C TEGFP G+C+G  F C C K+
Sbjct  17   ATE-DQGPVQVALARDCKSQSYKFKGMCVRDDNCASVCLTEGFPRGKCKG--FACSCHKD  73

Query  191  C  193
            C
Sbjct  74   C  74



>gb|ACG30752.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=80

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCR--GIRFRCMCI  184
            ATELG  T  VAEA  C   S +FKGLC  S  C ++C+TE FP G+CR  G   +C C 
Sbjct  20   ATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECRAEGATRKCFCK  77

Query  185  KNC  193
            K C
Sbjct  78   KIC  80



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  44   AEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            AEA  C   S  FKGLC  +  C ++C TEGF  G+C G+R RC C KNC
Sbjct  25   AEARLCWSESQAFKGLCFSNDNCATVCLTEGFTGGKCEGLRRRCFCSKNC  74



>gb|AIA67000.1| defensin [Triticum aestivum]
Length=84

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMC  181
            +ATE+G  T   AEA  CE  S KFKG C     C ++CRTE FP GQC    +  +C C
Sbjct  23   VATEMG--TTKTAEARTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNTHHVERKCYC  80

Query  182  IKNC  193
             ++C
Sbjct  81   ERDC  84



>gb|EMS64594.1| Defensin Tm-AMP-D1.2 [Triticum urartu]
Length=87

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 2/61 (3%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIKN  190
            E+G  T  VAEA  C   S  FKG C  S  C ++CRT+ FPDG+C    F  +C C + 
Sbjct  27   EMGATTTKVAEARDCVSQSHNFKGACLSSSNCAAVCRTDNFPDGECHTPHFERKCFCKRL  86

Query  191  C  193
            C
Sbjct  87   C  87



>emb|CEJ09690.1| Defensin protein [Zea mays]
Length=80

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCR--GIRFRC  175
            L +ATELG  T  VAEA  C   S +FKGLC  S  C ++C+TE FP G+C+  G   +C
Sbjct  17   LPVATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECKAEGATRKC  74

Query  176  MCIKNC  193
             C K C
Sbjct  75   FCKKIC  80



>emb|CDP10467.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  59   CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            CE PS +FKG C +   C ++C+TEGF  G+CRG+R RC C + C
Sbjct  57   CETPSKRFKGPCVKESNCAAVCQTEGFQGGKCRGLRRRCFCTRPC  101



>gb|KCW70075.1| hypothetical protein EUGRSUZ_F03380 [Eucalyptus grandis]
Length=74

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   RNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +  +   E   CE  S KF GLC   +TC  +C+ E F DG+CRG R RC C K C
Sbjct  19   QEVVWRIEGRMCESQSHKFHGLCMSDRTCVVVCKEEDFDDGKCRGFRHRCFCRKPC  74



>gb|AFW58880.1| low-molecular-weight cysteine-rich protein LCR70 [Zea mays]
Length=82

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCR--GIRFRC  175
            L  A+E+G  T  VAEA  C   S +F G C     C ++CRTEGFP G+CR  GI  +C
Sbjct  19   LLAASEMG--TTRVAEARHCTSQSHRFVGACMSKSNCENVCRTEGFPWGECRWHGIERKC  76

Query  176  MCIKNC  193
             C + C
Sbjct  77   HCKRIC  82



>sp|A4L7R7.1|DEF1_PINSY RecName: Full=Defensin-1; Flags: Precursor [Pinus sylvestris]
 gb|ABO61348.1| defensin [Pinus sylvestris]
Length=83

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +2

Query  20   LGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQC--RGIRFRCMCIKNC  193
            +G   + VAE   C+ PSGKFKG C  +  C+++CRTEGFP G C       +C C K C
Sbjct  23   IGMMQVQVAEGRMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPC  82



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (52%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +     +  ++  EA  C+  S  FKG C R   C  +CR EGF  G+C+G R RC C
Sbjct  12   LLLIVLASQEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFC  71

Query  182  IKNC  193
             K C
Sbjct  72   TKLC  75



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            +F+AT +G  T+   EA  CE  S +F+G C     C ++C  EGF  G+CRG R RC C
Sbjct  17   IFVATGMGPVTV---EARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRRRCFC  73

Query  182  IKNC  193
             ++C
Sbjct  74   TRHC  77



>ref|XP_010497013.1| PREDICTED: putative defensin-like protein 9 [Camelina sativa]
Length=82

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = +2

Query  23   GRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIKNC  193
            G   ++  +   CE  S  F G C + +TC+ +C +EGFPDG+C G  F  RCMC+K C
Sbjct  22   GVMKMVEGQPQMCETESINFTGFCSKWRTCKRVCMSEGFPDGKCNGDFFHSRCMCMKPC  80



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 35/63 (56%), Gaps = 2/63 (3%)
 Frame = +2

Query  5    FMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCI  184
             +A E+G    LV EA  CE  S KFKG C     C ++C +E F  G+CRG R RC C 
Sbjct  18   LLANEMG--GPLVVEARTCESQSHKFKGTCLSDTNCANVCHSERFSGGKCRGFRRRCFCT  75

Query  185  KNC  193
             +C
Sbjct  76   THC  78



>dbj|BAD25113.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ22207.1| hypothetical protein OsJ_05867 [Oryza sativa Japonica Group]
Length=92

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  35   ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++V +A  CE PS  FKGLC RS+ C + C  EG+ DG+C+ +  RC+C   C
Sbjct  28   VVVVQARLCEKPSSHFKGLCLRSQNCDNECMLEGYMDGKCKYLTRRCICSMEC  80



>ref|XP_011099999.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=82

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  44   AEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKN  190
            AE   C   S KFKG C +   C S+C+TEGF  G+CRG R RC C K 
Sbjct  30   AEPKLCIAKSNKFKGFCLKDPKCVSVCKTEGFTGGRCRGFRLRCYCTKT  78



>gb|ABX84377.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66997.1| defensin [Triticum aestivum]
Length=82

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIK  187
            TE+G  T  VAEA  C   S KFKG C  S  C SICRTE FP G+C+   F  +C C +
Sbjct  21   TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  80

Query  188  NC  193
             C
Sbjct  81   VC  82



>gb|ABX84378.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66996.1| defensin [Triticum aestivum]
Length=82

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIK  187
            TE+G  T  VAEA  C   S KFKG C  S  C SICRTE FP G+C+   F  +C C +
Sbjct  21   TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  80

Query  188  NC  193
             C
Sbjct  81   VC  82



>gb|ADK91098.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91099.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91100.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91101.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91102.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91103.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91104.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91105.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91106.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91107.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91108.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91109.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91110.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91111.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91112.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91113.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91114.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91115.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91117.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91118.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91119.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91120.1| PCP17C2 [Arabidopsis halleri]
Length=55

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +2

Query  38   LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +  EA  CE  S +FKG C  +  C ++C  EGF  G CRG R RC C +NC
Sbjct  4    VTVEARTCESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>dbj|BAJ89304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=83

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = +2

Query  11   ATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCI  184
            ATE+G  T+  AEA  C   S KFKG C  +  C  +CRTE FPDG+C   R   +C C 
Sbjct  23   ATEMG--TMKAAEARTCLSQSHKFKGTCLSNSNCAGVCRTENFPDGECNSHRLERKCYCK  80

Query  185  KNC  193
            + C
Sbjct  81   RTC  83



>gb|ACV84382.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIK  187
            TE+G  T+  AEA  C   S KFKG C  S  C SICRTE FP G+C+   F  +C C +
Sbjct  21   TEMGTPTMKAAEARDCLSQSHKFKGSCLSSSNCASICRTENFPGGECKLESFARKCFCKR  80

Query  188  NC  193
             C
Sbjct  81   VC  82



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 33/64 (52%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
              + T +    +  AEA  CE  S +FKG C    TC   CR EGF  G CRG+R RC C
Sbjct  13   FLLLTAVTDVAVKTAEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGDCRGLRRRCFC  72

Query  182  IKNC  193
             + C
Sbjct  73   NRLC  76



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 36/64 (56%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +AT +G  T+   EA  CE  S  F G C  +  C +IC  EGF DG C+G R RC+C
Sbjct  19   LLLATGMGPVTV---EARMCESSSQLFNGPCLSTTNCANICHNEGFTDGDCQGFRRRCIC  75

Query  182  IKNC  193
             + C
Sbjct  76   TRPC  79



>ref|XP_008340513.1| PREDICTED: defensin-like protein 1 [Malus domestica]
 gb|AFH74425.1| defensin [Malus domestica]
Length=87

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 32/62 (52%), Gaps = 0/62 (0%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            M  E    +    E   CE  SGKFKG+C  S  C + C  E F  G+C+G R RCMC K
Sbjct  26   MGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTK  85

Query  188  NC  193
             C
Sbjct  86   KC  87



>ref|XP_010038383.1| PREDICTED: uncharacterized protein LOC104426904 [Eucalyptus grandis]
Length=221

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +2

Query  17   ELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            E G++ +   E  KCE  S KFKG+C  ++ C  + R EGF  G+C+G+R RC C K C
Sbjct  126  EKGKDVVSAYEGPKCESKSLKFKGMCISTRHCGLVWRDEGFEGGKCKGLRRRCFCFKAC  184



>gb|AIA67013.1| defensin [Triticum aestivum]
Length=76

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            T   +  + +A A  C+  S KFKG+C R   C S+C  EGF  G+C+G   RC C K+C
Sbjct  17   TTEDQGPVQLALARDCQSKSFKFKGMCVRDDNCASVCLLEGFTGGKCKGFWHRCYCTKDC  76



>ref|XP_010481691.1| PREDICTED: putative defensin-like protein 9 [Camelina sativa]
Length=79

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF---R  172
            LF    LG   ++  +   CE  S  F+G C + +TC+ +C +EGFPDGQC G      +
Sbjct  11   LFFLVLLGVMKMVEGKPLLCEAQSINFRGFCVKWRTCKRVCISEGFPDGQCEGFLIFSNK  70

Query  173  CMCIKNC  193
            CMC K C
Sbjct  71   CMCRKPC  77



>ref|XP_011001252.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=74

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   RNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            +  ++  EA  C   S  FKG C R   C ++C+TEGFP G+C+G R RC C K C
Sbjct  19   QEMMVPTEARVCLSQSHNFKGPCVRGHNCANVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 33/64 (52%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +     +  I+  EA  CE  S  FKG C R   C  +CR E F  G+C+G+R RC C
Sbjct  11   LLLIVLASQEAIVPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGGRCKGVRRRCFC  70

Query  182  IKNC  193
             K C
Sbjct  71   TKLC  74



>ref|XP_007202934.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 ref|XP_007202943.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 ref|XP_007203068.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
 gb|EMJ04133.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 gb|EMJ04142.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 gb|EMJ04267.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
Length=85

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  59   CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            CE  S KFKG C RS  C +IC  EGF  G+C G R RC C KNC
Sbjct  41   CESLSTKFKGPCIRSSNCANICEEEGFKGGKCVGFRLRCTCTKNC  85



>gb|EMT22726.1| Defensin Tm-AMP-D1.2 [Aegilops tauschii]
Length=82

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 34/62 (55%), Gaps = 4/62 (6%)
 Frame = +2

Query  14   TELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRF--RCMCIK  187
            TE+G  T  VAEA  CE  S  FKG C     C S+CRTE FP GQC       +C C +
Sbjct  23   TEMG--TTKVAEARTCESQSHNFKGACFSDTNCASVCRTENFPRGQCHQHHLERKCYCER  80

Query  188  NC  193
            +C
Sbjct  81   DC  82



>ref|XP_009351647.1| PREDICTED: defensin-like protein 1 [Pyrus x bretschneideri]
Length=87

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 32/62 (52%), Gaps = 0/62 (0%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            M  E    +    E   CE  SGKFKG+C  S  C + C  E F  G+C+G R RCMC K
Sbjct  26   MGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTK  85

Query  188  NC  193
             C
Sbjct  86   KC  87



>ref|XP_007203287.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
 gb|EMJ04486.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
Length=85

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  59   CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            CE  S KFKG C RS  C +IC  EGF  G+C G R RC C KNC
Sbjct  41   CESLSTKFKGPCFRSSNCANICEKEGFKGGKCVGFRLRCTCTKNC  85



>gb|AIA67014.1| defensin [Triticum aestivum]
Length=75

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 5/64 (8%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE     ++ A+A +CE  S +F GLC  S  C  +C  EGF  G+C G++  CMC
Sbjct  17   LVVATE-----VVPAQARECETESERFNGLCFVSANCAGVCNAEGFTGGKCSGLKRSCMC  71

Query  182  IKNC  193
             K C
Sbjct  72   TKEC  75



>dbj|BAB64929.1| defensin-like protein [Pyrus pyrifolia]
Length=87

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 32/62 (52%), Gaps = 0/62 (0%)
 Frame = +2

Query  8    MATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIK  187
            M  E    +    E   CE  SGKFKG+C  S  C + C  E F  G+C+G R RCMC K
Sbjct  26   MGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTK  85

Query  188  NC  193
             C
Sbjct  86   KC  87



>ref|XP_007202863.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
 gb|EMJ04062.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
Length=85

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  59   CEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            CE  S KFKG C RS  C +IC  EGF  G+C G R RC C KNC
Sbjct  41   CESLSTKFKGPCIRSSNCANICEEEGFKGGKCVGFRLRCTCTKNC  85



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +2

Query  2    LFMATELGRNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMC  181
            L +ATE+G    +VAEA  CE  S   +G C   + C S CRTE F  G CRG R RC C
Sbjct  17   LLLATEMGPR--MVAEARGCESRSRHLRGKCESDENCASACRTERFSGGHCRGFRCRCFC  74

Query  182  IK  187
             K
Sbjct  75   DK  76



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 29/56 (52%), Gaps = 0/56 (0%)
 Frame = +2

Query  26   RNTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
               ++  E   CE  S +F GLC     C S+C  EGF  G+CRG R RC C K C
Sbjct  19   HQMVVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGKCRGFRKRCFCKKRC  74



>ref|XP_008240819.1| PREDICTED: defensin Ec-AMP-D1-like [Prunus mume]
Length=85

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  47   EAGKCEVPSGKFKGLCGRSKTCRSICRTEGFPDGQCRGIRFRCMCIKNC  193
            ++G CE  S KFKG C RS +C   C+ EGF  G+C G R RC C K C
Sbjct  37   KSGTCESLSTKFKGFCFRSSSCADACQKEGFMGGKCPGFRLRCTCTKKC  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1450662993712