BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16078_g3_i1 len=1236 path=[1961:0-1235]

Length=1236
                                                                      Score     E

gb|EYU25687.1|  hypothetical protein MIMGU_mgv1a023709mg                474   3e-160   
ref|XP_011097991.1|  PREDICTED: probable acyl-activating enzyme 4       471   1e-157   
ref|XP_010250375.1|  PREDICTED: probable acyl-activating enzyme 5...    460   2e-154   
gb|AGA17921.1|  CCL4                                                    459   4e-154   
gb|EYU25690.1|  hypothetical protein MIMGU_mgv1a003993mg                459   4e-154   
ref|XP_006343310.1|  PREDICTED: probable acyl-activating enzyme 9...    458   9e-153   
ref|XP_007034413.1|  Acyl activating enzyme 5                           457   2e-152   
ref|XP_007019243.1|  AMP-dependent synthetase and ligase family p...    455   3e-152   
gb|EPS62843.1|  hypothetical protein M569_11943                         454   3e-152   
gb|EYU25663.1|  hypothetical protein MIMGU_mgv1a019009mg                453   4e-152   
emb|CDP01727.1|  unnamed protein product                                451   7e-151   
ref|XP_004234497.1|  PREDICTED: probable acyl-activating enzyme 9       452   2e-150   
ref|XP_009620938.1|  PREDICTED: probable acyl-activating enzyme 6       448   7e-150   
ref|XP_009789560.1|  PREDICTED: probable acyl-activating enzyme 6       451   7e-150   
ref|XP_011004907.1|  PREDICTED: probable acyl-activating enzyme 6       448   1e-149   
ref|XP_002521743.1|  AMP dependent ligase, putative                     447   2e-149   Ricinus communis
ref|XP_009593059.1|  PREDICTED: probable acyl-activating enzyme 6       449   3e-149   
gb|KDO64308.1|  hypothetical protein CISIN_1g045072mg                   445   2e-148   
emb|CAN64147.1|  hypothetical protein VITISV_042774                     444   3e-148   Vitis vinifera
ref|XP_006371374.1|  AMP-binding family protein                         444   5e-148   
ref|XP_006481329.1|  PREDICTED: probable acyl-activating enzyme 5...    444   5e-148   
ref|XP_009788388.1|  PREDICTED: probable acyl-activating enzyme 6       443   1e-147   
gb|KDO55429.1|  hypothetical protein CISIN_1g044926mg                   443   2e-147   
ref|XP_010648868.1|  PREDICTED: probable acyl-activating enzyme 5...    443   3e-147   
ref|XP_006350454.1|  PREDICTED: probable acyl-activating enzyme 6...    442   3e-147   
ref|XP_006451536.1|  hypothetical protein CICLE_v10007865mg             442   5e-147   
ref|XP_002263801.1|  PREDICTED: probable acyl-activating enzyme 6       441   5e-147   Vitis vinifera
ref|XP_010250381.1|  PREDICTED: probable acyl-activating enzyme 5...    440   1e-146   
ref|XP_002321934.2|  hypothetical protein POPTR_0015s12700g             439   3e-146   Populus trichocarpa [western balsam poplar]
ref|XP_006434271.1|  hypothetical protein CICLE_v10003763mg             439   5e-146   
ref|XP_011048777.1|  PREDICTED: probable acyl-activating enzyme 6       439   5e-146   
ref|XP_007221472.1|  hypothetical protein PRUPE_ppa003732mg             439   5e-146   
emb|CDX70689.1|  BnaC03g07730D                                          438   5e-146   
ref|XP_008381411.1|  PREDICTED: probable acyl-activating enzyme 6       437   1e-145   
ref|XP_008803433.1|  PREDICTED: probable acyl-activating enzyme 5...    437   1e-145   
ref|XP_006371377.1|  hypothetical protein POPTR_0019s09600g             437   2e-145   
ref|XP_006383816.1|  hypothetical protein POPTR_0004s00210g             433   5e-145   
ref|XP_006371376.1|  hypothetical protein POPTR_0019s09590g             435   7e-145   
ref|XP_006472839.1|  PREDICTED: probable acyl-activating enzyme 9...    435   1e-144   
gb|KDP39789.1|  hypothetical protein JCGZ_03925                         435   1e-144   
ref|XP_008343272.1|  PREDICTED: probable acyl-activating enzyme 6       434   1e-144   
ref|XP_010459862.1|  PREDICTED: probable acyl-activating enzyme 9       434   3e-144   
gb|KDP31601.1|  hypothetical protein JCGZ_14826                         433   5e-144   
ref|XP_008227872.1|  PREDICTED: probable acyl-activating enzyme 5...    433   8e-144   
ref|XP_008463175.1|  PREDICTED: probable acyl-activating enzyme 5...    433   8e-144   
ref|XP_004162833.1|  PREDICTED: probable acyl-activating enzyme 5...    434   9e-144   
ref|XP_004148909.1|  PREDICTED: probable acyl-activating enzyme 5...    433   1e-143   
ref|XP_010498606.1|  PREDICTED: probable acyl-activating enzyme 9       432   1e-143   
ref|NP_173573.1|  probable acyl-activating enzyme 9                     432   1e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011097992.1|  PREDICTED: probable acyl-activating enzyme 5...    432   2e-143   
emb|CDX78686.1|  BnaA03g05980D                                          432   2e-143   
ref|XP_006287418.1|  hypothetical protein CARUB_v10000624mg             432   2e-143   
ref|XP_011004848.1|  PREDICTED: probable acyl-activating enzyme 6       432   2e-143   
ref|XP_010496337.1|  PREDICTED: probable acyl-activating enzyme 9       431   3e-143   
ref|XP_009131535.1|  PREDICTED: probable acyl-activating enzyme 5...    431   3e-143   
ref|XP_006400174.1|  hypothetical protein EUTSA_v10013162mg             431   3e-143   
ref|XP_010062342.1|  PREDICTED: probable acyl-activating enzyme 5...    432   3e-143   
ref|NP_197141.1|  acyl activating enzyme 5                              431   3e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472878.1|  PREDICTED: probable acyl-activating enzyme 9...    431   4e-143   
ref|XP_006434307.1|  hypothetical protein CICLE_v10000754mg             431   5e-143   
ref|XP_002893174.1|  hypothetical protein ARALYDRAFT_889616             431   6e-143   
emb|CDP01726.1|  unnamed protein product                                431   6e-143   
ref|XP_008463174.1|  PREDICTED: probable acyl-activating enzyme 5...    431   6e-143   
ref|XP_010539691.1|  PREDICTED: probable acyl-activating enzyme 9       430   8e-143   
ref|XP_008227873.1|  PREDICTED: probable acyl-activating enzyme 6       431   9e-143   
ref|XP_006472877.1|  PREDICTED: probable acyl-activating enzyme 9...    431   1e-142   
ref|XP_002319862.2|  hypothetical protein POPTR_0013s08950g             430   1e-142   Populus trichocarpa [western balsam poplar]
ref|XP_010549881.1|  PREDICTED: probable acyl-activating enzyme 5...    430   2e-142   
ref|XP_011011090.1|  PREDICTED: probable acyl-activating enzyme 6       429   2e-142   
ref|XP_010935531.1|  PREDICTED: probable acyl-activating enzyme 5...    427   2e-142   
ref|XP_010675193.1|  PREDICTED: probable acyl-activating enzyme 6       430   2e-142   
ref|XP_002325656.2|  hypothetical protein POPTR_0019s09610g             432   3e-142   Populus trichocarpa [western balsam poplar]
ref|XP_010675194.1|  PREDICTED: probable acyl-activating enzyme 6       430   3e-142   
ref|XP_010492530.1|  PREDICTED: probable acyl-activating enzyme 5...    429   3e-142   
emb|CDY04644.1|  BnaC05g16820D                                          428   5e-142   
ref|XP_007221471.1|  hypothetical protein PRUPE_ppa003617mg             428   6e-142   
ref|XP_011004906.1|  PREDICTED: probable acyl-activating enzyme 6       431   7e-142   
ref|XP_006416291.1|  hypothetical protein EUTSA_v10007282mg             428   7e-142   
ref|XP_010675195.1|  PREDICTED: probable acyl-activating enzyme 6       428   8e-142   
gb|EPS70079.1|  hypothetical protein M569_04675                         427   1e-141   
ref|XP_009149670.1|  PREDICTED: probable acyl-activating enzyme 9       427   1e-141   
ref|XP_010420326.1|  PREDICTED: probable acyl-activating enzyme 5...    427   2e-141   
ref|XP_010935532.1|  PREDICTED: probable acyl-activating enzyme 5...    427   2e-141   
ref|XP_006307172.1|  hypothetical protein CARUB_v10008762mg             427   2e-141   
ref|XP_004148908.1|  PREDICTED: probable acyl-activating enzyme 5...    427   2e-141   
ref|XP_006400173.1|  hypothetical protein EUTSA_v10016036mg             426   3e-141   
ref|XP_004170696.1|  PREDICTED: probable acyl-activating enzyme 5...    426   3e-141   
ref|XP_010935530.1|  PREDICTED: probable acyl-activating enzyme 5...    426   3e-141   
ref|XP_002873771.1|  hypothetical protein ARALYDRAFT_488489             426   3e-141   
ref|XP_010107699.1|  putative acyl-activating enzyme 6                  426   5e-141   
ref|XP_004490748.1|  PREDICTED: probable acyl-activating enzyme 6...    426   7e-141   
ref|XP_009128212.1|  PREDICTED: probable acyl-activating enzyme 4       424   2e-140   
ref|XP_004288564.1|  PREDICTED: probable acyl-activating enzyme 5...    424   3e-140   
ref|XP_003519307.1|  PREDICTED: probable acyl-activating enzyme 5...    424   3e-140   
ref|XP_010471911.1|  PREDICTED: probable acyl-activating enzyme 4       423   3e-140   
ref|XP_003616111.1|  2-succinylbenzoate-CoA ligase                      424   3e-140   
emb|CAA64328.1|  amp-binding protein                                    424   3e-140   Brassica napus [oilseed rape]
gb|AAL69511.1|  putative AMP-binding protein                            424   4e-140   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197138.1|  probable acyl-activating enzyme 6                     423   4e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231632.1|  PREDICTED: probable acyl-activating enzyme 6       423   6e-140   
ref|XP_010935529.1|  PREDICTED: probable acyl-activating enzyme 5...    422   9e-140   
gb|ABK28406.1|  unknown                                                 422   9e-140   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25877.1|  hypothetical protein AALP_AA8G173900                    422   1e-139   
emb|CDY66619.1|  BnaAnng22570D                                          421   1e-139   
ref|XP_008803425.1|  PREDICTED: probable acyl-activating enzyme 5...    422   1e-139   
ref|NP_001077573.1|  probable acyl-activating enzyme 10                 421   2e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453792.1|  PREDICTED: probable acyl-activating enzyme 5...    421   3e-139   
ref|XP_003544347.1|  PREDICTED: probable acyl-activating enzyme 6...    421   4e-139   
gb|KFK44250.1|  hypothetical protein AALP_AA1G234200                    421   5e-139   
ref|XP_008348622.1|  PREDICTED: probable acyl-activating enzyme 6       421   6e-139   
gb|AGA17928.1|  CCL11                                                   420   9e-139   
ref|XP_006390110.1|  hypothetical protein EUTSA_v10018371mg             419   1e-138   
ref|XP_003616110.1|  2-succinylbenzoate-CoA ligase                      419   2e-138   
ref|XP_010494557.1|  PREDICTED: probable acyl-activating enzyme 6       419   2e-138   
ref|XP_010095757.1|  putative acyl-activating enzyme 6                  419   2e-138   
ref|XP_006287411.1|  hypothetical protein CARUB_v10000617mg             419   3e-138   
ref|XP_002525882.1|  AMP dependent ligase, putative                     416   6e-138   Ricinus communis
ref|XP_004490749.1|  PREDICTED: probable acyl-activating enzyme 6...    417   8e-138   
ref|XP_010416654.1|  PREDICTED: probable acyl-activating enzyme 4       417   9e-138   
ref|XP_010441803.1|  PREDICTED: probable acyl-activating enzyme 6       417   2e-137   
gb|KFK42122.1|  hypothetical protein AALP_AA2G213800                    416   2e-137   
ref|XP_009627920.1|  PREDICTED: probable acyl-activating enzyme 6       416   2e-137   
ref|XP_010481667.1|  PREDICTED: probable acyl-activating enzyme 5...    416   3e-137   
ref|NP_173572.2|  probable acyl-activating enzyme 10                    416   4e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428792.1|  PREDICTED: probable acyl-activating enzyme 4       415   6e-137   
ref|XP_003518357.1|  PREDICTED: probable acyl-activating enzyme 6...    415   6e-137   
ref|XP_006301025.1|  hypothetical protein CARUB_v10021416mg             414   2e-136   
gb|AAM28625.1|AF503767_1  adenosine monophosphate binding protein...    414   2e-136   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177724.1|  AMP-dependent synthetase and ligase family protein    414   2e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668693.1|  PREDICTED: probable acyl-activating enzyme 5...    414   3e-136   
ref|XP_008803413.1|  PREDICTED: probable acyl-activating enzyme 5...    414   3e-136   
emb|CAJ86098.1|  H0103C06.2                                             414   4e-136   Oryza sativa [red rice]
ref|XP_002438211.1|  hypothetical protein SORBIDRAFT_10g009610          413   6e-136   Sorghum bicolor [broomcorn]
emb|CDX88352.1|  BnaC06g37960D                                          412   8e-136   
ref|XP_006350455.1|  PREDICTED: probable acyl-activating enzyme 6...    412   2e-135   
dbj|BAK02324.1|  predicted protein                                      409   2e-135   
gb|AAM28621.1|AF503763_1  adenosine monophosphate binding protein...    411   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231630.1|  PREDICTED: probable acyl-activating enzyme 5...    411   2e-135   
ref|NP_177848.1|  acyl-activating enzyme 2                              411   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007141984.1|  hypothetical protein PHAVU_008G242600g             411   2e-135   
ref|XP_002522210.1|  AMP dependent ligase, putative                     411   3e-135   Ricinus communis
ref|XP_009128147.1|  PREDICTED: probable acyl-activating enzyme 5...    411   3e-135   
ref|NP_001054242.1|  Os04g0674700                                       411   3e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010492518.1|  PREDICTED: probable acyl-activating enzyme 5...    410   3e-135   
emb|CDY39074.1|  BnaA02g17630D                                          411   3e-135   
gb|KDO80439.1|  hypothetical protein CISIN_1g0365442mg                  405   8e-135   
ref|XP_002887622.1|  hypothetical protein ARALYDRAFT_339769             414   1e-134   
ref|XP_004960088.1|  PREDICTED: probable acyl-activating enzyme 5...    410   1e-134   
ref|XP_009106386.1|  PREDICTED: probable acyl-activating enzyme 4       409   1e-134   
ref|XP_003544953.1|  PREDICTED: probable acyl-activating enzyme 5...    409   1e-134   
emb|CDX87532.1|  BnaA07g33410D                                          409   2e-134   
ref|XP_009799722.1|  PREDICTED: probable acyl-activating enzyme 6       409   2e-134   
emb|CDY62984.1|  BnaCnng41240D                                          408   3e-134   
ref|XP_006839140.1|  hypothetical protein AMTR_s00090p00177840          408   5e-134   
ref|XP_010453796.1|  PREDICTED: probable acyl-activating enzyme 5...    407   7e-134   
ref|XP_010420322.1|  PREDICTED: probable acyl-activating enzyme 5...    407   9e-134   
dbj|BAJ98602.1|  predicted protein                                      407   9e-134   
gb|KEH16506.1|  long-chain acyl-CoA synthetase                          407   1e-133   
gb|AFD33349.1|  acyl-activating enzyme 5                                407   1e-133   
ref|XP_004309396.1|  PREDICTED: probable acyl-activating enzyme 6...    407   2e-133   
ref|XP_003519306.1|  PREDICTED: probable acyl-activating enzyme 5...    405   4e-133   
ref|XP_010666048.1|  PREDICTED: probable acyl-activating enzyme 6       407   4e-133   
ref|XP_010935662.1|  PREDICTED: probable acyl-activating enzyme 5...    405   5e-133   
gb|KCW69470.1|  hypothetical protein EUGRSUZ_F02925                     405   7e-133   
ref|XP_007141985.1|  hypothetical protein PHAVU_008G242700g             405   9e-133   
ref|XP_004960094.1|  PREDICTED: probable acyl-activating enzyme 6...    406   9e-133   
ref|XP_003616108.1|  2-succinylbenzoate-CoA ligase                      404   2e-132   
gb|EMT02303.1|  2-succinylbenzoate--CoA ligase                          396   3e-132   
ref|XP_011097993.1|  PREDICTED: LOW QUALITY PROTEIN: probable acy...    403   3e-132   
ref|XP_007019247.1|  AMP-dependent synthetase and ligase family p...    402   3e-132   
ref|XP_006473030.1|  PREDICTED: probable acyl-activating enzyme 6...    403   4e-132   
gb|KDO80441.1|  hypothetical protein CISIN_1g008636mg                   403   5e-132   
ref|XP_002436828.1|  hypothetical protein SORBIDRAFT_10g009600          402   1e-131   Sorghum bicolor [broomcorn]
ref|XP_006434311.1|  hypothetical protein CICLE_v10003943mg             398   1e-131   
ref|XP_006429740.1|  hypothetical protein CICLE_v10013692mg             401   2e-131   
gb|AFW76928.1|  putative AMP-dependent synthetase and ligase supe...    401   2e-131   
ref|XP_002448762.1|  hypothetical protein SORBIDRAFT_06g032750          400   4e-131   Sorghum bicolor [broomcorn]
gb|EMS64064.1|  2-succinylbenzoate--CoA ligase                          394   7e-130   
emb|CBG76266.1|  OO_Ba0005L10-OO_Ba0081K17.17                           397   7e-130   Oryza officinalis
ref|XP_002889131.1|  hypothetical protein ARALYDRAFT_476888             393   1e-128   
ref|NP_001152382.1|  AMP-binding protein                                391   1e-127   Zea mays [maize]
gb|KFK42034.1|  hypothetical protein AALP_AA2G203300                    389   7e-127   
gb|EMT04966.1|  Medium-chain-fatty-acid--CoA ligase                     383   2e-124   
ref|XP_003580813.1|  PREDICTED: probable acyl-activating enzyme 5...    377   7e-122   
ref|XP_002521742.1|  AMP dependent ligase, putative                     366   1e-121   Ricinus communis
ref|XP_010541976.1|  PREDICTED: probable acyl-activating enzyme 10      375   2e-121   
ref|XP_006434308.1|  hypothetical protein CICLE_v10003208mg             371   3e-120   
ref|XP_006653021.1|  PREDICTED: probable acyl-activating enzyme 6...    372   3e-120   
ref|XP_006855572.1|  hypothetical protein AMTR_s00044p00031990          367   7e-118   
ref|XP_011043893.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    365   4e-117   
gb|KHN39514.1|  Putative acyl-activating enzyme 6                       360   1e-115   
ref|XP_002521696.1|  AMP dependent ligase, putative                     357   2e-115   Ricinus communis
ref|XP_010062333.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    360   4e-115   
ref|XP_003578618.1|  PREDICTED: benzoate--CoA ligase, peroxisomal...    360   4e-115   
ref|XP_002305237.1|  hypothetical protein POPTR_0004s08030g             358   2e-114   Populus trichocarpa [western balsam poplar]
gb|EAZ10040.1|  hypothetical protein OsI_32344                          358   2e-114   Oryza sativa Indica Group [Indian rice]
ref|NP_001063895.1|  Os09g0555800                                       358   2e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011038309.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    358   3e-114   
ref|XP_008792163.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    358   3e-114   
ref|XP_010105803.1|  Butyrate--CoA ligase AAE11                         357   4e-114   
ref|XP_010270776.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    357   5e-114   
ref|XP_006372491.1|  AMP-dependent synthetase and ligase family p...    357   9e-114   
ref|XP_009780397.1|  PREDICTED: probable acyl-activating enzyme 1...    357   9e-114   
gb|KDP35706.1|  hypothetical protein JCGZ_10478                         353   2e-113   
dbj|BAJ88014.1|  predicted protein                                      355   2e-113   
ref|XP_011038310.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    355   4e-113   
ref|XP_009626677.1|  PREDICTED: probable acyl-activating enzyme 1...    355   5e-113   
ref|XP_002521699.1|  AMP dependent ligase, putative                     353   1e-112   Ricinus communis
ref|XP_004503089.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    353   1e-112   
ref|XP_006416292.1|  hypothetical protein EUTSA_v10009822mg             349   2e-112   
ref|XP_010940269.1|  PREDICTED: benzoate--CoA ligase, peroxisomal...    353   2e-112   
ref|XP_008804291.1|  PREDICTED: benzoate--CoA ligase, peroxisomal...    353   3e-112   
ref|XP_003517547.1|  PREDICTED: probable acyl-activating enzyme 1...    352   3e-112   
ref|XP_011096925.1|  PREDICTED: LOW QUALITY PROTEIN: butyrate--Co...    353   3e-112   
ref|XP_010029595.1|  PREDICTED: probable acyl-activating enzyme 2       353   3e-112   
ref|XP_006372489.1|  AMP-dependent synthetase and ligase family p...    351   4e-112   
gb|AEO52695.1|  benzoyl-CoA/cinnamoyl-CoA ligase                        352   8e-112   
ref|XP_002272437.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    351   1e-111   Vitis vinifera
ref|XP_001753149.1|  predicted protein                                  350   1e-111   
gb|EYU33955.1|  hypothetical protein MIMGU_mgv1a003358mg                351   2e-111   
ref|XP_009408181.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    350   2e-111   
ref|XP_002967798.1|  hypothetical protein SELMODRAFT_409095             349   3e-111   
ref|XP_002992588.1|  hypothetical protein SELMODRAFT_448826             349   3e-111   
gb|AFS60176.1|  cinnamate:CoA ligase                                    350   3e-111   
ref|XP_008813690.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    350   4e-111   
gb|KDO57304.1|  hypothetical protein CISIN_1g038104mg                   349   5e-111   
gb|KDP43741.1|  hypothetical protein JCGZ_22368                         348   6e-111   
ref|XP_006430358.1|  hypothetical protein CICLE_v10011382mg             349   6e-111   
ref|XP_006340821.1|  PREDICTED: probable acyl-activating enzyme 2...    348   9e-111   
ref|XP_006481939.1|  PREDICTED: probable acyl-activating enzyme 1...    348   2e-110   
ref|XP_002465916.1|  hypothetical protein SORBIDRAFT_01g048050          347   2e-110   Sorghum bicolor [broomcorn]
gb|KDO80508.1|  hypothetical protein CISIN_1g036361mg                   345   2e-110   
ref|XP_002992620.1|  hypothetical protein SELMODRAFT_236556             347   3e-110   
ref|XP_009401909.1|  PREDICTED: LOW QUALITY PROTEIN: butyrate--Co...    348   3e-110   
ref|XP_003538370.1|  PREDICTED: probable acyl-activating enzyme 1...    348   6e-110   
ref|XP_007032206.1|  AMP-dependent synthetase and ligase family p...    348   7e-110   
ref|XP_002968051.1|  hypothetical protein SELMODRAFT_440236             346   7e-110   
gb|KHN08765.1|  Putative acyl-activating enzyme 12, peroxisomal         347   7e-110   
ref|XP_006602034.1|  PREDICTED: probable acyl-activating enzyme 1...    347   8e-110   
gb|EYU21630.1|  hypothetical protein MIMGU_mgv1a004128mg                345   8e-110   
ref|XP_010536456.1|  PREDICTED: probable acyl-activating enzyme 1...    345   9e-110   
gb|KHN24179.1|  Putative acyl-activating enzyme 12, peroxisomal         347   1e-109   
ref|XP_004145598.1|  PREDICTED: probable acyl-activating enzyme 1...    345   1e-109   
ref|XP_007046541.1|  AMP-dependent synthetase and ligase family p...    346   1e-109   
dbj|BAK01634.1|  predicted protein                                      345   1e-109   
ref|XP_004509425.1|  PREDICTED: probable acyl-activating enzyme 2...    346   1e-109   
ref|XP_008650750.1|  PREDICTED: probable acyl-activating enzyme 1...    347   2e-109   
ref|XP_003558087.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    345   2e-109   
ref|XP_010266145.1|  PREDICTED: probable acyl-activating enzyme 1...    342   3e-109   
ref|XP_004985815.1|  PREDICTED: probable acyl-activating enzyme 1...    347   3e-109   
ref|XP_009384627.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    345   4e-109   
ref|XP_008452948.1|  PREDICTED: probable acyl-activating enzyme 1...    344   4e-109   
gb|KHN35099.1|  Putative acyl-activating enzyme 1, peroxisomal          344   4e-109   
gb|KEH20360.1|  long-chain acyl-CoA synthetase                          342   4e-109   
ref|XP_010498489.1|  PREDICTED: probable acyl-activating enzyme 1...    339   4e-109   
ref|XP_007156997.1|  hypothetical protein PHAVU_002G035000g             344   4e-109   
ref|XP_003537984.1|  PREDICTED: probable acyl-activating enzyme 1...    343   5e-109   
gb|KDP43746.1|  hypothetical protein JCGZ_22373                         345   5e-109   
ref|XP_007146972.1|  hypothetical protein PHAVU_006G086100g             346   5e-109   
ref|XP_010266144.1|  PREDICTED: probable acyl-activating enzyme 2...    342   6e-109   
ref|XP_002307962.1|  hypothetical protein POPTR_0006s03470g             344   6e-109   Populus trichocarpa [western balsam poplar]
ref|NP_001077568.1|  acyl activating enzyme 1                           341   7e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509424.1|  PREDICTED: probable acyl-activating enzyme 2...    340   9e-109   
emb|CDY29523.1|  BnaA06g14470D                                          343   1e-108   
ref|XP_003631912.2|  PREDICTED: probable acyl-activating enzyme 1...    346   1e-108   
gb|EEE61896.1|  hypothetical protein OsJ_16604                          342   1e-108   Oryza sativa Japonica Group [Japonica rice]
gb|AHL44984.1|  4-coumarate:coenzyme A ligase 4                         343   1e-108   
ref|XP_004509423.1|  PREDICTED: probable acyl-activating enzyme 2...    340   1e-108   
ref|XP_004511496.1|  PREDICTED: probable acyl-activating enzyme 1...    342   2e-108   
gb|KFK44172.1|  hypothetical protein AALP_AA1G223900                    342   2e-108   
ref|XP_009764164.1|  PREDICTED: probable acyl-activating enzyme 1...    343   2e-108   
ref|XP_010459741.1|  PREDICTED: probable acyl-activating enzyme 1...    342   2e-108   
ref|XP_009149533.1|  PREDICTED: probable acyl-activating enzyme 1...    343   2e-108   
ref|XP_010692554.1|  PREDICTED: probable acyl-activating enzyme 1...    342   2e-108   
ref|XP_007199778.1|  hypothetical protein PRUPE_ppa003716mg             342   2e-108   
ref|XP_003544957.1|  PREDICTED: probable acyl-activating enzyme 1...    342   2e-108   
ref|XP_004243627.2|  PREDICTED: probable acyl-activating enzyme 1...    343   3e-108   
ref|XP_008241970.1|  PREDICTED: probable acyl-activating enzyme 2       343   3e-108   
ref|XP_009339486.1|  PREDICTED: probable acyl-activating enzyme 1...    342   3e-108   
emb|CDP01703.1|  unnamed protein product                                342   3e-108   
ref|XP_004232551.2|  PREDICTED: probable acyl-activating enzyme 1...    342   3e-108   
ref|XP_008237858.1|  PREDICTED: probable acyl-activating enzyme 1...    339   4e-108   
ref|XP_002964025.1|  hypothetical protein SELMODRAFT_81559              342   4e-108   
ref|XP_002465383.1|  hypothetical protein SORBIDRAFT_01g037610          342   4e-108   
ref|XP_010266143.1|  PREDICTED: probable acyl-activating enzyme 1...    342   5e-108   
ref|XP_004288576.1|  PREDICTED: probable acyl-activating enzyme 1...    342   5e-108   
ref|XP_003600627.1|  2-succinylbenzoate-CoA ligase                      342   5e-108   
gb|KDO71860.1|  hypothetical protein CISIN_1g008342mg                   340   5e-108   
ref|XP_004509422.1|  PREDICTED: probable acyl-activating enzyme 2...    340   6e-108   
gb|AAM28618.1|AF503760_1  adenosine monophosphate binding protein...    341   6e-108   
ref|XP_002323238.1|  hypothetical protein POPTR_0016s03410g             342   7e-108   
ref|NP_564116.1|  acyl activating enzyme 1                              341   7e-108   
tpg|DAA43216.1|  TPA: putative AMP-dependent synthetase and ligas...    347   7e-108   
gb|AAK50082.1|AF372942_1  At1g20560/F2D10_4                             340   8e-108   
ref|XP_010526841.1|  PREDICTED: probable acyl-activating enzyme 2       342   8e-108   
ref|XP_010278754.1|  PREDICTED: probable acyl-activating enzyme 1...    333   8e-108   
gb|AET03642.2|  long-chain acyl-CoA synthetase                          342   8e-108   
ref|XP_010477300.1|  PREDICTED: probable acyl-activating enzyme 1...    340   8e-108   
gb|AAF79607.1|AC027665_8  F5M15.12                                      341   9e-108   
ref|XP_010062353.1|  PREDICTED: benzoate--CoA ligase, peroxisomal...    340   9e-108   
ref|XP_010062354.1|  PREDICTED: benzoate--CoA ligase, peroxisomal...    340   9e-108   
gb|AAF80642.1|AC069251_35  F2D10.4                                      341   9e-108   
gb|KHG12779.1|  Acetate/butyrate--CoA ligase AAE7, peroxisomal -l...    341   9e-108   
ref|XP_006357895.1|  PREDICTED: probable acyl-activating enzyme 2...    339   1e-107   
ref|XP_007201990.1|  hypothetical protein PRUPE_ppa021932mg             340   1e-107   
ref|XP_011040752.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    341   1e-107   
ref|XP_001777379.1|  predicted protein                                  340   1e-107   
ref|XP_008440902.1|  PREDICTED: probable acyl-activating enzyme 2...    337   1e-107   
ref|XP_011072225.1|  PREDICTED: probable acyl-activating enzyme 1...    341   1e-107   
gb|AET03651.2|  long-chain acyl-CoA synthetase                          339   1e-107   
ref|XP_004288577.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    341   1e-107   
ref|XP_006416384.1|  hypothetical protein EUTSA_v10007137mg             341   1e-107   
ref|XP_009370584.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    340   1e-107   
ref|WP_034063188.1|  acyl-CoA synthetase                                331   2e-107   
ref|WP_031758460.1|  acyl-CoA synthetase                                331   2e-107   
ref|XP_008339094.1|  PREDICTED: probable acyl-activating enzyme 1...    339   2e-107   
ref|XP_010062318.1|  PREDICTED: benzoate--CoA ligase, peroxisomal...    340   2e-107   
gb|KDO71859.1|  hypothetical protein CISIN_1g008342mg                   340   2e-107   
gb|AHL44978.1|  4-coumarate:coenzyme A ligase 4                         340   3e-107   
ref|XP_004163400.1|  PREDICTED: LOW QUALITY PROTEIN: probable acy...    339   3e-107   
ref|XP_004145536.1|  PREDICTED: probable acyl-activating enzyme 1...    339   3e-107   
ref|XP_008362535.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    339   4e-107   
ref|XP_008237856.1|  PREDICTED: probable acyl-activating enzyme 1...    338   4e-107   
ref|XP_006419424.1|  hypothetical protein CICLE_v10004641mg             339   4e-107   
gb|ERX88047.1|  hypothetical protein Q083_03770                         331   4e-107   
ref|WP_037457650.1|  acyl-CoA synthetase                                338   5e-107   
ref|XP_011041404.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    339   5e-107   
ref|XP_008791989.1|  PREDICTED: probable acyl-activating enzyme 1...    338   5e-107   
ref|WP_036202696.1|  acyl-CoA synthetase                                338   5e-107   
emb|CDY31478.1|  BnaC05g15870D                                          338   5e-107   
ref|XP_003629166.1|  2-succinylbenzoate-CoA ligase                      342   5e-107   
ref|XP_010682997.1|  PREDICTED: probable acyl-activating enzyme 1...    341   6e-107   
gb|EMS53557.1|  2-succinylbenzoate--CoA ligase                          330   7e-107   
ref|WP_007153301.1|  acyl-CoA synthetase                                338   7e-107   
ref|XP_010682998.1|  PREDICTED: probable acyl-activating enzyme 1...    340   7e-107   
ref|XP_006304964.1|  hypothetical protein CARUB_v10011463mg             338   8e-107   
ref|WP_041117124.1|  acyl-CoA synthetase                                337   8e-107   
ref|XP_011040751.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    338   9e-107   
ref|XP_002893118.1|  adenosine monophosphate binding protein 1 AM...    338   9e-107   
ref|WP_019682988.1|  acyl-CoA synthetase                                331   9e-107   
ref|WP_016704864.1|  acyl-CoA synthetase                                337   1e-106   
ref|XP_008463169.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    338   1e-106   
ref|WP_023968667.1|  acyl-CoA synthetase                                337   1e-106   
ref|WP_004582950.1|  acyl-CoA synthetase                                337   1e-106   
ref|XP_008440901.1|  PREDICTED: probable acyl-activating enzyme 1...    338   1e-106   
ref|XP_010470480.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    338   2e-106   
ref|WP_009048151.1|  acyl-CoA synthetase                                337   2e-106   
ref|XP_010692562.1|  PREDICTED: probable acyl-activating enzyme 1...    337   2e-106   
ref|WP_038580397.1|  acyl-CoA synthetase                                337   2e-106   
ref|XP_006488868.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    337   2e-106   
ref|WP_011060462.1|  acyl-CoA synthetase                                337   2e-106   
ref|WP_003448681.1|  Long-chain-fatty-acid--CoA ligase                  337   2e-106   
gb|EMT07972.1|  2-succinylbenzoate--CoA ligase                          328   2e-106   
ref|XP_006380971.1|  hypothetical protein POPTR_0006s03460g             338   2e-106   
ref|XP_006357896.1|  PREDICTED: probable acyl-activating enzyme 2...    338   2e-106   
ref|XP_009369954.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    337   2e-106   
ref|WP_015634950.1|  putative acyl-CoA synthetase YngI                  336   2e-106   
ref|WP_028682095.1|  acyl-CoA synthetase                                336   2e-106   
ref|WP_038631328.1|  acyl-CoA synthetase                                336   2e-106   
ref|XP_006388071.1|  AMP-dependent synthetase and ligase family p...    337   3e-106   
ref|XP_010229258.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    338   3e-106   
ref|WP_019095107.1|  acyl-CoA synthetase                                336   3e-106   
ref|XP_003562130.1|  PREDICTED: probable acyl-activating enzyme 1...    339   3e-106   
ref|WP_022989407.1|  acyl-CoA synthetase                                336   4e-106   
ref|XP_009348886.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    337   4e-106   
ref|WP_027830638.1|  acyl-CoA synthetase                                336   4e-106   
ref|XP_006386144.1|  hypothetical protein POPTR_0002s011701g            333   4e-106   
ref|WP_028944184.1|  acyl-CoA synthetase                                335   4e-106   
ref|XP_011022140.1|  PREDICTED: probable acyl-activating enzyme 1...    337   5e-106   
ref|XP_006391319.1|  hypothetical protein EUTSA_v10018337mg             334   5e-106   
ref|XP_010259347.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    336   6e-106   
ref|WP_009620014.1|  acyl-CoA synthetase                                335   6e-106   
gb|AAP03024.1|  acyl-activating enzyme 11                               336   6e-106   
ref|WP_024309592.1|  acyl-CoA synthetase                                335   6e-106   
ref|WP_012019731.1|  acyl-CoA synthetase                                335   6e-106   
ref|XP_004134830.1|  PREDICTED: probable acyl-activating enzyme 2...    335   6e-106   
ref|XP_009392330.1|  PREDICTED: probable acyl-activating enzyme 1...    335   6e-106   
ref|XP_010459742.1|  PREDICTED: probable acyl-activating enzyme 1...    335   6e-106   
ref|WP_009401070.1|  acyl-CoA synthetase                                335   7e-106   
ref|WP_037051519.1|  acyl-CoA synthetase                                335   7e-106   
ref|XP_008786232.1|  PREDICTED: LOW QUALITY PROTEIN: acetate/buty...    336   8e-106   
gb|ABK25037.1|  unknown                                                 336   8e-106   
ref|WP_021445119.1|  acyl-CoA synthetase                                335   8e-106   
gb|ACG29870.1|  AMP-binding protein                                     336   8e-106   
ref|NP_001130745.1|  putative AMP-dependent synthetase and ligase...    335   9e-106   
ref|WP_017675525.1|  acyl-CoA synthetase                                335   9e-106   
ref|WP_013717196.1|  acyl-CoA synthetase                                335   9e-106   
ref|WP_036127966.1|  acyl-CoA synthetase                                335   1e-105   
ref|WP_003463051.1|  acyl-CoA synthetase                                335   1e-105   
ref|WP_038996100.1|  acyl-CoA synthetase                                335   1e-105   
gb|KFJ90135.1|  acyl-CoA synthetase                                     335   1e-105   
ref|XP_009341853.1|  PREDICTED: probable acyl-activating enzyme 1...    335   1e-105   
gb|AGA17920.1|  CCL3                                                    335   1e-105   
ref|XP_010511536.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    335   1e-105   
gb|KGN48985.1|  hypothetical protein Csa_6G509050                       336   1e-105   
ref|XP_007035745.1|  Acyl-activating enzyme 7                           337   1e-105   
ref|NP_176786.1|  butyrate--CoA ligase AAE11                            335   1e-105   
ref|WP_025804115.1|  acyl-CoA synthetase                                334   1e-105   
ref|WP_038528711.1|  acyl-CoA synthetase                                334   1e-105   
gb|AIY34668.1|  4-coumarate:CoA ligase-like protein                     334   2e-105   
ref|WP_031768156.1|  acyl-CoA synthetase                                330   2e-105   
gb|KGN50901.1|  Acyl:coa ligase acetate-coa synthetase-like protein     335   2e-105   
ref|XP_004148917.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    335   2e-105   
ref|XP_003550556.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    335   2e-105   
ref|WP_012701101.1|  acyl-CoA synthetase                                334   2e-105   
ref|WP_018403210.1|  acyl-CoA synthetase                                334   2e-105   
ref|XP_004515825.1|  PREDICTED: probable acyl-activating enzyme 2...    337   2e-105   
ref|XP_006574350.1|  PREDICTED: uncharacterized protein LOC100500...    336   2e-105   
ref|XP_004287741.1|  PREDICTED: probable acyl-activating enzyme 2...    336   2e-105   
ref|WP_021489511.1|  acyl-CoA synthetase                                334   2e-105   
ref|XP_004295105.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    335   2e-105   
ref|WP_025130113.1|  acyl-CoA synthetase                                334   2e-105   
ref|WP_011785565.1|  acyl-CoA synthetase                                334   2e-105   
ref|WP_028627208.1|  acyl-CoA synthetase                                334   2e-105   
ref|WP_035672563.1|  acyl-CoA synthetase                                334   2e-105   
ref|XP_008452947.1|  PREDICTED: probable acyl-activating enzyme 1...    334   2e-105   
ref|WP_022990962.1|  MULTISPECIES: acyl-CoA synthetase                  333   2e-105   
ref|WP_028465106.1|  acyl-CoA synthetase                                333   2e-105   
ref|WP_041024350.1|  acyl-CoA synthetase                                334   2e-105   
ref|WP_029610662.1|  acyl-CoA synthetase                                333   3e-105   
ref|WP_034081599.1|  acyl-CoA synthetase                                333   3e-105   
ref|WP_014420961.1|  MULTISPECIES: acyl-CoA synthetase                  333   3e-105   
ref|WP_029610117.1|  acyl-CoA synthetase                                333   3e-105   
gb|AJE15131.1|  acyl-CoA synthetase                                     334   3e-105   
ref|WP_014871845.1|  acyl-CoA synthetase                                333   3e-105   
ref|XP_010938304.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    334   3e-105   
ref|WP_034035131.1|  acyl-CoA synthetase                                333   3e-105   
ref|WP_039804114.1|  acyl-CoA synthetase                                333   3e-105   
gb|EYU36559.1|  hypothetical protein MIMGU_mgv1a004002mg                333   3e-105   
ref|WP_036998289.1|  acyl-CoA synthetase                                333   3e-105   
ref|WP_039593999.1|  acyl-CoA synthetase                                333   3e-105   
ref|XP_010511511.1|  PREDICTED: probable acyl-activating enzyme 1...    335   3e-105   
ref|XP_010061159.1|  PREDICTED: probable acyl-activating enzyme 1...    334   3e-105   
ref|XP_008337936.1|  PREDICTED: probable acyl-activating enzyme 2       335   3e-105   
ref|XP_010918226.1|  PREDICTED: probable acyl-activating enzyme 1...    333   4e-105   
ref|XP_006391320.1|  hypothetical protein EUTSA_v10018337mg             334   4e-105   
ref|WP_028628853.1|  acyl-CoA synthetase                                333   4e-105   
ref|XP_004134236.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    334   4e-105   
ref|WP_010226591.1|  MULTISPECIES: acyl-CoA synthetase                  333   4e-105   
ref|XP_004984635.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    333   5e-105   
ref|XP_010921518.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    332   5e-105   
gb|KFK41022.1|  hypothetical protein AALP_AA2G075200                    334   5e-105   
ref|XP_004243628.1|  PREDICTED: probable acyl-activating enzyme 1...    335   5e-105   
ref|XP_002468582.1|  hypothetical protein SORBIDRAFT_01g048390          334   5e-105   
ref|XP_009127457.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    334   5e-105   
ref|XP_010675229.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    335   6e-105   
gb|ERP40824.1|  acyl-CoA synthetase                                     333   6e-105   
ref|WP_028091971.1|  acyl-CoA synthetase                                333   6e-105   
ref|WP_003151352.1|  acyl-CoA synthetase                                333   6e-105   
ref|XP_004985818.1|  PREDICTED: probable acyl-activating enzyme 1...    333   6e-105   
ref|WP_031770813.1|  acyl-CoA synthetase                                331   6e-105   
ref|XP_002276533.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    333   6e-105   
ref|WP_016491482.1|  putative fatty-acid--CoA ligase                    332   7e-105   
ref|WP_031318593.1|  acyl-CoA synthetase                                333   7e-105   
ref|XP_009370618.1|  PREDICTED: probable acyl-activating enzyme 5...    325   7e-105   
ref|XP_004952113.1|  PREDICTED: probable acyl-activating enzyme 1...    333   7e-105   
ref|XP_008438938.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    333   7e-105   
ref|XP_009389193.1|  PREDICTED: probable acyl-activating enzyme 1...    333   7e-105   
ref|WP_038612915.1|  acyl-CoA synthetase                                332   7e-105   
ref|XP_003516747.1|  PREDICTED: probable acyl-activating enzyme 1...    333   7e-105   
ref|XP_011034884.1|  PREDICTED: probable acyl-activating enzyme 1...    333   8e-105   
ref|XP_006382984.1|  hypothetical protein POPTR_0005s10250g             333   8e-105   
ref|XP_008340623.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    334   9e-105   
ref|NP_001048877.2|  Os03g0133600                                       331   9e-105   
gb|KHN34147.1|  Putative acyl-activating enzyme 1, peroxisomal          332   1e-104   
ref|XP_004985853.1|  PREDICTED: benzoate--CoA ligase, peroxisomal...    333   1e-104   
ref|WP_033079167.1|  acyl-CoA synthetase                                332   1e-104   
gb|AIY34665.1|  4-coumarate:CoA ligase-like protein                     333   1e-104   
ref|XP_010921517.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    333   1e-104   
ref|XP_008776685.1|  PREDICTED: butyrate--CoA ligase AAE11, perox...    333   1e-104   
gb|AAN05508.1|  Putative AMP-binding protein                            332   1e-104   
gb|EAY84228.1|  hypothetical protein OsI_05608                          333   1e-104   
gb|ETV63188.1|  acyl-CoA synthetase                                     332   1e-104   
ref|WP_017940067.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_008944470.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_003114719.1|  acyl-CoA synthetase                                332   1e-104   
emb|CDY64460.1|  BnaCnng43930D                                          333   1e-104   
ref|XP_003629175.1|  Acyl coa ligase acetate-coa synthetase-like ...    337   1e-104   
ref|NP_001045699.1|  Os02g0119200                                       333   1e-104   
ref|XP_009417756.1|  PREDICTED: acetate/butyrate--CoA ligase AAE7...    333   1e-104   
ref|WP_034003857.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_034012662.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_016263067.1|  acyl-CoA synthetase                                332   1e-104   
ref|XP_009367112.1|  PREDICTED: probable acyl-activating enzyme 1...    333   1e-104   
ref|XP_011074098.1|  PREDICTED: probable acyl-activating enzyme 1...    332   1e-104   
ref|NP_001048876.1|  Os03g0133500                                       332   1e-104   
ref|WP_023096432.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_031628868.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_003093598.1|  MULTISPECIES: acyl-CoA synthetase                  332   1e-104   
emb|CEI01360.1|  Acetate/butyrate-CoA ligase AAE7, peroxisomal          332   1e-104   
ref|WP_033984041.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_003121882.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_033944725.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_031631018.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_034029631.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_034027898.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_003118168.1|  acyl-CoA synthetase                                332   1e-104   
ref|WP_034016576.1|  acyl-CoA synthetase                                332   2e-104   
ref|WP_034030641.1|  acyl-CoA synthetase                                332   2e-104   
ref|WP_033949508.1|  acyl-CoA synthetase                                332   2e-104   



>gb|EYU25687.1| hypothetical protein MIMGU_mgv1a023709mg, partial [Erythranthe 
guttata]
Length=538

 Score =   474 bits (1221),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 237/312 (76%), Positives = 268/312 (86%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTWGMAAVGG NVCLRRVD  SI  A+E + VTHMCGAPVVLNML N+     +
Sbjct  227   HANGWSYTWGMAAVGGANVCLRRVDAPSIYQALESYKVTHMCGAPVVLNMLTNHPC---S  283

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV+I+TAGAPPPAAVL R ESLGF VSHGYGLTETGGL VTCAWK+EW++L   E
Sbjct  284   KPLENPVNIMTAGAPPPAAVLGRAESLGFVVSHGYGLTETGGLVVTCAWKQEWNHLEGAE  343

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV +VGFTG DVV   +G+SV RDG+ +GEIVLRG S+MLGYLKD EGTSKC
Sbjct  344   RARLKARQGVGTVGFTGMDVVEADSGESVPRDGSTMGEIVLRGGSLMLGYLKDAEGTSKC  403

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+E+GWFYTGDVGV+HPDGY+EVKDR KDVII GGENLSSVEVE+VLY HPAV+EAAVVA
Sbjct  404   MRENGWFYTGDVGVVHPDGYLEVKDRSKDVIICGGENLSSVEVEAVLYSHPAVNEAAVVA  463

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  +  KPTEKE+REFCK RLPL+MVPR VVF   LPKTSTGK+
Sbjct  464   RPDRFWGETPCAFVSLKDEVAEKPTEKEIREFCKARLPLYMVPRMVVFKDELPKTSTGKL  523

Query  335   QKFLLRDIARDL  300
             QKFLLRD+A+ L
Sbjct  524   QKFLLRDMAKHL  535



>ref|XP_011097991.1| PREDICTED: probable acyl-activating enzyme 4 [Sesamum indicum]
Length=635

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/313 (76%), Positives = 261/313 (83%), Gaps = 3/313 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW Y W MAAVGG NVCLRRVD  SI  A+ER+ VTHMCGAPVVLNML N+      
Sbjct  313   HANGWGYVWAMAAVGGANVCLRRVDAPSIYQALERYKVTHMCGAPVVLNMLTNHPGR---  369

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ++TAGAPPPAAVL R ESLGF VSHGYGLTETGG  VTCAWK+EW+NL  PE
Sbjct  370   KPLDSPVHVMTAGAPPPAAVLGRAESLGFIVSHGYGLTETGGPVVTCAWKQEWNNLAGPE  429

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV  +G    DVV P +G+SV RDG  +GEIVLRG SVMLGYLKDPEGTSKC
Sbjct  430   RAQLKARQGVGMIGCPEVDVVEPDSGESVARDGCTMGEIVLRGGSVMLGYLKDPEGTSKC  489

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGV+HPDGY+EVKDR KDVII GGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  490   MREDGWFYTGDVGVMHPDGYLEVKDRSKDVIICGGENLSSVEVESVLYSHPAVNEAAVVA  549

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPDK+WGE PCAFVSLK+ +  KPTEKE+REFCK RLPL+MVPR VVF   LPKTSTGKI
Sbjct  550   RPDKYWGEIPCAFVSLKEEVFEKPTEKEVREFCKARLPLYMVPRMVVFKEELPKTSTGKI  609

Query  335   QKFLLRDIARDLS  297
             QKFLLRD+A+ L 
Sbjct  610   QKFLLRDMAKHLQ  622



>ref|XP_010250375.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Nelumbo 
nucifera]
Length=549

 Score =   460 bits (1184),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 230/315 (73%), Positives = 262/315 (83%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTN+CLR+ D A+I  AI RHGVTHMCGAPVVLNMLAN  +    
Sbjct  234   HANGWSYPWGMAAVGGTNICLRKFDAATIYAAIRRHGVTHMCGAPVVLNMLANAPD---A  290

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPPAAVL R ESLGF VSHGYGLTET GL V CAWKR+W+ LPA E
Sbjct  291   RPLKQPVQILTAGAPPPAAVLFRTESLGFIVSHGYGLTETAGLVVACAWKRQWNRLPATE  350

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G    DV+ P +G SVKRDG+ +GEIVLRG  VMLGYLKDP GTSKC
Sbjct  351   RARLKARQGVRTIGMAEVDVIDPESGASVKRDGSSLGEIVLRGGCVMLGYLKDPAGTSKC  410

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M + GWFYTGDVGVIHPDGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  411   MSDKGWFYTGDVGVIHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK     +P+EKE+ E+C+ RLP +MVP+ VVF   LPKTSTGKI
Sbjct  471   RPDEFWGETPCAFISLKPQ-AQRPSEKEIVEYCRARLPHYMVPKTVVFRDELPKTSTGKI  529

Query  335   QKFLLRDIARDLSSA  291
             QKFLLRDIA+ L ++
Sbjct  530   QKFLLRDIAKSLGAS  544



>gb|AGA17921.1| CCL4 [Humulus lupulus]
Length=556

 Score =   459 bits (1182),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 265/317 (84%), Gaps = 3/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTN+CLR+ D   I D I+RHGVTHMCGAPVVLNML+N      +
Sbjct  236   HANGWSYPWGMAAVGGTNICLRKFDSEIIYDMIKRHGVTHMCGAPVVLNMLSNAPG---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL + V I+TAGAPPP+AVL R ESLGF VSHGYGLTET GL V+CAWK+EW++LPA E
Sbjct  293   EPLKTTVQIMTAGAPPPSAVLFRTESLGFAVSHGYGLTETAGLVVSCAWKKEWNHLPATE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV +V  T  DVV P TG +VKRDG+ +GE+VLRG SVMLGYLKDPEGT+K 
Sbjct  353   RARLKSRQGVGTVMQTKIDVVDPVTGAAVKRDGSTLGEVVLRGGSVMLGYLKDPEGTAKS  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M  DGWFYTGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVES+LY HP + EAAVVA
Sbjct  413   MTADGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESILYSHPDILEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLKKG+  KPTEKE+ E+C+ +LP +MVP+ VVF   LPKTSTGK+
Sbjct  473   RPDEFWGETPCAFVSLKKGLTKKPTEKEIVEYCRSKLPRYMVPKTVVFKEELPKTSTGKV  532

Query  335   QKFLLRDIARDLSSADA  285
             QKF+LRD+AR + SA A
Sbjct  533   QKFILRDMARGMGSATA  549



>gb|EYU25690.1| hypothetical protein MIMGU_mgv1a003993mg [Erythranthe guttata]
Length=550

 Score =   459 bits (1181),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 262/315 (83%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTWGMAA GGTNVCLR+ D  +I  AI ++ VTHMCGAPVVLN+L++  +    
Sbjct  235   HANGWSYTWGMAAAGGTNVCLRKFDADAIYSAIRKYNVTHMCGAPVVLNLLSSIPDG---  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILTAGAPPPAAVL R ESLGF VSHGYGLTETGGL V C WK++W+  PA E
Sbjct  292   KPLERPVYILTAGAPPPAAVLLRTESLGFVVSHGYGLTETGGLVVCCTWKKKWNKFPAAE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR+ G    DV+ P +GKSV RDG  +GEIVLRG SVMLGYLKD EGTSKC
Sbjct  352   KARLKARQGVRTTGMAEVDVIEPESGKSVVRDGKTLGEIVLRGGSVMLGYLKDSEGTSKC  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK +GWF+TGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  412   MK-NGWFFTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+S+K G+I KPTEKE+ EFC+ RLP +MVP+ VVFM  LPKTSTGKI
Sbjct  471   RPDEFWGETPCAFLSVKDGVIEKPTEKEVMEFCRARLPHYMVPKTVVFMEELPKTSTGKI  530

Query  335   QKFLLRDIARDLSSA  291
             QKF+LRD+ + + S+
Sbjct  531   QKFVLRDMTKAMGSS  545



>ref|XP_006343310.1| PREDICTED: probable acyl-activating enzyme 9-like [Solanum tuberosum]
Length=616

 Score =   458 bits (1178),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 232/313 (74%), Positives = 261/313 (83%), Gaps = 5/313 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRV-DPASINDAIERHGVTHMCGAPvvlnmlanynnyaN  1059
             HANGW Y W MAAVGGTNVCLRR  + ASI +AI++H VTHMCGAPVVLNML+ Y+    
Sbjct  307   HANGWGYCWAMAAVGGTNVCLRRSHEAASIYEAIQQHKVTHMCGAPVVLNMLSTYSKR--  364

Query  1058  TKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAP  879
              KPL SPV +LTAGAPPPAAVL R ESLGF +SHGYGLTETGG AVTCAWK+EW++L   
Sbjct  365   -KPLDSPVHLLTAGAPPPAAVLDRTESLGFVISHGYGLTETGGPAVTCAWKQEWNSLTNS  423

Query  878   ERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             ERA +KSRQGVR VGFT  DVV P TG S++R+G  +GEIVL+G SVMLGYLKDPEGTSK
Sbjct  424   ERATLKSRQGVRMVGFTEVDVVDPETGISIERNGMAIGEIVLKGGSVMLGYLKDPEGTSK  483

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
             CMK DGWFYTGDVGV+H DGY+EVKDRLKDVII GGEN+SSVEVES+LY HPAV+EAAVV
Sbjct  484   CMKNDGWFYTGDVGVMHSDGYLEVKDRLKDVIICGGENISSVEVESILYKHPAVNEAAVV  543

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             ARPD +WGETPC FVSLKK    K TEKE+R+FCKE LPL+MVPR VV    LPKT+TGK
Sbjct  544   ARPDNYWGETPCVFVSLKKD-ACKVTEKELRDFCKENLPLYMVPRTVVIEDDLPKTATGK  602

Query  338   IQKFLLRDIARDL  300
             IQK+LLRD A+ L
Sbjct  603   IQKYLLRDKAKSL  615



>ref|XP_007034413.1| Acyl activating enzyme 5 [Theobroma cacao]
 gb|EOY05339.1| Acyl activating enzyme 5 [Theobroma cacao]
Length=609

 Score =   457 bits (1175),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 224/317 (71%), Positives = 265/317 (84%), Gaps = 3/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+TWG+AAVGG NVC+R+ D   I   I++HGVTHMCGAPVVL+ML+N+      
Sbjct  291   HANGWSFTWGIAAVGGINVCVRKFDAPIIYSLIKKHGVTHMCGAPVVLSMLSNFPE---I  347

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ILTAGAPPPAAVL R E+LGF VSHGYGLTETGGL V+CAWKR W+ LPA E
Sbjct  348   KPLQSPVKILTAGAPPPAAVLFRTEALGFIVSHGYGLTETGGLVVSCAWKRGWNKLPATE  407

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G T ADVV   +G SVKRDG+ +GEIVLRG  +MLGYLKDP GT+KC
Sbjct  408   RARLKARQGVRTLGMTEADVVDTESGLSVKRDGSTLGEIVLRGACIMLGYLKDPNGTNKC  467

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MKE+GWF+TGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVES+LY HPA+ EAAVVA
Sbjct  468   MKENGWFFTGDVGVMHPDGYMEIKDRSKDVIISGGENLSSVEVESILYNHPAIIEAAVVA  527

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WGETPCAFVSLK G+  KP+EKE+ E+C+ +LP +MVP+ VVF   LPKTSTGKI
Sbjct  528   RPDDYWGETPCAFVSLKAGLTQKPSEKEIIEYCRAKLPHYMVPKTVVFKEELPKTSTGKI  587

Query  335   QKFLLRDIARDLSSADA  285
             QKFLLR+IA+ + S+  
Sbjct  588   QKFLLREIAKGMGSSST  604



>ref|XP_007019243.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
 gb|EOY16468.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
Length=560

 Score =   455 bits (1170),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 223/320 (70%), Positives = 264/320 (83%), Gaps = 7/320 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS  WGMAAVGGTN+CLR+++P+ I   IE+HGVTHMCGAPVVLNML+N ++    
Sbjct  237   HANGWSLPWGMAAVGGTNICLRKIEPSVICRLIEQHGVTHMCGAPVVLNMLSNSSHL---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPPA VL R ES+GF VSHGYGLTETGG+ VTCAWK++W+ LP  E
Sbjct  294   EPLNRPVQILTAGAPPPAPVLGRTESMGFVVSHGYGLTETGGVVVTCAWKKKWNKLPLTE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV S  FT  DVV P TG+SVKRDG  +GE+VLRG  VMLGYLKDPEGTS C
Sbjct  354   RARLKARQGVNSAVFTEVDVVDPETGESVKRDGKTLGEVVLRGGCVMLGYLKDPEGTSNC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+E+GWF +GDVGVIHPDGY+E+KDR KD+IISGGEN+SS E+ESVLY HPAV+EAAVVA
Sbjct  414   MRENGWFCSGDVGVIHPDGYLEIKDRSKDIIISGGENISSPEIESVLYSHPAVNEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGI----IAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTS  348
             RPDKFWGETPCAFVSLKK I      KP+EKE+ E+C+E+LP +M P+ VVF   LPKTS
Sbjct  474   RPDKFWGETPCAFVSLKKNIDDELTQKPSEKEIMEYCREKLPHYMAPKTVVFEEELPKTS  533

Query  347   TGKIQKFLLRDIARDLSSAD  288
             TGK+QKF+LR+IA+ +S  D
Sbjct  534   TGKVQKFILREIAKAMSGVD  553



>gb|EPS62843.1| hypothetical protein M569_11943, partial [Genlisea aurea]
Length=556

 Score =   454 bits (1169),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 263/314 (84%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTWGM AVGG N+CLR+ D A++N AI  HGVTH+CGAPVVLNML N ++    
Sbjct  238   HANGWSYTWGMGAVGGANICLRKFDAAAVNAAIREHGVTHLCGAPVVLNMLCNVSD---Q  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV +LTAGAPPPAAVL R ESLGF VSHGYGLTETGGL V C+WKR+W+  PA E
Sbjct  295   RPLEKPVHVLTAGAPPPAAVLFRTESLGFVVSHGYGLTETGGLVVCCSWKRKWNKFPAGE  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++G T  DVV P +G+ VKRDG  +GE+VL G SVMLGYLKDPEGT+KC
Sbjct  355   RARLKSRQGVRTLGMTEMDVVEPESGRRVKRDGATLGEVVLSGGSVMLGYLKDPEGTAKC  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK +GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  415   MK-NGWFYTGDVGVMHSDGYLEIKDRSKDVIISGGENLSSVEVESVLYAHPAVNEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAF+SLK+  + KP+EK++ +FC+++LP FMVP+ VVF   LPKT+TGKI
Sbjct  474   RPDDFWGETPCAFISLKQQQLPKPSEKDIIQFCRDKLPRFMVPKTVVFKEELPKTATGKI  533

Query  335   QKFLLRDIARDLSS  294
             QKF+LRD+A+ L S
Sbjct  534   QKFVLRDLAKALGS  547



>gb|EYU25663.1| hypothetical protein MIMGU_mgv1a019009mg [Erythranthe guttata]
Length=529

 Score =   453 bits (1166),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 262/315 (83%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTWGMAA GGTN+CLR+ D  +I  AI+++ VTHMCGAPVVLNML+N  +    
Sbjct  214   HANGWSYTWGMAAAGGTNICLRKFDADAIYFAIKKYNVTHMCGAPVVLNMLSNIPDG---  270

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV I+T+GAPPP AVL R ESLGF VSHGYGLTETGG+ + C WK++W+  PA E
Sbjct  271   KPLERPVYIMTSGAPPPPAVLLRTESLGFVVSHGYGLTETGGIVICCTWKKKWNKYPAAE  330

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR++G    DV+ P +GKSV RDG  +GEIVLRG SVMLGYLK+ EGTSKC
Sbjct  331   KARLKARQGVRTIGMAKVDVIEPESGKSVSRDGKTLGEIVLRGGSVMLGYLKNSEGTSKC  390

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK +GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  391   MK-NGWFYTGDVGVMHSDGYLEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVA  449

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+S+K G+I KPTEKE+ EFC+ RLP +MVP+ VVFM  LPKTSTGKI
Sbjct  450   RPDEFWGETPCAFLSVKDGVIEKPTEKEVMEFCRARLPHYMVPKTVVFMEELPKTSTGKI  509

Query  335   QKFLLRDIARDLSSA  291
             QKFLLRD A+ + S+
Sbjct  510   QKFLLRDTAKAMGSS  524



>emb|CDP01727.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   451 bits (1160),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 217/315 (69%), Positives = 264/315 (84%), Gaps = 3/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTN+CLR+ D A +  AI +H VTH+CGAPVVLNM++N+      
Sbjct  236   HANGWSYPWGMAAVGGTNICLRKFDAAVVYSAIRQHNVTHLCGAPVVLNMISNFPMG---  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV+I+TAGAPPPAAVL R E+LGF+VSHGYGLTETGGL V+C WK +W+ LPA E
Sbjct  293   EPLKNPVEIMTAGAPPPAAVLLRTEALGFKVSHGYGLTETGGLVVSCTWKNKWNRLPATE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G    DV+ P TG SVKRDG+ +GE+VLRG  +MLGYLKDPEGTSK 
Sbjct  353   RARLKARQGVRTLGMAEIDVIEPETGVSVKRDGSTLGELVLRGGCIMLGYLKDPEGTSKS  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              +E+GWFYTGDV V+HPDGY+E+KDR KDVIISGGENLSSVEVESVLYMHPAV+EAAVVA
Sbjct  413   TRENGWFYTGDVAVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYMHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  +  +P EK++ EFC+ +LP +MVP+ VVF   LPKTSTGKI
Sbjct  473   RPDEFWGETPCAFVSLKADVKQRPAEKDVIEFCRGKLPKYMVPKTVVFRQELPKTSTGKI  532

Query  335   QKFLLRDIARDLSSA  291
             QKF+LR++A+ + S+
Sbjct  533   QKFVLREMAKAIGSS  547



>ref|XP_004234497.1| PREDICTED: probable acyl-activating enzyme 9 [Solanum lycopersicum]
Length=616

 Score =   452 bits (1163),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 229/313 (73%), Positives = 256/313 (82%), Gaps = 5/313 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRV-DPASINDAIERHGVTHMCGAPvvlnmlanynnyaN  1059
             HANGW + W MAAVGGTNVCLRR  D A I +AI++H VTHMCGAPVVLNML+ Y     
Sbjct  307   HANGWGFCWAMAAVGGTNVCLRRSHDAALIYEAIQQHKVTHMCGAPVVLNMLSTYTKR--  364

Query  1058  TKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAP  879
              KPL SPV ILTAGAPPPAAVL R ESLGF +SHGYGLTETGG AVTCAWK+EW++L   
Sbjct  365   -KPLDSPVQILTAGAPPPAAVLDRTESLGFVISHGYGLTETGGPAVTCAWKQEWNSLTNS  423

Query  878   ERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             ERA +KSRQGV+ VGFT  DVV P TG S++R+G  VGEIVL+G SVMLGYLKDPEGTSK
Sbjct  424   ERATLKSRQGVKMVGFTDVDVVDPETGISIERNGMAVGEIVLKGGSVMLGYLKDPEGTSK  483

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
             CMK DGWFYTGDVGV+H DGY+EVKDR KDVII GGEN+SSVE+ES+LY HPAV+EAAVV
Sbjct  484   CMKNDGWFYTGDVGVMHSDGYLEVKDRSKDVIICGGENISSVEIESILYKHPAVNEAAVV  543

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             ARPD +WGETPC FVSLK       TEKE+REFCKE LPL+MVPR VV    LPKT+TGK
Sbjct  544   ARPDNYWGETPCVFVSLKND-ARNVTEKELREFCKENLPLYMVPRTVVIQDDLPKTATGK  602

Query  338   IQKFLLRDIARDL  300
             IQK+LLRD A+ L
Sbjct  603   IQKYLLRDKAKSL  615



>ref|XP_009620938.1| PREDICTED: probable acyl-activating enzyme 6 [Nicotiana tomentosiformis]
Length=546

 Score =   448 bits (1153),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 259/312 (83%), Gaps = 5/312 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMA VGGTN+CLR+ D   I D+IE+H VTH+C APVVLNML+N  +   +
Sbjct  233   HANGWSYPWGMAVVGGTNICLRKFDAKIIYDSIEKHNVTHICAAPVVLNMLSNSPD---S  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV I+TAG+PPPA+VL R ESLGF V HGYGLTETGGL ++C WK +W+ LPA E
Sbjct  290   KPLKNPVYIMTAGSPPPASVLFRTESLGFVVHHGYGLTETGGLVISCTWKNQWNKLPAAE  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++G TG DVV P +G SVKRDG  +GEIVL+G  VMLGYLKDPEGT KC
Sbjct  350   RARLKSRQGVRTIGMTGVDVVDPESGVSVKRDGTTLGEIVLKGGCVMLGYLKDPEGTLKC  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK+DGWFYTGDV V+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY HPA++EAAVVA
Sbjct  410   MKDDGWFYTGDVAVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYAHPAINEAAVVA  469

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK     K +EK++ EFC+ +LP +MVP+ V+F   LPKTSTGKI
Sbjct  470   RPDEFWGETPCAFVSLKGK--EKASEKDIIEFCRAKLPHYMVPKTVIFKEELPKTSTGKI  527

Query  335   QKFLLRDIARDL  300
             QKF+LRDIA+ +
Sbjct  528   QKFVLRDIAKGM  539



>ref|XP_009789560.1| PREDICTED: probable acyl-activating enzyme 6 [Nicotiana sylvestris]
Length=616

 Score =   451 bits (1159),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 230/313 (73%), Positives = 259/313 (83%), Gaps = 5/313 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRR-VDPASINDAIERHGVTHMCGAPvvlnmlanynnyaN  1059
             HANGW + WGMAAVGGTNVCLRR  D +SI +AI +H VTHMCGAPVVLNML+ Y     
Sbjct  307   HANGWGFCWGMAAVGGTNVCLRRGHDASSIYEAIHQHKVTHMCGAPVVLNMLSTYPKR--  364

Query  1058  TKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAP  879
              +PL SPV I TAGAPPP AVL R ESLGF +SHGYGLTETGG AVTCAWK++WD+LP  
Sbjct  365   -QPLDSPVYIYTAGAPPPPAVLDRTESLGFVISHGYGLTETGGPAVTCAWKQDWDHLPQS  423

Query  878   ERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             ERA +KSRQGVR VGFT  DVV   TG S++R+G  +GEIVLRG +VMLGYLKDPEGTSK
Sbjct  424   ERAQLKSRQGVRMVGFTEVDVVDFETGISIERNGIAIGEIVLRGGTVMLGYLKDPEGTSK  483

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
             CMK DGWFYTGDVGV+H DGY+EVKDRLKDVII GGEN+SSVEVES+LY HPAV+EAAVV
Sbjct  484   CMKNDGWFYTGDVGVMHSDGYLEVKDRLKDVIICGGENISSVEVESILYKHPAVNEAAVV  543

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             A+PDKFWGETPCAF+SLK     K TEKE+R+FCKE LPL+MVPR VV    LPKT+TGK
Sbjct  544   AKPDKFWGETPCAFISLKTD-AEKMTEKELRDFCKENLPLYMVPRTVVIEDELPKTATGK  602

Query  338   IQKFLLRDIARDL  300
             IQK+LLR+ AR L
Sbjct  603   IQKYLLREKARSL  615



>ref|XP_011004907.1| PREDICTED: probable acyl-activating enzyme 6 [Populus euphratica]
Length=553

 Score =   448 bits (1152),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 221/314 (70%), Positives = 260/314 (83%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTN+CLR+ D  +I+  I+RHGVTHMCGAPVVL ML N  N    
Sbjct  235   HANGWSYPWGIAAVGGTNICLRKFDGPTIHSLIKRHGVTHMCGAPVVLTMLTNSTNK---  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPP+AVL R ESLGF VSHGYGLTET GL V+CAWK +W+  PA E
Sbjct  292   EPLKNPVQILTAGAPPPSAVLFRTESLGFVVSHGYGLTETAGLVVSCAWKPKWNTFPASE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV+ VGFT  DVV P +GK VKRDG  +GE+VL+G  VMLGYLKDP GTSKC
Sbjct  352   RARLKARQGVKIVGFTEIDVVEPESGKRVKRDGAALGEVVLKGGCVMLGYLKDPTGTSKC  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVE+ESVLY HPAV+EAAVVA
Sbjct  412   MK-DGWFYTGDVGVMHQDGYLEIKDRSKDVIISGGENISSVEIESVLYTHPAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK G+  KP+EK++ +FC+E++P +MVP+ VVF   LPKTSTGKI
Sbjct  471   RPDEFWGETPCAFVGLKDGLTQKPSEKDIIDFCREKMPHYMVPKTVVFKDELPKTSTGKI  530

Query  335   QKFLLRDIARDLSS  294
             QKF+LR IA+ + S
Sbjct  531   QKFVLRGIAKGMGS  544



>ref|XP_002521743.1| AMP dependent ligase, putative [Ricinus communis]
 gb|EEF40553.1| AMP dependent ligase, putative [Ricinus communis]
Length=556

 Score =   447 bits (1151),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 263/315 (83%), Gaps = 3/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMAAVGGTN+C+R+ D +SI   I+RHGVTHMCGAPVVLNML N  +    
Sbjct  240   HANGWSFPWGMAAVGGTNICIRKFDASSIYGLIKRHGVTHMCGAPVVLNMLTNSPD---N  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPPAAVL R ESLGF VSHGYGLTET GL V+CAWK +W+ +PA E
Sbjct  297   EPLKRPVHILTAGAPPPAAVLFRTESLGFVVSHGYGLTETAGLVVSCAWKPKWNTVPASE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR  GFT  DV+ P TG SVKRDG  +GEIVLRG  VM+GYLKDP+GTSKC
Sbjct  357   RARLKARQGVRIAGFTEIDVIDPKTGLSVKRDGLSLGEIVLRGGCVMMGYLKDPDGTSKC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K+DGWFYTGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVESVLY +P V+EAAVVA
Sbjct  417   LKDDGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENISSVEVESVLYSNPVVNEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD++WGETPCAFVSL+ G   K +EK++ E+C+E++P +MVP+ VVF   LPKTSTGKI
Sbjct  477   RPDEYWGETPCAFVSLRDGAREKVSEKDIIEYCREKMPHYMVPKTVVFKEELPKTSTGKI  536

Query  335   QKFLLRDIARDLSSA  291
             QKF+LRDIA+ + ++
Sbjct  537   QKFVLRDIAKAMGAS  551



>ref|XP_009593059.1| PREDICTED: probable acyl-activating enzyme 6 [Nicotiana tomentosiformis]
Length=616

 Score =   449 bits (1155),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/314 (73%), Positives = 258/314 (82%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRR-VDPASINDAIERHGVTHMCGAPvvlnmlanynnyaN  1059
             HANGW + WGMAAVGGTNVCLRR  D +SI +AI +H VTHMCGAPVVLNML+ Y     
Sbjct  307   HANGWGFCWGMAAVGGTNVCLRRGHDASSIYEAIHQHKVTHMCGAPVVLNMLSTYPKK--  364

Query  1058  TKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAP  879
              +PL SPV I TAGAPPP AVL R ESLGF +SHGYGLTETGG AVTCAWK+EW++LP  
Sbjct  365   -QPLDSPVHIYTAGAPPPPAVLDRTESLGFVISHGYGLTETGGPAVTCAWKQEWNHLPQS  423

Query  878   ERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             ERA +KSRQGVR VGFT  DVV   TG S++R+G  +GEIVLRG SVMLGYLKDPEGTSK
Sbjct  424   ERAQLKSRQGVRMVGFTEVDVVDFETGISIERNGIAIGEIVLRGGSVMLGYLKDPEGTSK  483

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
             CMK DGWFYTGDVGV+H DGY+EVKDRLKDVII GGEN+SSVEVES+LY H AV+EAAVV
Sbjct  484   CMKNDGWFYTGDVGVMHSDGYLEVKDRLKDVIICGGENISSVEVESILYKHSAVNEAAVV  543

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             ARPD +WGETPCAF+SLK     K TEKE+R+FCKE LPL+MVPR VV    LPKT+TGK
Sbjct  544   ARPDNYWGETPCAFISLKTD-AEKMTEKELRDFCKENLPLYMVPRTVVIEDELPKTATGK  602

Query  338   IQKFLLRDIARDLS  297
             IQK+LLR+ AR L+
Sbjct  603   IQKYLLREKARSLA  616



>gb|KDO64308.1| hypothetical protein CISIN_1g045072mg [Citrus sinensis]
Length=556

 Score =   445 bits (1144),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/312 (71%), Positives = 256/312 (82%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTNVCLR+ D A I   I +HGVTHMCGAPVVLNM++N      +
Sbjct  240   HANGWSYPWGMAAVGGTNVCLRKFDAAVIYKMIRQHGVTHMCGAPVVLNMISNLPR---S  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPAAVL R ESLGF VSHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  297   EPLRNPVHILTAGAPPPAAVLFRTESLGFLVSHGYGLTETAGLVVSCAWKNKWNRLPATE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+V FT  DV+   +G SV  DG  +GEIV RG S+MLGYLKDP GT KC
Sbjct  357   RARMKSRQGVRTVCFTEIDVIDSESGLSVSHDGASLGEIVFRGGSMMLGYLKDPNGTRKC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK+DGWFYTGDVGVIH DGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  417   MKDDGWFYTGDVGVIHADGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK  +  KPTEKE+ E+C+ RLP +MVP+ VVF   LPKTSTGKI
Sbjct  477   RPDEFWGETPCAFLSLKAELEKKPTEKEIIEYCRARLPRYMVPKTVVFKEELPKTSTGKI  536

Query  335   QKFLLRDIARDL  300
             +KF LR++A+ +
Sbjct  537   KKFELREMAKAM  548



>emb|CAN64147.1| hypothetical protein VITISV_042774 [Vitis vinifera]
Length=537

 Score =   444 bits (1141),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 224/317 (71%), Positives = 258/317 (81%), Gaps = 3/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWGMAAVGGTNVCLR+ D   I DAI ++G+THMC APVVLNML+NY N+   
Sbjct  221   HGNGWTFTWGMAAVGGTNVCLRKFDARIIYDAIPKYGITHMCAAPVVLNMLSNYPNH---  277

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPP +VL R ESLGF VSHGYG+TET G+ V+CAWK +WD  PA E
Sbjct  278   QPLGYPVKILTAGAPPPYSVLLRTESLGFVVSHGYGMTETAGVVVSCAWKPQWDRFPASE  337

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+V  T  DVV P +G SVKRDG+ +GEIVLRG  +MLGYLKDPEGTSKC
Sbjct  338   RARVKARQGVRTVVMTEVDVVDPKSGVSVKRDGSSLGEIVLRGACIMLGYLKDPEGTSKC  397

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M ++GW YTGDV V+HPDGYIE+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  398   MSKEGWLYTGDVAVMHPDGYIEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVA  457

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFVSLK G   KPT KEM E+C+ R+P +MVP+ VVF   LPKTSTGKI
Sbjct  458   RPDDFWGETPCAFVSLKPGSPDKPTAKEMMEYCRARMPHYMVPKTVVFKEELPKTSTGKI  517

Query  335   QKFLLRDIARDLSSADA  285
             QKF LRDIA+ +  + A
Sbjct  518   QKFKLRDIAKAMGCSPA  534



>ref|XP_006371374.1| AMP-binding family protein [Populus trichocarpa]
 gb|ERP49171.1| AMP-binding family protein [Populus trichocarpa]
Length=550

 Score =   444 bits (1141),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 259/315 (82%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTN+CLR+ D  +I   I+RHGVTHMCGAPVVL ML N  N    
Sbjct  235   HANGWSYPWGIAAVGGTNICLRKFDGPTIYSLIKRHGVTHMCGAPVVLTMLTNSTNK---  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +P+ ILTAGAPPP+AVL R ESLGF VSHGYGLTET GL V+CAWK +W+  P  E
Sbjct  292   EPLRNPIQILTAGAPPPSAVLFRTESLGFVVSHGYGLTETAGLVVSCAWKPKWNTFPPSE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV+ VGFT  DV+ P +GKSVKRDG  +GE+VL+G  +MLGYLKDP GTSKC
Sbjct  352   RARLKARQGVKIVGFTEIDVLEPESGKSVKRDGVALGEVVLKGGCIMLGYLKDPTGTSKC  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVE+ESVLY HPAV+EAAVVA
Sbjct  412   MK-DGWFYTGDVGVMHQDGYLEIKDRSKDVIISGGENISSVEIESVLYTHPAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK G+  KP EK++ +FC+E++P +MVP+ VVF   LPKTSTGKI
Sbjct  471   RPDEFWGETPCAFVGLKDGLTQKPGEKDIIDFCREKMPHYMVPKTVVFKDELPKTSTGKI  530

Query  335   QKFLLRDIARDLSSA  291
             QKF+LR IA+ + S+
Sbjct  531   QKFVLRGIAKGMGSS  545



>ref|XP_006481329.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Citrus sinensis]
Length=556

 Score =   444 bits (1141),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 221/312 (71%), Positives = 256/312 (82%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTNVCLR+ D A I   I +HGVTHMCGAPVVLNM++N      +
Sbjct  240   HANGWSYPWGMAAVGGTNVCLRKFDAAVIYKMIRQHGVTHMCGAPVVLNMISNLPR---S  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPAAVL R ESLGF VSHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  297   EPLRNPVHILTAGAPPPAAVLFRTESLGFLVSHGYGLTETAGLVVSCAWKNKWNRLPATE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+V FT  DV+   +G SV  DG  +GEIV RG S+MLGYLKDP GT +C
Sbjct  357   RARMKSRQGVRTVCFTEIDVIDSESGLSVSHDGASLGEIVFRGGSMMLGYLKDPNGTRQC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK+DGWFYTGDVGVIH DGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  417   MKDDGWFYTGDVGVIHADGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK  +  KPTEKE+ E+C+ RLP +MVP+ VVF   LPKTSTGKI
Sbjct  477   RPDEFWGETPCAFLSLKAELEKKPTEKEIIEYCRARLPRYMVPKTVVFKEELPKTSTGKI  536

Query  335   QKFLLRDIARDL  300
             +KF LR++A+ +
Sbjct  537   KKFELREMAKAM  548



>ref|XP_009788388.1| PREDICTED: probable acyl-activating enzyme 6 [Nicotiana sylvestris]
Length=551

 Score =   443 bits (1139),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/312 (70%), Positives = 255/312 (82%), Gaps = 5/312 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMA VGGTN+CLR+ D   I D+I++H VTH+C APVVLNML+N  +   +
Sbjct  233   HANGWSYPWGMAVVGGTNICLRKFDAKIIYDSIKKHNVTHICAAPVVLNMLSNSPD---S  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILTAG+PPPAAVL R ESLGF V HGYGLTETGGL V+C WK  W+ LPA E
Sbjct  290   KPLKHSVYILTAGSPPPAAVLFRTESLGFVVHHGYGLTETGGLVVSCTWKNHWNKLPAEE  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++G T  DVV P +G SVKRDG  +GEIVL+G  +MLGYLKDPEGTSKC
Sbjct  350   RARLKSRQGVRTIGMTEVDVVDPESGVSVKRDGTTLGEIVLKGGCIMLGYLKDPEGTSKC  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK+DGWFYTGDV V+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY HPA++EAAVVA
Sbjct  410   MKDDGWFYTGDVAVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTHPAINEAAVVA  469

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSL      K +EK++ EFC+ +LP +MVP+ V+F   LPKTSTGKI
Sbjct  470   RPDEFWGETPCAFVSLNGK--EKASEKDIIEFCRAKLPHYMVPKTVIFKQELPKTSTGKI  527

Query  335   QKFLLRDIARDL  300
             QKF+LRDIA+ +
Sbjct  528   QKFVLRDIAKSM  539



>gb|KDO55429.1| hypothetical protein CISIN_1g044926mg [Citrus sinensis]
Length=569

 Score =   443 bits (1139),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 261/314 (83%), Gaps = 3/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW + W MAAVGGTN+C+R+ D + I D I RHGVTHMCGAPVVLNML+NY +    
Sbjct  242   HSNGWCFPWAMAAVGGTNICIRKFDASIIFDLIRRHGVTHMCGAPVVLNMLSNYRDPDK-  300

Query  1055  KPL--TSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPA  882
             KPL    PV ++TAGAPPPAAVL R ESLGF+VSHGYGLTETGG+ V+CAWKR W+ LPA
Sbjct  301   KPLKLAKPVHLVTAGAPPPAAVLLRTESLGFKVSHGYGLTETGGIVVSCAWKRNWNLLPA  360

Query  881   PERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTS  702
              E+A +K+RQGV++   T  DV+ P +G S KRDG+ +GEIVLRG  +MLGYLKDP GT 
Sbjct  361   AEKAKLKARQGVKTTALTEVDVLDPKSGVSAKRDGSTLGEIVLRGGCIMLGYLKDPIGTR  420

Query  701   KCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAV  522
             KCM +DGWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAV
Sbjct  421   KCMTDDGWFYTGDVGVMHSDGYLEIKDRSKDVIISGGENLSSVEVESVLYSNPAVNEAAV  480

Query  521   VARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             VARPD+FWGETPCAFVSLK+G  +KPTEKEM E+C+ RLP +MVP+ VVFM  LPKTSTG
Sbjct  481   VARPDEFWGETPCAFVSLKEGSKSKPTEKEMIEYCRGRLPHYMVPKTVVFMDELPKTSTG  540

Query  341   KIQKFLLRDIARDL  300
             KIQKF+LR+IA ++
Sbjct  541   KIQKFVLREIAENM  554



>ref|XP_010648868.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal isoform 
X1 [Vitis vinifera]
 ref|XP_010648869.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal isoform 
X1 [Vitis vinifera]
 ref|XP_010648870.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal isoform 
X2 [Vitis vinifera]
Length=588

 Score =   443 bits (1139),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 261/315 (83%), Gaps = 3/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMAAVGGTNVCLR+ D + I +AI  H VTHMCGAPVVLNML+N+     T
Sbjct  272   HANGWSFPWGMAAVGGTNVCLRKFDASVIYEAIRVHRVTHMCGAPVVLNMLSNWPG---T  328

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPAA+L R ES GF VSHGYGLTETGGL V+C WK++W+ LPA E
Sbjct  329   EPLKNPVQILTAGAPPPAAILLRTESRGFIVSHGYGLTETGGLVVSCVWKQKWNRLPATE  388

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+VG T  DV+ P +G SVKRDG+ +GEIVLRG  +MLGYLKDP+GTSK 
Sbjct  389   RARLKSRQGVRTVGMTEVDVLDPGSGLSVKRDGSSLGEIVLRGGCIMLGYLKDPKGTSKS  448

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             + +DGWF+TGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  449   LTDDGWFFTGDVGVMHSDGYLEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVA  508

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFVSLK     +PTEKE+ E+C+ R+P +MVP+ VVF   LPKTSTGKI
Sbjct  509   RPDDFWGETPCAFVSLKPERTEQPTEKEIMEYCRARMPHYMVPKTVVFEEELPKTSTGKI  568

Query  335   QKFLLRDIARDLSSA  291
             QKF+LR+ A+ + S+
Sbjct  569   QKFVLRETAKAMGSS  583



>ref|XP_006350454.1| PREDICTED: probable acyl-activating enzyme 6-like [Solanum tuberosum]
Length=551

 Score =   442 bits (1136),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 216/317 (68%), Positives = 257/317 (81%), Gaps = 5/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTN+CLR+ D   I D+I +HGVTH+C APVVLNML+N  +   +
Sbjct  233   HANGWSYPWGMAAVGGTNICLRKFDAGIIYDSINKHGVTHICAAPVVLNMLSNSPD---S  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV I+TAG+PPPAAVL R ESLGF V HGYGLTETGGL ++C WK  W+  PA E
Sbjct  290   KPLKHPVYIMTAGSPPPAAVLFRTESLGFVVHHGYGLTETGGLVISCTWKNHWNKFPANE  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++G    DVV P +G SVKRDG+ +GEIVL+G  VMLGY KDPEGTSKC
Sbjct  350   RARLKSRQGVRTLGMAEVDVVDPESGVSVKRDGSTLGEIVLKGACVMLGYFKDPEGTSKC  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK+DGWFYTGDV V+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY HPA++EAAVVA
Sbjct  410   MKDDGWFYTGDVAVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTHPAINEAAVVA  469

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSL      K +EK++ EFC+ +LP +MVP+ V+    LPKTSTGKI
Sbjct  470   RPDEFWGETPCAFVSLNGK--HKASEKDIIEFCRAKLPHYMVPKTVIIKQELPKTSTGKI  527

Query  335   QKFLLRDIARDLSSADA  285
             QKF+LRDIA+ +  +++
Sbjct  528   QKFVLRDIAKSMGKSNS  544



>ref|XP_006451536.1| hypothetical protein CICLE_v10007865mg [Citrus clementina]
 ref|XP_006475506.1| PREDICTED: probable acyl-activating enzyme 6-like [Citrus sinensis]
 gb|ESR64776.1| hypothetical protein CICLE_v10007865mg [Citrus clementina]
Length=569

 Score =   442 bits (1136),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 260/314 (83%), Gaps = 3/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW + W MAAVGGTN+C R+ D + I D I RHGVTHMCGAPVVLNML+NY +    
Sbjct  242   HSNGWCFPWAMAAVGGTNICTRKFDASIIFDLIRRHGVTHMCGAPVVLNMLSNYRDPDK-  300

Query  1055  KPL--TSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPA  882
             KPL    PV ++TAGAPPPAAVL R ESLGF+VSHGYGLTETGG+ V+CAWKR W+ LPA
Sbjct  301   KPLKLAKPVHLVTAGAPPPAAVLLRTESLGFKVSHGYGLTETGGIVVSCAWKRNWNLLPA  360

Query  881   PERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTS  702
              E+A +K+RQGV++   T  DV+ P +G S KRDG+ +GEIVLRG  +MLGYLKDP GT 
Sbjct  361   AEKAKLKARQGVKTTALTEVDVLDPKSGVSAKRDGSTLGEIVLRGGCIMLGYLKDPIGTR  420

Query  701   KCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAV  522
             KCM +DGWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAV
Sbjct  421   KCMTDDGWFYTGDVGVMHSDGYLEIKDRSKDVIISGGENLSSVEVESVLYSNPAVNEAAV  480

Query  521   VARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             VARPD+FWGETPCAFVSLK+G  +KPTEKEM E+C+ RLP +MVP+ VVFM  LPKTSTG
Sbjct  481   VARPDEFWGETPCAFVSLKEGSKSKPTEKEMIEYCRGRLPHYMVPKTVVFMDELPKTSTG  540

Query  341   KIQKFLLRDIARDL  300
             KIQKF+LR+IA ++
Sbjct  541   KIQKFVLREIAENM  554



>ref|XP_002263801.1| PREDICTED: probable acyl-activating enzyme 6 [Vitis vinifera]
Length=549

 Score =   441 bits (1134),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 257/317 (81%), Gaps = 3/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWGMAA+GGTNVCLR+ D   I DAI ++G+THMC APVVLNML+NY N+   
Sbjct  233   HGNGWTFTWGMAAIGGTNVCLRKFDARIIYDAIPKYGITHMCAAPVVLNMLSNYPNH---  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPP +VL R ESLGF VSHGYG+TET G+ V+CAWK +WD  PA E
Sbjct  290   QPLGDPVKILTAGAPPPYSVLLRTESLGFVVSHGYGMTETAGVVVSCAWKPQWDRFPASE  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+V  T  DVV P +G SVKRDG+ +GEIVLRG  +MLGYLKDPEGTSKC
Sbjct  350   RARVKARQGVRTVVMTEVDVVDPKSGVSVKRDGSSLGEIVLRGACIMLGYLKDPEGTSKC  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M ++GW YTGDV V+HPDGYIE+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  410   MSKEGWLYTGDVAVMHPDGYIEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVA  469

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFVSLK     KPT KEM E+C+ R+P +MVP+ VVF   LPKTSTGKI
Sbjct  470   RPDDFWGETPCAFVSLKPESPDKPTAKEMMEYCRARMPHYMVPKTVVFKEELPKTSTGKI  529

Query  335   QKFLLRDIARDLSSADA  285
             QKF LRDIA+ +  + A
Sbjct  530   QKFKLRDIAKAMGCSPA  546



>ref|XP_010250381.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Nelumbo 
nucifera]
Length=549

 Score =   440 bits (1132),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 263/319 (82%), Gaps = 3/319 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW++ WGMAAVGGTN+CLR+ D A+I  AI +HGVTHMCGAPVVLNMLAN  N    
Sbjct  232   HANGWTFPWGMAAVGGTNICLRKFDAAAIYRAIHKHGVTHMCGAPVVLNMLANAPN---V  288

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV  LTAGAPPP+AVL R ESLGF VSHG+G+TETGG+ ++CAWK EW+  PA E
Sbjct  289   QPLPRPVHFLTAGAPPPSAVLLRTESLGFIVSHGFGMTETGGIVISCAWKSEWNRFPATE  348

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G T  DV+ P +G+SV+RDG+ +GEIVLRG  +MLGYLK+P  TS  
Sbjct  349   RARLKARQGVRTIGMTAIDVIDPKSGESVRRDGSSIGEIVLRGGCLMLGYLKEPAATSVA  408

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             + + GWF+TGDVGV++PDGY+++KDR KDVIISGGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  409   LSDKGWFFTGDVGVMYPDGYVQIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLKK    KP+EKE+ E+C+ RLP +M P+ VV M  LPKTSTGKI
Sbjct  469   RPDEFWGETPCAFVSLKKSSTQKPSEKEIVEYCRARLPHYMAPKIVVIMDELPKTSTGKI  528

Query  335   QKFLLRDIARDLSSADAIN  279
             QKF+LRD+A+ L+S+  ++
Sbjct  529   QKFVLRDMAKGLNSSQQLS  547



>ref|XP_002321934.2| hypothetical protein POPTR_0015s12700g [Populus trichocarpa]
 gb|EEF06061.2| hypothetical protein POPTR_0015s12700g [Populus trichocarpa]
Length=553

 Score =   439 bits (1129),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 254/315 (81%), Gaps = 2/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY WGMAAVGGTN+C+R+ D  +I   IE+H VTHMCGAPVVLNML+N       
Sbjct  236   HSNGWSYPWGMAAVGGTNICIRKFDAPTIYGLIEKHRVTHMCGAPVVLNMLSNSPTI--I  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV I+TAGAPPPA +L R ESLGF V HGYGLTETGG+ V+CAWKR+W   PA E
Sbjct  294   KPLKNPVHIITAGAPPPATILSRTESLGFVVGHGYGLTETGGIVVSCAWKRQWSLFPATE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VG    DVV P TG SVKRDG+ +GEIVLRG  +MLGYLKDP  T+KC
Sbjct  354   RARLKARQGVRTVGMNEVDVVDPITGTSVKRDGSTLGEIVLRGGCIMLGYLKDPVATAKC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M E+GWFYTGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY  P ++EAAVVA
Sbjct  414   MTENGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTFPDINEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV+LK+      TEKE+ E+C+ RLP +MVP+ VV    LPKT+TGKI
Sbjct  474   RPDEFWGETPCAFVTLKEACCKSTTEKEIIEYCRARLPHYMVPKTVVVTEELPKTATGKI  533

Query  335   QKFLLRDIARDLSSA  291
             QK LLRD+A+D+ S+
Sbjct  534   QKALLRDMAKDMGSS  548



>ref|XP_006434271.1| hypothetical protein CICLE_v10003763mg [Citrus clementina]
 gb|ESR47511.1| hypothetical protein CICLE_v10003763mg [Citrus clementina]
Length=551

 Score =   439 bits (1128),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 258/315 (82%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWGMAAVG TN+CLRR D ++I+D I++H VTHMCGAPVVLNM++N  ++   
Sbjct  240   HANGWGYTWGMAAVGATNICLRRFDASTISDLIQKHNVTHMCGAPVVLNMISNSPDF---  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPA VL R ES+GF VSHGYGLTET GL V+CAWK EWD LP  E
Sbjct  297   EPLKTPVQILTAGAPPPAPVLSRTESMGFVVSHGYGLTETAGLVVSCAWKPEWDKLPLEE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV++VG T   VV+P TG+SVKRDG  +GE+VLRG  V +GY KD E T +C
Sbjct  357   RARLKARQGVKTVGLTEVGVVNPETGESVKRDGVSLGEVVLRGGCVTVGYFKDKESTRRC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             + ++GWFYTGD+ V+H DGY+E+KDR KDVIISGGEN+ S EVESVLY + AV+EAAVVA
Sbjct  417   ISDNGWFYTGDIAVMHADGYVEIKDRSKDVIISGGENICSAEVESVLYSNTAVNEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKK--GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPDKFWGETPCAFVSLK+  G+  KPTEKE+ E+C+ RLP +MVPRKVVF   LPKTSTG
Sbjct  477   RPDKFWGETPCAFVSLKRDQGLTEKPTEKEIIEYCRARLPRYMVPRKVVFSEELPKTSTG  536

Query  341   KIQKFLLRDIARDLS  297
             KIQK+LLR+IA+ +S
Sbjct  537   KIQKYLLREIAKSMS  551



>ref|XP_011048777.1| PREDICTED: probable acyl-activating enzyme 6 [Populus euphratica]
Length=553

 Score =   439 bits (1128),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 254/315 (81%), Gaps = 2/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWS+ WGMAAVGGTN+C+R+ D  +I   IE+H VTHMCGAPVVLNML+N      T
Sbjct  236   HSNGWSFPWGMAAVGGTNICIRKFDAPTICGLIEKHRVTHMCGAPVVLNMLSNSPTI--T  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV I+TAGAPPPA +L R ESLGF V HGYGLTETGG+ V+CAWKR+W   PA E
Sbjct  294   KPLKNPVHIITAGAPPPATILSRTESLGFVVGHGYGLTETGGIVVSCAWKRQWSLFPATE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G T  DVV P TG SVKRDG  +GEIVLRG  +MLGYLKDP  T+KC
Sbjct  354   RARLKARQGVRTIGMTEVDVVDPMTGTSVKRDGLTLGEIVLRGGCIMLGYLKDPVATAKC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M E+GWFYTGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY  P ++EAAVVA
Sbjct  414   MTENGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTFPDINEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV+LK+      TEKE+ E C+ RLP +MVP+ VV    LPKT+TGKI
Sbjct  474   RPDEFWGETPCAFVTLKEACCKSTTEKEIIEHCRARLPHYMVPKTVVVTEELPKTATGKI  533

Query  335   QKFLLRDIARDLSSA  291
             QK LLRD+A+D+ S+
Sbjct  534   QKALLRDMAKDMGSS  548



>ref|XP_007221472.1| hypothetical protein PRUPE_ppa003732mg [Prunus persica]
 gb|EMJ22671.1| hypothetical protein PRUPE_ppa003732mg [Prunus persica]
Length=553

 Score =   439 bits (1128),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 221/317 (70%), Positives = 262/317 (83%), Gaps = 3/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY +G+AA+GGTN+CLR+ D   I   I+RH VTHMCGAPVVLNML N      T
Sbjct  235   HANGWSYPYGIAALGGTNICLRKFDAQIIYAVIKRHRVTHMCGAPVVLNMLTNVPPG--T  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L +PV ILTAGAPPPAAVL R ES+GF VSHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  293   EKLENPVQILTAGAPPPAAVLLRTESMGFVVSHGYGLTETAGLVVSCAWKGKWNLLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VG T  DVV P++G+SVKRDG  +GE+VL+G SVMLGYLKD  GT+KC
Sbjct  353   RARLKARQGVRTVGLTRMDVVDPNSGRSVKRDGLSLGEVVLKGGSVMLGYLKDQLGTAKC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK  GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  413   MK-GGWFYTGDVGVMHADGYLEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PD+FWGETPCAFVS+K  +  KPTEKEM E+C+ RLP +MVP+ VVF   LPKTSTGKI
Sbjct  472   KPDEFWGETPCAFVSMKSDVSPKPTEKEMMEYCRGRLPHYMVPKTVVFKEELPKTSTGKI  531

Query  335   QKFLLRDIARDLSSADA  285
             QKF+LR+IA+++ S+ +
Sbjct  532   QKFVLREIAKEIGSSSS  548



>emb|CDX70689.1| BnaC03g07730D [Brassica napus]
Length=551

 Score =   438 bits (1127),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 259/314 (82%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+   +   +
Sbjct  236   HANGWSYPWGIAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLNMLSASQD---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES GF++SHGYGLTET GL V+CAWK EW+ LPA E
Sbjct  293   QPLKHPVNILTAGAPPPAAVLLRAESKGFKISHGYGLTETAGLNVSCAWKPEWNRLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P TG+SV+R+G  VGEIV+RG+S+MLGYLKDP GT K 
Sbjct  353   RARLKARQGVRTVGFTEIDVVDPETGRSVERNGETVGEIVMRGSSIMLGYLKDPVGTEKA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWF+TGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV+E AVVA
Sbjct  413   LK-NGWFFTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPAVNEVAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPTE E+ E+CK+++P FMVP+ V F   LPKTSTGK+
Sbjct  472   RPDEFWGETPCAFVSLKPGLTRKPTEGELIEYCKQKMPRFMVPKTVSFKDELPKTSTGKV  531

Query  335   QKFLLRDIARDLSS  294
              KF+LRDIA+ + S
Sbjct  532   MKFVLRDIAKKMGS  545



>ref|XP_008381411.1| PREDICTED: probable acyl-activating enzyme 6 [Malus domestica]
 ref|XP_008358179.1| PREDICTED: probable acyl-activating enzyme 6 [Malus domestica]
Length=552

 Score =   437 bits (1125),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 258/315 (82%), Gaps = 3/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW++ +GMAAVGGTN+C+R+ D   I   I+RHGVTHMCGAPVVLNML N  +   T
Sbjct  236   HSNGWNFPYGMAAVGGTNICVRKFDGQIIYAMIKRHGVTHMCGAPVVLNMLTNVRSG--T  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L  PV ILT GAPPPA VL R ES+GF VSHGYGLTET G+ V+CAWK +W+ LPA E
Sbjct  294   EKLEYPVHILTGGAPPPAQVLIRTESMGFVVSHGYGLTETAGVVVSCAWKGKWNLLPATE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+VG T  DVV P +G SVKRDG  +GEIVLRG  VMLGYLKDP GT+KC
Sbjct  354   RARLKSRQGVRTVGMTRVDVVDPDSGLSVKRDGMSLGEIVLRGGCVMLGYLKDPSGTAKC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK  GWFYTGDVGVIHPDGY+E+KDR KDVIISGGENLSSVEVESVLY +PAVDEAAVVA
Sbjct  414   MK-GGWFYTGDVGVIHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVDEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  + AKPTE E+ E+C+++LP +MVP+ VVF   LPKTSTGKI
Sbjct  473   RPDEFWGETPCAFVSLKSDVTAKPTENEIMEYCRKKLPKYMVPKTVVFKDELPKTSTGKI  532

Query  335   QKFLLRDIARDLSSA  291
             QKF+LR +A+ L S+
Sbjct  533   QKFVLRQMAKGLGSS  547



>ref|XP_008803433.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Phoenix 
dactylifera]
Length=556

 Score =   437 bits (1125),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 260/314 (83%), Gaps = 1/314 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AA GGTN+CLRR D A+I  A+  H VTHMCGAPVVLNMLAN  + A  
Sbjct  238   HANGWSYPWGIAAAGGTNICLRRFDSATIYAALATHRVTHMCGAPVVLNMLANAPDSAR-  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILTAGAPPPAAVL R E+LGF +SHGYGLTET GLAV+CAWK EWD LPA E
Sbjct  297   KPLPGPVQILTAGAPPPAAVLHRAEALGFSISHGYGLTETAGLAVSCAWKGEWDRLPAAE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++     DV+   TG+SVKRDG  +GEIVLRG  VMLGYLKD E TS+ 
Sbjct  357   RARLKARQGVRTLAMAEIDVIDGSTGESVKRDGATLGEIVLRGGCVMLGYLKDEEATSRA  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +++DGWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  417   VRQDGWFYTGDVGVMHADGYVEIKDRSKDVIISGGENLSSVEVESVLYGHPAVNEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD++WGETPCAFVS+K+G+ A PTE E+  +C+ER+P +MVP+ VVF   LPKTSTGKI
Sbjct  477   RPDEYWGETPCAFVSIKEGMAAPPTEAEVIAWCRERMPRYMVPKTVVFKPELPKTSTGKI  536

Query  335   QKFLLRDIARDLSS  294
             QK++LR++A+ ++S
Sbjct  537   QKYVLREMAKAMAS  550



>ref|XP_006371377.1| hypothetical protein POPTR_0019s09600g [Populus trichocarpa]
 gb|ERP49174.1| hypothetical protein POPTR_0019s09600g [Populus trichocarpa]
Length=548

 Score =   437 bits (1123),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 257/315 (82%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTN+CLRRV+  +I   I+RHGVTHMCGAPVVLNML N  N    
Sbjct  236   HANGWSYPWGMAAVGGTNICLRRVEAPTIYSLIKRHGVTHMCGAPVVLNMLTNSPNAER-  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
               L +PV ILTAGAPPP+AVL R ESLGF VSHGYGLTET GL  +CAWK +W+  PA E
Sbjct  295   --LQNPVQILTAGAPPPSAVLFRAESLGFVVSHGYGLTETAGLVTSCAWKPKWNTFPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV  VGFT   VV P+TGKSV+RDG  +GE+VLRG SVMLGY KDP GTS C
Sbjct  353   RAILKSRQGVPIVGFTEMGVVDPNTGKSVERDGVSLGEVVLRGGSVMLGYFKDPLGTSMC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVGV+H DGY+EVKDR KDVIISGGEN+SSVE+ESVLY HPAV+EAAVVA
Sbjct  413   MK-DGWFYTGDVGVVHSDGYLEVKDRSKDVIISGGENISSVEIESVLYTHPAVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KP EK++ ++C+E++  +MVP+ VVF   LPKTSTGKI
Sbjct  472   RPDEFWGETPCAFVSLKNGLPHKPGEKDIIDYCREKMAHYMVPKIVVFKDELPKTSTGKI  531

Query  335   QKFLLRDIARDLSSA  291
             QK+LLR+ A+ + S+
Sbjct  532   QKYLLREYAKVVDSS  546



>ref|XP_006383816.1| hypothetical protein POPTR_0004s00210g [Populus trichocarpa]
 gb|ERP61613.1| hypothetical protein POPTR_0004s00210g [Populus trichocarpa]
Length=478

 Score =   433 bits (1114),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 216/317 (68%), Positives = 255/317 (80%), Gaps = 2/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY WGMAAVGGTN+CLR+ D  +I   I++HGVTHMCGAPVVLNML+N       
Sbjct  161   HSNGWSYPWGMAAVGGTNICLRKFDAPTIYGLIKKHGVTHMCGAPVVLNMLSNSPITM--  218

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV I+TAGAPPPA +L R ESLGF V HGYGLTETGG+ V+CAWKR+W+  PA E
Sbjct  219   EPLKNPVHIITAGAPPPATILSRTESLGFVVGHGYGLTETGGIVVSCAWKRQWNLFPATE  278

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VG T  DVV P TG SVKRDG  +GEIVLRG  +MLGYLKDP  T+KC
Sbjct  279   RARLKARQGVRTVGMTEVDVVDPVTGMSVKRDGLTLGEIVLRGGCIMLGYLKDPVATAKC  338

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M E+GWF TGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY  P ++EAAVVA
Sbjct  339   MTENGWFCTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTFPDINEAAVVA  398

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+     PTEKE+ E C+ +LP +MVP+ VV    LPKTSTGKI
Sbjct  399   RPDEFWGETPCAFVSLKEACCRIPTEKEIIEHCRGKLPHYMVPKTVVVKEKLPKTSTGKI  458

Query  335   QKFLLRDIARDLSSADA  285
             QK +LRD+A+ + S+ A
Sbjct  459   QKAVLRDMAKAMGSSRA  475



>ref|XP_006371376.1| hypothetical protein POPTR_0019s09590g [Populus trichocarpa]
 gb|ERP49173.1| hypothetical protein POPTR_0019s09590g [Populus trichocarpa]
Length=544

 Score =   435 bits (1119),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 256/313 (82%), Gaps = 4/313 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAA+GGTN+CLRRV+  +I   I+RHGVTHMCGAPVVLNML N  N    
Sbjct  236   HANGWSYAWGMAALGGTNICLRRVEAPTIYSLIKRHGVTHMCGAPVVLNMLTNSPN---A  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L +PV ILT GAPPP+AVL R ESLGF VSHGYGLTET GL  +CAWK +W+  PA E
Sbjct  293   ERLQNPVQILTGGAPPPSAVLFRAESLGFVVSHGYGLTETAGLVTSCAWKPKWNTFPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV  VGFT   VV P+TGKSV+RDG  +GE+VLRG SVMLGY KDP GTS C
Sbjct  353   RAILKSRQGVPIVGFTEMGVVDPNTGKSVERDGVSLGEVVLRGGSVMLGYFKDPLGTSMC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVGV+H DGY+EVKDR KDVIISGGEN+SSVE+ESVLY HPAV+EAAVVA
Sbjct  413   MK-DGWFYTGDVGVVHSDGYLEVKDRSKDVIISGGENISSVEIESVLYTHPAVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KP EK++ ++C+E++  +MVP+ VVF   LPKTSTGKI
Sbjct  472   RPDEFWGETPCAFVSLKNGLPHKPGEKDIIDYCREKMAHYMVPKIVVFKDELPKTSTGKI  531

Query  335   QKFLLRDIARDLS  297
             QK+LLR+ A++ S
Sbjct  532   QKYLLREYAKNNS  544



>ref|XP_006472839.1| PREDICTED: probable acyl-activating enzyme 9-like [Citrus sinensis]
Length=551

 Score =   435 bits (1118),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 257/315 (82%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWGMAAVG TN+CLRR D ++I+D I++H VTHMCGAPVVLNM++N  ++   
Sbjct  240   HANGWGYTWGMAAVGATNICLRRFDASAISDLIQKHNVTHMCGAPVVLNMISNSPDF---  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPA VL R ES+GF V HGYGLTET GL V+C+WK EWD LP  E
Sbjct  297   EPLKTPVQILTAGAPPPAPVLSRTESMGFVVCHGYGLTETAGLVVSCSWKPEWDKLPLEE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV++VG T  DVV+P TG+SVKRDG  +GE+VLRG  V +GY KD E T +C
Sbjct  357   RARLKARQGVKTVGLTEVDVVNPETGESVKRDGVSLGEVVLRGGCVTVGYFKDKESTRRC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             + ++GWFYTGD+ V+H DGY+E+KDR KDVIISGGEN+ S EVESVLY + AV+EAAVVA
Sbjct  417   ISDNGWFYTGDIAVMHVDGYVEIKDRSKDVIISGGENICSAEVESVLYSNTAVNEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKG--IIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPDKFWGETPCAFVSLK+   +  KPTEKE+ E+C+ RLP +MVPRKVVF   LPKTSTG
Sbjct  477   RPDKFWGETPCAFVSLKRDLELTEKPTEKEIIEYCRARLPRYMVPRKVVFSEELPKTSTG  536

Query  341   KIQKFLLRDIARDLS  297
             KIQK+LLR+IA+ +S
Sbjct  537   KIQKYLLREIAKSMS  551



>gb|KDP39789.1| hypothetical protein JCGZ_03925 [Jatropha curcas]
Length=554

 Score =   435 bits (1118),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/317 (68%), Positives = 261/317 (82%), Gaps = 6/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY WGMAAVGGTNVCLR+ D  ++   I  H VTHMCGAPVVLNMLAN    + T
Sbjct  237   HSNGWSYPWGMAAVGGTNVCLRKFDGPTVYRLINDHHVTHMCGAPVVLNMLANSPIESQT  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL +PV ILTAGAPPPAA+L R ESLGF+VSHGYGLTETGG+ ++CAWK++W+  PA E
Sbjct  297   -PLQNPVHILTAGAPPPAAILLRTESLGFKVSHGYGLTETGGIIISCAWKKKWNIFPATE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G T  DVV   +G SVKRDG  +GEIVLRG S+MLGYLKDP  TSKC
Sbjct  356   RAKLKARQGVRTIGMTEVDVVDTESGTSVKRDGLSLGEIVLRGGSLMLGYLKDPASTSKC  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MKE+GWFYTGDV V+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY +P ++EAAVVA
Sbjct  416   MKENGWFYTGDVAVMHPDGYVEIKDRSKDVIISGGENLSSVEVESVLYTNPLINEAAVVA  475

Query  515   RPDKFWGETPCAFVSLKKG--IIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD++WGETPCAFVSLKKG  II   TEK++ ++C+ +LP +MVP+ VV    LPKTSTG
Sbjct  476   RPDEYWGETPCAFVSLKKGESII---TEKDIIDYCRAKLPHYMVPKTVVIKDELPKTSTG  532

Query  341   KIQKFLLRDIARDLSSA  291
             KIQKF+LR++A+ + S+
Sbjct  533   KIQKFVLREMAKAMGSS  549



>ref|XP_008343272.1| PREDICTED: probable acyl-activating enzyme 6 [Malus domestica]
Length=528

 Score =   434 bits (1116),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 214/312 (69%), Positives = 255/312 (82%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW + W MAAVGGTN+C+R+ D   I D IE HGVTHMC APVVLNML N      +
Sbjct  198   HANGWCFPWAMAAVGGTNICVRKFDGPKIYDLIEAHGVTHMCAAPVVLNMLVNTRR---S  254

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL +PV+ILT GAPPP++VL R ES+GF V HG+G+TET G+ ++CAWK EW+ LPA E
Sbjct  255   DPLRNPVNILTGGAPPPSSVLLRAESIGFVVGHGFGMTETAGVVLSCAWKPEWNKLPAME  314

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGV ++G T AD V+P +G  VKRDG+ VGEIVLRG  VMLGYLKDP GT+ C
Sbjct  315   QARLKARQGVMTIGMTEADAVNPDSGLGVKRDGSEVGEIVLRGGCVMLGYLKDPSGTANC  374

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVGV+HPDGY+E+KDR KD+IISGGEN+SSVEVESVLY +PAV+EAAVVA
Sbjct  375   MK-DGWFYTGDVGVMHPDGYLEIKDRSKDIIISGGENMSSVEVESVLYANPAVNEAAVVA  433

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  +  KPTEKE+ EFC+++LP FMVP+ VVF   LPKTSTGKI
Sbjct  434   RPDEFWGETPCAFVSLKSDVTPKPTEKEIMEFCRKKLPHFMVPKTVVFKDELPKTSTGKI  493

Query  335   QKFLLRDIARDL  300
             QKFLLR+IAR +
Sbjct  494   QKFLLREIARGI  505



>ref|XP_010459862.1| PREDICTED: probable acyl-activating enzyme 9 [Camelina sativa]
Length=550

 Score =   434 bits (1115),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 251/314 (80%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVC RRVD  +I + I++H VTHMC AP+VLNML NY++    
Sbjct  239   HANGWGYTWGTAAVGATNVCTRRVDAPTIYNLIDKHDVTHMCAAPMVLNMLTNYSSR---  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV ++TAGAPPPAA++ R ESLGF V HGYGLTETGG  V+CAWK EWD+L   E
Sbjct  296   KPLKNPVQVMTAGAPPPAAIISRAESLGFNVGHGYGLTETGGPVVSCAWKSEWDHLEPLE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++GF  ADV  P TGKSV+ DG  VGEIVL+G SVMLGY KDPEGT+ C
Sbjct  356   RARLKSRQGVRTIGFAEADVRDPRTGKSVEHDGVSVGEIVLKGGSVMLGYFKDPEGTAAC  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  416   MREDGWFYTGDVGVIHKDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  475

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK         TE+E+REFCK +LP +MVPRKV+F   LPKTSTG
Sbjct  476   KPDKMWGETPCAFVSLKYDNNGDGSVTEREIREFCKAKLPKYMVPRKVIFQEELPKTSTG  535

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  536   KIQKFLLRQMAKSL  549



>gb|KDP31601.1| hypothetical protein JCGZ_14826 [Jatropha curcas]
Length=550

 Score =   433 bits (1114),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 220/312 (71%), Positives = 253/312 (81%), Gaps = 5/312 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTN+CLRR D + I   I RHGVTHMCGAPVVLNML N  +    
Sbjct  236   HANGWSYPWGMAAVGGTNICLRRFDASIIYGLISRHGVTHMCGAPVVLNMLTNSPS---N  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPAAVL R ESLGF VSHGYGLTET GL V+CAWK EW+   A E
Sbjct  293   QPLKNPVHILTAGAPPPAAVLNRTESLGFVVSHGYGLTETAGLVVSCAWKPEWNKFQASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV+  GFT  DVV   TG SVKRDG  +GE+VLRG  VMLGYLKDP GTSKC
Sbjct  353   RARLKARQGVKIAGFTEIDVVD-STGASVKRDGLSIGEVVLRGGCVMLGYLKDPIGTSKC  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K+D WFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVESVLY +PAV+EAAVVA
Sbjct  412   LKDD-WFYTGDVGVMHKDGYLEIKDRSKDVIISGGENISSVEVESVLYTNPAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD++WGETPCAFVSLK G+  KP+E ++  FC+E LP +MVP+ VVF   LPKTSTGKI
Sbjct  471   RPDEYWGETPCAFVSLKDGLTQKPSEGDIIGFCRENLPRYMVPKTVVFKKELPKTSTGKI  530

Query  335   QKFLLRDIARDL  300
             +KF LR+IA+ +
Sbjct  531   KKFELREIAKAM  542



>ref|XP_008227872.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Prunus 
mume]
Length=553

 Score =   433 bits (1113),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 258/315 (82%), Gaps = 3/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY +G+AA+GGTN+CLR+ D   I   I+RH VTHMCGAPVVLNML N      T
Sbjct  235   HANGWSYPYGIAALGGTNICLRKFDAQIIYAMIKRHRVTHMCGAPVVLNMLTNVPPG--T  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L +PV ILTAGAPPPAAVL R ES+GF VSHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  293   EKLENPVQILTAGAPPPAAVLLRTESMGFVVSHGYGLTETAGLVVSCAWKEKWNLLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+V  T  DVV P++G+SVKRDG  +GE+VLRG SVMLGYLKD  GT+KC
Sbjct  353   RARLKARQGVRTVVLTRIDVVDPNSGRSVKRDGLSLGEVVLRGGSVMLGYLKDQSGTAKC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK  GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  413   MK-GGWFYTGDVGVMHADGYLEIKDRSKDVIISGGENLSSVEVESVLYTHPAVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PD+FWGETPCAFVS+K     KPTEKEM E+C+ RLP +MVP+ VVF   LPKTSTGKI
Sbjct  472   KPDEFWGETPCAFVSIKSDASPKPTEKEMMEYCRGRLPHYMVPKTVVFKEELPKTSTGKI  531

Query  335   QKFLLRDIARDLSSA  291
             QKF+LR++A+ + S+
Sbjct  532   QKFVLREMAKGIGSS  546



>ref|XP_008463175.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Cucumis 
melo]
Length=555

 Score =   433 bits (1113),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 215/312 (69%), Positives = 255/312 (82%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ + +AAVGGTN+C+R+ D A I   I RH VTH+CGAPVVLNML N  N    
Sbjct  239   HANGWSFPFAIAAVGGTNICIRKFDAALIFSLINRHHVTHLCGAPVVLNMLTNSPN---N  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPPAAVL R ESLGF VSHGYGLTETGGL + C+WK +W+ LPA E
Sbjct  296   RPLERPVKILTAGAPPPAAVLFRTESLGFDVSHGYGLTETGGLVIFCSWKLKWNQLPATE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++    ADV+   TGKSVKRDG  +GEIVLRG S+MLGY KDPE T K 
Sbjct  356   RARLKARQGVRTLAMAEADVLDSETGKSVKRDGVSIGEIVLRGGSMMLGYFKDPEATKKA  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M E+GWF+TGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  416   MTEEGWFFTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVA  475

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSL++G+   PTE+E+ E+C+ +L  FMVP+ VVFM  LPKTSTGKI
Sbjct  476   RPDEFWGETPCAFVSLREGLSRVPTEEEIIEYCRGKLAGFMVPKTVVFMEQLPKTSTGKI  535

Query  335   QKFLLRDIARDL  300
             QKFLLR++A+ +
Sbjct  536   QKFLLREMAKSM  547



>ref|XP_004162833.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Cucumis sativus]
Length=576

 Score =   434 bits (1115),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 215/312 (69%), Positives = 254/312 (81%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ + +AAVGGTN+C+R+ D A I   I RH VTHMCGAPVVLNML N  N    
Sbjct  260   HANGWSFPFAIAAVGGTNICIRKFDAALIFSLINRHHVTHMCGAPVVLNMLTNSPN---N  316

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPPAAVL R ESLGF VSHGYGLTETGGL + C+WK EW+ LPA E
Sbjct  317   RPLERPVKILTAGAPPPAAVLLRTESLGFDVSHGYGLTETGGLVIFCSWKLEWNQLPATE  376

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++    ADV+   TGK V+RDG  +GEIV+RG S+MLGY KDPE T K 
Sbjct  377   RARLKARQGVRTLAMAEADVLDSGTGKRVQRDGVSIGEIVIRGGSMMLGYFKDPEATKKA  436

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M E+GWF+TGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  437   MTEEGWFFTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVA  496

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSL++G+   PTE+E+ E+CK +L  FMVP+ VVFM  LPKTSTGKI
Sbjct  497   RPDEFWGETPCAFVSLREGLTRVPTEEEIIEYCKGKLAGFMVPKTVVFMEQLPKTSTGKI  556

Query  335   QKFLLRDIARDL  300
             QKFLLR++A+ +
Sbjct  557   QKFLLREMAKSM  568



>ref|XP_004148909.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Cucumis sativus]
 gb|KGN50896.1| AMP dependent ligase [Cucumis sativus]
Length=576

 Score =   433 bits (1114),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 215/312 (69%), Positives = 254/312 (81%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ + +AAVGGTN+C+R+ D A I   I RH VTHMCGAPVVLNML N  N    
Sbjct  260   HANGWSFPFAIAAVGGTNICIRKFDAALIFSLINRHHVTHMCGAPVVLNMLTNSPN---N  316

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPPAAVL R ESLGF VSHGYGLTETGGL + C+WK EW+ LPA E
Sbjct  317   RPLERPVKILTAGAPPPAAVLLRTESLGFDVSHGYGLTETGGLVIFCSWKLEWNQLPATE  376

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++    ADV+   TGK V+RDG  +GEIV+RG S+MLGY KDPE T K 
Sbjct  377   RARLKARQGVRTLAMAEADVLDSGTGKRVQRDGVSIGEIVIRGGSMMLGYFKDPEATKKA  436

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M E+GWF+TGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  437   MTEEGWFFTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVA  496

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSL++G+   PTE+E+ E+CK +L  FMVP+ VVFM  LPKTSTGKI
Sbjct  497   RPDEFWGETPCAFVSLREGLTRVPTEEEIIEYCKGKLAGFMVPKTVVFMEQLPKTSTGKI  556

Query  335   QKFLLRDIARDL  300
             QKFLLR++A+ +
Sbjct  557   QKFLLREMAKSM  568



>ref|XP_010498606.1| PREDICTED: probable acyl-activating enzyme 9 [Camelina sativa]
Length=550

 Score =   432 bits (1112),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 250/314 (80%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVC RRVD  +I + I++H VTHMC AP+VLNML NY +    
Sbjct  239   HANGWGYTWGTAAVGATNVCTRRVDAPTIYNLIDKHDVTHMCAAPMVLNMLTNYPSR---  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV ++TAGAPPPAA++ R ESLGF V HGYGLTETGG  V+CAWK EWD+L   E
Sbjct  296   KPLKNPVQVMTAGAPPPAAIISRAESLGFNVGHGYGLTETGGPVVSCAWKSEWDHLDPLE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+VGF  ADV  P TGKSV+ DG  VGEIVL+G SVMLGY KDPEGT+ C
Sbjct  356   RARLKSRQGLRTVGFAEADVRDPRTGKSVEHDGVYVGEIVLKGGSVMLGYFKDPEGTAAC  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  416   MREDGWFYTGDVGVIHKDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  475

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK         TE+E+REFCK +LP +MVPRKV+F   LPKTSTG
Sbjct  476   KPDKMWGETPCAFVSLKYDNNGDGSVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTG  535

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  536   KIQKFLLRQMAKSL  549



>ref|NP_173573.1| probable acyl-activating enzyme 9 [Arabidopsis thaliana]
 sp|Q9LPK6.1|AEE9_ARATH RecName: Full=Probable acyl-activating enzyme 9; AltName: Full=AMP-binding 
protein 9; Short=AtAMPBP9 [Arabidopsis thaliana]
 gb|AAF87900.1|AC015447_10 Putative amp-binding protein [Arabidopsis thaliana]
 gb|AAM28626.1|AF503768_1 adenosine monophosphate binding protein 9 AMPBP9 [Arabidopsis 
thaliana]
 gb|AAL60038.1| putative AMP-binding protein [Arabidopsis thaliana]
 gb|AAM91793.1| putative amp-binding protein [Arabidopsis thaliana]
 gb|AEE30115.1| probable acyl-activating enzyme [Arabidopsis thaliana]
Length=550

 Score =   432 bits (1111),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 218/317 (69%), Positives = 252/317 (79%), Gaps = 11/317 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVC RRVD  +I D I++H VTHMC AP+VLNML NY +    
Sbjct  239   HANGWGYTWGTAAVGATNVCTRRVDAPTIYDLIDKHHVTHMCAAPMVLNMLTNYPSR---  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV ++TAGAPPPAA++ R E+LGF V HGYGLTETGG  V+CAWK EWD+L   E
Sbjct  296   KPLKNPVQVMTAGAPPPAAIISRAETLGFNVGHGYGLTETGGPVVSCAWKAEWDHLDPLE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++GF   DV  P TGKSV+ DG  VGEIVL+G SVMLGY KDPEGT+ C
Sbjct  356   RARLKSRQGVRTIGFAEVDVRDPRTGKSVEHDGVSVGEIVLKGGSVMLGYYKDPEGTAAC  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFY+GDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  416   MREDGWFYSGDVGVIHEDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  475

Query  515   RPDKFWGETPCAFVSLK-----KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKT  351
             +PDK WGETPCAFVSLK      G++   TE+E+REFCK RLP +MVPRKV+F   LPKT
Sbjct  476   KPDKMWGETPCAFVSLKYDSNGNGLV---TEREIREFCKTRLPKYMVPRKVIFQEELPKT  532

Query  350   STGKIQKFLLRDIARDL  300
             STGKIQKFLLR +A+ L
Sbjct  533   STGKIQKFLLRQMAKSL  549



>ref|XP_011097992.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Sesamum 
indicum]
Length=550

 Score =   432 bits (1111),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 255/314 (81%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWSYTWGMAA GGTNVCLR+ D A+I  AI ++ VTHMCGAPVVLNML+N  +    
Sbjct  235   HVNGWSYTWGMAASGGTNVCLRKFDAAAIYAAIHKYNVTHMCGAPVVLNMLSNVPHG---  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILT GAPPPAAVL R+ESLGF ++HGYG+TET GL V C WK++W+  PA E
Sbjct  292   KPLEKPVYILTGGAPPPAAVLLRIESLGFVITHGYGMTETAGLVVCCTWKKKWNKFPAAE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A IK+RQGVR+ G    DV+ P +GKSV RDG  +GEIVLRG+ + LGYLK+PE  +K 
Sbjct  352   KARIKARQGVRTPGMAAVDVIDPESGKSVARDGKTLGEIVLRGSCITLGYLKNPEANAKA  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+ +GWFYTGDVGVIHPDGY+E+KDR KDVIISGGENLSSV+VESVLY HP+V+EAAVVA
Sbjct  412   MR-NGWFYTGDVGVIHPDGYLEIKDRSKDVIISGGENLSSVDVESVLYRHPSVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK+G+  KPTE+E+  FC+  LP +MVP+ VVF   LPKTSTGKI
Sbjct  471   RPDEFWGETPCAFLSLKEGVTKKPTEEEVVAFCRSNLPHYMVPKTVVFKEELPKTSTGKI  530

Query  335   QKFLLRDIARDLSS  294
             QKF+LR++A+ + S
Sbjct  531   QKFVLRELAKAMGS  544



>emb|CDX78686.1| BnaA03g05980D [Brassica napus]
Length=551

 Score =   432 bits (1111),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 258/314 (82%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+   +   +
Sbjct  236   HANGWSYPWGIAAVGGTNVCLRKFDAPLIYRLISDHGVTHMCGAPVVLNMLSASQD---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES GF++SHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  293   QPLKHPVNILTAGAPPPAAVLLRAESKGFKISHGYGLTETAGLNVSCAWKPQWNRLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P TG SV+R+G  VGEIV+RG+S+MLGYLKDP GT K 
Sbjct  353   RARLKARQGVRTVGFTEIDVVDPGTGLSVERNGETVGEIVMRGSSIMLGYLKDPVGTEKA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWF+TGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV+E AVVA
Sbjct  413   LK-NGWFFTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPAVNEVAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPTE E+ E+C++++P +MVP+ V F   LPKTSTGK+
Sbjct  472   RPDEFWGETPCAFVSLKPGLTRKPTEGELIEYCRKKMPRYMVPKTVSFRDELPKTSTGKV  531

Query  335   QKFLLRDIARDLSS  294
              KF+LRDIA+ + S
Sbjct  532   MKFVLRDIAKKMGS  545



>ref|XP_006287418.1| hypothetical protein CARUB_v10000624mg [Capsella rubella]
 gb|EOA20316.1| hypothetical protein CARUB_v10000624mg [Capsella rubella]
Length=552

 Score =   432 bits (1111),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 259/314 (82%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  237   HANGWSYPWGMAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLNMLSATQE---S  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPPAAVL R ES+GF +SHGYGLTET GL V+CAWK +W+ LPA +
Sbjct  294   RPLNRPVSILTAGAPPPAAVLLRAESIGFVISHGYGLTETAGLNVSCAWKPQWNRLPATD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++GFT  DVV P +G+SV+R+G  VGEIV++G+SVMLGYLKDP GT K 
Sbjct  354   RARLKARQGVRTLGFTEIDVVDPESGRSVERNGESVGEIVMKGSSVMLGYLKDPIGTEKA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+V+Y +PAV E AVVA
Sbjct  414   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVMYTNPAVSEVAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G+  KPTE+EM E+C++++P +MVP+ V F+  LPKTSTGK+
Sbjct  473   RPDEFWGETPCAFVSLKEGLSKKPTEEEMIEYCRKKMPRYMVPKTVSFVDELPKTSTGKV  532

Query  335   QKFLLRDIARDLSS  294
              KF+LR+IA+ + +
Sbjct  533   MKFVLREIAKKMGT  546



>ref|XP_011004848.1| PREDICTED: probable acyl-activating enzyme 6 [Populus euphratica]
Length=551

 Score =   432 bits (1110),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 253/312 (81%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS+ WGMAAVGGTN+CLR+V+ ++I   I+RHGVTHM GAPVVLN+L    +    
Sbjct  240   HTNGWSHVWGMAAVGGTNICLRKVEASTIYSLIDRHGVTHMSGAPVVLNILTKSPD---V  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV I+TAGAPPPAAV+ R ESLGF VSHGYGLTET GL V+CAWK EW+  PA E
Sbjct  297   EPLKNPVHIITAGAPPPAAVILRTESLGFVVSHGYGLTETAGLVVSCAWKPEWNTFPASE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV   GFT  DVV P TG+S++RDG  VGE+VLRG  +MLGYLKDP GTSKC
Sbjct  357   RARLKARQGVTMAGFTEMDVVDPRTGESMRRDGVSVGEVVLRGGCLMLGYLKDPFGTSKC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVG++H DGY+E+KDR KDVIISGGEN+SSVEVESVLY HPAV EAAVV 
Sbjct  417   MK-DGWFYTGDVGIMHQDGYLEIKDRSKDVIISGGENISSVEVESVLYTHPAVHEAAVVG  475

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK G+  KP EK++ +FC+  +P FMVP+ VVF   LP+TSTGKI
Sbjct  476   RPDEFWGETPCAFVDLKDGLNQKPCEKDIIDFCRNNMPHFMVPKTVVFKDELPRTSTGKI  535

Query  335   QKFLLRDIARDL  300
             QKF+L++IA+ +
Sbjct  536   QKFVLKEIAKGM  547



>ref|XP_010496337.1| PREDICTED: probable acyl-activating enzyme 9 [Camelina sativa]
Length=550

 Score =   431 bits (1109),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 249/314 (79%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVC RRVD  +I + I++H VTHMC AP+VLNML NY +    
Sbjct  239   HANGWGYTWGTAAVGATNVCTRRVDAPTIYNLIDKHDVTHMCAAPMVLNMLTNYPSR---  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV ++TAGAPPP A++ R ESLGF V HGYGLTETGG  V+CAWK EWD+L   E
Sbjct  296   KPLKNPVQVMTAGAPPPTAIISRAESLGFNVGHGYGLTETGGPVVSCAWKSEWDHLDPLE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++GF  ADV  P TGKSV+ DG  VGEIVL+G SVMLGY KDPEGT+ C
Sbjct  356   RARLKSRQGVRTIGFAEADVRDPRTGKSVEHDGVSVGEIVLKGGSVMLGYFKDPEGTAAC  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  416   MREDGWFYTGDVGVIHKDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  475

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK         TE+E+REFCK +LP +MVPRKV+F   LPKTSTG
Sbjct  476   KPDKMWGETPCAFVSLKYDNNGDGSVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTG  535

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  536   KIQKFLLRQMAKSL  549



>ref|XP_009131535.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Brassica 
rapa]
Length=551

 Score =   431 bits (1109),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 258/314 (82%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+   +   +
Sbjct  236   HANGWSYPWGIAAVGGTNVCLRKFDAPLIYRLISDHGVTHMCGAPVVLNMLSASQD---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES GF++SHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  293   QPLKHPVNILTAGAPPPAAVLLRAESKGFKISHGYGLTETAGLNVSCAWKPQWNRLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P TG SV+R+G  VGEIV+RG+S+MLGYLKDP GT K 
Sbjct  353   RARLKARQGVRTVGFTEIDVVDPGTGLSVERNGETVGEIVMRGSSIMLGYLKDPVGTEKA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWF+TGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV+E AVVA
Sbjct  413   LK-NGWFFTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPAVNEVAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPTE E+ E+C++++P +MVP+ V F   LPKTSTGK+
Sbjct  472   RPDEFWGETPCAFVSLKPGLTRKPTEGELIEYCRKKMPRYMVPKTVSFRDELPKTSTGKV  531

Query  335   QKFLLRDIARDLSS  294
              KF+LRDIA+ + S
Sbjct  532   MKFVLRDIAKKMGS  545



>ref|XP_006400174.1| hypothetical protein EUTSA_v10013162mg [Eutrema salsugineum]
 gb|ESQ41627.1| hypothetical protein EUTSA_v10013162mg [Eutrema salsugineum]
Length=551

 Score =   431 bits (1109),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 258/314 (82%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  236   HANGWSFPWGIAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLNMLSATQE---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV+ILTAGAPPPA VL R ES+GF +SHGYGLTETGGL V+CAWK +W+ LPA +
Sbjct  293   KPLNHPVNILTAGAPPPATVLLRAESIGFNISHGYGLTETGGLNVSCAWKPQWNRLPASD  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G+SV+R+G  VGEIV+RG+S+MLGYLKDP GT K 
Sbjct  353   RARLKARQGVRTVGFTEIDVVDPGSGRSVERNGERVGEIVMRGSSIMLGYLKDPIGTEKA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWF+TGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV+E AVVA
Sbjct  413   LK-NGWFFTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPAVNEVAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPTE+E+ E+CK ++P +MVP+ V F   LPKTSTGK+
Sbjct  472   RPDEFWGETPCAFVSLKPGLTRKPTEEEIIEYCKTKMPRYMVPKTVSFQDELPKTSTGKV  531

Query  335   QKFLLRDIARDLSS  294
              KF+LR+IA+ + S
Sbjct  532   MKFVLREIAKRMGS  545



>ref|XP_010062342.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Eucalyptus 
grandis]
 gb|KCW69469.1| hypothetical protein EUGRSUZ_F02923 [Eucalyptus grandis]
Length=562

 Score =   432 bits (1110),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/315 (69%), Positives = 257/315 (82%), Gaps = 3/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WG+AAVGGT++CLR+ D  +I   I RHGVTHMCGAPVVLNML++ +     
Sbjct  242   HANGWSFPWGLAAVGGTSICLRKFDATTIYQVIRRHGVTHMCGAPVVLNMLSSGSGAG-A  300

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGAPPPAAVL R ESLGF VSHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  301   EPLKHPVKILTAGAPPPAAVLFRTESLGFEVSHGYGLTETAGLVVSCAWKPQWNRLPAGE  360

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+V  T  +VV P +G  V+RDG+ +GEIVLRG  VMLGYLKDPEGT+KC
Sbjct  361   RARLKARQGVRTVAMTEVEVVDPESGAPVRRDGSTLGEIVLRGGCVMLGYLKDPEGTAKC  420

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+  GWFYTGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV EAAVVA
Sbjct  421   MR-GGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYGHPAVHEAAVVA  479

Query  515   RPDKFWGETPCAFVSLKKGIIAK-PTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             RPD+FWGETPCAFVS+K     + PTEKE+ E+C+ ++P +MVP+ VVF   LPKTSTGK
Sbjct  480   RPDEFWGETPCAFVSIKANRGGQPPTEKEIVEYCRSKMPHYMVPKTVVFKEELPKTSTGK  539

Query  338   IQKFLLRDIARDLSS  294
             IQK+LLR+ A+ + S
Sbjct  540   IQKYLLRETAKQMGS  554



>ref|NP_197141.1| acyl activating enzyme 5 [Arabidopsis thaliana]
 sp|Q9FFE6.1|AAE5_ARATH RecName: Full=Probable acyl-activating enzyme 5, peroxisomal; 
AltName: Full=AMP-binding protein 5; Short=AtAMPBP5 [Arabidopsis 
thaliana]
 gb|AAM28622.1|AF503764_1 adenosine monophosphate binding protein 5 AMPBP5 [Arabidopsis 
thaliana]
 dbj|BAB09604.1| AMP-binding protein [Arabidopsis thaliana]
 gb|AED92284.1| acyl activating enzyme 5 [Arabidopsis thaliana]
Length=552

 Score =   431 bits (1109),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 259/314 (82%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+  N +   
Sbjct  237   HANGWSYPWGIAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLNMLSATNEF---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES+GF +SHGYGLTET GL V+CAWK +W+ LPA +
Sbjct  294   QPLNRPVNILTAGAPPPAAVLLRAESIGFVISHGYGLTETAGLNVSCAWKPQWNRLPASD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G+SV+R+G  VGEIV+RG+S+MLGYLKDP GT K 
Sbjct  354   RARLKARQGVRTVGFTEIDVVDPESGRSVERNGETVGEIVMRGSSIMLGYLKDPVGTEKA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV+E AVVA
Sbjct  414   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVETVLYTNPAVNEVAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFVSLK G+  +PTE EM E+C++++P +MVP+ V F+  LPKTSTGK+
Sbjct  473   RPDVFWGETPCAFVSLKSGLTQRPTEVEMIEYCRKKMPKYMVPKTVSFVDELPKTSTGKV  532

Query  335   QKFLLRDIARDLSS  294
              KF+LR+IA+ + +
Sbjct  533   MKFVLREIAKKMGT  546



>ref|XP_006472878.1| PREDICTED: probable acyl-activating enzyme 9-like isoform X2 
[Citrus sinensis]
Length=552

 Score =   431 bits (1108),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 254/315 (81%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWGMAAVG TN+CLRR D ++I+D I++H VTHMCGAPVVLNM++N  ++   
Sbjct  241   HANGWGYTWGMAAVGATNICLRRFDASTISDLIQKHNVTHMCGAPVVLNMISNSPDF---  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPA VL R ES+GF VSHGYGLTET GL V+CAWK EWD LP  E
Sbjct  298   EPLKTPVQILTAGAPPPAPVLSRTESMGFVVSHGYGLTETAGLVVSCAWKPEWDKLPLEE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV++VG    DVV+P TG+SVKRDG  +GE+VLRG  V +GY KD E T +C
Sbjct  358   RARLKARQGVKTVGLAEVDVVNPETGESVKRDGVSLGEVVLRGGCVTVGYFKDKEATRRC  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             + ++GWFYTGD+GV+H DGY+E+KDR KDVIISGGEN+ S EVESVLY   AV+EAAVVA
Sbjct  418   ISDNGWFYTGDIGVMHADGYVEIKDRSKDVIISGGENICSAEVESVLYSITAVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKG--IIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD FWGE PCAFVSLK+   +  KPTEKE+ E+C+ RLP +MVPRKVVF   LPKTSTG
Sbjct  478   RPDMFWGEIPCAFVSLKRDLELTKKPTEKEIIEYCRARLPRYMVPRKVVFSEELPKTSTG  537

Query  341   KIQKFLLRDIARDLS  297
             KIQK+LLR+ A+ +S
Sbjct  538   KIQKYLLREFAKSVS  552



>ref|XP_006434307.1| hypothetical protein CICLE_v10000754mg [Citrus clementina]
 gb|ESR47547.1| hypothetical protein CICLE_v10000754mg [Citrus clementina]
Length=552

 Score =   431 bits (1108),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 254/315 (81%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWGMAAVG TN+CLRR D ++I+D I++H VTHMCGAPVVLNM++N  ++   
Sbjct  241   HANGWGYTWGMAAVGATNICLRRFDASTISDLIQKHNVTHMCGAPVVLNMISNSPDF---  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPA VL R ES+GF VSHGYGLTET GL V+CAWK EWD LP  E
Sbjct  298   EPLKTPVQILTAGAPPPAPVLSRTESMGFVVSHGYGLTETAGLVVSCAWKPEWDKLPLEE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV++VG    DVV+P TG+SVKRDG  +GE+VLRG  V +GY KD E T +C
Sbjct  358   RARLKARQGVKTVGLAEVDVVNPETGESVKRDGVSLGEVVLRGGCVTVGYFKDKEATRRC  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             + ++GWFYTGD+GV+H DGY+E+KDR KDVIISGGEN+ S EVESVLY   AV+EAAVVA
Sbjct  418   ISDNGWFYTGDIGVMHADGYVEIKDRSKDVIISGGENICSAEVESVLYSITAVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKG--IIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD FWGE PCAFVSLK+   +  KPTEKE+ E+C+ RLP +MVPRKVVF   LPKTSTG
Sbjct  478   RPDMFWGEIPCAFVSLKRDLELTEKPTEKEIIEYCRARLPRYMVPRKVVFSEELPKTSTG  537

Query  341   KIQKFLLRDIARDLS  297
             KIQK+LLR+ A+ +S
Sbjct  538   KIQKYLLREFAKSVS  552



>ref|XP_002893174.1| hypothetical protein ARALYDRAFT_889616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69433.1| hypothetical protein ARALYDRAFT_889616 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   431 bits (1107),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 249/314 (79%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVC RRVD  +I D I++H VTHMC AP+VLNML NY +    
Sbjct  239   HANGWGYTWGTAAVGATNVCTRRVDAPTIYDLIDKHHVTHMCAAPMVLNMLTNYPSR---  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV ++TAGAPPPAA++ R ESLGF V HGYGLTETGG  V+CAWK EWD+L   E
Sbjct  296   KPLKNPVQVMTAGAPPPAAIISRAESLGFNVGHGYGLTETGGPVVSCAWKAEWDHLDPLE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++GF   DV  P TGKSV+ DG  VGEIVL+G SVMLGY KDPEGT+ C
Sbjct  356   RARLKSRQGVRTIGFADVDVRDPRTGKSVEHDGVSVGEIVLKGGSVMLGYYKDPEGTAAC  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFY+GDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  416   MREDGWFYSGDVGVIHEDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  475

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK         TE+E+REFCK +LP +MVPRKV+F   LPKTSTG
Sbjct  476   KPDKMWGETPCAFVSLKYDNNGNGSVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTG  535

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  536   KIQKFLLRQMAKSL  549



>emb|CDP01726.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   431 bits (1108),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 254/312 (81%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSYTWGMAAVGGTN+CLRR D   I   +  H VTHMCGAPVVLNM+AN ++    
Sbjct  242   HSNGWSYTWGMAAVGGTNICLRRFDAGIIYACVGLHDVTHMCGAPVVLNMIANSSH---A  298

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L +PV  LT GAPPPA V+ R ESLGF VSHGYGLTE  G+ V+CAWK  W+ LPA E
Sbjct  299   KSLKNPVHFLTGGAPPPATVVLRTESLGFVVSHGYGLTEVAGVVVSCAWKPMWNALPATE  358

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G T  DVV P TG SVK+DG+ +GEIVLRG  +MLGYLK+PEGTS+C
Sbjct  359   RARLKARQGVRTLGMTEVDVVEPETGVSVKKDGSSMGEIVLRGGCLMLGYLKNPEGTSRC  418

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++E+GW YTGDVGV+HPDGY+E+KDR KD+IISGGEN+SSVEVESVLY +P V+EAAVVA
Sbjct  419   LRENGWLYTGDVGVMHPDGYLEIKDRSKDIIISGGENVSSVEVESVLYTNPVVNEAAVVA  478

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PD +WGETPCAFVSLK+ +  KP EK++ EFC+ RLP +MVP+ VVFM  LPKT+TGKI
Sbjct  479   KPDDYWGETPCAFVSLKENVRKKPREKDIIEFCRARLPHYMVPKNVVFMDELPKTATGKI  538

Query  335   QKFLLRDIARDL  300
             QKF LRD+A+ +
Sbjct  539   QKFSLRDVAKKI  550



>ref|XP_008463174.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Cucumis 
melo]
Length=557

 Score =   431 bits (1108),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 252/315 (80%), Gaps = 3/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS+ WG+AAVGGTNVC+R+ D   I   I RH VTH+CGAPVVLNML N  +    
Sbjct  241   HGNGWSFPWGIAAVGGTNVCIRKFDARLIFSLIRRHHVTHLCGAPVVLNMLTNSPDNL--  298

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL  PV ILTAGAPPPA++L R ESLGF V+HGYGLTE+ G  + C+WK EW+ LPA E
Sbjct  299   -PLDRPVKILTAGAPPPASILLRTESLGFVVTHGYGLTESAGTIICCSWKSEWNQLPAIE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR +     DV+ P T KSVKRDG  +GEIV+RG SV LGYLKDPEGT+K 
Sbjct  358   QARLKARQGVRMLAVEAVDVLDPETRKSVKRDGASIGEIVVRGASVTLGYLKDPEGTAKA  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M EDGWF+TGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLYM+P V+EAAVVA
Sbjct  418   MSEDGWFFTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYMNPMVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK+G+  KPTE+E+ E+CK +LP FMVP+ V+FM  +PKT+TGKI
Sbjct  478   RPDEFWGETPCAFISLKEGLSRKPTEEEIIEYCKGKLPRFMVPKTVIFMTEMPKTATGKI  537

Query  335   QKFLLRDIARDLSSA  291
             QKF+LR  A+ L  A
Sbjct  538   QKFVLRQKAKSLGPA  552



>ref|XP_010539691.1| PREDICTED: probable acyl-activating enzyme 9 [Tarenaya hassleriana]
Length=551

 Score =   430 bits (1106),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 214/316 (68%), Positives = 256/316 (81%), Gaps = 7/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVGGTNVC RRVD  +I ++IE+H VTHMC AP+VLNML NY N    
Sbjct  238   HANGWGYTWGTAAVGGTNVCTRRVDAPTIFESIEKHDVTHMCAAPMVLNMLTNYQNR---  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              P+ +PV ++TAG+PPPAAV+ R ESLGF VSHGYG+TETGGL V C WK +W++L   E
Sbjct  295   SPVKNPVRVMTAGSPPPAAVISRAESLGFEVSHGYGMTETGGLVVYCGWKPQWNHLDENE  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG++S+G    DV+ P TGK+V+ DG  +GE+V RG SVMLGY KDPEGT+KC
Sbjct  355   RARLKSRQGIKSIGLAEVDVIDPKTGKTVEHDGVSIGEVVFRGASVMLGYYKDPEGTAKC  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M++DGW YTGD GVIHPDGY+EVKDR KDVII GGEN+SS E+ESVLY +PAV EAAVVA
Sbjct  415   MRDDGWLYTGDNGVIHPDGYLEVKDRSKDVIICGGENISSAEIESVLYTNPAVKEAAVVA  474

Query  515   RPDKFWGETPCAFVSLKKG---IIAKP-TEKEMREFCKERLPLFMVPRKVVFMAALPKTS  348
             +PDK WGETPCAFVSLK G     ++P TEKE+RE+CK++LP +MVPRKVVF   LPKTS
Sbjct  475   KPDKMWGETPCAFVSLKNGEEKERSRPVTEKEIREYCKKKLPRYMVPRKVVFREELPKTS  534

Query  347   TGKIQKFLLRDIARDL  300
             TGKIQKFLLR++A+ L
Sbjct  535   TGKIQKFLLREMAKSL  550



>ref|XP_008227873.1| PREDICTED: probable acyl-activating enzyme 6 [Prunus mume]
Length=561

 Score =   431 bits (1107),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 251/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW Y W MAAVGGTN+CLR+ D   I  +I  H VTHMC APVVLNML N+     +
Sbjct  241   HSNGWGYPWAMAAVGGTNICLRKFDAPKIYSSIRAHNVTHMCAAPVVLNMLVNHPI---S  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL  PV ILT GAPPP++VL R ES+GF V HGYGLTETGG+ V+CAWK EW+  P  E
Sbjct  298   DPLPHPVHILTGGAPPPSSVLLRAESIGFLVCHGYGLTETGGVVVSCAWKPEWNKYPMTE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR++G T  DVV P +G  VKRDG+ +GEIV +G  VMLGY KDPE T+KC
Sbjct  358   KAKLKARQGVRTIGMTEVDVVDPDSGSPVKRDGSEIGEIVFKGGCVMLGYFKDPESTAKC  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K++GWFYTGDVGV+HPDGY+E+KDR KDVII+GGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  418   LKKNGWFYTGDVGVMHPDGYLEIKDRSKDVIITGGENLSSVEVESVLYANPAVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PD+FWGETPCAFVSLK  +  KPTEKE+ E+C+E LP +MVP+ VVF   LPKTSTGKI
Sbjct  478   KPDEFWGETPCAFVSLKSDVSPKPTEKEIMEYCRENLPHYMVPKTVVFKDELPKTSTGKI  537

Query  335   QKFLLRDIARDL  300
             QKF+LR+IA+++
Sbjct  538   QKFVLREIAKEI  549



>ref|XP_006472877.1| PREDICTED: probable acyl-activating enzyme 9-like isoform X1 
[Citrus sinensis]
Length=569

 Score =   431 bits (1107),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 211/316 (67%), Positives = 254/316 (80%), Gaps = 5/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWGMAAVG TN+CLRR D ++I+D I++H VTHMCGAPVVLNM++N  ++   
Sbjct  241   HANGWGYTWGMAAVGATNICLRRFDASTISDLIQKHNVTHMCGAPVVLNMISNSPDF---  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPA VL R ES+GF VSHGYGLTET GL V+CAWK EWD LP  E
Sbjct  298   EPLKTPVQILTAGAPPPAPVLSRTESMGFVVSHGYGLTETAGLVVSCAWKPEWDKLPLEE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV++VG    DVV+P TG+SVKRDG  +GE+VLRG  V +GY KD E T +C
Sbjct  358   RARLKARQGVKTVGLAEVDVVNPETGESVKRDGVSLGEVVLRGGCVTVGYFKDKEATRRC  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             + ++GWFYTGD+GV+H DGY+E+KDR KDVIISGGEN+ S EVESVLY   AV+EAAVVA
Sbjct  418   ISDNGWFYTGDIGVMHADGYVEIKDRSKDVIISGGENICSAEVESVLYSITAVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKG--IIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD FWGE PCAFVSLK+   +  KPTEKE+ E+C+ RLP +MVPRKVVF   LPKTSTG
Sbjct  478   RPDMFWGEIPCAFVSLKRDLELTKKPTEKEIIEYCRARLPRYMVPRKVVFSEELPKTSTG  537

Query  341   KIQKFLLRDIARDLSS  294
             KIQK+LLR+ A+ + S
Sbjct  538   KIQKYLLREFAKSIES  553



>ref|XP_002319862.2| hypothetical protein POPTR_0013s08950g [Populus trichocarpa]
 gb|EEE95785.2| hypothetical protein POPTR_0013s08950g [Populus trichocarpa]
Length=551

 Score =   430 bits (1105),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 252/312 (81%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS+ WGMAAVGGTN+CLR+V+ ++I   I RHGVTHM GAPVVLN+L    +    
Sbjct  240   HTNGWSHVWGMAAVGGTNICLRKVEASTIYSLIHRHGVTHMSGAPVVLNILTKSPD---V  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV I+TAGAPPPAAV+ R ESLGF VSHGYGLTET GL V+CAWK +W+  PA E
Sbjct  297   EPLKNPVHIITAGAPPPAAVILRTESLGFVVSHGYGLTETAGLVVSCAWKPKWNTFPASE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV   GFT  DVV P TG+S++RDG  VGE+VLRG  +MLGYLKDP GTSKC
Sbjct  357   RARLKARQGVTMAGFTEMDVVDPRTGESMRRDGVSVGEVVLRGGCLMLGYLKDPLGTSKC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVG++H DGY+E+KDR KDVIISGGEN+SSVEVESVLY HPAV EAAVV 
Sbjct  417   MK-DGWFYTGDVGIMHQDGYLEIKDRSKDVIISGGENISSVEVESVLYTHPAVHEAAVVG  475

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK G+  KP EK++ +FC+  +P FMVP+ VVF   LP+TSTGKI
Sbjct  476   RPDEFWGETPCAFVDLKDGLNQKPCEKDIIDFCRNNMPHFMVPKTVVFKDELPRTSTGKI  535

Query  335   QKFLLRDIARDL  300
             QKF+L++IA+ +
Sbjct  536   QKFVLKEIAKGM  547



>ref|XP_010549881.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Tarenaya 
hassleriana]
Length=557

 Score =   430 bits (1105),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/312 (68%), Positives = 253/312 (81%), Gaps = 2/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW + W MAAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNM++N      +
Sbjct  239   HANGWCFPWAMAAVGGTNVCLRKFDAPVIYRLIREHGVTHMCGAPVVLNMISNTTVDK-S  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL SPV ILTAG+PPP+++L R ESLGF VSHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  298   QPLVSPVQILTAGSPPPSSILLRAESLGFVVSHGYGLTETAGLVVSCAWKPQWNRLPASE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV +V  T  DVV P +G+SV RDG+ +GEI LRG S+MLGYLKDPEGT KC
Sbjct  358   RARLKARQGVGTVASTEIDVVDPESGRSVARDGSTIGEIALRGGSIMLGYLKDPEGTQKC  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K  GWFYTGDVGVIHPDGY+E+KDR KD+II+GGEN+SSVEVESVLY + AV EAAVVA
Sbjct  418   LKT-GWFYTGDVGVIHPDGYLEIKDRSKDIIITGGENVSSVEVESVLYTNTAVHEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD++WGETPCAFVSLK G+  KPTEKEM E+C+E+LP +MVP+ V F   LPKTSTGKI
Sbjct  477   RPDEYWGETPCAFVSLKPGLRRKPTEKEMIEYCREKLPHYMVPKTVSFEEELPKTSTGKI  536

Query  335   QKFLLRDIARDL  300
             QKF+LR+ A+ +
Sbjct  537   QKFVLREKAKKM  548



>ref|XP_011011090.1| PREDICTED: probable acyl-activating enzyme 6 [Populus euphratica]
Length=554

 Score =   429 bits (1104),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 253/317 (80%), Gaps = 2/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY WGMAAVGGTN+C+R+ D  +I   I++HGVTHMCGAPVVLNML+N       
Sbjct  237   HSNGWSYPWGMAAVGGTNICVRKFDAPTIYGLIKKHGVTHMCGAPVVLNMLSNSPTNM--  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV I+TAGAPPPA +L R ESLGF V HGYGLTETGG+ V+CAWKR+W+  PA E
Sbjct  295   EPLKHPVHIITAGAPPPATILSRTESLGFVVGHGYGLTETGGIVVSCAWKRQWNLFPATE  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VG T  DVV P TG SVKRDG  +GEIVLRG  +MLGYLKDP  T+KC
Sbjct  355   RARLKARQGVRTVGMTEVDVVDPVTGMSVKRDGLTLGEIVLRGGCIMLGYLKDPVATAKC  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M  +GWF TGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY  P ++EAAVVA
Sbjct  415   MTGNGWFCTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTFPDINEAAVVA  474

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+     PTEKE+ E C+ RLP +MVP+ VV    LPKTSTGKI
Sbjct  475   RPDEFWGETPCAFVSLKEACCRIPTEKEIIEHCRGRLPHYMVPKTVVVKENLPKTSTGKI  534

Query  335   QKFLLRDIARDLSSADA  285
             QK +LRD+A+ + S+ A
Sbjct  535   QKAVLRDMAKAMGSSRA  551



>ref|XP_010935531.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal isoform 
X1 [Elaeis guineensis]
Length=501

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 256/314 (82%), Gaps = 1/314 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AA GGTNVCLRR D A+I  A+  H VTHMCGAPVVLNMLAN  + A  
Sbjct  183   HANGWSYPWGIAAAGGTNVCLRRFDAATIYAALATHRVTHMCGAPVVLNMLANAPDSAR-  241

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILTAGAPPPAAVL RVE+LGF V HGYGLTETGG+A++CAWK EWD LPA E
Sbjct  242   KPLPGTVRILTAGAPPPAAVLHRVEALGFSVGHGYGLTETGGMALSCAWKVEWDRLPAAE  301

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++  T  DV+   TG+SV+RDG  +GEIVLRG  VMLGYLKD EGTS+ 
Sbjct  302   RARLKARQGVRTLAMTDIDVIDRATGRSVRRDGATMGEIVLRGGYVMLGYLKDEEGTSRA  361

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  362   VRPDGWFYTGDVGVMHSDGYVEIKDRSKDVIISGGENVSSVEVESVLYGHPAVNEAAVVA  421

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WGET CAFVS+K+G+ A PTE E+  +C+ER+P +M P+ VV    LPKTSTGK+
Sbjct  422   RPDDYWGETTCAFVSMKEGVAAPPTEAEVIAWCRERMPHYMAPKTVVLKPELPKTSTGKV  481

Query  335   QKFLLRDIARDLSS  294
             QK+LLR++A+ + S
Sbjct  482   QKYLLREMAKAMGS  495



>ref|XP_010675193.1| PREDICTED: probable acyl-activating enzyme 6 [Beta vulgaris subsp. 
vulgaris]
Length=578

 Score =   430 bits (1106),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/312 (68%), Positives = 254/312 (81%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS TWGMAAVG TN+CLR+ D  ++ +AI  H VTHMCGAPVVLNMLAN  +    
Sbjct  253   HANGWSLTWGMAAVGATNICLRKFDAPTVFEAINHHKVTHMCGAPVVLNMLANLPS---A  309

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV+ILTAGAPPPA+VL R ESLGF VSHGYGLTETGGL V  AWK +W+N PA E
Sbjct  310   KPLEKPVEILTAGAPPPASVLFRTESLGFVVSHGYGLTETGGLVVNSAWKSKWNNYPAEE  369

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV S+G T  +++ P TG+ V+RDG  +GE+VLRG S+MLGYLKDPEGTSK 
Sbjct  370   RARLKARQGVGSLGMTEVNILDPKTGQPVQRDGLTLGEVVLRGGSIMLGYLKDPEGTSKS  429

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M   GWF TGDVGVIHPDGY+E+KDRLKD+IISGGEN+SSVEVE+VLY HPAV+EAAVVA
Sbjct  430   MTRTGWFRTGDVGVIHPDGYLEIKDRLKDIIISGGENISSVEVEAVLYTHPAVNEAAVVA  489

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK+    + TEKE+  +C+ER+  +MVP+ VVF   LPKTSTGK+
Sbjct  490   RPDEFWGETPCAFLSLKRKGKEEVTEKEIIGYCRERMAHYMVPKTVVFQEELPKTSTGKV  549

Query  335   QKFLLRDIARDL  300
             QKFLLR++A  +
Sbjct  550   QKFLLREMANAM  561



>ref|XP_002325656.2| hypothetical protein POPTR_0019s09610g [Populus trichocarpa]
 gb|EEF00038.2| hypothetical protein POPTR_0019s09610g [Populus trichocarpa]
Length=649

 Score =   432 bits (1111),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 255/315 (81%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGG N+CLRRV+  +I   I+RHGVTHMCGAPVVLNML N  N    
Sbjct  236   HANGWSYPWGMAAVGGANICLRRVEAPTIYSLIKRHGVTHMCGAPVVLNMLTNSPNAER-  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
               L +PV ILT GAPPP+AVL R ESLGF VSHGYGLTET GL  +CAWK +W+  PA E
Sbjct  295   --LQNPVQILTGGAPPPSAVLFRAESLGFVVSHGYGLTETAGLFTSCAWKPKWNTFPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV  VGFT   VV P+TGKSV+RDG  +GE+VLRG SVMLGY KDP GTS C
Sbjct  353   RARLKSRQGVPFVGFTEMGVVDPNTGKSVERDGVSLGEVVLRGGSVMLGYFKDPLGTSMC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVGV+H DGY+EVKDR KDVIISGGEN+SSVE+ESVLY HPAV+EAAVVA
Sbjct  413   MK-DGWFYTGDVGVLHSDGYLEVKDRSKDVIISGGENISSVEIESVLYTHPAVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KP EK++ ++C+E++  +MVP+ VVF   LPKTSTGKI
Sbjct  472   RPDEFWGETPCAFVSLKHGLPHKPGEKDIIDYCREKMAHYMVPKIVVFKDELPKTSTGKI  531

Query  335   QKFLLRDIARDLSSA  291
             QK+LLR+ A+ + S+
Sbjct  532   QKYLLREYAKVVDSS  546



>ref|XP_010675194.1| PREDICTED: probable acyl-activating enzyme 6 [Beta vulgaris subsp. 
vulgaris]
Length=582

 Score =   430 bits (1105),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 258/312 (83%), Gaps = 2/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWS+TWGMAAVGGTNVCL++ D A+I+ AI  H VTHMC APVVL+ML    +    
Sbjct  257   HSNGWSFTWGMAAVGGTNVCLKKFDGATIHAAIRAHNVTHMCAAPVVLSMLTTLTSDPG-  315

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL+ PV ILT G+PPPA +L R E+LGF V HGYGLTETGG+ V+CAWKR+W++LP+ E
Sbjct  316   -PLSWPVHILTGGSPPPAPILIRAEALGFIVGHGYGLTETGGVMVSCAWKRQWNDLPSLE  374

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +++RQGVR++  T  ++++P+TG+ V RDG  VGEIVLRG S+MLGYLKDPEGTSKC
Sbjct  375   RARLRARQGVRTIALTDINIINPNTGQPVNRDGKSVGEIVLRGASIMLGYLKDPEGTSKC  434

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M EDGWF TGD+GV+H DGY+E+KDR KD+IISGGEN+SSVEVE+VLY +PAV E AVVA
Sbjct  435   MGEDGWFRTGDLGVMHSDGYLEIKDRSKDIIISGGENISSVEVENVLYTYPAVSEVAVVA  494

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             + D++WGETPCAF+SL+KG+  KPTE+++ E+C+ ++P +MVP++VVF   LPKTSTGKI
Sbjct  495   KNDEYWGETPCAFISLRKGLKEKPTERDIFEYCRAKMPHYMVPKRVVFKEDLPKTSTGKI  554

Query  335   QKFLLRDIARDL  300
             QK+LLRD+A  L
Sbjct  555   QKYLLRDMANSL  566



>ref|XP_010492530.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
 ref|XP_010492531.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
 ref|XP_010492532.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
 ref|XP_010492534.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
 ref|XP_010492535.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
 ref|XP_010492536.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
Length=553

 Score =   429 bits (1102),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 258/312 (83%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  238   HANGWSYPWGIAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLNMLSATQE---S  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES+GF +SHGYGLTET GL V+CAWK +W+ LPA +
Sbjct  295   QPLNRPVNILTAGAPPPAAVLLRAESIGFVISHGYGLTETAGLNVSCAWKPQWNRLPATD  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++GFT  DVV P +G+ V+R+G  VGEIV++G+SVMLGYLKDP GT K 
Sbjct  355   RARLKARQGVRTLGFTEIDVVDPESGRGVERNGETVGEIVMKGSSVMLGYLKDPSGTEKA  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV E AVVA
Sbjct  415   LK-NGWFYTGDVGVIHTDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPAVSEVAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G+  +PTE+E+ E+C++++P +MVP+ V F   LPKTSTGK+
Sbjct  474   RPDEFWGETPCAFVSLKEGLSRRPTEEELIEYCRKKMPRYMVPKTVSFRDELPKTSTGKV  533

Query  335   QKFLLRDIARDL  300
              KF+LR+IA+++
Sbjct  534   MKFVLREIAKNM  545



>emb|CDY04644.1| BnaC05g16820D [Brassica napus]
Length=549

 Score =   428 bits (1101),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 249/314 (79%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVC RRVD  +I D I++H VTHMC AP+VLNML NY +    
Sbjct  238   HANGWGYTWGTAAVGATNVCTRRVDAPTIYDLIDKHKVTHMCAAPMVLNMLTNYPSR---  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL SPV ++TAGAPPPAA++ R E+LGF V HGYGLTETGG  ++CAWK EWD+L   E
Sbjct  295   QPLKSPVQVMTAGAPPPAAIISRTETLGFNVGHGYGLTETGGPVISCAWKPEWDHLDPLE  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+VGF   DV    TGKSVK DG  VGEIVL+G SVMLGY KDPEG++ C
Sbjct  355   RARLKSRQGVRTVGFAEVDVRDKRTGKSVKHDGVSVGEIVLKGGSVMLGYYKDPEGSAAC  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  415   MREDGWFYTGDVGVIHEDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  474

Query  515   RPDKFWGETPCAFVSLKKGII--AKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK G       TE+E+R+FCK +LP +MVPRKV+F   LPKTSTG
Sbjct  475   KPDKMWGETPCAFVSLKYGNNGDGSVTEREIRDFCKTKLPKYMVPRKVIFQEELPKTSTG  534

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  535   KIQKFLLRQMAKSL  548



>ref|XP_007221471.1| hypothetical protein PRUPE_ppa003617mg [Prunus persica]
 gb|EMJ22670.1| hypothetical protein PRUPE_ppa003617mg [Prunus persica]
Length=561

 Score =   428 bits (1101),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 250/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW Y W MAAVGGTN+CLR+ D   I  +I  H VTHMC APVVLNML N+     +
Sbjct  241   HSNGWGYPWAMAAVGGTNICLRKFDAPKIYSSIRAHNVTHMCAAPVVLNMLVNHPI---S  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL  PV ILT GAPPP++VL R ES+GF V HGYGLTETGG+ V+CAWK EW+  P  E
Sbjct  298   VPLPHPVHILTGGAPPPSSVLLRAESIGFLVCHGYGLTETGGVVVSCAWKPEWNKYPMTE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR++G T  DVV P +G  VKRDG+ +GEIV +G  VMLGY KDPE T+KC
Sbjct  358   KAKLKARQGVRTIGMTEVDVVDPDSGSPVKRDGSEIGEIVFKGGCVMLGYFKDPESTAKC  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K++GWFYTGDVGV+HPDGY+E+KDR KDVII+GGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  418   LKKNGWFYTGDVGVMHPDGYLEIKDRSKDVIITGGENLSSVEVESVLYANPAVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PD+FWGETPCAFVSLK  +  KPTEKE+ E+C+E LP +MVP+ VVF   LPKTSTGKI
Sbjct  478   KPDEFWGETPCAFVSLKSDVSPKPTEKEIMEYCRENLPHYMVPKTVVFKDELPKTSTGKI  537

Query  335   QKFLLRDIARDL  300
             QKF+LR+IA+ +
Sbjct  538   QKFVLREIAKAI  549



>ref|XP_011004906.1| PREDICTED: probable acyl-activating enzyme 6 [Populus euphratica]
Length=649

 Score =   431 bits (1109),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 254/315 (81%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGG N+CLRRV+  +I   I+RHGVTHMCGAPVVLNML N  N    
Sbjct  236   HANGWSYPWGMAAVGGANICLRRVEAPTIYSLIKRHGVTHMCGAPVVLNMLTNSPNAER-  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
               L +PV ILTAGAPPP+AVL R ESLGF VSHGYGLTET G+  +CAWK +W+  PA E
Sbjct  295   --LQNPVQILTAGAPPPSAVLFRAESLGFVVSHGYGLTETAGVVTSCAWKPKWNTFPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV  VGFT   VV P+TGKSV+RDG  +GE+VLRG SVMLGY KDP GTS C
Sbjct  353   RARLKSRQGVPIVGFTEMGVVDPNTGKSVERDGVSLGEVVLRGGSVMLGYFKDPLGTSMC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVGV+H DGY+EVKDR KDVIISGGEN+ SVE+ESVLY HPAV+EAAVVA
Sbjct  413   MK-DGWFYTGDVGVVHSDGYLEVKDRSKDVIISGGENICSVEIESVLYTHPAVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KP EK++ ++C+E++  +M P+ VVF   LPKTSTGKI
Sbjct  472   RPDEFWGETPCAFVSLKNGLADKPDEKDIIDYCREKMAHYMAPKIVVFKDELPKTSTGKI  531

Query  335   QKFLLRDIARDLSSA  291
             QK+LLR+ A+ + S+
Sbjct  532   QKYLLREYAKGVDSS  546



>ref|XP_006416291.1| hypothetical protein EUTSA_v10007282mg [Eutrema salsugineum]
 gb|ESQ34644.1| hypothetical protein EUTSA_v10007282mg [Eutrema salsugineum]
Length=548

 Score =   428 bits (1100),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 249/315 (79%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVC RRVD  +I D I++H VTHMC AP+VLNML NY +    
Sbjct  237   HANGWGYTWGTAAVGATNVCTRRVDAPTIYDLIDKHHVTHMCAAPMVLNMLTNYPSP---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV ++TAGAPPPA ++ R ESLGF V HGYGLTETGG  V+CAWK EW++L   E
Sbjct  294   KPLNNPVQVMTAGAPPPATIISRAESLGFNVGHGYGLTETGGPVVSCAWKPEWNHLEPLE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++GF   DV +  TGKSV+ DG  VGEIVL+G SVMLGY KDPEGT+ C
Sbjct  354   RAGLKSRQGVRTIGFAEVDVRNRLTGKSVEHDGVSVGEIVLKGGSVMLGYYKDPEGTAAC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  414   MREDGWFYTGDVGVIHKDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  473

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK         TE+E+REFCK +LP +MVPRKV+F   LPKTSTG
Sbjct  474   KPDKMWGETPCAFVSLKYDHNGDGSVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTG  533

Query  341   KIQKFLLRDIARDLS  297
             KIQKFLLR +A+ LS
Sbjct  534   KIQKFLLRQMAKSLS  548



>ref|XP_010675195.1| PREDICTED: probable acyl-activating enzyme 6 [Beta vulgaris subsp. 
vulgaris]
Length=559

 Score =   428 bits (1101),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 210/317 (66%), Positives = 257/317 (81%), Gaps = 3/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+TWGMAAVG TN+CLR+ D  ++ D I+ H VTHMCGAPVVLNML+N  N    
Sbjct  243   HANGWSFTWGMAAVGATNICLRKFDGPTVFDTIQAHNVTHMCGAPVVLNMLSNLPNPT--  300

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL+SPV ILTAGAPPPAA+L R ESLGF VSHGYGLTETGGL V+CAWK +W+  PA E
Sbjct  301   -PLSSPVHILTAGAPPPAAILLRTESLGFIVSHGYGLTETGGLIVSCAWKPKWNKFPASE  359

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQG+R++  +  DV+   TGKSV +DG+ VG+IVLRG  +MLGYLKDPEGTSKC
Sbjct  360   RAKLKARQGIRTLSASEVDVIDSETGKSVPKDGHTVGDIVLRGGFLMLGYLKDPEGTSKC  419

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M +DGWF TGDVGV+H DGY+E+KDR KD+IISGGEN+SSVEVES++Y  P V+EAAVVA
Sbjct  420   MGDDGWFRTGDVGVMHLDGYLEIKDRSKDIIISGGENISSVEVESMIYSFPGVNEAAVVA  479

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD++WGETPCAFVS K  +   P+E+++ E+C+ +LP +MVP+ VVF   LPKTSTGKI
Sbjct  480   RPDEYWGETPCAFVSFKDEVKNPPSERDVIEYCRAKLPHYMVPKTVVFKKELPKTSTGKI  539

Query  335   QKFLLRDIARDLSSADA  285
             QKF+LRDIA+ L  + A
Sbjct  540   QKFVLRDIAKALGPSKA  556



>gb|EPS70079.1| hypothetical protein M569_04675 [Genlisea aurea]
Length=547

 Score =   427 bits (1099),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/322 (65%), Positives = 258/322 (80%), Gaps = 7/322 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSYTWGMAAVGGTNVCLR+ +   + DAI RH VTHMCGAPVVLNM+ANY      
Sbjct  232   HSNGWSYTWGMAAVGGTNVCLRKFNAEIVYDAINRHNVTHMCGAPVVLNMMANYPR----  287

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
               L SPV ILT GAPPPA VL R ESLGF VSHGYG+TE  G+ V+CAWK +W++ PA E
Sbjct  288   --LKSPVQILTGGAPPPAPVLLRTESLGFVVSHGYGMTEVAGVVVSCAWKSKWNSFPATE  345

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQGVR++G   ADVV P  G+SV RDG  +GEIVLRG+ +MLGYLK+PE T+KC
Sbjct  346   QARLKSRQGVRTLGLAAADVVDPSNGESVPRDGLTMGEIVLRGSCLMLGYLKNPEATAKC  405

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+ +GW +TGD+GV+H DGYIE+KDR KD+IISGGEN+SSVEVESVLY +PAV+EAAVVA
Sbjct  406   MR-NGWLFTGDIGVMHRDGYIEIKDRSKDIIISGGENVSSVEVESVLYSNPAVNEAAVVA  464

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WGETPCAF+SLK+G+ ++P E E+ EFC+ERLP +MVP+ V+FM  LPKT+TGK+
Sbjct  465   RPDDYWGETPCAFLSLKEGVESRPAENEVIEFCRERLPHYMVPKTVIFMEELPKTATGKV  524

Query  335   QKFLLRDIARDLSSADAINANQ  270
             +KF LR IA  + S     A++
Sbjct  525   KKFALRGIAHQMGSQSQTPASR  546



>ref|XP_009149670.1| PREDICTED: probable acyl-activating enzyme 9 [Brassica rapa]
 emb|CDY08199.1| BnaA06g15270D [Brassica napus]
Length=548

 Score =   427 bits (1098),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 249/314 (79%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVC RRVD  +I D I++H VTHMC AP+VLNML NY +    
Sbjct  237   HANGWGYTWGTAAVGATNVCTRRVDAPTIYDLIDKHKVTHMCAAPMVLNMLTNYPSR---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ++TAGAPPPAA++ R E+LGF V HGYGLTETGG  ++CAWK EWD+L   E
Sbjct  294   QPLKNPVQVMTAGAPPPAAIISRAETLGFNVGHGYGLTETGGPVISCAWKPEWDHLDPLE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+VGF   DV    TG+SVK DG  VGEIVL+G SVMLGY KDPEGT+ C
Sbjct  354   RARLKSRQGVRTVGFAEVDVRDKRTGQSVKHDGVSVGEIVLKGGSVMLGYYKDPEGTAAC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  414   MREDGWFYTGDVGVIHEDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGII--AKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK G       TE+E+R+FCK +LP +MVPRKV+F   LPKTSTG
Sbjct  474   KPDKMWGETPCAFVSLKYGNNGDGSVTEREIRDFCKTKLPKYMVPRKVIFQEELPKTSTG  533

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  534   KIQKFLLRQMAKSL  547



>ref|XP_010420326.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
Length=552

 Score =   427 bits (1098),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 257/312 (82%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  237   HANGWSYPWGIAAVGGTNVCLRKFDTPLIYRLIRDHGVTHMCGAPVVLNMLSATQE---S  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES+GF +SHGYGLTET GL V+CAWK +W+ LPA +
Sbjct  294   QPLNRPVNILTAGAPPPAAVLLRAESIGFVISHGYGLTETAGLNVSCAWKPQWNRLPATD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++GFT  DVV P +G+ V+R+G  VGEIV++G+S+MLGYLKDP GT K 
Sbjct  354   RARLKARQGVRTLGFTEIDVVDPESGRGVERNGETVGEIVMKGSSIMLGYLKDPNGTEKA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV E AVVA
Sbjct  414   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPAVSEVAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G+  +PTE+E+ E+C++++P +MVP+ V F   LPKTSTGK+
Sbjct  473   RPDEFWGETPCAFVSLKEGLSRRPTEEELIEYCRKKMPRYMVPKTVSFRDELPKTSTGKV  532

Query  335   QKFLLRDIARDL  300
              KF+LR+IA+ +
Sbjct  533   MKFVLREIAKKM  544



>ref|XP_010935532.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal isoform 
X2 [Elaeis guineensis]
Length=556

 Score =   427 bits (1098),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 256/314 (82%), Gaps = 1/314 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AA GGTNVCLRR D A+I  A+  H VTHMCGAPVVLNMLAN  + A  
Sbjct  238   HANGWSYPWGIAAAGGTNVCLRRFDAATIYAALATHRVTHMCGAPVVLNMLANAPDSAR-  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILTAGAPPPAAVL RVE+LGF V HGYGLTETGG+A++CAWK EWD LPA E
Sbjct  297   KPLPGTVRILTAGAPPPAAVLHRVEALGFSVGHGYGLTETGGMALSCAWKVEWDRLPAAE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++  T  DV+   TG+SV+RDG  +GEIVLRG  VMLGYLKD EGTS+ 
Sbjct  357   RARLKARQGVRTLAMTDIDVIDRATGRSVRRDGATMGEIVLRGGYVMLGYLKDEEGTSRA  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  417   VRPDGWFYTGDVGVMHSDGYVEIKDRSKDVIISGGENVSSVEVESVLYGHPAVNEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WGET CAFVS+K+G+ A PTE E+  +C+ER+P +M P+ VV    LPKTSTGK+
Sbjct  477   RPDDYWGETTCAFVSMKEGVAAPPTEAEVIAWCRERMPHYMAPKTVVLKPELPKTSTGKV  536

Query  335   QKFLLRDIARDLSS  294
             QK+LLR++A+ + S
Sbjct  537   QKYLLREMAKAMGS  550



>ref|XP_006307172.1| hypothetical protein CARUB_v10008762mg [Capsella rubella]
 gb|EOA40070.1| hypothetical protein CARUB_v10008762mg [Capsella rubella]
Length=550

 Score =   427 bits (1097),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 249/314 (79%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG T+VC RRVD  +I + I++H VTHMC AP+VLNML NY +    
Sbjct  239   HANGWGYTWGTAAVGATSVCTRRVDAPTIYNLIDKHDVTHMCAAPMVLNMLTNYPSR---  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV ++TAGAPPPAA++ R ESLGF V HGYGLTETGG  V+CAWK EWD+L   E
Sbjct  296   KPLKNPVQVMTAGAPPPAAIISRAESLGFNVGHGYGLTETGGPVVSCAWKSEWDHLDPLE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++GF   DV  P TGKSV+ DG  +GEIVL+G SVMLGY KDPEGT+ C
Sbjct  356   RARLKSRQGVRTIGFAEVDVRDPITGKSVEHDGVSIGEIVLKGGSVMLGYYKDPEGTAAC  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  416   MREDGWFYTGDVGVIHKDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  475

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK         TE+E+REFCK +LP +MVPRKV+F   LPKTSTG
Sbjct  476   KPDKMWGETPCAFVSLKYDNNGDGSVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTG  535

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  536   KIQKFLLRQMAKSL  549



>ref|XP_004148908.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Cucumis sativus]
 gb|KGN50898.1| AMP dependent ligase [Cucumis sativus]
Length=557

 Score =   427 bits (1097),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 249/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS+ WG+AAVGGTNVC+R+ D   I   I RH VTH+CGAPVVLNML N  +    
Sbjct  241   HGNGWSFPWGIAAVGGTNVCIRKFDSRLIFSLIRRHHVTHLCGAPVVLNMLTNSPDNL--  298

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL  PV ILTAGAPPPA+VL R ESLGF V+HGYGLTE+ G  + C+WK EW+ LPA E
Sbjct  299   -PLDRPVKILTAGAPPPASVLLRTESLGFVVTHGYGLTESAGTIICCSWKSEWNQLPAIE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR +     DV+ P T KSVKRDG  +GEIV+RG S+MLGYLKD E TSK 
Sbjct  358   QARLKARQGVRMLAVEAVDVLDPETRKSVKRDGASIGEIVVRGPSLMLGYLKDTEATSKA  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M EDGWF+TGDVGV+HPDGYIE+KDR KDVIISGGENLSSVEVESVLYM+P V+EAAVVA
Sbjct  418   MSEDGWFFTGDVGVMHPDGYIEIKDRSKDVIISGGENLSSVEVESVLYMNPMVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK+G+  KPTE+E+ E+CK +LP FMVP+ V+FM  +PKT+TGK 
Sbjct  478   RPDEFWGETPCAFISLKEGLSRKPTEEEIIEYCKGKLPKFMVPKTVIFMTEMPKTATGKF  537

Query  335   QKFLLRDIARDL  300
             QKF+LR  A+ L
Sbjct  538   QKFVLRQKAKSL  549



>ref|XP_006400173.1| hypothetical protein EUTSA_v10016036mg [Eutrema salsugineum]
 gb|ESQ41626.1| hypothetical protein EUTSA_v10016036mg [Eutrema salsugineum]
Length=551

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 258/315 (82%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWS+ WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  236   HSNGWSFPWGIAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLNMLSATQE---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV++LTAG+PPP  VL R ES+GF +SHGYGLTE GG+ V+CAWK +W+ LPA +
Sbjct  293   QPLNHPVNVLTAGSPPPTTVLLRAESIGFNISHGYGLTEAGGVIVSCAWKPQWNRLPASD  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G+SV+R+G  VGEIV+RG+S+MLGYLKDP GT K 
Sbjct  353   RARLKARQGVRTVGFTEIDVVDPGSGRSVERNGESVGEIVMRGSSIMLGYLKDPIGTEKA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWF+TGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV+E AVVA
Sbjct  413   LK-NGWFFTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVETVLYTNPAVNEVAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPTE+EM E+C++++P +MVP+ V F   LPKTSTGKI
Sbjct  472   RPDEFWGETPCAFVSLKPGLTRKPTEEEMIEYCRKKMPRYMVPKTVTFQDELPKTSTGKI  531

Query  335   QKFLLRDIARDLSSA  291
              KF+LR+IA+ + S+
Sbjct  532   MKFVLREIAKKMGSS  546



>ref|XP_004170696.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Cucumis sativus]
Length=557

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 249/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS+ WG+AAVGGTNVC+R+ D   I   I RH VTH+CGAPVVLNML N  +    
Sbjct  241   HGNGWSFPWGIAAVGGTNVCIRKFDSRLIFSLIRRHHVTHLCGAPVVLNMLTNSPDNL--  298

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL  PV ILTAGAPPPA+VL R ESLGF V+HGYGLTE+ G  + C+WK EW+ LPA E
Sbjct  299   -PLDRPVKILTAGAPPPASVLLRTESLGFVVTHGYGLTESAGTIICCSWKSEWNQLPAIE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR +     DV+ P T KSVKRDG  +GEIV+RG S+MLGYLKD E TSK 
Sbjct  358   QARLKARQGVRMLAVEAVDVLDPETRKSVKRDGASIGEIVVRGPSLMLGYLKDTEATSKA  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M EDGWF+TGDVGV+HPDGYIE+KDR KDVIISGGENLSSVEVESVLYM+P V+EAAVVA
Sbjct  418   MSEDGWFFTGDVGVMHPDGYIEIKDRSKDVIISGGENLSSVEVESVLYMNPMVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK+G+  KPTE+E+ E+CK +LP FMVP+ V+FM  +PKT+TGK 
Sbjct  478   RPDEFWGETPCAFISLKEGLSRKPTEEEIIEYCKGKLPKFMVPKTVIFMTEMPKTATGKF  537

Query  335   QKFLLRDIARDL  300
             QKF+LR  A+ L
Sbjct  538   QKFVLRQKAKSL  549



>ref|XP_010935530.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Elaeis 
guineensis]
Length=557

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 258/315 (82%), Gaps = 2/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WG+AA GGTNVCLRR D A+I  A+  H VTHMCGAPVVLNMLAN  + A  
Sbjct  238   HANGWSFPWGIAASGGTNVCLRRFDSATIYAALATHRVTHMCGAPVVLNMLANAPDSAR-  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R E+LGF +SHGYGLTET GLA++CAWK EWD LPA E
Sbjct  297   QPLPDRVHILTAGAPPPAAVLHRAEALGFSISHGYGLTETAGLAISCAWKGEWDRLPAAE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++     DV+   TG+SVKRDG  +GEIVLRG  VMLGYLKD E TS+ 
Sbjct  357   RARLKARQGVRTLAMAEIDVIDGSTGESVKRDGATMGEIVLRGGCVMLGYLKDEEATSRA  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  417   VRPDGWFYTGDVGVMHADGYVEIKDRSKDVIISGGENLSSVEVESVLYGHPAVNEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAK-PTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             RPD++WGETPCAFVS+K+G++A  PTEKE+  +C+ER+P +MVP+ VVF   LPKTSTGK
Sbjct  477   RPDEYWGETPCAFVSIKEGVLAAPPTEKEVIGWCRERMPHYMVPKTVVFKPELPKTSTGK  536

Query  338   IQKFLLRDIARDLSS  294
             IQK++LR +AR + S
Sbjct  537   IQKYVLRKMARAMGS  551



>ref|XP_002873771.1| hypothetical protein ARALYDRAFT_488489 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50030.1| hypothetical protein ARALYDRAFT_488489 [Arabidopsis lyrata subsp. 
lyrata]
Length=552

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 255/312 (82%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  237   HANGWSYPWGIAAVGGTNVCLRKFDAPLIYRLIREHGVTHMCGAPVVLNMLSATQE---S  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES+GF +SHGYGLTET GL V+CAWK +W+ LPA +
Sbjct  294   QPLNRPVNILTAGAPPPAAVLLRAESIGFVISHGYGLTETAGLNVSCAWKPQWNRLPASD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV   +G SV+R+G  VGEIV+RG+S+MLGYLKDP GT K 
Sbjct  354   RARLKARQGVRTVGFTEIDVVDTESGLSVERNGETVGEIVMRGSSIMLGYLKDPIGTEKA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV E AVVA
Sbjct  414   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPAVSEVAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFVSLK G+  +PTE+E+ E+C++++P +MVP+ V F+  LPKTSTGK+
Sbjct  473   RPDAFWGETPCAFVSLKSGLSRRPTEEELIEYCRKKMPRYMVPKTVSFVDELPKTSTGKV  532

Query  335   QKFLLRDIARDL  300
              KF+LR+IA+ +
Sbjct  533   MKFVLREIAKKM  544



>ref|XP_010107699.1| putative acyl-activating enzyme 6 [Morus notabilis]
 gb|EXC16672.1| putative acyl-activating enzyme 6 [Morus notabilis]
Length=554

 Score =   426 bits (1095),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 215/319 (67%), Positives = 256/319 (80%), Gaps = 7/319 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMAAVGGTN+CLR+ D  +I D I +H VTH+CGAPVVLNM++N       
Sbjct  236   HANGWSFPWGMAAVGGTNICLRKFDAPTIYDMIRKHDVTHLCGAPVVLNMISNGAKDQ--  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
               L +PV ILTAGAPPPAA+L R E+LGF VSHGYGLTET GL V+CAWKR W+ LPA E
Sbjct  294   --LKNPVQILTAGAPPPAAILFRTETLGFVVSHGYGLTETAGLVVSCAWKRHWNRLPATE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGV +VG T   VV+P TG  V+ DGN +GE+VLRG SVMLGYLKDPEGT+KC
Sbjct  352   QARLKARQGVGTVGLTKLAVVNPETGAEVRNDGNTLGEVVLRGGSVMLGYLKDPEGTAKC  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M  D WFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVESV+Y  P V EAAVVA
Sbjct  412   MAGD-WFYTGDVGVMHSDGYLEIKDRSKDVIISGGENISSVEVESVIYGFPGVYEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIA--KPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD+FWGETPCAFVSLK+   A  +PTEKE+ ++C+ +LP +MVP+ VVF A LPKTSTG
Sbjct  471   RPDEFWGETPCAFVSLKESPAAEKRPTEKEIMDYCRSKLPHYMVPKTVVFKAELPKTSTG  530

Query  341   KIQKFLLRDIARDLSSADA  285
             KIQKF+LR+IA+ +  A A
Sbjct  531   KIQKFVLREIAKAMGPAGA  549



>ref|XP_004490748.1| PREDICTED: probable acyl-activating enzyme 6-like [Cicer arietinum]
Length=570

 Score =   426 bits (1095),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 255/314 (81%), Gaps = 6/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY WG+AAVGGT+VC RRVD  +I   IE HGVTHMC APVVLNML+N+N    T
Sbjct  241   HSNGWSYPWGLAAVGGTSVCARRVDAPTIYRLIESHGVTHMCAAPVVLNMLSNFNK---T  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV +LT G+ PPA +L + ESLGF VSHGYG+TET G+ V+CAWKR+WD  PA E
Sbjct  298   KPLKKPVHVLTGGSSPPATILSKAESLGFDVSHGYGMTETIGVVVSCAWKRKWDRFPATE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR VG T  DVV P TG+SVKRDG  VGEIV++G  +MLGYLKD + T +C
Sbjct  358   RARLKARQGVRRVGVTEVDVVGP-TGESVKRDGVTVGEIVVKGGCLMLGYLKDEDATWQC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+E+GWFYTGDVGVIH DGY+E+KDR KDVIISGGEN+SSVEVE+VLYMHPAV EAAVVA
Sbjct  417   MRENGWFYTGDVGVIHEDGYLEIKDRKKDVIISGGENMSSVEVEAVLYMHPAVKEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAK--PTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD+FWGETPCAFVSLK  +  +   TEKE++EFC+ERLP FMVP+ VVF   LPKTSTG
Sbjct  477   RPDEFWGETPCAFVSLKDELKEREMTTEKEVKEFCRERLPHFMVPKTVVFKDELPKTSTG  536

Query  341   KIQKFLLRDIARDL  300
             KIQK +LR +AR +
Sbjct  537   KIQKHVLRRVARAM  550



>ref|XP_009128212.1| PREDICTED: probable acyl-activating enzyme 4 [Brassica rapa]
 ref|XP_009128213.1| PREDICTED: probable acyl-activating enzyme 4 [Brassica rapa]
 emb|CDY38357.1| BnaA02g18500D [Brassica napus]
Length=552

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 213/312 (68%), Positives = 244/312 (78%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTW  AAVG TN+C+RRVD  +I + I++H VTHMC AP+VLNML NY      
Sbjct  243   HANGWGYTWATAAVGATNICVRRVDAPTIFELIDKHQVTHMCAAPMVLNMLTNYPAR---  299

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L  PV ++TAGAPPPA V+   ESLGF V+HGYGLTETGGL VTCAWK EWD L   E
Sbjct  300   KQLKRPVQVMTAGAPPPATVISSAESLGFDVAHGYGLTETGGLVVTCAWKPEWDGLGQDE  359

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F  ADV+   TGKSVK DG  VGEIV RG  VMLGY KDPEGT+  
Sbjct  360   RAKLKSRQGIRTAVFAEADVLDTLTGKSVKHDGVTVGEIVFRGGCVMLGYYKDPEGTAAS  419

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDVII GGEN+SS EVE+VLY +PAV EAAVVA
Sbjct  420   MREDGWFYTGDIGVMHPDGYLEVKDRSKDVIICGGENISSTEVETVLYTNPAVKEAAVVA  479

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       TE+E+REFCK++LP +MVPR VVFM  LPKTSTGKI
Sbjct  480   KPDKMWGETPCAFVSLKCSDGGSVTEREVREFCKKKLPKYMVPRNVVFMEELPKTSTGKI  539

Query  335   QKFLLRDIARDL  300
             QKFLLR +A+ L
Sbjct  540   QKFLLRQMAKSL  551



>ref|XP_004288564.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Fragaria vesca subsp. vesca]
Length=558

 Score =   424 bits (1090),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 226/315 (72%), Positives = 255/315 (81%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY +G+AAVGGTNVC+R+ D   I D I RHGVTHMCGAPVVLNML N  N    
Sbjct  243   HANGWSYPYGIAAVGGTNVCVRKFDARVIYDLITRHGVTHMCGAPVVLNMLTNIPN---V  299

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL SPV ILTAGAPPPAAVL R ESLGF VSHGYGLTET GL V+CAWK  W+  PA E
Sbjct  300   EPLRSPVHILTAGAPPPAAVLGRTESLGFVVSHGYGLTETAGLVVSCAWKPGWNKFPATE  359

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+V  T  DVV P TGK VKRDG  +GE+VLRG  VMLGYLKDP+GT+ C
Sbjct  360   RARLKSRQGVRTVAMTRVDVVDPDTGKPVKRDGASLGEVVLRGGCVMLGYLKDPKGTASC  419

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDV V+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY H AV+EAAVVA
Sbjct  420   MK-DGWFYTGDVAVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTHAAVNEAAVVA  478

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  +  +PTEKE+ E+C+ +LP FM P+ VVF   LPKTSTGKI
Sbjct  479   RPDEFWGETPCAFVSLKGDVSPRPTEKEIMEYCRGKLPSFMAPKTVVFKEELPKTSTGKI  538

Query  335   QKFLLRDIARDLSSA  291
             QKF+LR++A+ L S 
Sbjct  539   QKFVLREMAKALGST  553



>ref|XP_003519307.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Glycine max]
Length=549

 Score =   424 bits (1089),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 215/316 (68%), Positives = 255/316 (81%), Gaps = 9/316 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ +G+AAVGGTN+C+R+ D   +   I+RH VTHMCGAPVVLNML N       
Sbjct  235   HANGWSFPYGIAAVGGTNICVRKFDAEIVYSLIKRHHVTHMCGAPVVLNMLTNA-----N  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL  PV ILTAGAPPPAAVL R E+LGF VSHGYGLTETGGL V+CAWK EW+ LPA E
Sbjct  290   SPLEKPVQILTAGAPPPAAVLFRTEALGFVVSHGYGLTETGGLVVSCAWKGEWNKLPATE  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+V     DVV P TG+SVKRDG  +GE+V++G  VMLGYLKDP GT+ C
Sbjct  350   RARLKARQGVRTVAMAEVDVVGP-TGESVKRDGVSIGEVVMKGGCVMLGYLKDPSGTASC  408

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVES+LY HPAV+EAAVVA
Sbjct  409   FK-NGWFYTGDVGVMHEDGYLEIKDRSKDVIISGGENLSSVEVESILYGHPAVNEAAVVA  467

Query  515   RPDKFWGETPCAFVSLKKGI--IAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RP ++WGETPCAFVSLKKGI    KPTEK++ E+C++ +P +MVP+ VVF   LPKTSTG
Sbjct  468   RPHEYWGETPCAFVSLKKGIKEKEKPTEKDIIEYCRDNMPHYMVPKTVVFKDELPKTSTG  527

Query  341   KIQKFLLRDIARDLSS  294
             KIQKF+LR IA+++ S
Sbjct  528   KIQKFVLRQIAKEMGS  543



>ref|XP_010471911.1| PREDICTED: probable acyl-activating enzyme 4 [Camelina sativa]
Length=545

 Score =   423 bits (1088),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 248/312 (79%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG  N+CL RVD  +I + I++H VTHMC AP+VLNML NY++    
Sbjct  237   HANGWSYTWATAAVGAKNICLTRVDAPTIFNLIDKHQVTHMCAAPMVLNMLTNYSSQ---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ++TAGAPPPA V+ + E+LGF V HGYG+TETGGL V+CAWK EWD L   E
Sbjct  294   KPLKSPVKVMTAGAPPPATVISKAEALGFDVGHGYGMTETGGLVVSCAWKPEWDRLEPYE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+V F  ADV  P TGKSVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  354   RAKLKSRQGIRTVVFAEADVRDPLTGKSVKHDGVTVGEIVFRGGSVMLGYYKDPEGTAAN  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDV+I GGEN+SS EVE+VLY +PA+ EAA+VA
Sbjct  414   MREDGWFYTGDIGVMHPDGYLEVKDRSKDVVICGGENISSTEVEAVLYTNPAIKEAALVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       TE+E+REFCK +LP +MVPR VVF+  LPKTSTGKI
Sbjct  474   KPDKMWGETPCAFVSLKYH-DGSVTEREIREFCKTKLPKYMVPRNVVFLEELPKTSTGKI  532

Query  335   QKFLLRDIARDL  300
             QKFLLR +A+ L
Sbjct  533   QKFLLRQMAKSL  544



>ref|XP_003616111.1| 2-succinylbenzoate-CoA ligase [Medicago truncatula]
 gb|AES99069.1| long-chain acyl-CoA synthetase [Medicago truncatula]
Length=562

 Score =   424 bits (1090),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 254/314 (81%), Gaps = 7/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WG+AAVGGTN+C+R+ D   +   I +H VTHMCGAPVVLNML N  +    
Sbjct  239   HANGWSFPWGIAAVGGTNICVRKFDAEIVFSLIRKHHVTHMCGAPVVLNMLTNSPD---N  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILTAGAPPPAAVL R E+LGF VSHGYGLTETGGL V C WK++W+ LPA E
Sbjct  296   KPLQKTVHILTAGAPPPAAVLHRTEALGFTVSHGYGLTETGGLVVCCTWKKKWNLLPATE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++G T  DVV P +G+SVKRDG  +GE+V+RG  VMLGYLKD EGT  C
Sbjct  356   RARLKSRQGVRTLGMTKVDVVGP-SGESVKRDGATLGEVVMRGGCVMLGYLKDSEGTKNC  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K+ GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  415   FKK-GWFYTGDVGVMHEDGYLEIKDRSKDVIISGGENLSSVEVESVLYGHPAVNEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAK--PTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             R D+FWGETPCAFVSLK+G+  +  PTEKE+ E+C++ LP +MVP+ VVF   LPKTSTG
Sbjct  474   REDEFWGETPCAFVSLKEGLKERDIPTEKEIVEYCRKNLPHYMVPKTVVFKDELPKTSTG  533

Query  341   KIQKFLLRDIARDL  300
             KIQKF+LR IA+D+
Sbjct  534   KIQKFVLRQIAKDM  547



>emb|CAA64328.1| amp-binding protein [Brassica napus]
 emb|CDY40876.1| BnaCnng09670D [Brassica napus]
Length=552

 Score =   424 bits (1089),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 213/312 (68%), Positives = 244/312 (78%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTW  AAVG TN+C+RRVD  +I + I++H VTHMC AP+VLNML NY +    
Sbjct  243   HANGWGYTWATAAVGATNICVRRVDAPTIFELIDKHQVTHMCAAPMVLNMLTNYPSR---  299

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L  PV I+TAGAPPPA V+   ESLGF V+HGYGLTETGGL VTCAWK EWD L   E
Sbjct  300   KQLKRPVQIMTAGAPPPATVISSAESLGFDVAHGYGLTETGGLVVTCAWKPEWDGLGQDE  359

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F  ADV+   TGKSVK DG  VGEIV RG  VMLGY  DPEGT+  
Sbjct  360   RARLKSRQGIRTAVFAEADVLDTLTGKSVKHDGVTVGEIVFRGGCVMLGYYNDPEGTAAS  419

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDVII GGEN+SS EVE+VLY +PAV EAAVVA
Sbjct  420   MREDGWFYTGDIGVMHPDGYLEVKDRSKDVIICGGENISSTEVETVLYTNPAVKEAAVVA  479

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       TE+E+REFCK++LP +MVPR VVFM  LPKTSTGKI
Sbjct  480   KPDKMWGETPCAFVSLKCSDRGSVTEREVREFCKKKLPKYMVPRNVVFMEELPKTSTGKI  539

Query  335   QKFLLRDIARDL  300
             QKFLLR +A+ L
Sbjct  540   QKFLLRQMAKSL  551



>gb|AAL69511.1| putative AMP-binding protein [Arabidopsis thaliana]
Length=549

 Score =   424 bits (1089),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 255/312 (82%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW+  WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  236   HSNGWTNPWGIAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLNMLSATQE---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAG+PPPA VL R ES+GF +SHGYGLTET G+ V+CAWK +W++LPA +
Sbjct  293   QPLNHPVNILTAGSPPPATVLLRAESIGFVISHGYGLTETAGVIVSCAWKPKWNHLPASD  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G SV+R+G  VGEIV+RG+SVMLGYLKDP GT K 
Sbjct  353   RARLKARQGVRTVGFTEIDVVDPESGLSVERNGETVGEIVMRGSSVMLGYLKDPVGTEKA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY  PAV+E AVVA
Sbjct  413   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVETVLYTIPAVNEVAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G   KPTE+E+ E+C++++P +MVP+ V FM  LPK+STGK+
Sbjct  472   RPDEFWGETPCAFVSLKNGFSGKPTEEELMEYCRKKMPKYMVPKTVSFMDELPKSSTGKV  531

Query  335   QKFLLRDIARDL  300
              KF+LRDIA+ +
Sbjct  532   TKFVLRDIAKKM  543



>ref|NP_197138.1| probable acyl-activating enzyme 6 [Arabidopsis thaliana]
 sp|Q9FFE9.1|AAE6_ARATH RecName: Full=Probable acyl-activating enzyme 6; AltName: Full=AMP-binding 
protein 6; Short=AtAMPBP6 [Arabidopsis thaliana]
 gb|AAM28623.1|AF503765_1 adenosine monophosphate binding protein 6 AMPBP6 [Arabidopsis 
thaliana]
 dbj|BAB09601.1| AMP-binding protein [Arabidopsis thaliana]
 gb|AED92281.1| probable acyl-activating enzyme 6 [Arabidopsis thaliana]
Length=550

 Score =   423 bits (1088),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 255/312 (82%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW+  WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  237   HSNGWTNPWGIAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLNMLSATQE---S  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAG+PPPA VL R ES+GF +SHGYGLTET G+ V+CAWK +W++LPA +
Sbjct  294   QPLNHPVNILTAGSPPPATVLLRAESIGFVISHGYGLTETAGVIVSCAWKPKWNHLPASD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G SV+R+G  VGEIV+RG+SVMLGYLKDP GT K 
Sbjct  354   RARLKARQGVRTVGFTEIDVVDPESGLSVERNGETVGEIVMRGSSVMLGYLKDPVGTEKA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY  PAV+E AVVA
Sbjct  414   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVETVLYTIPAVNEVAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G   KPTE+E+ E+C++++P +MVP+ V FM  LPK+STGK+
Sbjct  473   RPDEFWGETPCAFVSLKNGFSGKPTEEELMEYCRKKMPKYMVPKTVSFMDELPKSSTGKV  532

Query  335   QKFLLRDIARDL  300
              KF+LRDIA+ +
Sbjct  533   TKFVLRDIAKKM  544



>ref|XP_004231632.1| PREDICTED: probable acyl-activating enzyme 6 [Solanum lycopersicum]
Length=550

 Score =   423 bits (1087),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 209/317 (66%), Positives = 252/317 (79%), Gaps = 5/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTN+CLR+ D   I ++I RH VTH+C APVVLNML+N      +
Sbjct  233   HANGWSYPWGMAAVGGTNICLRKFDAGIIYNSINRHNVTHICAAPVVLNMLSNSPE---S  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV I+TAG+PPPAAVL R ESLGF V HGYGLTETGGL ++C WK  W+  PA E
Sbjct  290   KPLNHPVYIMTAGSPPPAAVLFRTESLGFVVHHGYGLTETGGLVLSCTWKNHWNKFPANE  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+VG    DVV P +G SV+RDG+ +GEIVL+G  VMLGY KDPEGT KC
Sbjct  350   RARLKSRQGVRTVGMAEVDVVDPESGVSVQRDGSTLGEIVLKGACVMLGYFKDPEGTLKC  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+ +GWFYTGDV V+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HP+++EAAVVA
Sbjct  410   MR-NGWFYTGDVAVMHSDGYLEIKDRSKDVIISGGENLSSVEVESVLYTHPSINEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSL  G     +EK++ E+C+ +LP +MVP+ V+    LPKTSTGKI
Sbjct  469   RPDEFWGETPCAFVSL-NGKHKMISEKDIIEYCRAKLPHYMVPKTVIIKQDLPKTSTGKI  527

Query  335   QKFLLRDIARDLSSADA  285
             QKF+LRDIA+ +  +++
Sbjct  528   QKFVLRDIAKSMGKSNS  544



>ref|XP_010935529.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Elaeis 
guineensis]
Length=556

 Score =   422 bits (1086),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 252/314 (80%), Gaps = 1/314 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AA GGTNVCLRR D A+I  A+  H VTHMCGAPVVLNMLAN  +    
Sbjct  238   HANGWSYPWGIAAAGGTNVCLRRFDAATIYAALATHRVTHMCGAPVVLNMLANAPDSTR-  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILT G+PPPAAVL RVE+LGF V HGYGLTETGG+A++C WK EWD LPA E
Sbjct  297   KPLPGTVQILTGGSPPPAAVLHRVEALGFSVGHGYGLTETGGMALSCTWKAEWDRLPAAE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++  T  DV+   TG+SVKRDG  +GEIVLRG  VMLGYLKD +GTS+ 
Sbjct  357   RARLKSRQGVRTLAMTDIDVIDRATGQSVKRDGATMGEIVLRGGYVMLGYLKDEDGTSRA  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVESVLY HPAV+E AVVA
Sbjct  417   VRPDGWFYTGDVGVMHADGYVEIKDRSKDVIISGGENVSSVEVESVLYGHPAVNEVAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WGET CAFVS+K+G+ A PTE E+  +C+ER+P +M P+ VV    LPKTSTGK+
Sbjct  477   RPDDYWGETTCAFVSMKEGVAAPPTEAEVIAWCRERMPHYMAPKTVVLKPELPKTSTGKV  536

Query  335   QKFLLRDIARDLSS  294
             QK+LLR++A+ + S
Sbjct  537   QKYLLREMAKAMGS  550



>gb|ABK28406.1| unknown [Arabidopsis thaliana]
Length=550

 Score =   422 bits (1086),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 210/317 (66%), Positives = 251/317 (79%), Gaps = 7/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TN+C RRVD  +I + I++H VTHMC AP+VLNML NY     +
Sbjct  236   HANGWGYTWGTAAVGATNICTRRVDAPTIYNLIDKHNVTHMCAAPMVLNMLINYPL---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL +PV ++T+GAPPPA ++ R ESLGF VSH YGLTET G  V+CAWK +WD+L   E
Sbjct  293   TPLKNPVQVMTSGAPPPATIISRAESLGFNVSHSYGLTETSGPVVSCAWKPKWDHLDPLE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++GFT  DV    TGKSVK DG +VGEIV RG+SVMLGY KDP+GT+ C
Sbjct  353   RARLKSRQGVRTLGFTEVDVRDRKTGKSVKHDGVLVGEIVFRGSSVMLGYYKDPQGTAAC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFY+GD+GVIH DGY+E+KDR KDVII GGEN+SS E+E+VLY +P V EAAVVA
Sbjct  413   MREDGWFYSGDIGVIHKDGYLEIKDRSKDVIICGGENISSAEIETVLYTNPVVKEAAVVA  472

Query  515   RPDKFWGETPCAFVSLK---KGIIAKP-TEKEMREFCKERLPLFMVPRKVVFMAALPKTS  348
             +PDK WGETPCAFVSLK    G  + P TE+E+REFCK +LP +MVPRKV+F   LPKTS
Sbjct  473   KPDKMWGETPCAFVSLKCDNNGDGSVPVTEREIREFCKTKLPKYMVPRKVIFQEELPKTS  532

Query  347   TGKIQKFLLRDIARDLS  297
             TGKIQKFLLR +A+ LS
Sbjct  533   TGKIQKFLLRQMAKTLS  549



>gb|KFK25877.1| hypothetical protein AALP_AA8G173900 [Arabis alpina]
Length=551

 Score =   422 bits (1085),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/314 (66%), Positives = 255/314 (81%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVCLR+ D   I   I  HGVTH+CGAPVVLNML+       +
Sbjct  236   HANGWSYPWGIAAVGGTNVCLRKFDAPLIYRLIRHHGVTHLCGAPVVLNMLSATQE---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV+ILTAGAPPPAAVL R ES+GF++SHGYGLTET GL V+CAWK EW+ LPA +
Sbjct  293   KPLDRPVNILTAGAPPPAAVLLRAESIGFQISHGYGLTETAGLNVSCAWKPEWNRLPASD  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G  V+R+G  VGEIV+RG+S+MLGYLKD  GT K 
Sbjct  353   RARLKARQGVRTVGFTEIDVVDPESGLGVERNGESVGEIVMRGSSIMLGYLKDRTGTEKA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +P V+E AVVA
Sbjct  413   LK-NGWFYTGDVGVIHTDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPVVNEVAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  K TE+E+ E+C++++P +MVP+ V F   LPKTSTGK+
Sbjct  472   RPDEFWGETPCAFVSLKDGLSRKVTEEELIEYCRKKMPRYMVPKTVSFRDELPKTSTGKV  531

Query  335   QKFLLRDIARDLSS  294
              KF+LR+IA+ + +
Sbjct  532   MKFVLREIAKKMGT  545



>emb|CDY66619.1| BnaAnng22570D [Brassica napus]
Length=512

 Score =   421 bits (1082),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 259/327 (79%), Gaps = 9/327 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW++ WG+AAVGGTNVCLR+ D   I   I  HGVTHMCGAPVVL++L+   +    
Sbjct  190   HANGWTFPWGIAAVGGTNVCLRKFDAPLIYRLIRDHGVTHMCGAPVVLSILSASQD---V  246

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV++LTAGAPPP AVL R ES+GF++SHGYGLTETGGL V+CAWK +W+ LPA +
Sbjct  247   QPLDHPVNVLTAGAPPPVAVLLRAESIGFKISHGYGLTETGGLNVSCAWKPQWNRLPASD  306

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR+VGFT  DVV P TG SV+R+G  VGEIV+RG+S+MLGYLKDP GT   
Sbjct  307   QARLKARQGVRTVGFTEIDVVDPVTGLSVERNGENVGEIVMRGSSIMLGYLKDPVGTESV  366

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K  GWF+TGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+V+Y +P V E AVVA
Sbjct  367   LKS-GWFFTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVMYTNPVVSEVAVVA  425

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK G+  KPTEKEM E+C++R+P +MVP+ V F   LPKTSTGK+
Sbjct  426   RPDEFWGETPCAFVYLKPGLRMKPTEKEMIEYCRKRMPRYMVPKTVSFRNELPKTSTGKV  485

Query  335   QKFLLRDIAR-----DLSSADAINANQ  270
              KF+LR+IA+      LS+   ++ N+
Sbjct  486   MKFVLREIAKKMGQTSLSTGQVLSINK  512



>ref|XP_008803425.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Phoenix 
dactylifera]
Length=557

 Score =   422 bits (1085),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 258/314 (82%), Gaps = 1/314 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWSY WG+AA GGTNVCLRR D A+I  AI  H VTHMCGAPVVLNMLAN  + A  
Sbjct  239   HGNGWSYPWGIAAAGGTNVCLRRFDAATIYAAIATHRVTHMCGAPVVLNMLANAPDSAR-  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILTAGAPPPA+VL RVE+LGF VSHGYGLTETGG+A++CAWK EWD LP  E
Sbjct  298   KPLPGPVQILTAGAPPPASVLHRVEALGFSVSHGYGLTETGGMALSCAWKAEWDRLPPAE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++  T  DV+   TG+SV+RDG  +GEIVLRG  VMLGYLKD EGT + 
Sbjct  358   RARLKARQGVRTLAMTDIDVIDGATGQSVRRDGATMGEIVLRGGYVMLGYLKDEEGTKQA  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  418   VRPDGWFYTGDVGVMHADGYVEIKDRSKDVIISGGENVSSVEVESVLYEHPAVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WGET CAFVS+K+G++A PTE+E+  +C+ER+P +M P+ VVF   LPKTSTGKI
Sbjct  478   RPDDYWGETTCAFVSMKEGVLAPPTEEEVIAWCRERMPHYMAPKTVVFKPELPKTSTGKI  537

Query  335   QKFLLRDIARDLSS  294
             QK++LR++AR + +
Sbjct  538   QKYVLREMARAMGT  551



>ref|NP_001077573.1| probable acyl-activating enzyme 10 [Arabidopsis thaliana]
 sp|Q9LPK7.1|AEE10_ARATH RecName: Full=Probable acyl-activating enzyme 10; AltName: Full=AMP-binding 
protein 10; Short=AtAMPBP10 [Arabidopsis thaliana]
 gb|AAF87901.1|AC015447_11 Putative amp-binding protein [Arabidopsis thaliana]
 gb|ABE65638.1| AMP-binding protein [Arabidopsis thaliana]
 gb|AEE30114.1| probable acyl-activating enzyme 10 [Arabidopsis thaliana]
Length=549

 Score =   421 bits (1083),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/317 (66%), Positives = 250/317 (79%), Gaps = 7/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TN+C RRVD  +I + I++H VTHMC AP+VLNML NY     +
Sbjct  236   HANGWGYTWGTAAVGATNICTRRVDAPTIYNLIDKHNVTHMCAAPMVLNMLINYPL---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL +PV ++T+GAPPPA ++ R ESLGF VSH YGLTET G  V+CAWK +WD+L   E
Sbjct  293   TPLKNPVQVMTSGAPPPATIISRAESLGFNVSHSYGLTETSGPVVSCAWKPKWDHLDPLE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++GFT  DV    TGKSVK DG  VGEIV RG+SVMLGY KDP+GT+ C
Sbjct  353   RARLKSRQGVRTLGFTEVDVRDRKTGKSVKHDGVSVGEIVFRGSSVMLGYYKDPQGTAAC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFY+GD+GVIH DGY+E+KDR KDVII GGEN+SS E+E+VLY +P V EAAVVA
Sbjct  413   MREDGWFYSGDIGVIHKDGYLEIKDRSKDVIICGGENISSAEIETVLYTNPVVKEAAVVA  472

Query  515   RPDKFWGETPCAFVSLK---KGIIAKP-TEKEMREFCKERLPLFMVPRKVVFMAALPKTS  348
             +PDK WGETPCAFVSLK    G  + P TE+E+REFCK +LP +MVPRKV+F   LPKTS
Sbjct  473   KPDKMWGETPCAFVSLKCDNNGDGSVPVTEREIREFCKTKLPKYMVPRKVIFQEELPKTS  532

Query  347   TGKIQKFLLRDIARDLS  297
             TGKIQKFLLR +A+ LS
Sbjct  533   TGKIQKFLLRQMAKTLS  549



>ref|XP_010453792.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
Length=553

 Score =   421 bits (1083),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 256/312 (82%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AAVGGTNVC+R+ D   I   I  HGVTHMCGAPVVLNML+       +
Sbjct  238   HANGWSYPWGIAAVGGTNVCVRKFDAPVIYRLIRDHGVTHMCGAPVVLNMLSATQE---S  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES+GF +SHGYGLTET GL V+CAWK +W+ LPA +
Sbjct  295   QPLNRPVNILTAGAPPPAAVLLRAESIGFVISHGYGLTETAGLNVSCAWKPQWNRLPATD  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++GFT  DVV P +G+ V+R+G  VGEIV++G+S+MLGYLKDP GT   
Sbjct  355   RARLKARQGVRTLGFTEIDVVDPESGRGVERNGETVGEIVMKGSSIMLGYLKDPIGTENA  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+G EN+SSVEVE+VLY +PAV E AVVA
Sbjct  415   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIITGRENVSSVEVEAVLYTNPAVSEVAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G+  +PTE+E+ E+C++++P +MVP+ V F   LPKTSTGK+
Sbjct  474   RPDEFWGETPCAFVSLKEGLSRRPTEEELIEYCRKKMPRYMVPKTVSFRDELPKTSTGKV  533

Query  335   QKFLLRDIARDL  300
              KF+LR+IA+++
Sbjct  534   MKFVLREIAKNM  545



>ref|XP_003544347.1| PREDICTED: probable acyl-activating enzyme 6-like [Glycine max]
Length=551

 Score =   421 bits (1082),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/317 (66%), Positives = 250/317 (79%), Gaps = 6/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW++ WG+AA GGTN+C R++D  +I   IE H VTHMC APVVLNML        T
Sbjct  232   HSNGWTFPWGIAAAGGTNICARKIDAPTIYRLIESHNVTHMCAAPVVLNMLLTR-----T  286

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +P+ +PV +LT G+PPPAA+L R E LGFRVSHGYG+TET G+ V+CAWK+EWD  P+ E
Sbjct  287   EPVKNPVHVLTGGSPPPAAILTRAEELGFRVSHGYGMTETLGVVVSCAWKKEWDKFPSTE  346

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA  K+RQGVR+V  T  DVV P TG SVKRDG   GEIV RG+ VMLGYLKD EGT +C
Sbjct  347   RARFKARQGVRTVAMTEVDVVDPTTGISVKRDGVTPGEIVFRGSCVMLGYLKDIEGTKRC  406

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ + W YTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+E AVVA
Sbjct  407   IR-NNWLYTGDVGVMHGDGYLEIKDRSKDVIISGGENLSSVEVESVLYGHPAVNEVAVVA  465

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK+G++A P+EKE+ EFC+ERLP FMVP+ VVF  ALPKTSTGKI
Sbjct  466   RPDEFWGETPCAFVMLKEGLVAPPSEKELVEFCRERLPHFMVPKTVVFKEALPKTSTGKI  525

Query  335   QKFLLRDIARDLSSADA  285
             QK +LR  A+ + S  A
Sbjct  526   QKHVLRMNAKAMGSLVA  542



>gb|KFK44250.1| hypothetical protein AALP_AA1G234200 [Arabis alpina]
Length=547

 Score =   421 bits (1081),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 246/314 (78%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG T+VC RRVD  +I D I++H VTHMC AP+VLNML NY +    
Sbjct  236   HANGWGYTWGTAAVGATSVCTRRVDAPTIYDLIDKHQVTHMCAAPMVLNMLTNYPSR---  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV ++TAGAPPPA ++ R ESLGF V HGYGLTETGG  ++CAWKREWD+L   E
Sbjct  293   KPLKNPVQVMTAGAPPPATIISRAESLGFNVGHGYGLTETGGPVISCAWKREWDHLDPLE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQGVR++G    DV    TGKSV+ DG  VGEIVL+G SVMLGY KDPEGT+ C
Sbjct  353   KARLKSRQGVRTIGLADVDVRDRITGKSVEHDGVSVGEIVLKGGSVMLGYYKDPEGTAAC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGDVGVIH D Y+E+KDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  413   MREDGWFYTGDVGVIHKDSYLELKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVA  472

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK         TE+E+REFCK +LP +MVPRKV+F   LPKTSTG
Sbjct  473   KPDKMWGETPCAFVSLKYDSNGDGSVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTG  532

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  533   KIQKFLLRQMAKSL  546



>ref|XP_008348622.1| PREDICTED: probable acyl-activating enzyme 6 [Malus domestica]
Length=567

 Score =   421 bits (1082),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 210/313 (67%), Positives = 253/313 (81%), Gaps = 4/313 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW + W MAAVGGTN+C+R+ D   I + IE +GVTHMC APVVLNML N      +
Sbjct  236   HANGWCFPWAMAAVGGTNICVRKFDGPKIYELIEDNGVTHMCAAPVVLNMLINTRR---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL +PV+ILT GAPPP++VL R ES+GF V HGYG+TET G+ ++CAWK EW+ LPA E
Sbjct  293   DPLRNPVNILTGGAPPPSSVLLRAESIGFVVGHGYGMTETAGVVLSCAWKPEWNKLPAME  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGV ++G T ADVV+P +G SV RDG  +GEIVLRG  +MLGYLKD  GT+ C
Sbjct  353   QARLKARQGVMTIGMTEADVVNPDSGLSVNRDGLEIGEIVLRGGCLMLGYLKDAAGTANC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DGWFYTGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVESVLY +PAV+EAAVVA
Sbjct  413   MK-DGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENMSSVEVESVLYGNPAVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  +  KPTEKE+ E+C+ +LP FMVP+ VV    LPKTSTGKI
Sbjct  472   RPDEFWGETPCAFVSLKSDVSPKPTEKEIIEYCRGKLPSFMVPKTVVIKDELPKTSTGKI  531

Query  335   QKFLLRDIARDLS  297
             QKFLLR+IAR ++
Sbjct  532   QKFLLREIARGIA  544



>gb|AGA17928.1| CCL11 [Humulus lupulus]
Length=563

 Score =   420 bits (1080),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 251/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG+AAVGGTN+CLRR D   I + I RH VTHMC AP+VLNML+N  N    
Sbjct  239   HANGWGYTWGIAAVGGTNICLRRFDGEIIFNLIRRHRVTHMCAAPIVLNMLSNSPN---A  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ++T GAPPPAAVL R ES GF +SHGYG+TE  G+ V+CAWKREW+ LPA E
Sbjct  296   EPLPNPVHVMTGGAPPPAAVLLRTESJGFVISHGYGMTEMLGVVVSCAWKREWNRLPATE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQGVR+      DVV P++G SVKRDG  +GEIVL+G+S+MLGYLK+   T+KC
Sbjct  356   QARLKSRQGVRTAAMMEVDVVDPNSGVSVKRDGLTMGEIVLKGSSIMLGYLKNSAATAKC  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGD+ V+HPDGY+E+KDR KDVIISGGEN+SSVEVES LY HPAVDEAAVVA
Sbjct  416   IRADGWFYTGDMAVMHPDGYLEIKDRSKDVIISGGENVSSVEVESALYSHPAVDEAAVVA  475

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
              PD++WGETP AFV+LKKG+  +PTEKE+ E+C+E+L  FMVP+ VVF   LPKTSTGKI
Sbjct  476   CPDEYWGETPFAFVTLKKGMRVRPTEKEILEYCREKLAHFMVPKVVVFRDKLPKTSTGKI  535

Query  335   QKFLLRDIARDL  300
             QKF L++I + +
Sbjct  536   QKFTLKEIVKTM  547



>ref|XP_006390110.1| hypothetical protein EUTSA_v10018371mg [Eutrema salsugineum]
 gb|ESQ27396.1| hypothetical protein EUTSA_v10018371mg [Eutrema salsugineum]
Length=543

 Score =   419 bits (1077),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 247/314 (79%), Gaps = 8/314 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTW  AAVG TN+CLRRVD  +I + I++H VTHMC AP+VLNML NY++    
Sbjct  235   HANGWGYTWATAAVGATNICLRRVDAPTIFELIDKHQVTHMCAAPMVLNMLTNYSDR---  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L SPV ++TAGAPPPA V+ R E+LGF V HGYGLTETGGL V+CAWK EWD L   E
Sbjct  292   KQLKSPVRVMTAGAPPPATVISRAENLGFDVGHGYGLTETGGLVVSCAWKPEWDCLGPNE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F  AD+  P TGKSVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  352   RATLKSRQGIRTAVFAEADLRDPITGKSVKHDGATVGEIVFRGGSVMLGYYKDPEGTAAS  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  412   MREDGWFYTGDMGVMHPDGYLEVKDRSKDVIICGGENISSTEVETVLYTNPVVKEAAVVA  471

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK   G +   TE+E+REFCK +LP +MVPR VVF   LPKTSTG
Sbjct  472   KPDKMWGETPCAFVSLKYHDGTV---TEREIREFCKTKLPKYMVPRNVVFQEELPKTSTG  528

Query  341   KIQKFLLRDIARDL  300
             KIQK+LLR +A+ L
Sbjct  529   KIQKYLLRQMAKSL  542



>ref|XP_003616110.1| 2-succinylbenzoate-CoA ligase [Medicago truncatula]
 gb|AES99068.1| long-chain acyl-CoA synthetase [Medicago truncatula]
Length=563

 Score =   419 bits (1078),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/316 (67%), Positives = 250/316 (79%), Gaps = 6/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY W MAAVGG N+C RR+D  +I   IE HGVTHMC APVVLNML+++N    T
Sbjct  239   HSNGWSYPWAMAAVGGINICARRIDAPTIYRLIESHGVTHMCAAPVVLNMLSSFNK---T  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV +LT G+ PPA +L R E LGF VSHGYG+TET G+ V+CAWKREWD  PA E
Sbjct  296   EPLKKPVHVLTGGSSPPATILCRAELLGFEVSHGYGMTETCGVIVSCAWKREWDRFPATE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR VG    DVV P TG+SVK DG  VGEIV++G  VMLGYLKD   T +C
Sbjct  356   RARMKARQGVRRVGVAEVDVVGP-TGESVKNDGVTVGEIVVKGACVMLGYLKDEYATWQC  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M++DGWFYTGDVGVIH +GY+E+KDR KDVIISGGEN+SSVEVE+VLYMHPAV EAAVVA
Sbjct  415   MRKDGWFYTGDVGVIHKNGYMEIKDRTKDVIISGGENMSSVEVEAVLYMHPAVKEAAVVA  474

Query  515   RPDKFWGETPCAFVSLKKGIIAK--PTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD+FWGETPCAFVSL   +  +  PTEKE++EFC+E+LP FMVP+ VVF   LPKTSTG
Sbjct  475   RPDEFWGETPCAFVSLNDELKEEEIPTEKEVKEFCREKLPHFMVPKTVVFKEELPKTSTG  534

Query  341   KIQKFLLRDIARDLSS  294
             KIQK +LR +AR + S
Sbjct  535   KIQKHVLRRVARAMGS  550



>ref|XP_010494557.1| PREDICTED: probable acyl-activating enzyme 6 [Camelina sativa]
Length=553

 Score =   419 bits (1077),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 262/314 (83%), Gaps = 6/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW+Y WG+AAVGGTNVCLR+VD   +   I  HGVTHMCGAPVVLNML++  +   +
Sbjct  238   HANGWTYPWGIAAVGGTNVCLRKVDVPLVYRLIRDHGVTHMCGAPVVLNMLSSTQD---S  294

Query  1055  KPLTS-PVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAP  879
             +PL + PV+ LTAG+PPPAAV+ R ES+GF +SHGYGLTET G+ V+CAWK +W++LPA 
Sbjct  295   QPLLNRPVNFLTAGSPPPAAVILRAESIGFVISHGYGLTETAGVIVSCAWKPQWNHLPAS  354

Query  878   ERAAIKSRQGVRSVG-FTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTS  702
             +RA +K+RQGVR+VG F+  DVV P +G+S++RDG+ VGEIV+RG+S+MLGYLKDP GT 
Sbjct  355   DRAMLKTRQGVRTVGGFSEIDVVDPESGESIERDGDTVGEIVMRGSSIMLGYLKDPIGTE  414

Query  701   KCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAV  522
             K +K +GW YTGDVGVIH DGY+E+KDR KD+II+GGEN+++VEVE+VLY +PAV E AV
Sbjct  415   KALK-NGWLYTGDVGVIHSDGYLEIKDRSKDIIITGGENVNTVEVETVLYTNPAVSEVAV  473

Query  521   VARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             VARPD+FWGETPCAFVSLK G+  KPTEKE+ E+C++ +P +MVP+ V+FM  LPKTSTG
Sbjct  474   VARPDEFWGETPCAFVSLKSGLSTKPTEKELIEYCRKMMPRYMVPKTVLFMNELPKTSTG  533

Query  341   KIQKFLLRDIARDL  300
             K  KFLL++IA+++
Sbjct  534   KFSKFLLKEIAKNM  547



>ref|XP_010095757.1| putative acyl-activating enzyme 6 [Morus notabilis]
 gb|EXB62177.1| putative acyl-activating enzyme 6 [Morus notabilis]
Length=557

 Score =   419 bits (1077),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 247/315 (78%), Gaps = 3/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY WGMAAVGGTNVCLR+ D  +I   I RH VTHM GAPVVLNML+N  +    
Sbjct  236   HSNGWSYPWGMAAVGGTNVCLRKFDGPTIFHLIRRHSVTHMGGAPVVLNMLSNTPD---V  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV I+T GAPPPA VL R ESLGF V HGYGLTE  G+ V+CAWK EW+ LPA E
Sbjct  293   EPLKNPVHIMTGGAPPPAPVLHRTESLGFIVCHGYGLTEVMGVVVSCAWKHEWNRLPATE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+      D+V P+TG SVKRDG  +GEIV+RG  VMLGYLKD E T +C
Sbjct  353   RARLKSRQGVRTTATAEIDIVDPNTGMSVKRDGMSLGEIVVRGGCVMLGYLKDSEATERC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +   GW YTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVES LY HPAV EAAVVA
Sbjct  413   INSKGWLYTGDVGVMHSDGYMEIKDRSKDVIISGGENVSSVEVESALYAHPAVHEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK G   KPTE+E+ E+C+ +LP +MVP+ VVF   LPKTSTGKI
Sbjct  473   RPDEFWGETPCAFLSLKNGATRKPTEEEIFEYCRRKLPHYMVPKSVVFKEELPKTSTGKI  532

Query  335   QKFLLRDIARDLSSA  291
             QKF+L++IA+ + S+
Sbjct  533   QKFVLKEIAKAMGSS  547



>ref|XP_006287411.1| hypothetical protein CARUB_v10000617mg [Capsella rubella]
 gb|EOA20309.1| hypothetical protein CARUB_v10000617mg [Capsella rubella]
Length=554

 Score =   419 bits (1076),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 254/312 (81%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW Y WG+AAVGGTNVCLR+ D   I   I  H VTHMCGAPVVLNML+       +
Sbjct  241   HANGWCYPWGIAAVGGTNVCLRKFDAPLIYRLIRDHNVTHMCGAPVVLNMLSTTQE---S  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES+GF +SHGYGLTE  G+ V+CAWK +W+ LPA +
Sbjct  298   QPLNRPVNILTAGAPPPAAVLLRAESIGFVISHGYGLTEAAGVIVSCAWKPQWNRLPATD  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++GFT  DVV P +G+SV+R+G  VGEIV++G+S+MLGYLKDP GT K 
Sbjct  358   RARLKARQGVRTLGFTEIDVVDPESGRSVERNGESVGEIVMKGSSIMLGYLKDPIGTEKA  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+II+GGEN+SSVEVE+VLY +PAV E AVVA
Sbjct  418   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIITGGENVSSVEVEAVLYTNPAVSEVAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPTE+EM E+C++++P +MVP+ V+F   LPK+STGK+
Sbjct  477   RPDEFWGETPCAFVSLKDGLSKKPTEEEMIEYCRKKMPRYMVPKTVLFRDELPKSSTGKV  536

Query  335   QKFLLRDIARDL  300
              K +L++IA+ +
Sbjct  537   SKIMLKEIAKKM  548



>ref|XP_002525882.1| AMP dependent ligase, putative [Ricinus communis]
 gb|EEF36486.1| AMP dependent ligase, putative [Ricinus communis]
Length=480

 Score =   416 bits (1068),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 255/324 (79%), Gaps = 9/324 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY WGMAAVGG N+CLR+ D ++I   I +H VTHMCGAPVVLNMLAN+     T
Sbjct  152   HSNGWSYPWGMAAVGGINICLRKFDASTIYRLIIKHEVTHMCGAPVVLNMLANFPIDNKT  211

Query  1055  KPL--TSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPA  882
             + +  T+ + +LTAGAPPPAA+L R E+LGF+VSHGYGLTE+GG+ ++CAWK+ W+  PA
Sbjct  212   QNILKTNQIHVLTAGAPPPAAILTRAEALGFKVSHGYGLTESGGIVISCAWKQMWNRFPA  271

Query  881   PERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTS  702
              ERA +K+RQGVR++G T  DVV P TG+SVKRDG   GEIVLRG  VMLGYLKDP  TS
Sbjct  272   TERARLKARQGVRTIGVTKMDVVDPVTGESVKRDGLSQGEIVLRGGCVMLGYLKDPVSTS  331

Query  701   KCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAV  522
             KCM  +GW YTGDV V+HPDGY+E+KDR KDVIISGGENLSSVEVESVLYM+P ++EAAV
Sbjct  332   KCMTSEGWLYTGDVAVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYMNPIINEAAV  391

Query  521   VARPDKFWGETPCAFVSLKKGIIAK-------PTEKEMREFCKERLPLFMVPRKVVFMAA  363
             VARPD++WGETPCAFVSL+K   +          EKE+ E+C+ RLP +MVP+ VV    
Sbjct  392   VARPDEYWGETPCAFVSLRKSGGSSGGDLSPVAMEKEIIEYCRARLPHYMVPKTVVVKDE  451

Query  362   LPKTSTGKIQKFLLRDIARDLSSA  291
             LPKTSTGKIQK +LRD+A+ + S+
Sbjct  452   LPKTSTGKIQKSVLRDMAKAMGSS  475



>ref|XP_004490749.1| PREDICTED: probable acyl-activating enzyme 6-like [Cicer arietinum]
Length=553

 Score =   417 bits (1073),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 254/314 (81%), Gaps = 7/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WG+AAVGGTN+C+R+ D  ++   I++H VTHMCGAPVVLNML N  +    
Sbjct  237   HANGWSFPWGIAAVGGTNICVRKFDAETVFTLIKKHHVTHMCGAPVVLNMLTNSPD---N  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILTAGAPPPAAVL R ESLGF VSHGYGLTETGGL V+C+WK +W+ LPA E
Sbjct  294   KPLQHKVHILTAGAPPPAAVLYRTESLGFEVSHGYGLTETGGLVVSCSWKNKWNRLPATE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR++G T  DVV P+ G SVKRDG  +GE+V+RG  VMLGYLKDPEGT+ C
Sbjct  354   RARLKSRQGVRTIGMTNVDVVDPN-GDSVKRDGATLGEVVMRGGCVMLGYLKDPEGTASC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ +GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  413   LR-NGWFYTGDVGVMHEDGYLEIKDRSKDVIISGGENLSSVEVESVLYGHPAVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMR--EFCKERLPLFMVPRKVVFMAALPKTSTG  342
             R D+FWGETPCAFVSLK G+  K   KE    E+C++ LP +MVP+ VV +  LPKTSTG
Sbjct  472   RADEFWGETPCAFVSLKNGLKEKEIPKEKEIVEYCRKNLPHYMVPKTVVLIDELPKTSTG  531

Query  341   KIQKFLLRDIARDL  300
             KIQKF+LRD+A+ +
Sbjct  532   KIQKFVLRDMAKKM  545



>ref|XP_010416654.1| PREDICTED: probable acyl-activating enzyme 4 [Camelina sativa]
Length=546

 Score =   417 bits (1072),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 246/312 (79%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG  N+C  RVD  +I + I++H VTHMC AP+VLNML NY++    
Sbjct  237   HANGWSYTWATAAVGAKNICPTRVDAPTIFNLIDKHQVTHMCAAPMVLNMLTNYSSQ---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ++TAGAPPPA V+ + E+LGF V HGYG+TETGGL V+CAWK +WD L   E
Sbjct  294   KPLKSPVKVMTAGAPPPATVISKAEALGFDVGHGYGMTETGGLVVSCAWKPKWDRLETYE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+V F  ADV  P TGK+VK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  354   RAKLKSRQGIRTVVFAEADVRDPLTGKTVKHDGVTVGEIVFRGGSVMLGYCKDPEGTAAN  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDV+I GGEN+SS EVE+VLY +PA+ EAAVVA
Sbjct  414   MREDGWFYTGDIGVMHPDGYLEVKDRSKDVVICGGENISSTEVEAVLYTNPAIKEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       TE+E+REFCK +LP +MVPR VVF+  LPKTSTGKI
Sbjct  474   KPDKMWGETPCAFVSLKYH-DGSVTEREIREFCKTKLPKYMVPRNVVFLEELPKTSTGKI  532

Query  335   QKFLLRDIARDL  300
             QKFLLR + + L
Sbjct  533   QKFLLRQMTKSL  544



>ref|XP_010441803.1| PREDICTED: probable acyl-activating enzyme 6 [Camelina sativa]
Length=550

 Score =   417 bits (1071),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/313 (65%), Positives = 255/313 (81%), Gaps = 5/313 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW+Y WG+AAVGGTNVCLR+VD   +   I  HGVTHMCGAPVVLNML+       +
Sbjct  236   HANGWTYPWGIAAVGGTNVCLRKVDVPLVYRLIREHGVTHMCGAPVVLNMLSVSQE---S  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ LTAG+PPPAAV+ R ES+GF +SHGYGLTET G+  +CAWK +W+ LPA +
Sbjct  293   QPLNRPVNFLTAGSPPPAAVILRAESIGFVISHGYGLTETAGVIASCAWKPQWNRLPASD  352

Query  875   RAAIKSRQGVRSVG-FTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             RA +K+RQGVR+VG FT  DVV P +G+SV+RDG  VGEIV+RG+S+MLGYLKD  GT K
Sbjct  353   RAMLKTRQGVRTVGGFTEIDVVDPDSGRSVERDGETVGEIVMRGSSIMLGYLKDRSGTEK  412

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
              +K +G  YTGDVGVIH DGY+E+KDR KD+II+GGEN+++VEVE+VLY +PAVDE AVV
Sbjct  413   ALK-NGRLYTGDVGVIHSDGYLEIKDRSKDIIITGGENVNTVEVETVLYTNPAVDEVAVV  471

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             ARPD+FWG+TPCAFVSLK G+  KPTE+E+ E+C++ +P FMVP+ V+FM  LPKTSTGK
Sbjct  472   ARPDEFWGQTPCAFVSLKSGLSTKPTEEELIEYCRKMMPRFMVPKTVLFMNELPKTSTGK  531

Query  338   IQKFLLRDIARDL  300
               KFLL++IA+++
Sbjct  532   FSKFLLKEIAKNM  544



>gb|KFK42122.1| hypothetical protein AALP_AA2G213800 [Arabis alpina]
Length=544

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 243/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTW  AAVG  N+C++RVD  +I D I+ H VTHMC AP VLNML NY      
Sbjct  236   HANGWGYTWATAAVGAINICVQRVDAETIFDLIDEHHVTHMCAAPTVLNMLTNYPAR---  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L SPV ++TAGAPPPA V+   E+LGF V HGYG+TETGGL V+C WK EWD+L   E
Sbjct  293   KQLKSPVQVMTAGAPPPATVISEAETLGFEVGHGYGMTETGGLVVSCTWKPEWDHLEPTE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F  ADV+ P TGKSVK DG  VGEIV RG  VMLGY KDP+GT+  
Sbjct  353   RAKMKSRQGIRTALFAEADVIDPITGKSVKHDGVTVGEIVFRGGMVMLGYYKDPKGTAAS  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDVII GGEN++S EVE+VLY +PAV EAAVVA
Sbjct  413   MREDGWFYTGDMGVMHPDGYMEVKDRSKDVIICGGENINSTEVETVLYTNPAVKEAAVVA  472

Query  515   RPDKFWGETPCAFVSLK--KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             +PDK WGETPCAFVSLK  KG +   TE+E+REFCK +LP +MVPR VVF   LPKTSTG
Sbjct  473   KPDKMWGETPCAFVSLKHHKGSV---TEREIREFCKTKLPKYMVPRNVVFQEELPKTSTG  529

Query  341   KIQKFLLRDIARDL  300
             KIQKFLLR +A+ L
Sbjct  530   KIQKFLLRQMAKSL  543



>ref|XP_009627920.1| PREDICTED: probable acyl-activating enzyme 6 [Nicotiana tomentosiformis]
Length=551

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 247/317 (78%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSYTWGMA VGGTN+CLR+ D   +   I +H VTHMCGAPVVL MLAN       
Sbjct  236   HSNGWSYTWGMAVVGGTNICLRKFDANVVFHDINKHNVTHMCGAPVVLTMLANSPC---A  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV   T GAPPPA V+ RVE+LGF V+HGYG+TE  G+ V+C WK +W+ LPA  
Sbjct  293   KPLKNPVHFRTGGAPPPATVVLRVENLGFVVNHGYGMTEVAGVVVSCIWKPKWNKLPANM  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQG+RS+G T  DVV P +G SVKRDG  +GEIVLRG  +MLGYLK+ E TSKC
Sbjct  353   KAKLKSRQGIRSLGMTEVDVVDPESGVSVKRDGLTMGEIVLRGGCIMLGYLKNQEATSKC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK D W YTGDV V+HPDGY+E+KDR KD+IISGGEN+SSVEVESVLY +  V+EAAVVA
Sbjct  413   MKND-WLYTGDVAVMHPDGYLEIKDRSKDIIISGGENVSSVEVESVLYSNTFVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK  +  KP EKE+ +FC+ERLP +M+P+ V+FM  LPKT+TGKI
Sbjct  472   RPDEFWGETPCAFLSLKMEVKQKPKEKEIVDFCRERLPHYMIPKTVIFMDELPKTATGKI  531

Query  335   QKFLLRDIARDLSSADA  285
             QKF LR+IA+ + S  A
Sbjct  532   QKFSLREIAKGMGSLPA  548



>ref|XP_010481667.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
Length=548

 Score =   416 bits (1069),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 259/313 (83%), Gaps = 5/313 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW+Y WG+AAVGGTNVCLR+V+   +   I  HGVTHMCGAPVVLNML++  +   +
Sbjct  239   HANGWTYPWGIAAVGGTNVCLRKVNVPLVYRLIRDHGVTHMCGAPVVLNMLSSTQD---S  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ LTAG+PPPAAV+ R ES+GF +SHGYGLTET G+ V+CAWK +W+ LPA +
Sbjct  296   QPLNRPVNFLTAGSPPPAAVILRAESIGFVISHGYGLTETAGVVVSCAWKPQWNRLPASD  355

Query  875   RAAIKSRQGVRSVG-FTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             RA +K+RQGVR++G FT  DVV P +G+SV+RDG  VGEIV+RG+S+MLGYLKD  GT K
Sbjct  356   RAMLKTRQGVRTIGGFTEIDVVDPDSGRSVERDGETVGEIVMRGSSIMLGYLKDRIGTEK  415

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
              +K +GW YTGDVGVIH DGY+E+KDR KD+II+GGEN+++VEVE+VLY +PAV+E AVV
Sbjct  416   ALK-NGWLYTGDVGVIHSDGYLEIKDRSKDIIITGGENVNTVEVETVLYTNPAVNEVAVV  474

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             ARPD+FWGETPCAFVSLK  + +KPTE+E+ E+C++ +P FMVP+ V+FM  LPKTSTGK
Sbjct  475   ARPDEFWGETPCAFVSLKSRLSSKPTEEELIEYCRKMMPRFMVPKTVLFMNELPKTSTGK  534

Query  338   IQKFLLRDIARDL  300
               KFLL++IA+++
Sbjct  535   FSKFLLKEIAKNI  547



>ref|NP_173572.2| probable acyl-activating enzyme 10 [Arabidopsis thaliana]
 gb|AAM28627.1|AF503769_1 adenosine monophosphate binding protein 10 AMPBP10 [Arabidopsis 
thaliana]
 gb|AEE30113.1| probable acyl-activating enzyme 10 [Arabidopsis thaliana]
Length=547

 Score =   416 bits (1068),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 207/319 (65%), Positives = 248/319 (78%), Gaps = 13/319 (4%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TN+C RRVD  +I + I++H VTHMC AP+VLNML         
Sbjct  236   HANGWGYTWGTAAVGATNICTRRVDAPTIYNLIDKHNVTHMCAAPMVLNMLI-------N  288

Query  1055  KPLTSPVD--ILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPA  882
              PL++P+   ++T+GAPPPA ++ R ESLGF VSH YGLTET G  V+CAWK +WD+L  
Sbjct  289   YPLSTPLKNPVMTSGAPPPATIISRAESLGFNVSHSYGLTETSGPVVSCAWKPKWDHLDP  348

Query  881   PERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTS  702
              ERA +KSRQGVR++GFT  DV    TGKSVK DG  VGEIV RG+SVMLGY KDP+GT+
Sbjct  349   LERARLKSRQGVRTLGFTEVDVRDRKTGKSVKHDGVSVGEIVFRGSSVMLGYYKDPQGTA  408

Query  701   KCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAV  522
              CM+EDGWFY+GD+GVIH DGY+E+KDR KDVII GGEN+SS E+E+VLY +P V EAAV
Sbjct  409   ACMREDGWFYSGDIGVIHKDGYLEIKDRSKDVIICGGENISSAEIETVLYTNPVVKEAAV  468

Query  521   VARPDKFWGETPCAFVSLK---KGIIAKP-TEKEMREFCKERLPLFMVPRKVVFMAALPK  354
             VA+PDK WGETPCAFVSLK    G  + P TE+E+REFCK +LP +MVPRKV+F   LPK
Sbjct  469   VAKPDKMWGETPCAFVSLKCDNNGDGSVPVTEREIREFCKTKLPKYMVPRKVIFQEELPK  528

Query  353   TSTGKIQKFLLRDIARDLS  297
             TSTGKIQKFLLR +A+ LS
Sbjct  529   TSTGKIQKFLLRQMAKTLS  547



>ref|XP_010428792.1| PREDICTED: probable acyl-activating enzyme 4 [Camelina sativa]
Length=546

 Score =   415 bits (1067),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 244/312 (78%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG  N+C+ RVD  +I + I++H VTHMC AP+VLNML NY++    
Sbjct  237   HANGWSYTWATAAVGAKNICVTRVDAPTIYNLIDKHQVTHMCAAPMVLNMLTNYSDQ---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ++TAGAPPPA V+ + E+LGF V HGYG+TETGGL V+CAWK EWD L   E
Sbjct  294   KPLKSPVKVMTAGAPPPATVISKAEALGFDVGHGYGMTETGGLVVSCAWKPEWDRLEPYE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F  ADV    TGKSVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  354   RAKLKSRQGIRTAVFAEADVRDTITGKSVKHDGVTVGEIVFRGGSVMLGYYKDPEGTAAN  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDV+I GGEN+SS EVE+VLY +P + EAAVVA
Sbjct  414   MREDGWFYTGDIGVMHPDGYLEVKDRSKDVVICGGENISSTEVEAVLYTNPVIKEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       TE+E+REFCK +LP +MVPR VVF+  LPKTSTGKI
Sbjct  474   KPDKMWGETPCAFVSLKYH-DGSVTEREIREFCKTKLPKYMVPRNVVFLEELPKTSTGKI  532

Query  335   QKFLLRDIARDL  300
             QKFLLR + + L
Sbjct  533   QKFLLRQMTKSL  544



>ref|XP_003518357.1| PREDICTED: probable acyl-activating enzyme 6-like [Glycine max]
Length=553

 Score =   415 bits (1067),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 206/317 (65%), Positives = 247/317 (78%), Gaps = 6/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW++ WG+AA GGTNVC R++D   I   I+ H VTHMC APVVLN+L        T
Sbjct  234   HSNGWTFPWGIAAAGGTNVCPRKIDAPMIYHLIQSHNVTHMCAAPVVLNLLLTR-----T  288

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +P+ +PV +LT G+PPPAA+L R E LGFRV HGYG+TET G+ V+CAWK+EWD  PA E
Sbjct  289   EPVKNPVHVLTGGSPPPAAILTRAEKLGFRVRHGYGMTETLGVVVSCAWKKEWDKFPATE  348

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA  K+RQGVR+V  T  DVV P TG SVKRDG   GEIV RG  VMLGYLKD +GT +C
Sbjct  349   RARFKARQGVRTVAMTEVDVVDPATGVSVKRDGVTSGEIVFRGACVMLGYLKDSDGTKRC  408

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ + W YTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVE+VLY HPAV+E AVVA
Sbjct  409   IR-NNWLYTGDVGVMHGDGYLEIKDRSKDVIISGGENLSSVEVEAVLYDHPAVNEVAVVA  467

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK+G++A P+EKE+ EFC+ERLP FMVP+ VVF  ALPKTSTGKI
Sbjct  468   RPDEFWGETPCAFVMLKEGLVAPPSEKEVVEFCRERLPHFMVPKTVVFKEALPKTSTGKI  527

Query  335   QKFLLRDIARDLSSADA  285
             QK +LR  A+ + S  A
Sbjct  528   QKHVLRMDAQAMGSLAA  544



>ref|XP_006301025.1| hypothetical protein CARUB_v10021416mg [Capsella rubella]
 gb|EOA33923.1| hypothetical protein CARUB_v10021416mg [Capsella rubella]
Length=545

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 241/312 (77%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG TN+C  RVD  +I + I+ H VTHMC AP+VLNML NY      
Sbjct  237   HANGWSYTWATAAVGATNICATRVDAPTIFNLIDMHQVTHMCAAPMVLNMLTNYPGQ---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ++TAGAPPPA V+ + E+LGF V HGYG+TETGGL V+CAWK EWD L   E
Sbjct  294   KPLRSPVKVMTAGAPPPATVIAKAEALGFEVGHGYGMTETGGLVVSCAWKPEWDRLEPYE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F   D+  P TGKSVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  354   RAKLKSRQGIRTTVFAQVDIRDPITGKSVKHDGVAVGEIVFRGGSVMLGYYKDPEGTAAN  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDV+I GGEN+SS EVE+VLY +P + EAAVVA
Sbjct  414   MREDGWFYTGDIGVMHPDGYLEVKDRSKDVVICGGENISSTEVETVLYTNPMIKEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       T KE+REFCK +LP +MVPR VVF+  LPKTSTGK+
Sbjct  474   KPDKIWGETPCAFVSLKYH-DGSVTGKEIREFCKTKLPKYMVPRNVVFLEELPKTSTGKV  532

Query  335   QKFLLRDIARDL  300
             QKFLLR +A+ L
Sbjct  533   QKFLLRQMAKSL  544



>gb|AAM28625.1|AF503767_1 adenosine monophosphate binding protein 8 AMPBP8 [Arabidopsis 
thaliana]
Length=542

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 251/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW+Y WG+AAVGGTNVC+R++   SI   I  HGVTHM GAP+VL +L+        
Sbjct  234   HANGWTYPWGIAAVGGTNVCVRKLHAPSIYHLIRDHGVTHMYGAPIVLQILSASQESD--  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL SPV+ LTAG+ PPA VL R ESLGF VSHGYGLTET G+ V+CAWK  W+ LPA +
Sbjct  292   QPLKSPVNFLTAGSSPPATVLLRAESLGFIVSHGYGLTETAGVIVSCAWKPNWNRLPASD  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQGVR+VGF+  DVV P +G+SV+RDG  VGEIVLRG+S+MLGYLK+P GT   
Sbjct  352   QAQLKSRQGVRTVGFSEIDVVDPESGRSVERDGETVGEIVLRGSSIMLGYLKNPIGTQNS  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF+TGD+GVIH DGY+E+KDR KDVIISGGEN+SSVEVE+VLY +PAV+EAAVVA
Sbjct  412   FK-NGWFFTGDLGVIHGDGYLEIKDRSKDVIISGGENVSSVEVEAVLYTNPAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPT+KE+ E+CK ++P +M P+ V F+  LPKTSTGKI
Sbjct  471   RPDEFWGETPCAFVSLKPGLTRKPTDKEIIEYCKYKMPRYMAPKTVSFLEELPKTSTGKI  530

Query  335   QKFLLRDIARDL  300
              K LL++IA+++
Sbjct  531   IKSLLKEIAKNM  542



>ref|NP_177724.1| AMP-dependent synthetase and ligase family protein [Arabidopsis 
thaliana]
 sp|Q9LQS1.1|AAE8_ARATH RecName: Full=Probable acyl-activating enzyme 8; AltName: Full=AMP-binding 
protein 8; Short=AtAMPBP8 [Arabidopsis thaliana]
 gb|AAF26762.1|AC007396_11 T4O12.18 [Arabidopsis thaliana]
 gb|AAL49853.1| putative AMP-binding protein [Arabidopsis thaliana]
 gb|AAN13201.1| putative AMP-binding protein [Arabidopsis thaliana]
 gb|AEE35781.1| AMP-dependent synthetase and ligase family protein [Arabidopsis 
thaliana]
Length=544

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 251/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW+Y WG+AAVGGTNVC+R++   SI   I  HGVTHM GAP+VL +L+        
Sbjct  236   HANGWTYPWGIAAVGGTNVCVRKLHAPSIYHLIRDHGVTHMYGAPIVLQILSASQESD--  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL SPV+ LTAG+ PPA VL R ESLGF VSHGYGLTET G+ V+CAWK  W+ LPA +
Sbjct  294   QPLKSPVNFLTAGSSPPATVLLRAESLGFIVSHGYGLTETAGVIVSCAWKPNWNRLPASD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQGVR+VGF+  DVV P +G+SV+RDG  VGEIVLRG+S+MLGYLK+P GT   
Sbjct  354   QAQLKSRQGVRTVGFSEIDVVDPESGRSVERDGETVGEIVLRGSSIMLGYLKNPIGTQNS  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF+TGD+GVIH DGY+E+KDR KDVIISGGEN+SSVEVE+VLY +PAV+EAAVVA
Sbjct  414   FK-NGWFFTGDLGVIHGDGYLEIKDRSKDVIISGGENVSSVEVEAVLYTNPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPT+KE+ E+CK ++P +M P+ V F+  LPKTSTGKI
Sbjct  473   RPDEFWGETPCAFVSLKPGLTRKPTDKEIIEYCKYKMPRYMAPKTVSFLEELPKTSTGKI  532

Query  335   QKFLLRDIARDL  300
              K LL++IA+++
Sbjct  533   IKSLLKEIAKNM  544



>ref|XP_008668693.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Zea 
mays]
 tpg|DAA35376.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=556

 Score =   414 bits (1063),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 253/312 (81%), Gaps = 2/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW + WGMAAVGGTNVCLRRVD A + DAI R GV H+CGAPVVLNMLAN  + A  
Sbjct  234   HANGWCFPWGMAAVGGTNVCLRRVDAAEVYDAIARRGVDHLCGAPVVLNMLANAPDAAR-  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R ES+GF V+HGYGLTET GL V CAWKREW+ LPA E
Sbjct  293   RPLPGKVRILTAGAPPPAAVLHRTESIGFEVTHGYGLTETAGLVVCCAWKREWNKLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    D+V   TG+SV RDG+ +GEIVLRG  VMLGYL D + T   
Sbjct  353   RARLKARQGVRTPGMNEVDIVDGETGRSVPRDGSTMGEIVLRGGGVMLGYLNDDKATRAA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++++GWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  413   IRDNGWFYTGDVGVMHPDGYMEIRDRSKDVIISGGENISSVEVESVLYNHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G  A  T  ++  +C++R+P +MVP+ VV  A LPKTSTGKI
Sbjct  473   RPDEFWGETPCAFVSLKEGSGAV-TAADVIAWCRDRMPHYMVPKTVVLRAELPKTSTGKI  531

Query  335   QKFLLRDIARDL  300
             QK++LR++A+++
Sbjct  532   QKYVLRNLAKEM  543



>ref|XP_008803413.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Phoenix 
dactylifera]
Length=557

 Score =   414 bits (1063),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 254/314 (81%), Gaps = 1/314 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WG+AA GGTNVCLRR D A+I  AI  H VTHMC AP+VLNMLAN  + A  
Sbjct  239   HANGWSYPWGIAAAGGTNVCLRRFDAATIYAAIATHRVTHMCCAPIVLNMLANVPDSAR-  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILTAGAPPPAAVL RVE+LGF VSHGYGLTETGG A+ CAWK EWD LP  E
Sbjct  298   KPLPGPVQILTAGAPPPAAVLHRVEALGFSVSHGYGLTETGGTALFCAWKAEWDRLPPAE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++  T  DV+   TG+SV+RDG  +GEIVLRG  VMLGYLKD  GT + 
Sbjct  358   RARLKARQGVRTLAMTDFDVIDGATGQSVRRDGATMGEIVLRGGYVMLGYLKDEVGTKRA  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  418   VRPDGWFYTGDVGVMHADGYVEIKDRSKDVIISGGENVSSVEVESVLYDHPAVNEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD++WGET CAFVS+K+G++A PTE E+  +C+ER+P +M P+ VV    LPKTSTGKI
Sbjct  478   RPDEYWGETTCAFVSMKEGVLAPPTEAEVIAWCRERMPHYMAPKTVVLKPELPKTSTGKI  537

Query  335   QKFLLRDIARDLSS  294
             QK++LR++AR + +
Sbjct  538   QKYVLREMARAMGT  551



>emb|CAJ86098.1| H0103C06.2 [Oryza sativa Indica Group]
 emb|CAH68190.1| H0403D02.18 [Oryza sativa Indica Group]
Length=558

 Score =   414 bits (1063),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 251/323 (78%), Gaps = 2/323 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD A + D I R GV H+CGAPVVLNMLAN       
Sbjct  235   HANGWSFPWGMAVVGGTNVCLRRVDAAEVFDTIARRGVNHLCGAPVVLNMLANAPEGVR-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILTAGAPPPAAVL R E++GF VSHGYGLTET GL ++CAWK EWD LPA E
Sbjct  294   KPLPGKVRILTAGAPPPAAVLYRTEAIGFEVSHGYGLTETAGLVLSCAWKGEWDKLPASE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    DVV   TG+SV RDG+ +GEIVLRG  + LGYL D   T   
Sbjct  354   RARLKARQGVRTPGMAEVDVVDGETGRSVPRDGSTMGEIVLRGGCITLGYLNDEAATKAA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++++GWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  414   IRDNGWFYTGDVGVMHPDGYVEIRDRSKDVIISGGENISSVEVESVLYGHPAVNEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G  A  T  ++  + +ER+P +MVP+ V+F   LPKTSTGKI
Sbjct  474   RPDEFWGETPCAFVSLKQGGGAV-TAADVVAWSRERMPRYMVPKTVIFRDELPKTSTGKI  532

Query  335   QKFLLRDIARDLSSADAINANQN  267
             QK++LR+IA+++      N N+N
Sbjct  533   QKYVLRNIAKEMGPTTGTNTNRN  555



>ref|XP_002438211.1| hypothetical protein SORBIDRAFT_10g009610 [Sorghum bicolor]
 gb|EER89578.1| hypothetical protein SORBIDRAFT_10g009610 [Sorghum bicolor]
Length=558

 Score =   413 bits (1061),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 210/315 (67%), Positives = 247/315 (78%), Gaps = 2/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD   +   I   GVTH+CGAPVVLNMLAN       
Sbjct  234   HANGWSFPWGMAVVGGTNVCLRRVDAGEVYATIAARGVTHLCGAPVVLNMLANAPEVVR-  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R ES+GF VSHGYGLTET GL V C+WKREW+ LPA E
Sbjct  293   RPLPGKVRILTAGAPPPAAVLHRTESIGFEVSHGYGLTETAGLVVCCSWKREWNKLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+ G    D+V   TG+SV RDG+ +GEIVLRG  VMLGYL D + T   
Sbjct  353   RARLKSRQGVRTPGMAEVDIVDGETGRSVPRDGSTMGEIVLRGGCVMLGYLNDDKATGAA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++EDGWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  413   IREDGWFYTGDVGVMHPDGYMEIRDRSKDVIISGGENISSVEVESVLYSHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKP-TEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             RPD FWGETPCAFV LK+G  A   T  ++  +C++R+P +MVPR VVF   LPKTSTGK
Sbjct  473   RPDDFWGETPCAFVGLKEGASAGAVTAADVIAWCRQRMPHYMVPRTVVFRDELPKTSTGK  532

Query  338   IQKFLLRDIARDLSS  294
             IQK++LR++A+++ S
Sbjct  533   IQKYVLRNLAKEMGS  547



>emb|CDX88352.1| BnaC06g37960D [Brassica napus]
Length=543

 Score =   412 bits (1059),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 240/312 (77%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG TN+CLRRVD  +I D+I++H VTHMC AP+VLNML N  +    
Sbjct  235   HANGWSYTWATAAVGATNICLRRVDAKTIYDSIDKHHVTHMCAAPMVLNMLTNSPSR---  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L  PV ++TAGAPPP  V+   ESLGF V HGYGLTETG L V+CAWK EWD L   E
Sbjct  292   RQLKQPVRVMTAGAPPPETVISSAESLGFDVGHGYGLTETGCLNVSCAWKPEWDGLGESE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F   DV    TGKSVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  352   RAKLKSRQGIRTAVFAEVDVRDTLTGKSVKHDGVTVGEIVFRGGSVMLGYYKDPEGTAAS  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  412   MREDGWFYTGDMGVMHPDGYLEVKDRSKDVIICGGENISSKEVETVLYTNPVVKEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSL K +    +E+E+REFCK +LP +MVPR VVF   LPKTSTGKI
Sbjct  472   KPDKMWGETPCAFVSL-KCLDGSVSEREIREFCKTKLPKYMVPRNVVFQEELPKTSTGKI  530

Query  335   QKFLLRDIARDL  300
             QKFLLR +A+ +
Sbjct  531   QKFLLRQMAKSM  542



>ref|XP_006350455.1| PREDICTED: probable acyl-activating enzyme 6-like [Solanum tuberosum]
Length=552

 Score =   412 bits (1058),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/317 (64%), Positives = 245/317 (77%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSYTWGMA VGGTN+CLR+ D   +  AI ++ VTHMCGAPVVL MLAN       
Sbjct  237   HSNGWSYTWGMAVVGGTNICLRKFDANVVFHAINKYNVTHMCGAPVVLTMLANSPC---A  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV   T GAPPPA ++ RVESLGF V+HGYG+TE  G+ V+C WK +W+ L A  
Sbjct  294   KPLKNPVHFRTGGAPPPATIVLRVESLGFVVNHGYGMTEVAGVVVSCIWKPKWNKLSANV  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQG++S+G T  DVV P +G SVKRDG  +GEIVLRG  +MLGYLK+ E TSKC
Sbjct  354   KAKLKSRQGIKSLGMTEVDVVDPESGVSVKRDGVTMGEIVLRGGCIMLGYLKNEEATSKC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK + W YTGDV V+HPDGY+E+KDR KD+IISGGEN+SSVEVESVLY +  V+EAAVVA
Sbjct  414   MK-NNWLYTGDVAVMHPDGYLEIKDRSKDIIISGGENVSSVEVESVLYSNNFVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  +  KP EKE+ +FC+ERLP +M+PR V+FM  LPKT+TGKI
Sbjct  473   RPDEFWGETPCAFVSLKMELKLKPKEKEIIDFCRERLPHYMIPRTVIFMEELPKTATGKI  532

Query  335   QKFLLRDIARDLSSADA  285
             QKF LR IA  + S  A
Sbjct  533   QKFSLRQIANGMGSLPA  549



>dbj|BAK02324.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=468

 Score =   409 bits (1050),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 247/312 (79%), Gaps = 1/312 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD A + D I R GVTH+CGAPVVLNMLAN       
Sbjct  147   HANGWSFPWGMAVVGGTNVCLRRVDAAEVYDTIARRGVTHLCGAPVVLNMLANAPEGVQ-  205

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R E++GF VSHGYGLTET GL + CAWK EW+ LPA E
Sbjct  206   RPLPGKVHILTAGAPPPAAVLGRTEAIGFDVSHGYGLTETAGLVLLCAWKGEWNKLPASE  265

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    D+V   TG+SV RDG  +GEIVLRG  V +GY KD + T   
Sbjct  266   RARLKARQGVRTPGMAEVDIVDGETGRSVPRDGATMGEIVLRGGCVTMGYFKDEDATRAA  325

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +++DGWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVES+LY HPAV+EAAVVA
Sbjct  326   IRDDGWFYTGDVGVMHPDGYLEIRDRSKDVIISGGENISSVEVESLLYGHPAVNEAAVVA  385

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G     T  E+  + +ER+P +MVP+ VVF A LPKTSTGKI
Sbjct  386   RPDEFWGETPCAFVSLKEGAGGVVTAAEVIAWSRERMPGYMVPKTVVFRAELPKTSTGKI  445

Query  335   QKFLLRDIARDL  300
             QK++LR++A+++
Sbjct  446   QKYVLRNLAKEM  457



>gb|AAM28621.1|AF503763_1 adenosine monophosphate binding protein 4 AMPBP4 [Arabidopsis 
thaliana]
Length=545

 Score =   411 bits (1057),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 243/312 (78%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG  N+C+ RVD  +I + I+++ VTHMC AP+VLNML N+      
Sbjct  237   HANGWSYTWATAAVGARNICVTRVDVPTIFNLIDKYQVTHMCAAPMVLNMLTNHPAQ---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ++TAGAPPPA V+ + E+LGF VSHGYG+TETGGL V+CA K EWD L   E
Sbjct  294   KPLQSPVKVMTAGAPPPATVISKAEALGFDVSHGYGMTETGGLVVSCALKPEWDRLEPDE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA  KSRQG+R+  F   DV  P +GKSVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  354   RAKQKSRQGIRTAVFAEVDVRDPISGKSVKHDGATVGEIVFRGGSVMLGYYKDPEGTAAS  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDV+I GGEN+SS E+E+VLY +PA+ EAAVVA
Sbjct  414   MREDGWFYTGDIGVMHPDGYLEVKDRSKDVVICGGENISSTELEAVLYTNPAIKEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       TE+E+REFCK +LP +MVPR VVF+  LPKTSTGKI
Sbjct  474   KPDKMWGETPCAFVSLKYH-DGSVTEREIREFCKTKLPKYMVPRNVVFLEELPKTSTGKI  532

Query  335   QKFLLRDIARDL  300
             QKFLLR +A+ L
Sbjct  533   QKFLLRQMAKSL  544



>ref|XP_004231630.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Solanum 
lycopersicum]
Length=552

 Score =   411 bits (1057),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 245/317 (77%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSYTWGMA VGGTN+CLR+ D   +  AI ++ VTHMCGAPVVL MLAN       
Sbjct  237   HSNGWSYTWGMAVVGGTNICLRKFDANVVFHAINKYNVTHMCGAPVVLTMLANSPC---A  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL +PV   T GAPPPA ++ RVESLGF V+HGYG+TE  G+ V+C WK +W+ L A  
Sbjct  294   KPLQNPVHFRTGGAPPPATIVLRVESLGFIVNHGYGMTEVAGVVVSCIWKPKWNKLSANV  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQG++S+G T  DVV P +G SVKRDG  +GEIVLRG  +MLGYLK+ E TSKC
Sbjct  354   KAKLKSRQGIKSLGMTEVDVVDPESGVSVKRDGVTMGEIVLRGGCIMLGYLKNEEATSKC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK + W YTGDV V+HPDGY+E+KDR KD+IISGGEN+SSVEVESVLY +  V+EAAVVA
Sbjct  414   MK-NNWLYTGDVAVVHPDGYLEIKDRSKDIIISGGENVSSVEVESVLYSNNFVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  +  KP EKE+ +FC+ERLP +M+P+ V+FM  LPKT+TGKI
Sbjct  473   RPDEFWGETPCAFVSLKMELKLKPKEKEIIDFCRERLPHYMIPKTVIFMDELPKTATGKI  532

Query  335   QKFLLRDIARDLSSADA  285
             QKF LR IA  + S  A
Sbjct  533   QKFSLRQIANGMGSLPA  549



>ref|NP_177848.1| acyl-activating enzyme 2 [Arabidopsis thaliana]
 sp|O80658.1|AAE4_ARATH RecName: Full=Probable acyl-activating enzyme 4; AltName: Full=AMP-binding 
protein 4; Short=AtAMPBP4 [Arabidopsis thaliana]
 gb|AAC34346.1| Putative amp-binding protein [Arabidopsis thaliana]
 gb|AEE35953.1| probable acyl-activating enzyme 4 [Arabidopsis thaliana]
Length=545

 Score =   411 bits (1056),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 243/312 (78%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG  N+C+ RVD  +I + I+++ VTHMC AP+VLNML N+      
Sbjct  237   HANGWSYTWATAAVGARNICVTRVDVPTIFNLIDKYQVTHMCAAPMVLNMLTNHPAQ---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ++TAGAPPPA V+ + E+LGF VSHGYG+TETGGL V+CA K EWD L   E
Sbjct  294   KPLQSPVKVMTAGAPPPATVISKAEALGFDVSHGYGMTETGGLVVSCALKPEWDRLEPDE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA  KSRQG+R+  F   DV  P +GKSVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  354   RAKQKSRQGIRTAVFAEVDVRDPISGKSVKHDGATVGEIVFRGGSVMLGYYKDPEGTAAS  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDV+I GGEN+SS E+E+VLY +PA+ EAAVVA
Sbjct  414   MREDGWFYTGDIGVMHPDGYLEVKDRSKDVVICGGENISSTELEAVLYTNPAIKEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       TE+E+REFCK +LP +MVPR VVF+  LPKTSTGKI
Sbjct  474   KPDKMWGETPCAFVSLKYH-DGSVTEREIREFCKTKLPKYMVPRNVVFLEELPKTSTGKI  532

Query  335   QKFLLRDIARDL  300
             QKFLLR +A+ L
Sbjct  533   QKFLLRQMAKSL  544



>ref|XP_007141984.1| hypothetical protein PHAVU_008G242600g [Phaseolus vulgaris]
 gb|ESW13978.1| hypothetical protein PHAVU_008G242600g [Phaseolus vulgaris]
Length=553

 Score =   411 bits (1057),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 215/316 (68%), Positives = 258/316 (82%), Gaps = 7/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS  WG+AA+GGTN+C+R+ D   I   I+RH VTHMCGAPVVL+ML N  +    
Sbjct  237   HANGWSLPWGIAALGGTNICVRKFDAEIIYSHIKRHHVTHMCGAPVVLSMLTNSPD---N  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILTAGAPPPAAVL R E+LGF VSHGYGLTETGGL V+CAWK +W+ LPA E
Sbjct  294   KPLEKPVHILTAGAPPPAAVLHRTEALGFVVSHGYGLTETGGLVVSCAWKEKWNRLPAAE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VG    DVV P TG+SVKRDG  VGE+V+RG S+MLGYLKDPEGT+ C
Sbjct  354   RARLKARQGVRTVGMAEIDVVGP-TGESVKRDGVSVGEVVMRGGSLMLGYLKDPEGTASC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVES+LY HPAV EAAVVA
Sbjct  413   LK-NGWFYTGDVGVMHEDGYLEIKDRSKDVIISGGENLSSVEVESILYGHPAVAEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGI--IAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RP ++WGETPCAFVSLK G+    KP+E ++ ++C+E++P +MVP+ VVF   LPKTSTG
Sbjct  472   RPHEYWGETPCAFVSLKTGLKEKEKPSEDDIIKYCREKMPHYMVPKTVVFKDELPKTSTG  531

Query  341   KIQKFLLRDIARDLSS  294
             KIQKF+LR IA+++ S
Sbjct  532   KIQKFVLRQIAKEMGS  547



>ref|XP_002522210.1| AMP dependent ligase, putative [Ricinus communis]
 gb|EEF40185.1| AMP dependent ligase, putative [Ricinus communis]
Length=562

 Score =   411 bits (1057),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 255/324 (79%), Gaps = 9/324 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynn----  1068
             H+NGW+Y W +A VGG N+CLR+ D  +I   I++H VTHMC APVVLNML+N  +    
Sbjct  234   HSNGWNYPWSLAVVGGVNICLRKFDGPTIYRLIKKHNVTHMCAAPVVLNMLSNNYSPTDD  293

Query  1067  yaNTKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNL  888
              + T  L +PV ILTAGAPPPA+VL R ESLGF VSHGYG+TETGG  V+CAWK +W+  
Sbjct  294   NSQTPTLKNPVHILTAGAPPPASVLSRTESLGFIVSHGYGMTETGGTVVSCAWKSKWNQF  353

Query  887   PAPERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEG  708
             PA ERA +K+RQGVR++G    DV+ P TGKSVKRDG  +GEIVLRG  +MLGYLK+PE 
Sbjct  354   PATERARLKARQGVRTIGMIEVDVLDPETGKSVKRDGLSLGEIVLRGGCIMLGYLKNPET  413

Query  707   TSKCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEA  528
             TSK M +DGWF+TGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVESVLY HP + EA
Sbjct  414   TSKQMNDDGWFFTGDVGVMHPDGYLEIKDRSKDVIISGGENVSSVEVESVLYTHPDIKEA  473

Query  527   AVVARPDKFWGETPCAFVSLK---KGIIAKP-TEKEMREFCKERLPLFMVPRKVVFMAA-  363
             AVVARPD+FWGETPCAFVSLK    G+I +   EK++ E+C+ R+P FMVP+ VV +   
Sbjct  474   AVVARPDEFWGETPCAFVSLKDSGNGLIDQAMIEKKIIEYCRARMPHFMVPKMVVVIKGE  533

Query  362   LPKTSTGKIQKFLLRDIARDLSSA  291
             LPKTSTGKI+KF+LRD+AR + S+
Sbjct  534   LPKTSTGKIKKFVLRDMARAMGSS  557



>ref|XP_009128147.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Brassica 
rapa]
Length=550

 Score =   411 bits (1056),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 250/314 (80%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW Y W +AAVGGTNVCLR+     I+  I  HGVTHMCGAPVVLNML   +     
Sbjct  236   HANGWCYPWAIAAVGGTNVCLRKFQAPLIHRLIRDHGVTHMCGAPVVLNMLTATHE----  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL SPV  LTAG+ PP  VL R ESLGF +SHGYGLTET G+ V+CAWK +W+ LPA +
Sbjct  292   EPLKSPVHFLTAGSSPPVTVLLRAESLGFVISHGYGLTETAGVVVSCAWKPQWNRLPASD  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K RQGV +VGFT  DVV P +G+SV+RDG  +GEIV+RG+SVMLGYLKDP GT K 
Sbjct  352   QARLKGRQGVGTVGFTEIDVVDPASGRSVERDGATMGEIVMRGSSVMLGYLKDPVGTRKT  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWF+TGDVGV+H DGY+E+KDR KDVII+GGEN+SSVEVE+VLY H AV+EAAVVA
Sbjct  412   LK-NGWFFTGDVGVLHGDGYLEIKDRSKDVIITGGENVSSVEVEAVLYTHSAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+ WGETPCAFVSLK G+  KPTEKEM E+C+E++P +MVP+ VVF+  LPKTSTGKI
Sbjct  471   RPDEQWGETPCAFVSLKPGLTRKPTEKEMIEYCREKMPRYMVPKTVVFLDELPKTSTGKI  530

Query  335   QKFLLRDIARDLSS  294
              KF+L+++A  + S
Sbjct  531   PKFVLKEMANKMGS  544



>ref|NP_001054242.1| Os04g0674700 [Oryza sativa Japonica Group]
 emb|CAE03240.2| OSJNBa0018M05.15 [Oryza sativa Japonica Group]
 dbj|BAF16156.1| Os04g0674700 [Oryza sativa Japonica Group]
 dbj|BAG97777.1| unnamed protein product [Oryza sativa Japonica Group]
Length=558

 Score =   411 bits (1056),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/323 (65%), Positives = 250/323 (77%), Gaps = 2/323 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD A + D I R GV H+CGAPVVLNMLAN       
Sbjct  235   HANGWSFPWGMAVVGGTNVCLRRVDAAEVFDTIARRGVNHLCGAPVVLNMLANAPEGVR-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILTAGAPPPAAVL R E++GF VSHGYGLTET GL ++CAWK EWD LPA E
Sbjct  294   KPLPGKVRILTAGAPPPAAVLYRTEAIGFEVSHGYGLTETAGLVLSCAWKGEWDKLPASE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    DVV   TG+SV RDG+ +GEIVLRG  + LGYL D   T   
Sbjct  354   RARLKARQGVRTPGMAEVDVVDGETGRSVPRDGSTMGEIVLRGGCITLGYLNDEAATKAA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++++GWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  414   IRDNGWFYTGDVGVMHPDGYVEIRDRSKDVIISGGENISSVEVESVLYGHPAVNEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G  A  T  ++  + +ER+P +MVP+ V+F   LPKTSTGKI
Sbjct  474   RPDEFWGETPCAFVSLKQGGGAV-TAADVVAWSRERMPRYMVPKTVIFRDELPKTSTGKI  532

Query  335   QKFLLRDIARDLSSADAINANQN  267
             QK++LR+IA+++      N  +N
Sbjct  533   QKYVLRNIAKEMGPTTGTNTKRN  555



>ref|XP_010492518.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal isoform 
X1 [Camelina sativa]
 ref|XP_010492519.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal isoform 
X2 [Camelina sativa]
Length=549

 Score =   410 bits (1055),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 251/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW Y WG+AAVGGTNVCLR+ +       I  H VTHMCGAPVVL+ML+        
Sbjct  237   HANGWCYPWGIAAVGGTNVCLRKFEAPLTYRLIRDHNVTHMCGAPVVLHMLSATQQSH--  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES+GF +SHGYGLTE  G+ V+C WK +W+ LPA +
Sbjct  295   QPLKRPVNILTAGAPPPAAVLLRAESIGFVISHGYGLTEAAGVVVSCVWKPQWNRLPASD  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G+SV+R+G  +GEIV++G+S+MLGYLKDP GT K 
Sbjct  355   RARLKARQGVRTVGFTEIDVVDPESGRSVERNGETMGEIVMKGSSIMLGYLKDPIGTEKA  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGDVGVIH DGY+E+KDR KD+IISGGEN+SSVEVE+VLY +PAV E AVVA
Sbjct  415   LR-DGWFYTGDVGVIHTDGYLEIKDRSKDIIISGGENVSSVEVEAVLYTNPAVSEVAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G+  +PTE+E+ E+C++++  FMVP+ V+F   LPKTSTGK+
Sbjct  474   RPDEFWGETPCAFVSLKEGLSVEPTEEELIEYCRKKMSRFMVPKTVLFRDELPKTSTGKV  533

Query  335   QKFLLRDIARDL  300
              K +L++IA+ +
Sbjct  534   SKLVLKEIAKKM  545



>emb|CDY39074.1| BnaA02g17630D [Brassica napus]
Length=550

 Score =   411 bits (1056),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 250/314 (80%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW Y W +AAVGGTNVCLR+     I+  I  HGVTHMCGAPVVLNML   +     
Sbjct  236   HANGWCYPWAIAAVGGTNVCLRKFQAPLIHRLIRDHGVTHMCGAPVVLNMLTATHE----  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL SPV  LTAG+ PP  VL R ESLGF +SHGYGLTET G+ V+CAWK +W+ LPA +
Sbjct  292   EPLKSPVHFLTAGSSPPVTVLLRAESLGFVISHGYGLTETAGVVVSCAWKPQWNRLPASD  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K RQGV +VGFT  DVV P +G+SV+RDG  +GEIV+RG+SVMLGYLKDP GT K 
Sbjct  352   QARLKGRQGVGTVGFTEIDVVDPASGRSVERDGATMGEIVMRGSSVMLGYLKDPVGTRKT  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWF+TGDVGV+H DGY+E+KDR KDVII+GGEN+SSVEVE+VLY H AV+EAAVVA
Sbjct  412   LK-NGWFFTGDVGVLHGDGYLEIKDRSKDVIITGGENVSSVEVEAVLYTHSAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+ WGETPCAFVSLK G+  KPTEKEM E+C+E++P +MVP+ VVF+  LPKTSTGKI
Sbjct  471   RPDEQWGETPCAFVSLKPGLTRKPTEKEMIEYCREKMPRYMVPKTVVFLDELPKTSTGKI  530

Query  335   QKFLLRDIARDLSS  294
              KF+L+++A  + S
Sbjct  531   PKFVLKEMANKMGS  544



>gb|KDO80439.1| hypothetical protein CISIN_1g0365442mg, partial [Citrus sinensis]
Length=429

 Score =   405 bits (1042),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 237/310 (76%), Gaps = 3/310 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWSY+WGMAAVGGTN+CLR+VD   I   I+ HGVTH+CGA   L +L   ++  +T
Sbjct  120   HENGWSYSWGMAAVGGTNICLRKVDVPIIYSVIKHHGVTHICGA---LVVLNMLSSSPST  176

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILT+GA PPAAVL R ESLGF VSH YGLTET G  V+CAWK +W+ L   E
Sbjct  177   KPLDRPVKILTSGASPPAAVLLRTESLGFVVSHSYGLTETAGFVVSCAWKSQWNTLADTE  236

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G    DVVHP TG SVK DG   GEIV R  S+MLGYLKD EG+S C
Sbjct  237   RARLKARQGVRTIGLADMDVVHPETGMSVKHDGQSQGEIVFRSGSIMLGYLKDQEGSSLC  296

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+++ WFYTGD+GV+H DGY+E+KDR KDVIISGGEN+SS EVESVLYM+PA++E A+VA
Sbjct  297   MRDNDWFYTGDIGVVHSDGYLEIKDRSKDVIISGGENISSAEVESVLYMNPAINEVALVA  356

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             + DKFWG+ PCAFVSLK  +  KPTE+ + EFC+ RLP +M  + V+    LPKT+TGKI
Sbjct  357   QRDKFWGKRPCAFVSLKWELSKKPTEEAIIEFCRARLPHYMAHKSVIIEDELPKTATGKI  416

Query  335   QKFLLRDIAR  306
             QKF+LR+I  
Sbjct  417   QKFVLREIVN  426



>ref|XP_002887622.1| hypothetical protein ARALYDRAFT_339769 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63881.1| hypothetical protein ARALYDRAFT_339769 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   414 bits (1065),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 250/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW+Y WG+AAVGGTNVC+R++    +   I  HGVTHMCGAP++L +L+        
Sbjct  395   HANGWTYPWGIAAVGGTNVCVRKLHAPLLYRLIRDHGVTHMCGAPILLQILSASQESE--  452

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV  LTAG+ PPA VL R ESLGF VSHGYGLTET G+ V+CAW  +W+ LPA +
Sbjct  453   QPLKNPVKFLTAGSAPPATVLLRAESLGFIVSHGYGLTETAGVIVSCAWNPKWNRLPASD  512

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQGVR+VGF+  DVV P +G+ V+RDG   GEIV+RG+S+MLGYLKDP GT K 
Sbjct  513   QARLKSRQGVRTVGFSEIDVVDPESGRRVERDGATFGEIVMRGSSIMLGYLKDPIGTQKS  572

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF+TGDVGVIH DGY+E+KDR KDVIISGGEN+SSVEVE+VLY +PAV+EAAVVA
Sbjct  573   FK-NGWFFTGDVGVIHGDGYLEIKDRSKDVIISGGENVSSVEVEAVLYTNPAVNEAAVVA  631

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G+  KPT+KE+ E+CK+++P +MVP+ V F+  LPK+STGKI
Sbjct  632   RPDEFWGETPCAFVSLKPGLTRKPTDKEIIEYCKKKMPRYMVPKTVSFLEELPKSSTGKI  691

Query  335   QKFLLRDIARDL  300
              K LL++IA+ +
Sbjct  692   TKLLLKEIAKKM  703



>ref|XP_004960088.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Setaria italica]
Length=557

 Score =   410 bits (1053),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 249/312 (80%), Gaps = 1/312 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WG+A VGGTNVCLRRVD   +   I R GV H+CGAPVVLNMLAN  +    
Sbjct  234   HANGWSFPWGVAVVGGTNVCLRRVDATEVYATIARRGVNHLCGAPVVLNMLANAPDGVR-  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R ES+GF VSHGYGLTET GL ++CAWK EW+ LPA E
Sbjct  293   QPLQGKVRILTAGAPPPAAVLNRTESIGFEVSHGYGLTETAGLVMSCAWKGEWNKLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    D++   TG+SV RDG+ +GEIVLRG  +MLGYL D + T   
Sbjct  353   RARLKARQGVRTPGMAEVDIIDGETGRSVPRDGSTMGEIVLRGGCLMLGYLDDDKATRAA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +++DGWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  413   IRDDGWFYTGDVGVMHPDGYMEIRDRSKDVIISGGENISSVEVESVLYNHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK+G     T  ++  +C+ER+P +MVP+ VVF A LPKTSTGKI
Sbjct  473   RPDEFWGETPCAFLSLKEGSPGAVTASDVMAWCRERMPRYMVPKTVVFRAELPKTSTGKI  532

Query  335   QKFLLRDIARDL  300
             QK++LR++A+++
Sbjct  533   QKYVLRNLAKEM  544



>ref|XP_009106386.1| PREDICTED: probable acyl-activating enzyme 4 [Brassica rapa]
Length=544

 Score =   409 bits (1052),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 240/312 (77%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG TN+CLRRVD  +I ++I++H VTHMC AP+VLNML NY      
Sbjct  236   HANGWSYTWATAAVGATNICLRRVDAKTIYESIDKHHVTHMCAAPMVLNMLTNYPAR---  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L  PV ++TAGAPPP  V+   ESLGF V HGYGLTETG L V+CAWK EWD L   E
Sbjct  293   KQLKQPVRVMTAGAPPPETVISSAESLGFDVGHGYGLTETGCLNVSCAWKPEWDGLGESE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F   DV    TG+SVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  353   RAKLKSRQGIRTAVFAEVDVRDTLTGESVKHDGVTVGEIVFRGGSVMLGYYKDPEGTAAS  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  413   MREDGWFYTGDMGVMHPDGYLEVKDRSKDVIICGGENISSKEVETVLYTNPVVKEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSL K +    +E+E+REFCK +LP +MVPR VVF   LPKTSTGKI
Sbjct  473   KPDKMWGETPCAFVSL-KCLDGSVSEREIREFCKTKLPKYMVPRNVVFQEELPKTSTGKI  531

Query  335   QKFLLRDIARDL  300
             QKF+LR +A+ L
Sbjct  532   QKFVLRQMAKSL  543



>ref|XP_003544953.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Glycine max]
Length=554

 Score =   409 bits (1052),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 213/316 (67%), Positives = 251/316 (79%), Gaps = 7/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ +G+AAVGGTN+C+R+ D   +   I+RH VTHMCGAPVVLNML N  +    
Sbjct  238   HANGWSFPYGIAAVGGTNICVRKFDAEIVYSLIKRHHVTHMCGAPVVLNMLTNSPD---N  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILTAGAPPPAAVL R E+LGF VSHGYGLTETGGL V+CAWK EW+ LPA E
Sbjct  295   KPLEKPVQILTAGAPPPAAVLFRTEALGFVVSHGYGLTETGGLVVSCAWKGEWNKLPATE  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    DVV P TG+SVKRDG  +GE+V+RG  VMLGYLKDP GT+ C
Sbjct  355   RARLKARQGVRTAGMAEVDVVGP-TGESVKRDGVSIGEVVMRGGCVMLGYLKDPSGTASC  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+EAAVVA
Sbjct  414   FK-NGWFYTGDVGVMHEDGYLEIKDRSKDVIISGGENLSSVEVESVLYGHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMR--EFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RP ++WGETPCAFVSLK+ I  K    E    E+C++ +P +MVPR V+F   LPKTSTG
Sbjct  473   RPHEYWGETPCAFVSLKREIKEKEKPTEKEIIEYCRDNMPHYMVPRTVIFKDELPKTSTG  532

Query  341   KIQKFLLRDIARDLSS  294
             KIQKF+LR IA+++ S
Sbjct  533   KIQKFVLRQIAKEMGS  548



>emb|CDX87532.1| BnaA07g33410D [Brassica napus]
Length=544

 Score =   409 bits (1050),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 239/312 (77%), Gaps = 4/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG TN+CLRRVD  +I ++I++H VTHMC AP+VLNML NY      
Sbjct  236   HANGWSYTWATAAVGATNICLRRVDAKTIYESIDKHHVTHMCAAPMVLNMLTNYPAR---  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L  PV ++TAGAPPP  V+   ESLGF V HGYGLTETG L V+CAWK EWD L   E
Sbjct  293   RQLKQPVRVMTAGAPPPETVISSAESLGFDVGHGYGLTETGCLNVSCAWKPEWDGLGESE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+R+  F   DV    TGKSVK DG  VGEIV RG SVMLGY KDPEGT+  
Sbjct  353   RAKLKSRQGIRTAVFAEVDVRDTLTGKSVKHDGVTVGEIVFRGGSVMLGYYKDPEGTAAS  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GV+HPDGY+EVKDR KDVII GGEN+SS EVE+VLY +P V EAAVVA
Sbjct  413   MREDGWFYTGDMGVMHPDGYLEVKDRSKDVIICGGENISSKEVETVLYTNPVVKEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAFVSLK       +E+E+REFCK +LP +MVPR VVF   LPKTSTGKI
Sbjct  473   KPDKMWGETPCAFVSLKYH-DGSVSEREIREFCKAKLPKYMVPRNVVFQEELPKTSTGKI  531

Query  335   QKFLLRDIARDL  300
             QKF+LR +A+ L
Sbjct  532   QKFVLRQMAKSL  543



>ref|XP_009799722.1| PREDICTED: probable acyl-activating enzyme 6 [Nicotiana sylvestris]
Length=551

 Score =   409 bits (1050),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 244/317 (77%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSYTWGMA VGGTN+CLR+ D   +  AI  H VTHMCGAPVVL MLAN       
Sbjct  236   HSNGWSYTWGMAVVGGTNICLRKFDANVVFRAIIEHNVTHMCGAPVVLTMLANSPCAT--  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL  PV   T GAPPPA V+ RVE LGF V+HGYG+TE  G+ V+C WK +W+ L A  
Sbjct  294   -PLKYPVHFRTGGAPPPAMVVLRVEKLGFVVNHGYGMTEVAGVVVSCIWKPKWNKLNANM  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQG+RS+G T  DVV+P +G SVKRDG  +GEIVLRG  +MLGYLK+ E TSKC
Sbjct  353   KAKLKSRQGIRSLGMTEVDVVNPESGVSVKRDGLTMGEIVLRGGCIMLGYLKNQEATSKC  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK D W YTGD+ V+HPDGY+E+KDR KD+IISGGEN+SSVEVESVLY +  V+EAAVVA
Sbjct  413   MKND-WLYTGDLAVMHPDGYLEIKDRSKDIIISGGENVSSVEVESVLYSNNFVNEAAVVA  471

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK  +  KP EKE+ +FC+ERLP +M+P+ V+FM  LPKT+TGKI
Sbjct  472   RPDEFWGETPCAFLSLKMEVKQKPKEKEIVDFCRERLPHYMIPKTVIFMDELPKTATGKI  531

Query  335   QKFLLRDIARDLSSADA  285
             QKF LR+IA+ + S  A
Sbjct  532   QKFSLREIAKGMGSLPA  548



>emb|CDY62984.1| BnaCnng41240D [Brassica napus]
Length=548

 Score =   408 bits (1049),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 247/314 (79%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW Y W +AAVGGTNVCLR+     I+  I  HGVTHMCGAPVVLNML         
Sbjct  234   HANGWCYPWAIAAVGGTNVCLRKFQAPLIHRLIRDHGVTHMCGAPVVLNMLTASQE----  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L SPV  LTAG+ PP  VL R ESLGF +SHGYGLTET G+ V+CAWK +W+ LPA  
Sbjct  290   ETLKSPVHFLTAGSSPPVTVLLRAESLGFIISHGYGLTETAGVVVSCAWKPQWNRLPASN  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K RQGV +VGFT  +VV P +G+SV+RDG  +GEIV+RG+SVMLGYLKDP GT K 
Sbjct  350   QARLKGRQGVGTVGFTKINVVDPGSGRSVERDGATMGEIVMRGSSVMLGYLKDPVGTRKT  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWF+TGDVGV+H DGY+E+KDR KDVII+GGEN+SSVEVE+VLY HPAV+EAAVVA
Sbjct  410   LK-NGWFFTGDVGVLHGDGYLEIKDRSKDVIITGGENVSSVEVEAVLYTHPAVNEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+ WGETPCAFVSLK G+  KPTEKEM E+C+E++P +MVP+ V F+  LPKTSTGKI
Sbjct  469   RPDEHWGETPCAFVSLKPGLTRKPTEKEMIEYCREKMPHYMVPKTVAFLEELPKTSTGKI  528

Query  335   QKFLLRDIARDLSS  294
              KF+L+++A  + S
Sbjct  529   PKFVLKEMANKMGS  542



>ref|XP_006839140.1| hypothetical protein AMTR_s00090p00177840 [Amborella trichopoda]
 gb|ERN01709.1| hypothetical protein AMTR_s00090p00177840 [Amborella trichopoda]
Length=550

 Score =   408 bits (1048),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 246/312 (79%), Gaps = 7/312 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WG+AA+GGTNVCLRR DPAS+ +AI  H VTHMCGAPVVLNML+N       
Sbjct  233   HANGWSFPWGIAAMGGTNVCLRRFDPASVYNAITEHRVTHMCGAPVVLNMLSNAPAK---  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
               L   V+ILTAGAPPPAAVL R E+LGF VSHGYGLTET GLA +C W+ EWD LP  E
Sbjct  290   --LQHTVNILTAGAPPPAAVLARTEALGFTVSHGYGLTETAGLATSCVWRGEWDKLPGME  347

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+V  T ADV+   T  SV RDG  +GEI LRG+ VMLGYLKDPE T+KC
Sbjct  348   RARLKARQGVRTVAMTEADVLDRQTMTSVPRDGAHLGEIALRGSCVMLGYLKDPEATAKC  407

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +  +GWF TGDVGV+HPDGYIE+KDR KDVII+GGEN+SSV+VESVLY HP+V+EAAVVA
Sbjct  408   LV-NGWFLTGDVGVMHPDGYIEIKDRSKDVIITGGENVSSVQVESVLYEHPSVEEAAVVA  466

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV  +     +  EKE+  FC+ R+P +MVP+ VVF+  LPKTSTGKI
Sbjct  467   RPDEFWGETPCAFVKARTQ-TQEVGEKEVVAFCRGRMPHYMVPKTVVFVPELPKTSTGKI  525

Query  335   QKFLLRDIARDL  300
             QKFLLR+ A+ +
Sbjct  526   QKFLLREKAKAM  537



>ref|XP_010453796.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
Length=552

 Score =   407 bits (1047),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 196/312 (63%), Positives = 249/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW Y WG+AAVGGTNVCLR+ + +     I  H VTHMCGAPVVLNML+        
Sbjct  238   HANGWCYPWGIAAVGGTNVCLRKFEASLTYRLIRDHNVTHMCGAPVVLNMLSATQESH--  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAV+ R ES+GF +SHGYGLTE  G+ V+C WK +W+ LPA +
Sbjct  296   QPLKRPVNILTAGAPPPAAVILRAESIGFVISHGYGLTEAAGVVVSCVWKPQWNRLPASD  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G+ V+R+   VGEIV++G+S+MLGYLKDP GT K 
Sbjct  356   RARLKARQGVRTVGFTEIDVVDPESGRGVERNRETVGEIVMKGSSIMLGYLKDPSGTEKA  415

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGVIH DGY+E+KDR KD+IISGGEN+SSVEVE+VLY +PAV E AVVA
Sbjct  416   LK-NGWFYTGDVGVIHSDGYLEIKDRSKDIIISGGENVSSVEVEAVLYTNPAVSEVAVVA  474

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G+  +PTE+E+ E+C+ ++  FMVP+ V+F   LPKTSTGK+
Sbjct  475   RPDEFWGETPCAFVSLKEGLSVEPTEEELIEYCRNKMSRFMVPKTVLFRDELPKTSTGKV  534

Query  335   QKFLLRDIARDL  300
              + +L++IA+ +
Sbjct  535   SRLVLKEIAKTM  546



>ref|XP_010420322.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Camelina 
sativa]
Length=564

 Score =   407 bits (1047),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 250/312 (80%), Gaps = 2/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW Y WG+AAVGGTNVCLR+ +       I  H VTHMCGAPVVLNML+     ++ 
Sbjct  252   HANGWCYPWGIAAVGGTNVCLRKFEAPLTYRLIRDHNVTHMCGAPVVLNMLSAATQESH-  310

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV+ILTAGAPPPAAVL R ES+GF +SHGYGLTE  G+ V+C WK +W+ LPA +
Sbjct  311   QPLKRPVNILTAGAPPPAAVLLRAESIGFVISHGYGLTEAAGVVVSCVWKPQWNRLPASD  370

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VGFT  DVV P +G+SV+R+G  +GEIV+RG+S+MLGYLKDP GT K 
Sbjct  371   RARLKARQGVRTVGFTEIDVVDPESGRSVERNGETMGEIVMRGSSIMLGYLKDPMGTEKA  430

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GW YTGDVGVIH DGY+E+KDR KD+IISGGEN+SSVEVE+VLY +PAV E AVVA
Sbjct  431   LK-NGWCYTGDVGVIHSDGYLEIKDRSKDIIISGGENVSSVEVEAVLYTNPAVSEVAVVA  489

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G+  +PTE+E+ E+C+ ++  FMVP+ V+F   LP TSTGK+
Sbjct  490   RPDEFWGETPCAFVSLKEGLSVEPTEEELIEYCRNKMSRFMVPKTVLFRDELPTTSTGKV  549

Query  335   QKFLLRDIARDL  300
              K +L++IA+ +
Sbjct  550   SKLVLKEIAKTM  561



>dbj|BAJ98602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=555

 Score =   407 bits (1047),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 247/312 (79%), Gaps = 1/312 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD A + D I R GVTH+CGAPVVLNMLAN       
Sbjct  234   HANGWSFPWGMAVVGGTNVCLRRVDAAEVYDTIARRGVTHLCGAPVVLNMLANAPEGVR-  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R E++GF VSHGYGLTET GL + CAWK EW+ LPA E
Sbjct  293   RPLPGKVHILTAGAPPPAAVLGRTEAIGFDVSHGYGLTETAGLVLLCAWKGEWNKLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    D+V   TG+SV RDG  +GEIVLRG  V +GY KD + T   
Sbjct  353   RARLKARQGVRTPGMAEVDIVDGETGRSVPRDGATMGEIVLRGGCVTMGYFKDEDATRAA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +++DGWFYTGDVGV+HPDGY+E++DR +DVIISGGEN+SSVEVES+LY HPAV+EAAVVA
Sbjct  413   IRDDGWFYTGDVGVMHPDGYLEIRDRSRDVIISGGENISSVEVESLLYGHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK+G     T  E+  + +ER+P +MVP+ VVF A LPKTSTGKI
Sbjct  473   RPDEFWGETPCAFVSLKEGAGGVVTAAEVIAWSRERMPGYMVPKTVVFRAELPKTSTGKI  532

Query  335   QKFLLRDIARDL  300
             QK++LR++A+++
Sbjct  533   QKYVLRNLAKEM  544



>gb|KEH16506.1| long-chain acyl-CoA synthetase [Medicago truncatula]
Length=569

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 246/317 (78%), Gaps = 6/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY WGMAAVGGTN+C RR D  SI + IE HGVTHMC APVVLNML+N+N     
Sbjct  241   HSNGWSYPWGMAAVGGTNICTRRTDAPSIYNLIESHGVTHMCAAPVVLNMLSNFNK---N  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L  PV +LT G+ PPAA+L R E+LGF VSHGYG+TE  G+ V+CAWKREWD  PA  
Sbjct  298   EQLKKPVHVLTGGSSPPAAILIRAENLGFEVSHGYGMTEVIGVIVSCAWKREWDRFPATG  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR VG T  DVV P TG+SVK DG   GEIV++G  VMLGYLKD   T +C
Sbjct  358   KARMKARQGVRRVGVTEVDVVGP-TGESVKHDGITAGEIVVKGACVMLGYLKDENATLQC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK++GWFYTGDV V+H DGY+E+KDRLKDVIISGGEN+SSVEVE VLYMHPAV EAAVVA
Sbjct  417   MKKNGWFYTGDVAVMHEDGYLEIKDRLKDVIISGGENMSSVEVEGVLYMHPAVKEAAVVA  476

Query  515   RPDKFWGETPCAFVSLKKGIIAK--PTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD FWGETPCAFVSLK  +     PT+ E+++FC+E LP FM P+ +V M  LPKTSTG
Sbjct  477   RPDDFWGETPCAFVSLKDELNENDIPTDMEIKKFCREELPHFMTPKTIVIMKELPKTSTG  536

Query  341   KIQKFLLRDIARDLSSA  291
             K++K +LR +A+++ S 
Sbjct  537   KVKKHVLRKVAKEMGST  553



>gb|AFD33349.1| acyl-activating enzyme 5 [Cannabis sativa]
Length=575

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/313 (65%), Positives = 246/313 (79%), Gaps = 4/313 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWG AAVG TNVCLRR D   I + I RH VTHMC AP+VLNML+N  N    
Sbjct  247   HANGWGYTWGTAAVGATNVCLRRFDGEIIFNLIRRHRVTHMCAAPIVLNMLSNSPNAG--  304

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL +PV ++T GAPPPAAVL R ESLGF +SHGYG+TE  G+ V+CAWK+EW+  PA E
Sbjct  305   -PLPNPVHVMTGGAPPPAAVLLRTESLGFVISHGYGMTEMLGVVVSCAWKKEWNMFPATE  363

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+   T  DVV P++G SVKRDG  +GEIVL+G+ VMLGYLK+   T+KC
Sbjct  364   RARLKSRQGVRTAAMTEVDVVDPNSGVSVKRDGLTMGEIVLKGSCVMLGYLKNSTATAKC  423

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +++ GWFYTGD+ V+HPDGY+E+KDR KDVIISGGEN+SSVEVES LY HPAVDEAAVVA
Sbjct  424   IRDGGWFYTGDMAVMHPDGYLEIKDRSKDVIISGGENVSSVEVESALYSHPAVDEAAVVA  483

Query  515   RPDKFWGETPCAFVSLKKGII-AKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
              PD++WGETP AFV+LKKG +    TEKE+ E+C+E+L  FMVP+ VVF   LPKTSTGK
Sbjct  484   CPDEYWGETPLAFVTLKKGAVRVTVTEKEILEYCREKLAHFMVPKVVVFRDKLPKTSTGK  543

Query  338   IQKFLLRDIARDL  300
             IQKF L++I + +
Sbjct  544   IQKFTLKEIVKSM  556



>ref|XP_004309396.1| PREDICTED: probable acyl-activating enzyme 6-like [Fragaria vesca 
subsp. vesca]
Length=556

 Score =   407 bits (1045),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 212/317 (67%), Positives = 252/317 (79%), Gaps = 3/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW + W MAAVGGTN+CLR+ D   I D I++H VTHMC APVVLNML N+      
Sbjct  236   HANGWCFPWAMAAVGGTNICLRKFDGPVIYDLIQKHRVTHMCAAPVVLNMLVNHPRP---  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL +PV ILT GAPPP++VL R ESLGF VSHGYGLTET G+ V+CAWK EW   P  E
Sbjct  293   DPLPNPVCILTGGAPPPSSVLLRAESLGFVVSHGYGLTETAGVVVSCAWKPEWGKFPVTE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGV +VG T  DVV P +G SVKR+G+ +GEIV+RG  VMLGYLKDPE TS+ 
Sbjct  353   KARLKARQGVGTVGTTEVDVVDPDSGLSVKRNGSDIGEIVIRGGCVMLGYLKDPETTSRA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K +GWFYTGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY H AV+EAAVVA
Sbjct  413   LKRNGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYTHAAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK  +  +PTEKE+ E+C+ +LP FMVP+ VVF   LPKTSTGKI
Sbjct  473   RPDEFWGETPCAFVSLKGDVSPRPTEKEIIEYCRGKLPSFMVPKTVVFKEELPKTSTGKI  532

Query  335   QKFLLRDIARDLSSADA  285
             QK +LR+IA+ + S+ A
Sbjct  533   QKSVLREIAKSIGSSSA  549



>ref|XP_003519306.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal-like 
[Glycine max]
Length=555

 Score =   405 bits (1042),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 249/316 (79%), Gaps = 8/316 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW+ TWG+AA+GGTN+C+R+ D   +   I  H VTHMCGAPVVLNML N +     
Sbjct  240   HANGWNLTWGIAALGGTNICVRKFDAGVVYSLIRNHHVTHMCGAPVVLNMLTNSDK----  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV  +TAGAPPPAAVL R E  GF V HGYGLTETGG+ V+CAWK +W+ LPA E
Sbjct  296   RPLEKPVQFITAGAPPPAAVLLRAEEFGFVVGHGYGLTETGGIVVSCAWKGKWNRLPATE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+VG T  DVV P TG+SVKRDG  VGEIV++G  VMLGYLKDP GT++C
Sbjct  356   RARLKARQGVRTVGVTEVDVVGP-TGESVKRDGVSVGEIVVKGGCVMLGYLKDPSGTARC  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +G FYTGDV V+H DGY+E+KDR K+VIISGGENLSSVE+ESVLY HPAV+EAAVVA
Sbjct  415   FK-NGRFYTGDVAVMHEDGYLEIKDRSKEVIISGGENLSSVELESVLYGHPAVNEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKP--TEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD++WGETPCAFVSLK  I  K   TEK+M ++CK+ +P +MVP+ VVF   LPKTSTG
Sbjct  474   RPDEYWGETPCAFVSLKAAIKEKEKLTEKDMIQYCKDNMPHYMVPKTVVFKDELPKTSTG  533

Query  341   KIQKFLLRDIARDLSS  294
             KIQKF+L+ IA ++ S
Sbjct  534   KIQKFVLKQIANNMGS  549



>ref|XP_010666048.1| PREDICTED: probable acyl-activating enzyme 6 [Beta vulgaris subsp. 
vulgaris]
Length=591

 Score =   407 bits (1045),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 246/312 (79%), Gaps = 0/312 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWGMAAVG TN+CLR+ D A I+D I R+ VTH+C APVVLNML + +N A T
Sbjct  270   HVNGWAFTWGMAAVGATNICLRQFDGAKIHDLIRRYQVTHLCAAPVVLNMLTDKSNTAAT  329

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L  PV +LTAG+PPPA+V+ R E+LGF VSHGYGLTETGG+ V+CAWK +W+ LPA E
Sbjct  330   QILDHPVHVLTAGSPPPASVILRAEALGFVVSHGYGLTETGGVTVSCAWKPKWNGLPANE  389

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +++RQGVR++  T   VV P T K V RDG  +GEIV RG+ +MLGY K+P+ T  C
Sbjct  390   RAQLRARQGVRTLAMTAVVVVDPTTNKPVSRDGKTIGEIVQRGSCIMLGYFKNPQATLNC  449

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M +DGWF TGD+GV+H DGYI +KDR KD+IISGGEN+SSVEVESVLY  P V+EAAVVA
Sbjct  450   MGDDGWFRTGDLGVMHTDGYIMIKDRSKDIIISGGENISSVEVESVLYTFPGVNEAAVVA  509

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +P +FWGETPCAFV     +  +PTEKE+ +FC++RLP +MVP+KV+F   LPKT+TGKI
Sbjct  510   QPHEFWGETPCAFVCFNTEVKVRPTEKEIIDFCRDRLPHYMVPKKVIFKDDLPKTATGKI  569

Query  335   QKFLLRDIARDL  300
             +K +LR+IAR L
Sbjct  570   KKLVLREIARAL  581



>ref|XP_010935662.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Elaeis 
guineensis]
Length=539

 Score =   405 bits (1040),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 207/310 (67%), Positives = 249/310 (80%), Gaps = 2/310 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS  WG+AA GGTNVCLR  D  +I  A+  + VTHMCGAPVVLNMLAN  +    
Sbjct  195   HANGWSCPWGIAAAGGTNVCLRSFDATTIYAALATYRVTHMCGAPVVLNMLANAPDSTR-  253

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV ILTAGA PPAAVL RVE+LGF VSHGYGLTETGG+A++C WK EWD LPA E
Sbjct  254   RPLPGPVQILTAGASPPAAVLHRVEALGFSVSHGYGLTETGGMALSCTWKAEWDRLPAAE  313

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQ +R++  T  DV+   TG+SV RDG  +GEIVLRG  VMLGYLKD E TS+ 
Sbjct  314   RARLKARQDIRTLATTDIDVIDGSTGESVHRDGTTMGEIVLRGGCVMLGYLKDEEATSRA  373

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWFYTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV++AAVVA
Sbjct  374   VRPDGWFYTGDVGVMHADGYVEIKDRSKDVIISGGENLSSVEVESVLYGHPAVNKAAVVA  433

Query  515   RPDKFWGETPCAFVSLKKGIIAK-PTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             RP ++WGETPCAFVS+K+G++A  PTE E+  +C+ER+P +MVP+ VVF   LPKT TGK
Sbjct  434   RPVEYWGETPCAFVSIKEGVLAAPPTEAEVIGWCRERMPHYMVPKTVVFKPELPKTPTGK  493

Query  338   IQKFLLRDIA  309
             IQK++LR++A
Sbjct  494   IQKYVLREMA  503



>gb|KCW69470.1| hypothetical protein EUGRSUZ_F02925, partial [Eucalyptus grandis]
Length=548

 Score =   405 bits (1040),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 253/315 (80%), Gaps = 11/315 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynny---  1065
             HANGWS+ WG+AAVGGT++CLR+ D A+I + I RHGVTHMCGAPVVLNML++ +     
Sbjct  242   HANGWSFPWGLAAVGGTSICLRKFDAATIYNLIRRHGVTHMCGAPVVLNMLSSGSGSGSG  301

Query  1064  aNTKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLP  885
             A+ + L  PV I+TAGAPPPAAVL R ESLGF VSHGYGLTET G+ V+CAWK++W+ LP
Sbjct  302   ADAEQLEHPVKIMTAGAPPPAAVLFRTESLGFEVSHGYGLTETEGIVVSCAWKQQWNRLP  361

Query  884   APERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGT  705
             A ERA +K+RQGVR+V  T  +VV P +G  V+RDG+ +GEIVLRG  VMLGYLKDPEGT
Sbjct  362   AGERARLKARQGVRTVAMTEVEVVDPESGAPVRRDGSTLGEIVLRGGCVMLGYLKDPEGT  421

Query  704   SKCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAA  525
             +KCM+  GWFYTGDVGV+HPDGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV EAA
Sbjct  422   AKCMR-GGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESVLYGHPAVHEAA  480

Query  524   VVARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
             VVARPD+FWG      +   +G    PTEKE+ E+C+ ++P +MVP+ VVF   LPKTST
Sbjct  481   VVARPDEFWG------IKANRG-GQSPTEKEIVEYCRSKMPHYMVPKTVVFKEELPKTST  533

Query  344   GKIQKFLLRDIARDL  300
             GKIQK+LLR++A+ +
Sbjct  534   GKIQKYLLREMAKQM  548



>ref|XP_007141985.1| hypothetical protein PHAVU_008G242700g [Phaseolus vulgaris]
 gb|ESW13979.1| hypothetical protein PHAVU_008G242700g [Phaseolus vulgaris]
Length=551

 Score =   405 bits (1040),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 241/314 (77%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW + WG+AAVGGTNVC R+ +   I   IE H VTHMC APVVLNML        T
Sbjct  236   HANGWGFPWGIAAVGGTNVCTRKTNAPIIYRLIESHNVTHMCAAPVVLNMLLRR-----T  290

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL SPV +L  G+PPPAAVL R E LGF VSHGYG+TET G+ V+CAWKREWD LP  E
Sbjct  291   EPLKSPVHVLAGGSPPPAAVLARAEELGFVVSHGYGMTETLGVVVSCAWKREWDRLPGRE  350

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +++RQGVR+   +  DVV P +G SVKRDG   GE+V+RG SVM+GYLKD +GT  C
Sbjct  351   RARLRARQGVRTAAVSEVDVVDPASGVSVKRDGVTSGEVVVRGASVMMGYLKDLKGTRSC  410

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++E+GW YTGDVGV+H DGY+E+KDR KDVIISGGEN+SSVEVE+VLY HP V EAAVV 
Sbjct  411   VRENGWLYTGDVGVVHGDGYLEIKDRSKDVIISGGENVSSVEVETVLYAHPEVREAAVVG  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV L + +   PTE+E+ EFC+ERLP FMVP+ VVF  ALPKTSTGKI
Sbjct  471   RPDEFWGETPCAFVELNERLERLPTEEEVVEFCRERLPHFMVPKTVVFKEALPKTSTGKI  530

Query  335   QKFLLRDIARDLSS  294
             +K +LR  A+ + S
Sbjct  531   RKHVLRKEAQGMGS  544



>ref|XP_004960094.1| PREDICTED: probable acyl-activating enzyme 6-like [Setaria italica]
Length=593

 Score =   406 bits (1043),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 245/315 (78%), Gaps = 1/315 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMAAVGG NVCLRRV+ A++  AI   GVTH+C APVVLNMLAN       
Sbjct  271   HANGWSFPWGMAAVGGANVCLRRVNAATVYAAIAIRGVTHLCCAPVVLNMLANAPEGVR-  329

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V +LTAGAPPPAAVLQR E++GF VSHGYGLTET GL V+C WKREWD LPAPE
Sbjct  330   RPLPGKVRVLTAGAPPPAAVLQRTEAIGFEVSHGYGLTETAGLPVSCTWKREWDKLPAPE  389

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR  G    DV+   TG SV  DG+ +GEIVLRG  VMLGYL D E T   
Sbjct  390   RARLKARQGVRLPGMAEVDVIDGETGLSVPHDGSTMGEIVLRGGCVMLGYLNDDEATRAA  449

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +++DGWFYTGDVGV+HPDGY+E++DR KDVII+ GEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  450   IRDDGWFYTGDVGVVHPDGYLEIRDRSKDVIINAGENISSVEVESVLYGHPAVNEAAVVA  509

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+  GETPCAFVSLK+      T  ++  +C+ER+P +MVPR VVF A LPKTSTGKI
Sbjct  510   RPDELRGETPCAFVSLKEDAAGAVTAADLMAWCRERMPQYMVPRTVVFRAELPKTSTGKI  569

Query  335   QKFLLRDIARDLSSA  291
             QK++LR++A ++  A
Sbjct  570   QKYVLRNLAMEMGPA  584



>ref|XP_003616108.1| 2-succinylbenzoate-CoA ligase [Medicago truncatula]
 gb|AES99066.1| long-chain acyl-CoA synthetase [Medicago truncatula]
Length=563

 Score =   404 bits (1039),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 243/316 (77%), Gaps = 6/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGWSY W MAAVGG N+C RR D  +I   IE HGVTHMC APVVLNML+N+N    T
Sbjct  239   HSNGWSYPWAMAAVGGINICTRRTDAPTIYTLIESHGVTHMCAAPVVLNMLSNFNK---T  295

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV +LT G+ PP A+L R E LGF VSHG+G+TE  G+ V+CAWKREWD  PA E
Sbjct  296   EPLKKPVHVLTGGSSPPTAILTRAERLGFEVSHGFGMTEVIGVIVSCAWKREWDRFPATE  355

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGVR VG    DVV P TG+SVK DG  VGEIV++G  VMLGY KD   TS+C
Sbjct  356   KARMKARQGVRKVGVAEVDVVGP-TGESVKNDGVTVGEIVVKGACVMLGYFKDEIATSQC  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +K++GWFYTGDV V+H DGY+E+KDR KD+IISGGEN+SSVEVE VLYMH AV EAAVVA
Sbjct  415   IKKNGWFYTGDVAVMHEDGYLEIKDRSKDLIISGGENMSSVEVEGVLYMHSAVKEAAVVA  474

Query  515   RPDKFWGETPCAFVSLKKGIIAK--PTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             RPD FWGETPC FVSLK  +     PT+ E++EFCKE+LP FM+P+ +VFM  LPKTSTG
Sbjct  475   RPDDFWGETPCGFVSLKDELKKNDIPTDNEIKEFCKEKLPHFMMPKTIVFMKELPKTSTG  534

Query  341   KIQKFLLRDIARDLSS  294
             K+QK +LR +A+ + S
Sbjct  535   KVQKHVLRKVAKKMGS  550



>gb|EMT02303.1| 2-succinylbenzoate--CoA ligase [Aegilops tauschii]
Length=345

 Score =   396 bits (1017),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 242/312 (78%), Gaps = 1/312 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD  ++  AI  H +TH+CGAPVVL+MLAN       
Sbjct  23    HANGWSFPWGMAVVGGTNVCLRRVDAKNVYAAITDHEITHLCGAPVVLSMLANAPEGVR-  81

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL S V I  AG P PAAVL RVE+LGF +SHGYGLTETGG  V+CAWK EW+ LPA E
Sbjct  82    KPLHSKVRIRPAGPPRPAAVLHRVEALGFELSHGYGLTETGGHVVSCAWKGEWNKLPASE  141

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    D+V   TG+SV R+G+ +GEIVLRG  +MLGYL D E T   
Sbjct  142   RARLKARQGVRTPGKAEVDIVDADTGRSVPREGSTMGEIVLRGGCIMLGYLNDSEATKAA  201

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             +++DGWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVES+LY HPAV EAAVVA
Sbjct  202   IRDDGWFYTGDVGVMHPDGYLEIRDRSKDVIISGGENISSVEVESMLYGHPAVSEAAVVA  261

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFVSLK G     T  E+  + +ER+  +MVP+ VVF   LPKTSTGK+
Sbjct  262   RPDEFWGETPCAFVSLKDGAAGVVTAAEVIAWSRERMAGYMVPKTVVFRGELPKTSTGKV  321

Query  335   QKFLLRDIARDL  300
             QK++LR +AR++
Sbjct  322   QKYVLRKLAREM  333



>ref|XP_011097993.1| PREDICTED: LOW QUALITY PROTEIN: probable acyl-activating enzyme 
5, peroxisomal [Sesamum indicum]
Length=540

 Score =   403 bits (1035),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 247/314 (79%), Gaps = 14/314 (4%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTWGMAA             A+I  AI  + VTHMCGAPVVLNML N  +    
Sbjct  235   HANGWSYTWGMAAXAP----------AAIYAAIREYKVTHMCGAPVVLNMLTNVPDG---  281

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV I+TAGAPPPAAVL R ESLGF VSHGYGLTETGGL V C WK++W+  PA E
Sbjct  282   KPLERPVYIMTAGAPPPAAVLLRTESLGFVVSHGYGLTETGGLVVCCTWKKKWNKFPAAE  341

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A IK+RQGVR+ G    DV+ P +GKSVKRDG  +GEIVLRG+ VMLGYLKDPE T+K 
Sbjct  342   KARIKARQGVRTPGMAEVDVIDPQSGKSVKRDGKTLGEIVLRGSCVMLGYLKDPEATAKA  401

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK +GWFYTGDVGV+ PDGY+E+KDR KDVIISGGENLSSVEVES+LY HPAV+EAAVVA
Sbjct  402   MK-NGWFYTGDVGVMQPDGYLEIKDRSKDVIISGGENLSSVEVESILYTHPAVNEAAVVA  460

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK+G+  KPTEKE+  FC+ +LP +MVP+ VV    LPKTSTGKI
Sbjct  461   RPDEFWGETPCAFLSLKEGVKEKPTEKEVVAFCRSKLPHYMVPKTVVIKEELPKTSTGKI  520

Query  335   QKFLLRDIARDLSS  294
             QKF+LR++A+ + S
Sbjct  521   QKFVLREMAKAMGS  534



>ref|XP_007019247.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
 gb|EOY16472.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
Length=517

 Score =   402 bits (1033),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 241/312 (77%), Gaps = 2/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTWGMA +GGTNVCLR  + + I + I+RH VTHMCGAPVVL M+ + +     
Sbjct  208   HANGWSYTWGMATMGGTNVCLRNFNASIIYNLIKRHNVTHMCGAPVVLKMVVSNSPT--N  265

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L  PV  L +GAP PA +L + ESLGFRVSHGYGLTET G  ++CAWK +W+ L A E
Sbjct  266   EHLEKPVQFLASGAPVPAPLLLQAESLGFRVSHGYGLTETAGFVMSCAWKPQWNTLAASE  325

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +++RQGVR++G    DVV P  G SVK+DG  +GEIV +G  +MLGYLKDP   S C
Sbjct  326   RARLRARQGVRTIGLMQMDVVDPERGVSVKKDGLSLGEIVFKGGPMMLGYLKDPTAESSC  385

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+EDGWFYTGD+GVIHPDGY+EVKDR KDVIISGGEN+SS EVESVLY +PA+ EAAVVA
Sbjct  386   MREDGWFYTGDIGVIHPDGYLEVKDRSKDVIISGGENISSTEVESVLYSNPAISEAAVVA  445

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK  +   PTE+E+ EFC+ +LP +M P+ VVF   LPKTSTGK+
Sbjct  446   RPDEFWGETPCAFVCLKDELSETPTEEEIIEFCRTKLPHYMAPKTVVFKEELPKTSTGKV  505

Query  335   QKFLLRDIARDL  300
              KF+LRDIA+ +
Sbjct  506   NKFMLRDIAKAI  517



>ref|XP_006473030.1| PREDICTED: probable acyl-activating enzyme 6-like [Citrus sinensis]
Length=558

 Score =   403 bits (1036),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 200/316 (63%), Positives = 245/316 (78%), Gaps = 7/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS+TWG A VG TNVCLR+ D  ++   I +HGVTHMCGAP+VLN+L++       
Sbjct  241   HNNGWSFTWGAAVVGATNVCLRKFDAPTVFALIRKHGVTHMCGAPIVLNLLSSSPE---A  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L  PV ILTAG+PPPA VL R ESLGF VSHGYG TE  G+ V+CAWK +W+ LPA E
Sbjct  298   KQLDRPVRILTAGSPPPAPVLLRTESLGFIVSHGYGKTEIAGVNVSCAWKPKWNKLPARE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA++K+RQGVR++G T  D+V P TG SVKRDG   GEIV+RG S+MLGYLKDPE TSKC
Sbjct  358   RASLKARQGVRTIGLTEVDIVDPETGLSVKRDGQTRGEIVMRGGSLMLGYLKDPEATSKC  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DG +YTGDVG++HPDGY+E+KDR KDVIISGGEN+SS E+ESVLY HP V+EAAVV 
Sbjct  418   MK-DGRYYTGDVGMMHPDGYLEIKDRSKDVIISGGENISSTEIESVLYSHPMVNEAAVVG  476

Query  515   RPDKFWGETPCAFVSLKKGIIA---KPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
             RPD FW E PCAFVSLK G  +     TEK++ ++C+ R+P +MVP+ VVF+  LPKT+T
Sbjct  477   RPDPFWQEIPCAFVSLKTGTDSGGMMTTEKDIIQYCRARIPRYMVPKTVVFIDELPKTAT  536

Query  344   GKIQKFLLRDIARDLS  297
             GK+QK++L DIA  +S
Sbjct  537   GKVQKYVLGDIANSMS  552



>gb|KDO80441.1| hypothetical protein CISIN_1g008636mg [Citrus sinensis]
Length=558

 Score =   403 bits (1035),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 200/316 (63%), Positives = 245/316 (78%), Gaps = 7/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS+TWG A VG TNVCLR+ D  ++   I +HGVTHMCGAP+VLN+L++       
Sbjct  241   HNNGWSFTWGAAVVGATNVCLRKFDAPTVFALIRKHGVTHMCGAPIVLNLLSSSPE---A  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L  PV ILTAG+PPPA VL R ESLGF VSHGYG TE  G+ V+CAWK +W+ LPA E
Sbjct  298   KQLDRPVRILTAGSPPPAPVLLRTESLGFIVSHGYGKTEIAGVNVSCAWKPKWNKLPARE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA++K+RQGVR++G T  D+V P TG SVKRDG   GEIV+RG S+MLGYLKDPE TSKC
Sbjct  358   RASLKARQGVRTIGLTEVDIVDPETGLSVKRDGQTRGEIVMRGGSLMLGYLKDPEATSKC  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DG +YTGDVG++HPDGY+E+KDR KDVIISGGEN+SS E+ESVLY HP V+EAAVV 
Sbjct  418   MK-DGRYYTGDVGMMHPDGYLEIKDRSKDVIISGGENISSTEIESVLYSHPMVNEAAVVG  476

Query  515   RPDKFWGETPCAFVSLKKGIIA---KPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
             RPD FW E PCAFVSLK G  +     TEK++ ++C+ R+P +MVP+ VVF+  LPKT+T
Sbjct  477   RPDPFWQEIPCAFVSLKTGTDSGGMMTTEKDIIQYCRARIPRYMVPKTVVFIDELPKTAT  536

Query  344   GKIQKFLLRDIARDLS  297
             GK+QK++L DIA  +S
Sbjct  537   GKVQKYVLGDIANSMS  552



>ref|XP_002436828.1| hypothetical protein SORBIDRAFT_10g009600 [Sorghum bicolor]
 gb|EER88195.1| hypothetical protein SORBIDRAFT_10g009600 [Sorghum bicolor]
Length=552

 Score =   402 bits (1033),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 247/315 (78%), Gaps = 1/315 (0%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRV+ A++  AI   GVTH+C APVVLNMLAN ++    
Sbjct  232   HANGWSFPWGMAVVGGTNVCLRRVNAATVYAAIASRGVTHLCCAPVVLNMLANAHDGVR-  290

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V I TAGAPPPAAVLQR E++GF +SHGYGLTET GL V+C WK EWD+LPAPE
Sbjct  291   RPLPGKVRIRTAGAPPPAAVLQRTEAIGFEISHGYGLTETAGLPVSCTWKGEWDSLPAPE  350

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+      DV+   TG+SV RDG  +GEIV+RG  VMLGYL D E T   
Sbjct  351   RARLKARQGVRTPATGKVDVIDSETGRSVPRDGATMGEIVVRGGCVMLGYLNDDEATKAA  410

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++EDGWFYTGDVGV+HPDGY+E++DR KDVII+ GEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  411   IREDGWFYTGDVGVMHPDGYLEIRDRSKDVIINAGENISSVEVESVLYDHPAVNEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+  GETPCAFVSLK+      T  ++  +C+ER+P +MVPR VVF A LPKTSTGKI
Sbjct  471   RPDELRGETPCAFVSLKEDAAGTVTAADVIAWCRERMPQYMVPRTVVFHAELPKTSTGKI  530

Query  335   QKFLLRDIARDLSSA  291
             QK++LR++A ++  A
Sbjct  531   QKYVLRNLAMEMGPA  545



>ref|XP_006434311.1| hypothetical protein CICLE_v10003943mg, partial [Citrus clementina]
 gb|ESR47551.1| hypothetical protein CICLE_v10003943mg, partial [Citrus clementina]
Length=432

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/310 (61%), Positives = 235/310 (76%), Gaps = 3/310 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWSY+WGMAAVGGTN+CLR+V    I   I+ HGVTH+CGA   L +L   ++  +T
Sbjct  123   HENGWSYSWGMAAVGGTNICLRKVGVPIIYSVIKHHGVTHICGA---LVVLNMLSSSPST  179

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILT+GA PPAAVL R ESLGF VSH YGLTET G  V+CAWK +W+ L   E
Sbjct  180   KPLDRPVKILTSGASPPAAVLLRTESLGFVVSHSYGLTETAGFVVSCAWKSQWNTLADTE  239

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G    DVVHP TG SVK DG   GEIV R  S+MLGYLKD EG+S C
Sbjct  240   RARVKARQGVRTIGLADMDVVHPETGMSVKHDGQSQGEIVFRSGSIMLGYLKDQEGSSLC  299

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+++ WFYTGD+GV+H DGY+E+KDR KDVIISGGEN+SS EVESVLYM+PA++E A+VA
Sbjct  300   MRDNDWFYTGDIGVVHSDGYLEIKDRSKDVIISGGENISSAEVESVLYMNPAINEVALVA  359

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             + DKFWG+ PCAFVSLK  +  KPTE+ + EFC+ RLP ++ P+ ++    LP T+T KI
Sbjct  360   QRDKFWGKRPCAFVSLKWELSKKPTEEAIIEFCRARLPHYLAPKSLIIQDELPITATVKI  419

Query  335   QKFLLRDIAR  306
             +KF+LR+I  
Sbjct  420   EKFVLREIVN  429



>ref|XP_006429740.1| hypothetical protein CICLE_v10013692mg [Citrus clementina]
 gb|ESR42980.1| hypothetical protein CICLE_v10013692mg [Citrus clementina]
Length=544

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 243/312 (78%), Gaps = 15/312 (5%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSY WGMAAVGGTNVCLR+ D A I   I +HGVTHMCGAPVVLNM++N      +
Sbjct  240   HANGWSYPWGMAAVGGTNVCLRKFDAAVIYKMIRQHGVTHMCGAPVVLNMISNLPR---S  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPAAVL R ESLGF VSHGYGLTET GL V+CAWK +W+ LPA E
Sbjct  297   EPLRNPVHILTAGAPPPAAVLFRTESLGFLVSHGYGLTETAGLVVSCAWKNKWNRLPATE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGVR+V FT  DV+   +G SV  DG  +GEIV RG S+MLGYLKD  G +  
Sbjct  357   RARMKSRQGVRTVCFTEIDVIDSESGLSVSHDGASLGEIVFRGGSMMLGYLKDLTGPA--  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
                       +VGVIH DGY+E+KDR KDVIISGGENLSSVEVESVLY +PAV+EAAVVA
Sbjct  415   ----------NVGVIHADGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVA  464

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAF+SLK  +  KPTEKE+ E+C+ RLP +MVP+ VVF   LPKTSTGKI
Sbjct  465   RPDEFWGETPCAFLSLKAELEKKPTEKEIIEYCRARLPRYMVPKTVVFKEELPKTSTGKI  524

Query  335   QKFLLRDIARDL  300
             +KF LR++A+ +
Sbjct  525   KKFELREMAKAM  536



>gb|AFW76928.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
Length=554

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 245/314 (78%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD A +   I   GV+H+CGAPVVLNMLAN       
Sbjct  234   HANGWSFPWGMAVVGGTNVCLRRVDAAEVYATIAGRGVSHLCGAPVVLNMLANAPEGVR-  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R ES+GF V HGYGLTET GL V CAWK EW+ LPA E
Sbjct  293   RPLPGKVRILTAGAPPPAAVLHRTESIGFEVIHGYGLTETAGLVVCCAWKGEWNKLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    D+V   TG+SV RDG+ +GEIVLRG  VMLGYL D + T   
Sbjct  353   RARLKARQGVRTPGMAEVDIVDGETGRSVPRDGSTMGEIVLRGGCVMLGYLDDDKATKAA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++++GWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  413   IRDNGWFYTGDVGVMHPDGYMEIRDRSKDVIISGGENISSVEVESVLYSHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFVSLK+      T  ++  +C++R+P +MVPR VVF   LPKTSTGKI
Sbjct  473   RPDDFWGETPCAFVSLKE---EGSTAADVIAWCRQRMPHYMVPRTVVFRDELPKTSTGKI  529

Query  335   QKFLLRDIARDLSS  294
             QK++LR++A+++ S
Sbjct  530   QKYVLRNLAKEMGS  543



>ref|XP_002448762.1| hypothetical protein SORBIDRAFT_06g032750 [Sorghum bicolor]
 gb|EES13090.1| hypothetical protein SORBIDRAFT_06g032750 [Sorghum bicolor]
Length=560

 Score =   400 bits (1029),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 246/315 (78%), Gaps = 4/315 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW + WGMAAVGGTNVCLRRV  A +   I R GV H+CGAPVVLNMLAN  + A  
Sbjct  234   HANGWCFPWGMAAVGGTNVCLRRVHAAEVYATIARRGVDHLCGAPVVLNMLANAPDAAR-  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R ES+GF V+HGYGLTET GL V+CAWK EW+ LPA E
Sbjct  293   RPLPGKVRILTAGAPPPAAVLHRTESIGFEVTHGYGLTETAGLVVSCAWKGEWNKLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+      D+V   TG SV RDG+ +GEIVLRG  VMLGYL D   T   
Sbjct  353   RARLKARQGVRTPAMAEVDIVDGETGHSVPRDGSTMGEIVLRGGCVMLGYLNDDTATRAA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++++GWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  413   IRDNGWFYTGDVGVMHPDGYMEIRDRSKDVIISGGENISSVEVESVLYNHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
             RPD+FWGETPCAFVSLK+     P   T  ++  +C++R+P +MVP+ VV  A LPKTST
Sbjct  473   RPDEFWGETPCAFVSLKEERSGSPGAVTAADVIAWCRDRMPHYMVPKTVVLRAELPKTST  532

Query  344   GKIQKFLLRDIARDL  300
             GKIQK++LR++A+D+
Sbjct  533   GKIQKYVLRNLAKDM  547



>gb|EMS64064.1| 2-succinylbenzoate--CoA ligase [Triticum urartu]
Length=468

 Score =   394 bits (1013),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 242/311 (78%), Gaps = 1/311 (0%)
 Frame = -2

Query  1232  ANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNTK  1053
             A   ++ WGMAA+GGTNVCLRRVD   +  AI  HGVTH+CGAPVVL+MLAN       +
Sbjct  148   AKDLTFPWGMAALGGTNVCLRRVDARDVYSAITDHGVTHLCGAPVVLSMLANAPEDVR-R  206

Query  1052  PLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPER  873
             PL   + I+TAG+PPPAAVL R E+LGF VSHGYGLTETGG  V+CAWK EW+ LPA ER
Sbjct  207   PLPGKIRIMTAGSPPPAAVLHRAEALGFEVSHGYGLTETGGHVVSCAWKGEWNKLPASER  266

Query  872   AAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKCM  693
             A +K+RQGVR+ G    D++   TG+SV RDG+ +GEIVLRG  VMLGYL D E T   +
Sbjct  267   ARLKARQGVRTPGMAEVDILDGETGRSVPRDGSTMGEIVLRGGCVMLGYLNDSEATKAAI  326

Query  692   KEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVAR  513
             ++DGWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVES+LY HPAV EAAVVAR
Sbjct  327   RDDGWFYTGDVGVMHPDGYLEIRDRSKDVIISGGENISSVEVESMLYGHPAVSEAAVVAR  386

Query  512   PDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKIQ  333
             PD+FWGETPCAFVSLK+G     T  E+  + ++R+  +MVP+ VVF   LPKTSTGK+Q
Sbjct  387   PDEFWGETPCAFVSLKEGAAGAVTAAEVIAWSRKRMAGYMVPKTVVFSTELPKTSTGKVQ  446

Query  332   KFLLRDIARDL  300
             K++LR +AR++
Sbjct  447   KYVLRKLAREM  457



>emb|CBG76266.1| OO_Ba0005L10-OO_Ba0081K17.17 [Oryza officinalis]
Length=559

 Score =   397 bits (1021),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 206/313 (66%), Positives = 245/313 (78%), Gaps = 2/313 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD A + D I R GV H+CGAPVVLNMLAN  +    
Sbjct  235   HANGWSFPWGMAVVGGTNVCLRRVDAAEVYDTIARRGVNHLCGAPVVLNMLANAPDGVR-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L   V ILTAGAPPPAAVL R E++GF VSHGYGLTET GL ++CAWK EWD LPA E
Sbjct  294   KSLPGKVRILTAGAPPPAAVLYRTEAIGFEVSHGYGLTETAGLVLSCAWKGEWDKLPASE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    DVV   TG+SV RDG+ +GEIVLRG  + LGYL D   T   
Sbjct  354   RARLKARQGVRTPGMAEVDVVDGETGRSVPRDGSTMGEIVLRGGCITLGYLNDEAATRAA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++E+GWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  414   IRENGWFYTGDVGVMHPDGYVEIRDRSKDVIISGGENISSVEVESVLYGHPAVNEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKK-GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             RPD+FWGETPCAFVSLK+ G     T  ++  + + R+P +MVP+ VVF   LPKTSTGK
Sbjct  474   RPDEFWGETPCAFVSLKQGGAAGAVTAADVIAWSRGRMPRYMVPKTVVFRDELPKTSTGK  533

Query  338   IQKFLLRDIARDL  300
             IQK++LR+IA+++
Sbjct  534   IQKYVLRNIAKEM  546



>ref|XP_002889131.1| hypothetical protein ARALYDRAFT_476888 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65390.1| hypothetical protein ARALYDRAFT_476888 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   393 bits (1010),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 235/312 (75%), Gaps = 18/312 (6%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWSYTW  AAVG TN+C+ RVD  +I + I+++ VTHMC AP+VLNML NY      
Sbjct  237   HANGWSYTWATAAVGATNICVTRVDAPTIFNLIDKYQVTHMCAAPMVLNMLTNYPGQ---  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL SPV ++TAGAPPPA V+ + ++LGF V HGYG+TETGGL V+CAWK EWD L    
Sbjct  294   KPLQSPVKVMTAGAPPPATVISKAKALGFDVGHGYGMTETGGLVVSCAWKPEWDRLEPDA  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQG+++  F   DV  P +GK VK DG  VGEIV +G SVMLGY KDPEGT+  
Sbjct  354   RAKLKSRQGIKTAVFAEVDVRDPLSGKGVKHDGATVGEIVFKGGSVMLGYYKDPEGTAAS  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M+ED WFYTGD+GV+HPDGY+EVKDR KDV+I GGEN+SS+E+E+VLY +PA+ EAAVVA
Sbjct  414   MREDRWFYTGDIGVMHPDGYLEVKDRSKDVVICGGENISSMELEAVLYTNPAIKEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             +PDK WGETPCAF+               REFCK +LP +MVPR VVF+  LPKTSTGKI
Sbjct  474   KPDKMWGETPCAFI---------------REFCKTKLPKYMVPRNVVFLEELPKTSTGKI  518

Query  335   QKFLLRDIARDL  300
             QKFLLR IA+ L
Sbjct  519   QKFLLRQIAKSL  530



>ref|NP_001152382.1| AMP-binding protein [Zea mays]
 gb|ACG47332.1| AMP-binding protein [Zea mays]
Length=554

 Score =   391 bits (1005),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 240/314 (76%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD A +   I   GV+H+CGAPVVLNMLAN       
Sbjct  234   HANGWSFPWGMAVVGGTNVCLRRVDAAEVYATIAGRGVSHLCGAPVVLNMLANAPEGVR-  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V ILTAGAPPPAAVL R ES+GF V HGYGLTET GL V CAWK EW+ LPA E
Sbjct  293   RPLPGKVRILTAGAPPPAAVLHRTESIGFEVIHGYGLTETAGLVVCCAWKGEWNKLPASE  352

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+ G    D+V   TG SV  DG+ +GEIVL G  VMLGYL D +     
Sbjct  353   RARLKARQGVRTPGMAEVDIVDGETGXSVPXDGSXMGEIVLXGGCVMLGYLDDDKAXKXA  412

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++++GWFYTGDVGV+HPDGY+E++DR KDVII GGEN+SSVEVESVLY HPAV+EAAVVA
Sbjct  413   IRDNGWFYTGDVGVMHPDGYMEIRDRSKDVIIXGGENISSVEVESVLYSHPAVNEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFVSLK+      T  ++  +C++R+P +MVPR VVF   LPKTSTGKI
Sbjct  473   RPDDFWGETPCAFVSLKE---EGSTAADVIAWCRQRMPHYMVPRTVVFRDELPKTSTGKI  529

Query  335   QKFLLRDIARDLSS  294
             QK++LR++A+++ S
Sbjct  530   QKYVLRNLAKEMGS  543



>gb|KFK42034.1| hypothetical protein AALP_AA2G203300 [Arabis alpina]
Length=534

 Score =   389 bits (999),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 245/315 (78%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW   + +AAVGGTNVCLR++    I   I  HGVTHMCGAPVVLNML + +     
Sbjct  220   HANGWCLPYSIAAVGGTNVCLRKLQTPLIYRLIRHHGVTHMCGAPVVLNMLTSSHQ----  275

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L SPV  LTAG+ PP  V+ R ESLGF +SHGYGLTET G+ V+CAWK EW+ LP+ E
Sbjct  276   KSLKSPVHFLTAGSSPPEPVILRAESLGFIISHGYGLTETAGVIVSCAWKPEWNRLPSSE  335

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             R  +K RQGVR++GF+  DVV P +G+SV RDG+ VGEIV+RG+SVMLGYLKD  GT + 
Sbjct  336   RTRLKIRQGVRTIGFSEIDVVDPDSGRSVNRDGSTVGEIVMRGSSVMLGYLKDQTGTKRV  395

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGD+GV++ DGY+E+KDR KDVII+GGEN+SSVEVE+VLY +P V+EAAVVA
Sbjct  396   FK-NGWFLTGDIGVVYKDGYLEIKDRSKDVIITGGENVSSVEVEAVLYTNPVVNEAAVVA  454

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             R D++WGETPCAFVSLK G+  K TE+E+ E+C++++P +MVP+ V+F+  LPKTSTGKI
Sbjct  455   RTDEYWGETPCAFVSLKTGLNRKVTEEEIIEYCRKKMPHYMVPKTVLFLDELPKTSTGKI  514

Query  335   QKFLLRDIARDLSSA  291
              KF L++I ++L S 
Sbjct  515   PKFKLKEIVKNLGST  529



>gb|EMT04966.1| Medium-chain-fatty-acid--CoA ligase [Aegilops tauschii]
Length=556

 Score =   383 bits (984),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/312 (60%), Positives = 244/312 (78%), Gaps = 2/312 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANG S+ WGMA VGGTN+CLRRVD A +   I R+GVTH+C +P+VLN+LAN       
Sbjct  238   HANGSSFPWGMAMVGGTNICLRRVDAAEVYATIARNGVTHLCASPMVLNVLANAPEGVRR  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              P    V +LT GA PPAAVL++ E++GF+VSHGYGL+ETGGL V+C WK EW+ LPAPE
Sbjct  298   LPAAGNVRVLTGGAQPPAAVLEQAEAVGFQVSHGYGLSETGGLVVSCVWKEEWNKLPAPE  357

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR+     AD++H  TG+SV RDG+ +GEIVLRG+ VMLGYL D + T   
Sbjct  358   RARLKARQGVRTPVMAEADILHNETGRSVPRDGSTMGEIVLRGSCVMLGYLNDDKATEAA  417

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++EDGWF+TGD+GV+HPDGY+E++DR KDVI+SGG+N+SS+EVES LY HPAV+EAAV+A
Sbjct  418   IREDGWFHTGDIGVMHPDGYLEIRDRSKDVIVSGGDNISSMEVESALYGHPAVNEAAVLA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+  GE PCAFVSLK+G  +  T  E+  + +E +P FMVP+ VVF A LPKTSTGK+
Sbjct  478   RPDESLGEAPCAFVSLKEG--STVTAGELIAWSRECMPHFMVPKTVVFRAELPKTSTGKM  535

Query  335   QKFLLRDIARDL  300
             +K++LRD+A ++
Sbjct  536   KKYVLRDLANEM  547



>ref|XP_003580813.1| PREDICTED: probable acyl-activating enzyme 5, peroxisomal [Brachypodium 
distachyon]
Length=576

 Score =   377 bits (969),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 244/321 (76%), Gaps = 11/321 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA  GGTNVCLRRVD   +  AI +H V+H+CGAPVVLNMLAN    A  
Sbjct  240   HANGWSFPWGMAVAGGTNVCLRRVDAREVYAAIAQHRVSHLCGAPVVLNMLANAPESAR-  298

Query  1055  KPL---TSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWK-REWDNL  888
             +PL      V ILTAGAPPPAAVL R E+LGF VSHGYGLTET GL ++CAWK  +W+ L
Sbjct  299   RPLPEGAHKVRILTAGAPPPAAVLGRTEALGFDVSHGYGLTETAGLVISCAWKGDQWNKL  358

Query  887   PAPERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEG  708
             PA ERA +K+RQGVR+ G    D+V   TG+SV RDG  +GEIVLRG  + LGY KD   
Sbjct  359   PASERARLKARQGVRTPGMAEVDIVDAVTGRSVPRDGATMGEIVLRGGCLTLGYYKDEAA  418

Query  707   TSKCMK-----EDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHP  543
             T   ++     E+GWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVE+VLY HP
Sbjct  419   TRAAIRGTGAGEEGWFYTGDVGVMHPDGYLEIRDRSKDVIISGGENISSVEVEAVLYGHP  478

Query  542   AVDEAAVVARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAA  363
             AVDEAAVVARPD+FWGETPCAF+SLKK  +   T +E+  + +ER+  +MVP+ VVF   
Sbjct  479   AVDEAAVVARPDEFWGETPCAFLSLKKKGV-NVTAEEVIAWSRERMAGYMVPKTVVFRDE  537

Query  362   LPKTSTGKIQKFLLRDIARDL  300
             LPKTSTGK+QKF+LR++A ++
Sbjct  538   LPKTSTGKVQKFVLRNMASEM  558



>ref|XP_002521742.1| AMP dependent ligase, putative [Ricinus communis]
 gb|EEF40552.1| AMP dependent ligase, putative [Ricinus communis]
Length=261

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/256 (68%), Positives = 211/256 (82%), Gaps = 2/256 (1%)
 Frame = -2

Query  1052  PLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPER  873
             PL SPV ILTAGAPPPAAVL R ESLGF VSHGYGLTET G+ V+CAWK +W+ LP  ER
Sbjct  4     PLKSPVHILTAGAPPPAAVLLRTESLGFVVSHGYGLTETAGVVVSCAWKPKWNMLPENER  63

Query  872   AAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKCM  693
             A +++RQGV+  GFT  DV+ P TG SVKRDG  +GEIVLRG SVM+GYLKDP+GTSKC+
Sbjct  64    ARLRARQGVKIAGFTEMDVIDPKTGLSVKRDGLSLGEIVLRGGSVMMGYLKDPDGTSKCL  123

Query  692   KED--GWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
             KED  GW YTGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVESVLY +P V+EAAVV
Sbjct  124   KEDDDGWLYTGDVGVMHPDGYLEIKDRSKDVIISGGENISSVEVESVLYSNPVVNEAAVV  183

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             ARPD++WGE PCAFVSLK G+  + +EK++ E+C+ER+  +M P+ VVF   LPKTSTGK
Sbjct  184   ARPDEYWGERPCAFVSLKDGVTERVSEKDIIEYCRERMAHYMAPKTVVFQDELPKTSTGK  243

Query  338   IQKFLLRDIARDLSSA  291
             IQK  LR+IA+ + ++
Sbjct  244   IQKLALREIAKAMGAS  259



>ref|XP_010541976.1| PREDICTED: probable acyl-activating enzyme 10 [Tarenaya hassleriana]
Length=543

 Score =   375 bits (964),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/308 (61%), Positives = 230/308 (75%), Gaps = 6/308 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPAS-INDAIERHGVTHMCGAPvvlnmlanynnyaN  1059
             HANGW+YTWGMAAVGG NVC+RR D +  + D +E+H VTHMC AP +LN L  +     
Sbjct  237   HANGWTYTWGMAAVGGKNVCMRRPDVSQEVFDLMEKHDVTHMCAAPELLNRLVIHRKE--  294

Query  1058  TKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAP  879
              +PL  PV ++T G+ P    +   ESLGF VSHGYG+TE GG+  +CAWK EW+ L A 
Sbjct  295   -RPLKKPVRVMTGGSSPKK--ISEYESLGFDVSHGYGMTEVGGMMTSCAWKPEWNVLDAM  351

Query  878   ERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             ERA +KSRQGVR++G +  DV+ P TG+S+K DG   GEIV+RG  +MLGY K+PEGT++
Sbjct  352   ERARLKSRQGVRTLGISEVDVIDPETGESLKHDGVSQGEIVVRGMGMMLGYYKNPEGTAE  411

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
             CMK DGWFYTGD+GVIH D YIE+K R KDVII GGEN++S+EVE+VL MHP V EAAVV
Sbjct  412   CMKSDGWFYTGDLGVIHEDNYIEIKGRSKDVIICGGENINSIEVETVLCMHPNVKEAAVV  471

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             ARPD FWGE   AFV LK G   K  EKE+R+ CKE+LP +MVPR V F+  LPKT+TGK
Sbjct  472   ARPDSFWGEVAYAFVCLKDGRGGKVNEKEIRDHCKEKLPSYMVPRDVEFVEDLPKTATGK  531

Query  338   IQKFLLRD  315
             IQKF+LR+
Sbjct  532   IQKFILRE  539



>ref|XP_006434308.1| hypothetical protein CICLE_v10003208mg [Citrus clementina]
 gb|ESR47548.1| hypothetical protein CICLE_v10003208mg [Citrus clementina]
Length=511

 Score =   371 bits (952),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 233/316 (74%), Gaps = 24/316 (8%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS+TWG AAVG TNVCLR+ D  ++   I +HGVTHMCGAP+VLN+L++       
Sbjct  211   HNNGWSFTWGAAAVGATNVCLRKFDAPTVFALIRKHGVTHMCGAPIVLNLLSSSPE---A  267

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ILTAG+PPPA VL R ESLGF VSHGYG+TE       C            E
Sbjct  268   KPLDRPVHILTAGSPPPAPVLLRTESLGFIVSHGYGITED------CC-----------E  310

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGVR++G T  D+V P TG SVKRDG   GEIV+RG S+MLGYLKDPE TSKC
Sbjct  311   RARLKARQGVRTIGLTEVDIVDPKTGLSVKRDGLTRGEIVMRGGSLMLGYLKDPEATSKC  370

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             MK DG +YTGDVGV+HPDGY+E+KDR KDVIISGGEN+SS E+ESVLY HP V+EAAVV 
Sbjct  371   MK-DGRYYTGDVGVMHPDGYLEIKDRSKDVIISGGENISSAEIESVLYSHPVVNEAAVVG  429

Query  515   RPDKFWGETPCAFVSLKKGIIA---KPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
             RPD FW E PCAFVSLK G  +     TEK++ ++C+ R+P +MVP+ VV +  LPKT+T
Sbjct  430   RPDPFWQEIPCAFVSLKTGTDSGGMMTTEKDIIQYCRARIPRYMVPKTVVIIDELPKTAT  489

Query  344   GKIQKFLLRDIARDLS  297
              K+QK++LRDIA  +S
Sbjct  490   RKVQKYVLRDIANSMS  505



>ref|XP_006653021.1| PREDICTED: probable acyl-activating enzyme 6-like [Oryza brachyantha]
Length=548

 Score =   372 bits (955),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 201/326 (62%), Positives = 234/326 (72%), Gaps = 15/326 (5%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGWS+ WGMA VGGTNVCLRRVD A + D I R  VTH+CGAPVVLNMLAN       
Sbjct  234   HANGWSFPWGMAVVGGTNVCLRRVDAAEVYDTIARRRVTHLCGAPVVLNMLANAAEGVR-  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ILTAGAPPPAAVL R E++GF VSHGYGLTET GL ++CAWK EWD LPA  
Sbjct  293   KPLPGKVRILTAGAPPPAAVLSRTEAIGFEVSHGYGLTETAGLVLSCAWKGEWDRLPA--  350

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEI-VLRGNSVMLGYLKDPEGTSK  699
                      V  +    ADV    T  SV RDG  VGEI VLRG  V LGYL D   T  
Sbjct  351   --------SVSVLSLADADVKDAKTMVSVPRDGKTVGEIIVLRGGCVTLGYLNDEAATKA  402

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
              ++++GWFYTGDVGV+HPDGY+E++DR KDVIISGGEN+SSVEVESVLY HPAV+EAAVV
Sbjct  403   AIRDNGWFYTGDVGVMHPDGYLEIRDRSKDVIISGGENISSVEVESVLYGHPAVNEAAVV  462

Query  518   ARPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRKVVFMAALPKTS  348
             ARPD+FWGETPCAFVSLK+         T  E+  + +ER+P +MVPR VVF   LPKTS
Sbjct  463   ARPDEFWGETPCAFVSLKQQQQGGGGAVTAAEVIAWSRERMPRYMVPRTVVFRDELPKTS  522

Query  347   TGKIQKFLLRDIARDLSSADAINANQ  270
             TGKIQK++LR+IA+++  +   N+  
Sbjct  523   TGKIQKYVLRNIAKEMGPSTNRNSKM  548



>ref|XP_006855572.1| hypothetical protein AMTR_s00044p00031990 [Amborella trichopoda]
 gb|ERN17039.1| hypothetical protein AMTR_s00044p00031990 [Amborella trichopoda]
Length=584

 Score =   367 bits (943),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 234/321 (73%), Gaps = 5/321 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      I  AI  HGVTHMC AP++ N+L N  +    
Sbjct  238   HCNGWTFTWGIAARGGTNVCMRNTTAPDIYRAISEHGVTHMCAAPIIFNLLLNPADEHRL  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K    PV ILT GAPPPA++L ++E LGF ++H YG+TE  G A+ C W  EWD LP+ E
Sbjct  298   K---KPVRILTGGAPPPASLLDQIERLGFHITHAYGMTEATGPALVCEWLSEWDRLPSKE  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             R+ IK+RQG+  +    ADVV+P T +SV+ DG+ +GEI+LRG+SVM GY KDP+ T++ 
Sbjct  355   RSQIKARQGISVLSLADADVVNPETMQSVRHDGHTMGEIILRGSSVMKGYFKDPKATTEA  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K  GWF+TGD+ VIHPDGY+E+KDRLKDVIISGGEN+SSVEVESVLY HP + E AVVA
Sbjct  415   FK-GGWFHTGDMAVIHPDGYVEIKDRLKDVIISGGENISSVEVESVLYRHPKIAEVAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
              P+  WGE+PCAFVSLKKG     +E+E+  FC+ ++  + +P+KVVF+  LPKT TGKI
Sbjct  474   MPNHHWGESPCAFVSLKKG-SKDLSEEELISFCRTKMAGYKLPKKVVFLGELPKTGTGKI  532

Query  335   QKFLLRDIARDLSSADAINAN  273
             +KF LR+ A+D ++ +  + N
Sbjct  533   RKFQLREWAKDFATHNPSHPN  553



>ref|XP_011043893.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Populus 
euphratica]
Length=584

 Score =   365 bits (938),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 232/316 (73%), Gaps = 5/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      +  +I  H VTHMC AP+V N+L     +   
Sbjct  231   HCNGWTFTWGVAARGGTNVCIRNTSAKDMYQSIAAHKVTHMCCAPIVFNILLEAKPHER-  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + +TSPV+ILT GAPPPA++L+++ESLGF V+H YGLTE  G A+ C W+ +W+ LP P+
Sbjct  290   REITSPVEILTGGAPPPASLLEKIESLGFHVTHAYGLTEATGPALVCEWQTKWNKLPQPD  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +    AD+    T  S+ RDG  +GEIVLRG+S+M GY KDPE TSK 
Sbjct  350   QAKLKARQGISILTLADADIKDLDTMASMPRDGKTMGEIVLRGSSIMKGYFKDPEATSKA  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+ESVLY HP V EAAVVA
Sbjct  410   FR-NGWFVTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELESVLYRHPRVLEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKK---GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+KK   G      E E+  +C++ LP FM+P++V FMA LPKTST
Sbjct  469   MPHPKWGESPCAFISVKKNSSGETNDVKESEIIAYCRQNLPHFMIPKRVEFMAELPKTST  528

Query  344   GKIQKFLLRDIARDLS  297
             GKIQKF LR++A+ L+
Sbjct  529   GKIQKFQLREVAKTLA  544



>gb|KHN39514.1| Putative acyl-activating enzyme 6 [Glycine soja]
Length=516

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 224/314 (71%), Gaps = 41/314 (13%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW++ WG+AA GGTN+C R++D  +I   IE H VTHMC APVVLNML        T
Sbjct  232   HSNGWTFPWGIAAAGGTNICARKIDAPTIYRLIESHNVTHMCAAPVVLNMLLTR-----T  286

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +P+ +PV +LT G+PPPAA+L R E LGFRVSHGYG+TET G+ V+CAWK+EWD  P+ E
Sbjct  287   EPVKNPVHVLTGGSPPPAAILTRAEELGFRVSHGYGMTETLGVVVSCAWKKEWDKFPSTE  346

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA  K+RQGVR+V  T                                   +D EGT +C
Sbjct  347   RARFKARQGVRTVAMT-----------------------------------EDIEGTKRC  371

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ + W YTGDVGV+H DGY+E+KDR KDVIISGGENLSSVEVESVLY HPAV+E AVVA
Sbjct  372   IR-NNWLYTGDVGVMHGDGYLEIKDRSKDVIISGGENLSSVEVESVLYGHPAVNEVAVVA  430

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+FWGETPCAFV LK+G++A P+EKE+ EFC+ERLP FMVP+ VVF  ALPKTSTGKI
Sbjct  431   RPDEFWGETPCAFVMLKEGLVAPPSEKELVEFCRERLPHFMVPKTVVFKEALPKTSTGKI  490

Query  335   QKFLLRDIARDLSS  294
             QK +LR  A+ + S
Sbjct  491   QKHVLRMNAKAMGS  504



>ref|XP_002521696.1| AMP dependent ligase, putative [Ricinus communis]
 gb|EEF40683.1| AMP dependent ligase, putative [Ricinus communis]
Length=480

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 231/314 (74%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H+NGW  TWGMAA GGTN+C+R+V P +I D+I +H VTHM GAP VLNM+ N       
Sbjct  171   HSNGWCLTWGMAAQGGTNICIRKVTPNAIFDSIGQHNVTHMGGAPTVLNMIVNSPVSDR-  229

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L   V+I+T GAPPP  ++ ++E LGF VSH YGLTET G    CAWK EWD+LP  E
Sbjct  230   RTLPHKVEIMTGGAPPPPQIIFKMEELGFGVSHLYGLTETYGPGTYCAWKPEWDSLPPDE  289

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQG+  +G    DV  P T +SV  DG  +GE+V RGN++M GYLKD + T + 
Sbjct  290   RAKVKARQGIHHLGLEDVDVRDPMTQESVPADGKTIGEVVFRGNTIMSGYLKDLKATEEA  349

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               + GWF +GD+ V HPDGYIEVKDRLKD+IISGGEN+S+VEVE+VLY HPA+ EAAVVA
Sbjct  350   F-QGGWFRSGDLAVKHPDGYIEVKDRLKDIIISGGENISTVEVETVLYSHPAIFEAAVVA  408

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WG+TPCAFV LK+G +   +E+++ +FC++RLP +M PR V+F   LP+TSTGK+
Sbjct  409   RPDDHWGQTPCAFVKLKEGFVV--SEQDIIKFCRDRLPHYMAPRTVIF-EDLPRTSTGKV  465

Query  335   QKFLLRDIARDLSS  294
             QKF+LR+ A+ + S
Sbjct  466   QKFILREKAKTMGS  479



>ref|XP_010062333.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Eucalyptus 
grandis]
 gb|KCW69461.1| hypothetical protein EUGRSUZ_F02917 [Eucalyptus grandis]
Length=590

 Score =   360 bits (925),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 228/322 (71%), Gaps = 5/322 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR    A +   I  HGVTHMC AP++ N+L     +   
Sbjct  235   HCNGWTFTWGIAARGGTNVCLRNPTAADMYRNIAAHGVTHMCCAPIIFNILLEAKPHERR  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +  T PV++LT GAPPPAA+LQ++ESLGF V+H YGLTE  G A+ C W+  WD LPA E
Sbjct  295   ENAT-PVEVLTGGAPPPAALLQKIESLGFHVTHAYGLTEATGPALVCEWQTRWDRLPAAE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +     DV H  T +SV RDG  +GEIVLRG+S+M GY KDP  TSK 
Sbjct  354   QAQLKARQGISILTLADVDVKHSQTMRSVPRDGKTMGEIVLRGSSIMKGYYKDPVETSKA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + +GWF+TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVE+VLY HP V EAAVVA
Sbjct  414   FR-NGWFFTGDVGVIHPDGYMEIKDRSKDVIISGGENISSVEVENVLYRHPRVREAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAFV++KK    K     E E+  +C++ LP FMVP+KV FMA LPK  T
Sbjct  473   MPHPRWGESPCAFVAVKKNSAGKTDDVKEAEIISYCRKNLPHFMVPKKVEFMAELPKIPT  532

Query  344   GKIQKFLLRDIARDLSSADAIN  279
             GKI K  LR +A+    +++ N
Sbjct  533   GKILKAQLRAVAKKFVVSESNN  554



>ref|XP_003578618.1| PREDICTED: benzoate--CoA ligase, peroxisomal-like [Brachypodium 
distachyon]
Length=572

 Score =   360 bits (923),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 226/313 (72%), Gaps = 5/313 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GG NVC+R     ++  A+  HGVTHMC APV+ N+L +       
Sbjct  240   HCNGWTFTWGVAARGGANVCVRAPTAQAMYSAVVAHGVTHMCAAPVLFNVLLDDAP---P  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL   V++LT GAPPPAA+L+RVE LGF V+H YG+TE  G A+ C W+  WD LP PE
Sbjct  297   APLPRRVEVLTGGAPPPAALLERVEKLGFHVTHAYGMTEATGPAMVCEWRERWDALPPPE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV ++   GA V    T  SV RDG  +GEIVLRG+SVM GY KDP+ T+  
Sbjct  357   RALLKARQGVSALSLAGAGVKDLQTMASVPRDGATMGEIVLRGSSVMKGYYKDPKATAAA  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              +  GWF TGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVE+ LY HPAV EAAVVA
Sbjct  417   FRA-GWFLTGDVGVVHPDGYVEIKDRSKDVIISGGENISSVEVEAALYGHPAVREAAVVA  475

Query  515   RPDKFWGETPCAFVSLKKGIIA-KPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
              P + WGETPCAFV+LKK   A + +E+E+  FC+ ++  FMVPRKVVFM  LPK +TGK
Sbjct  476   MPHRHWGETPCAFVALKKEFSAGEVSEEEVVSFCRNKMAHFMVPRKVVFMDELPKNATGK  535

Query  338   IQKFLLRDIARDL  300
             +QK  LR+ AR L
Sbjct  536   VQKLALRERARGL  548



>ref|XP_002305237.1| hypothetical protein POPTR_0004s08030g [Populus trichocarpa]
 gb|ABK95768.1| unknown [Populus trichocarpa]
 gb|EEE85748.1| hypothetical protein POPTR_0004s08030g [Populus trichocarpa]
Length=584

 Score =   358 bits (920),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 230/316 (73%), Gaps = 5/316 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      +  +I  H VTHMC AP+V N+L     +   
Sbjct  231   HCNGWTFTWGVAARGGTNVCIRNTSAKDMYQSIADHKVTHMCCAPIVFNILLEAKPHER-  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + +TSPV+ILT GAPPPA++L+++ESLGF V+H YGLTE  G A+ C W+ +W+ LP  +
Sbjct  290   REITSPVEILTGGAPPPASLLEKIESLGFHVTHAYGLTEATGPALVCEWQTKWNKLPQQD  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             ++ +K+RQG+  +    AD+    T  S+ RDG  +GEIVLRG+S+M GY KDPE TSK 
Sbjct  350   QSKLKARQGISILTLADADIKDLDTMASMPRDGKTMGEIVLRGSSIMKGYFKDPEATSKA  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+ESVLY HP V EAAVVA
Sbjct  410   FR-NGWFVTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELESVLYRHPRVLEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKK---GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+KK   G      E E+  +C++ LP FM+P++V FM  LPKTST
Sbjct  469   MPHPKWGESPCAFISVKKNSNGETNDVKESEIIAYCRKNLPRFMIPKRVEFMPELPKTST  528

Query  344   GKIQKFLLRDIARDLS  297
             GKIQKF LR++A++ +
Sbjct  529   GKIQKFQLREVAKNFA  544



>gb|EAZ10040.1| hypothetical protein OsI_32344 [Oryza sativa Indica Group]
Length=577

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 228/314 (73%), Gaps = 6/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R     ++  A   HGVTHMC APV+ N+L +       
Sbjct  242   HCNGWTFTWGVAARGGTNVCIRAPTADAMYAAFAAHGVTHMCAAPVLFNILLDGACR---  298

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV++LT GAPPPAA+L+RVE LGF V+H YG+TE  G+ + C W+ +WD LP  E
Sbjct  299   EPLRRPVEVLTGGAPPPAALLERVERLGFHVTHAYGMTEATGVVMVCEWREQWDALPPSE  358

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV ++    ADV    T +SV RDG  +GE+VLRG++VM GY K+P  T+  
Sbjct  359   RARLKARQGVSALTLADADVKDLKTMESVPRDGATMGEVVLRGSNVMKGYFKNPRATADA  418

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + DGWF TGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVE+ LY HPAV EAAVVA
Sbjct  419   FR-DGWFLTGDVGVVHPDGYVEIKDRSKDVIISGGENISSVEVEAALYQHPAVREAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGI--IAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
              P   WGETPCAFV+LK+      + +E+E+  FC+ R+  +MVPRKVVF+  LPK STG
Sbjct  478   MPHPHWGETPCAFVALKREFAGAGEVSEQEVVSFCRNRMAHYMVPRKVVFVDELPKNSTG  537

Query  341   KIQKFLLRDIARDL  300
             K+QK  LRD+AR L
Sbjct  538   KVQKLALRDMARRL  551



>ref|NP_001063895.1| Os09g0555800 [Oryza sativa Japonica Group]
 dbj|BAF25809.1| Os09g0555800 [Oryza sativa Japonica Group]
 gb|EAZ45624.1| hypothetical protein OsJ_30291 [Oryza sativa Japonica Group]
Length=577

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 228/314 (73%), Gaps = 6/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R     ++  A   HGVTHMC APV+ N+L +       
Sbjct  242   HCNGWTFTWGVAARGGTNVCIRAPTADAMYAAFAAHGVTHMCAAPVLFNILLDGACR---  298

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL  PV++LT GAPPPAA+L+RVE LGF V+H YG+TE  G+ + C W+ +WD LP  E
Sbjct  299   EPLRRPVEVLTGGAPPPAALLERVERLGFHVTHAYGMTEATGVVMVCEWREQWDALPPSE  358

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV ++    ADV    T +SV RDG  +GE+VLRG++VM GY K+P  T+  
Sbjct  359   RARLKARQGVSALTLADADVKDLKTMESVPRDGATMGEVVLRGSNVMKGYFKNPRATADA  418

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + DGWF TGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVE+ LY HPAV EAAVVA
Sbjct  419   FR-DGWFLTGDVGVVHPDGYVEIKDRSKDVIISGGENISSVEVEAALYQHPAVREAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGI--IAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
              P   WGETPCAFV+LK+      + +E+E+  FC+ R+  +MVPRKVVF+  LPK STG
Sbjct  478   MPHPHWGETPCAFVALKREFAGAGEVSEQEVVSFCRNRMAHYMVPRKVVFVDELPKNSTG  537

Query  341   KIQKFLLRDIARDL  300
             K+QK  LRD+AR L
Sbjct  538   KVQKLALRDMARRL  551



>ref|XP_011038309.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Populus 
euphratica]
Length=586

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 231/325 (71%), Gaps = 5/325 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      +   I  H VTHMC AP+V N+L     +   
Sbjct  231   HCNGWTFTWGVAARGGTNVCIRNTSAQDMYHNIAEHAVTHMCCAPIVFNVLLEARPHER-  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + +TSPV+ILT GAPPPA++LQ++E LGF V+H YGLTE  G A+ C W+++W+ LP  +
Sbjct  290   REITSPVEILTGGAPPPASLLQKIERLGFHVTHAYGLTEATGPALVCEWQKKWNKLPQQD  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +    ADV    T  SV RDG  +GEIVLRG+S+M GY KDP  TSK 
Sbjct  350   QAKLKARQGISILTLADADVKDLDTMVSVPRDGKTMGEIVLRGSSIMKGYFKDPAATSKA  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+ESVLY HP V EAAVVA
Sbjct  410   FR-NGWFATGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELESVLYRHPRVLEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKK---GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+KK   G      E ++  +CK+ LP F VP++V FMA LPKTST
Sbjct  469   MPHPKWGESPCAFISVKKNSNGDTNDVKESDIIAYCKKNLPHFTVPKRVEFMAELPKTST  528

Query  344   GKIQKFLLRDIARDLSSADAINANQ  270
             GKIQKF LR +A++    + + +N+
Sbjct  529   GKIQKFQLRALAQNFVVTEILPSNK  553



>ref|XP_008792163.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Phoenix 
dactylifera]
Length=578

 Score =   358 bits (918),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 225/323 (70%), Gaps = 3/323 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWGMAA GG N+C+R      +  AI  H VTHMC AP+V N+L   +     
Sbjct  233   HCNGWTFTWGMAARGGANICIRATTARDMYRAIADHHVTHMCSAPIVFNILLEASPAER-  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L +PV +LT GAPPPA +L+++E LGFRVSH YGLTE  G A+ C W+ EW++ PA E
Sbjct  292   RTLAAPVSVLTGGAPPPAPLLEKIERLGFRVSHAYGLTEATGPALVCEWREEWNHRPAHE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQG+  +     DV    T +SV RDGN +GEIVLRG+S+M GY K+ E T   
Sbjct  352   QAWLKSRQGISVLTLADVDVKDVETMRSVPRDGNTLGEIVLRGSSIMKGYYKNREATDAA  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + DGWF TGDVGVIH DGY+E+KDR KDVIISGGEN+SSVEVE++LY HP V EAAVVA
Sbjct  412   FR-DGWFLTGDVGVIHTDGYVEIKDRSKDVIISGGENISSVEVETILYRHPMVLEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPT-EKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
              P   WGETPCAF+ LKK   A    E+++  +C+  +  FMVP+KVVFM  LPKTSTGK
Sbjct  471   MPHPHWGETPCAFLKLKKECEAGSIREEDIISYCRNSMSRFMVPKKVVFMEELPKTSTGK  530

Query  338   IQKFLLRDIARDLSSADAINANQ  270
             IQKFLLR+ AR L   +    NQ
Sbjct  531   IQKFLLRETARGLKVTETQGKNQ  553



>ref|XP_010105803.1| Butyrate--CoA ligase AAE11 [Morus notabilis]
 gb|EXC06271.1| Butyrate--CoA ligase AAE11 [Morus notabilis]
Length=574

 Score =   357 bits (917),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 229/313 (73%), Gaps = 3/313 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      IN +I  HGVTHMC AP+V N+L +       
Sbjct  236   HCNGWTFTWGVAARGGTNVCLRNTTAYDINRSIALHGVTHMCCAPIVFNILLDAKPTER-  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + + SPV+ILT GAPPPA +L+++ESLGF V+H YGLTE  G A+ C W+ +W++LP  +
Sbjct  295   RHILSPVEILTGGAPPPAPLLEKIESLGFHVTHAYGLTEATGPALVCEWQAQWNDLPKED  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A IK+RQG+  +     DV    T KSV +DG  +GEIVLRG+S+M GYLKD E T+K 
Sbjct  355   QARIKARQGISILTLAEVDVKDLKTMKSVPKDGKTMGEIVLRGSSIMKGYLKDTEATAKA  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVESVLY HP V EAAVVA
Sbjct  415   FK-NGWFLTGDVGVVHPDGYLEIKDRSKDVIISGGENISSVEVESVLYRHPKVLEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
              P   WGE+PCAFV+LK G     +E ++  +C++ +P FMVP+KV F+  LPKTSTGK+
Sbjct  474   MPHLRWGESPCAFVALKNG-GGGISETDIISYCRKNMPHFMVPKKVEFLKELPKTSTGKV  532

Query  335   QKFLLRDIARDLS  297
             QKF LR +A+  +
Sbjct  533   QKFELRALAKTFT  545



>ref|XP_010270776.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Nelumbo 
nucifera]
Length=589

 Score =   357 bits (917),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 225/319 (71%), Gaps = 10/319 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      +  AI  H VTHMC AP+V N+L         
Sbjct  239   HCNGWTFTWGVAARGGTNVCIRNTCAVEMYRAIAEHRVTHMCCAPIVFNILLEARPEER-  297

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + + SPV ILT GAPPPA +L+++E LGF V+H YGLTE  G A+ C W+ +WD LP   
Sbjct  298   REIASPVHILTGGAPPPAPLLEKIERLGFHVTHAYGLTEATGPALVCEWQAKWDRLPREH  357

Query  875   RAAIKSRQGVRSVGFTGADVVHP-HTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             +A +K+RQG+  +     DV +   T +SV RDG  VGEIVLRG+S+M GY KDPE TSK
Sbjct  358   QAKLKARQGISVLTLADVDVKNDMETMRSVPRDGQTVGEIVLRGSSIMKGYFKDPEATSK  417

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
                 +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVE+VLY HP V EAAVV
Sbjct  418   AF-HNGWFQTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVEVETVLYKHPKVLEAAVV  476

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMRE-----FCKERLPLFMVPRKVVFMAALPK  354
             A P   WGETPCAF++LKKG  A+ +E+ +RE     +C+  LP FM PRKVV M  LPK
Sbjct  477   AMPHNRWGETPCAFITLKKG--AERSEEAIREADIIAYCRNNLPKFMSPRKVVLMEELPK  534

Query  353   TSTGKIQKFLLRDIARDLS  297
             TSTGKIQKF LR+ A+  +
Sbjct  535   TSTGKIQKFQLREYAKSFT  553



>ref|XP_006372491.1| AMP-dependent synthetase and ligase family protein [Populus trichocarpa]
 gb|ERP50288.1| AMP-dependent synthetase and ligase family protein [Populus trichocarpa]
Length=586

 Score =   357 bits (915),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 226/315 (72%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      +   I  H VTHMC AP+V N+L     +   
Sbjct  231   HCNGWTFTWGVAARGGTNVCIRNTSAKDMYHNIAEHAVTHMCCAPIVFNVLLEARPHER-  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + +TSPV+ILT GAPPPA++LQ +E LGF V+H YGLTE  G A+ C W+++W+ LP  +
Sbjct  290   REITSPVEILTGGAPPPASLLQDIERLGFHVTHAYGLTEATGPALVCEWQKKWNKLPQQD  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +    ADV    T  SV RDG  +GEIVLRG+S+M GY KDPE TSK 
Sbjct  350   QAKLKARQGISILTLADADVKDLDTMVSVPRDGKTMGEIVLRGSSIMKGYFKDPEATSKA  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+ESVLY HP V EAAVVA
Sbjct  410   FR-NGWFATGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELESVLYRHPRVLEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKK---GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+KK   G      E ++  +CK+ LP F VP++V FMA LPKTST
Sbjct  469   MPHPKWGESPCAFISVKKNSNGDTNDVKESDIIAYCKKNLPHFTVPKRVEFMAELPKTST  528

Query  344   GKIQKFLLRDIARDL  300
             GKIQKF LR +A++ 
Sbjct  529   GKIQKFQLRALAQNF  543



>ref|XP_009780397.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal [Nicotiana 
sylvestris]
Length=592

 Score =   357 bits (916),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 224/314 (71%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW  TWG+AA+GGT++CLR+V P  I ++I  H VTH+ GAP +LNM+ N       
Sbjct  281   HCNGWCLTWGLAALGGTSICLRQVSPKVIFESIVEHNVTHLSGAPTILNMIVNSPESDR-  339

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V+I+T G+PPP  +L ++E LGFRV H YGLTET G    C WK EWD+LP  E
Sbjct  340   KPLPHKVNIMTGGSPPPPQILSQMEELGFRVHHLYGLTETYGPGTYCLWKPEWDSLPPNE  399

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +  +K+RQGV+ +     D++ P T K V  DG  +GEIV RGN+VM GYLKD E T + 
Sbjct  400   KYKLKARQGVQHLCSESVDIMDPTTMKKVPEDGKTIGEIVFRGNTVMSGYLKDVEATEEA  459

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K  GWF++GD+ V HPDGYIEVKDRLKD++ISGGEN+S+VEVE VLY HPAV E AVVA
Sbjct  460   FK-GGWFHSGDLAVKHPDGYIEVKDRLKDIVISGGENISTVEVERVLYSHPAVLETAVVA  518

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WG+TPCAFV LK G     T++E+  FC++ LP +M PR V+F   LPKTSTGKI
Sbjct  519   RPDNYWGQTPCAFVKLKDG-FNNITDQEIINFCRDNLPHYMAPRTVIFQ-DLPKTSTGKI  576

Query  335   QKFLLRDIARDLSS  294
             QKF+LRD A+ L S
Sbjct  577   QKFILRDKAKALGS  590



>gb|KDP35706.1| hypothetical protein JCGZ_10478 [Jatropha curcas]
Length=509

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 239/352 (68%), Gaps = 7/352 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR +    +   I  H VTHMC AP+V N++     +   
Sbjct  157   HCNGWTFTWGIAARGGTNVCLRNITAYDMFRNISLHKVTHMCCAPIVFNIILEAKPHER-  215

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + +TSPV++LT GAPPP ++L+++E LGF V+H YGLTE  G A+ C W+ +W+ LP  E
Sbjct  216   RQITSPVEVLTGGAPPPPSLLEKIEPLGFHVTHAYGLTEATGPALVCEWQEKWNQLPVQE  275

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQG+  +     DV    T  SV RDG  +GEIVL+G+S+M GY KDP  TS  
Sbjct  276   QAKLKSRQGLSVLTLADVDVKDLQTMASVPRDGKTMGEIVLKGSSIMKGYYKDPAATSMA  335

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+ESVLY H  + EAAVVA
Sbjct  336   FK-NGWFCTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELESVLYRHTRILEAAVVA  394

Query  515   RPDKFWGETPCAFVSLKK---GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF++LKK   G   +  E ++  +C++ LP FMVP+KVVF+  LPKT+T
Sbjct  395   MPHPVWGESPCAFIALKKNANGKTDELKEDDIIAYCRKNLPGFMVPKKVVFLPELPKTAT  454

Query  344   GKIQKFLLRDIARDL--SSADAINANQNGIGHEINQA*TSFPLIPASEFVLF  195
             GKIQKF LR +A++   S   +I+  + G   ++N+    +   P  + + F
Sbjct  455   GKIQKFQLRTLAQNFQVSKNQSISGKKTGKSDQVNREIAEYGTQPHEQILAF  506



>dbj|BAJ88014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=567

 Score =   355 bits (912),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 224/315 (71%), Gaps = 8/315 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GG NVC+R     ++  AI  HGVTHMC APV+ N+L N +     
Sbjct  232   HCNGWTFTWGIAARGGANVCVRAPTADAMYSAITDHGVTHMCVAPVLFNVLLNAHR----  287

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL   V++LT GAPPPAA+L+RVE LGF V+H YG+TE  G A+ C W+  WD LPAPE
Sbjct  288   DPLPRAVEVLTGGAPPPAALLERVERLGFHVTHAYGMTEATGPAMVCEWRERWDALPAPE  347

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RAA+K+RQGV ++   GADV    T  SV RDG  +GEIVLRG+SVM GY K+PE T   
Sbjct  348   RAALKARQGVSAISLAGADVKDLKTMVSVPRDGTTLGEIVLRGSSVMKGYYKNPEATDAA  407

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              +  GWF TGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVE+ LY HPAV EAAVVA
Sbjct  408   FR-GGWFLTGDVGVVHPDGYVEIKDRSKDVIISGGENISSVEVEAALYGHPAVQEAAVVA  466

Query  515   RPDKFWGETPCAFVSLKKGI---IAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE PCAFV+LKK       +  E+E+  FC+ ++  FMVP KVVF+  LPK +T
Sbjct  467   MPHPHWGEVPCAFVTLKKEFDSGAGEVNEEELVAFCRSKMAHFMVPGKVVFVDELPKNAT  526

Query  344   GKIQKFLLRDIARDL  300
             GK+QK  LR+ AR L
Sbjct  527   GKVQKLALRERARGL  541



>ref|XP_011038310.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Populus 
euphratica]
Length=586

 Score =   355 bits (911),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 178/325 (55%), Positives = 230/325 (71%), Gaps = 5/325 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      +   I  H VTHMC AP+V N+L     +   
Sbjct  231   HCNGWTFTWGVAARGGTNVCIRNTSAQDMYHNIAEHAVTHMCCAPIVFNVLLEARPHER-  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + +TSPV+ILT GAPPPA++LQ++E LGF V+H YGLTE  G A+ C W+++W+ LP  +
Sbjct  290   REITSPVEILTGGAPPPASLLQKIERLGFHVTHAYGLTEATGPALVCEWQKKWNKLPQQD  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +    ADV    T  SV RDG  +GEIVLRG+S+M GY KDP  TSK 
Sbjct  350   QAKLKARQGISILTLADADVKDLDTMVSVPRDGKTMGEIVLRGSSIMKGYFKDPAATSKA  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+ESVLY HP V EAAVVA
Sbjct  410   FR-NGWFATGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELESVLYRHPRVLEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKK---GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+KK   G      E ++  +CK+ LP F VP++V FMA LPK ST
Sbjct  469   MPHPKWGESPCAFISVKKNSNGDTNDVKESDIIAYCKKNLPHFTVPKRVEFMAELPKPST  528

Query  344   GKIQKFLLRDIARDLSSADAINANQ  270
             GKIQKF LR +A++    + + +N+
Sbjct  529   GKIQKFQLRALAQNFVVTEILPSNK  553



>ref|XP_009626677.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal [Nicotiana 
tomentosiformis]
Length=591

 Score =   355 bits (911),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 223/314 (71%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW  TWG+AA+GGT++CLR+V P  I ++I  H VTHM GAP VLNM+ N       
Sbjct  280   HCNGWCLTWGLAALGGTSICLRQVSPKVIFESIVEHKVTHMSGAPTVLNMIVNSPESDR-  338

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V+I+T G+PPP  +L ++E LGFRV H YGLTET G    C WK EWD+LP  E
Sbjct  339   KPLPHKVNIMTGGSPPPPQILSQMEELGFRVHHLYGLTETYGPGTYCLWKPEWDSLPPNE  398

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +  +K+RQGV+ +     D++ P T + V  DG  +GEIV RGN+VM GYLKD E T + 
Sbjct  399   KYKLKARQGVQHLCSESVDIMDPITMEKVPEDGKTIGEIVFRGNTVMSGYLKDVEATEEA  458

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K  GWF++GD+ V HPDGYIEVKDRLKD+IISGGEN+S+VEVE VLY HPAV E AVVA
Sbjct  459   FK-GGWFHSGDLAVKHPDGYIEVKDRLKDIIISGGENISTVEVERVLYSHPAVLETAVVA  517

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WG+TPCAFV LK G      ++E+  FC++ LP +M PR V+F   LPKTSTGKI
Sbjct  518   RPDNYWGQTPCAFVKLKDG-FKNVCDQEIINFCRDNLPHYMAPRSVIFQ-DLPKTSTGKI  575

Query  335   QKFLLRDIARDLSS  294
             QKF+LRD A+ L S
Sbjct  576   QKFILRDKAKALGS  589



>ref|XP_002521699.1| AMP dependent ligase, putative [Ricinus communis]
 gb|EEF40686.1| AMP dependent ligase, putative [Ricinus communis]
Length=544

 Score =   353 bits (905),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 227/310 (73%), Gaps = 5/310 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW  TWG+AA GGTN+C+R+V P +I D+I +H VTHM GAP VLNM+ N       
Sbjct  235   HCNGWCLTWGVAAQGGTNICIRKVTPKAIFDSIGQHNVTHMGGAPTVLNMIVNSPVSDR-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L   V+I+T GAPPP  ++ ++E LGF VSH YGLTET G    CAWK EWD+LP  E
Sbjct  294   RTLPHKVEIMTGGAPPPPQIIFKMEELGFGVSHLYGLTETYGPGTYCAWKPEWDSLPPDE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQG+  +G    DV  P T +SV  DG  +GEIV RGN+VM GYLKD + T + 
Sbjct  354   RAKLKARQGIHHLGLEDVDVRDPMTQESVPADGKTIGEIVFRGNTVMSGYLKDLKATEEA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               + GWF +GD+ V HPDGYIEVKDRLKD+IISGGEN+S+VEVE+VLY HPA+ EAAVVA
Sbjct  414   F-QGGWFRSGDLAVKHPDGYIEVKDRLKDIIISGGENISTVEVETVLYSHPAIFEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WG+TPCAFV LK+G +   +E+++ +FC++RLP +M PR V+F   LP+TSTGK+
Sbjct  473   RPDDHWGQTPCAFVKLKEGFVV--SEQDIIKFCRDRLPHYMAPRTVIF-EDLPRTSTGKV  529

Query  335   QKFLLRDIAR  306
             QKF+LR  A+
Sbjct  530   QKFILRQKAK  539



>ref|XP_004503089.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Cicer 
arietinum]
Length=584

 Score =   353 bits (907),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 181/338 (54%), Positives = 234/338 (69%), Gaps = 12/338 (4%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTN+C+R      I  +IE H VTHMC AP+V N++    N    
Sbjct  241   HCNGWTFTWGVAARGGTNICIRNTLAYDIYRSIELHNVTHMCCAPIVFNIILGAKNSEK-  299

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + + S V+ILT GAPPPA++++++E LGF V+H YGLTE  G A+ C W+++WD LP  E
Sbjct  300   RVIKSKVNILTGGAPPPASLVEKIEELGFHVTHAYGLTEATGPALVCEWQKKWDKLPKAE  359

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             ++ +K+RQGV  +  T  DV +  T +SV RDG  +GEIVL+G+ +M+GY KD E TSK 
Sbjct  360   KSMMKARQGVSVLTLTDVDVKNLETMESVARDGKTLGEIVLKGSGIMMGYFKDSEATSKA  419

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + DGWF TGDVGVIH DGY+E+KDR KDVIISGGEN+SSVEVE+V+Y HP V EAAVVA
Sbjct  420   FR-DGWFRTGDVGVIHCDGYLEIKDRSKDVIISGGENISSVEVENVIYRHPMVLEAAVVA  478

Query  515   RPDKFWGETPCAFVSLKKGI-------IAKPTEKEMREFCKERLPLFMVPRKVVFMAALP  357
              P   WGE+PCAFVSLKK             TE ++  +C++ LP FMVP+KVVFM  LP
Sbjct  479   MPHPKWGESPCAFVSLKKDNDENIKDDHVSVTEDQLIGYCRKNLPHFMVPKKVVFMKELP  538

Query  356   KTSTGKIQKFLLRDIARDLSSADAINANQNGIGHEINQ  243
             KT+TGKIQKF LR  A+     +    N NG   ++NQ
Sbjct  539   KTATGKIQKFGLRVKAKFFVVNE---NNSNGKNSQVNQ  573



>ref|XP_006416292.1| hypothetical protein EUTSA_v10009822mg [Eutrema salsugineum]
 gb|ESQ34645.1| hypothetical protein EUTSA_v10009822mg [Eutrema salsugineum]
Length=452

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 197/247 (80%), Gaps = 2/247 (1%)
 Frame = -2

Query  1031  ILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPERAAIKSRQ  852
             ++T+GAPPPAA++ R ES GF VSH YGLTETGG  V+CAWK EW++L   ERA +KSRQ
Sbjct  206   VMTSGAPPPAAIISRAESSGFNVSHSYGLTETGGPVVSCAWKPEWNHLGPLERARLKSRQ  265

Query  851   GVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKCMKEDGWFY  672
             GVR++GF   DV    TGKSV+ DG   GEIV RG+SVMLGY KDPEGT+ CM+EDGWFY
Sbjct  266   GVRTIGFAEVDVRDRKTGKSVEHDGVSGGEIVFRGSSVMLGYYKDPEGTAACMREDGWFY  325

Query  671   TGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVARPDKFWGE  492
             +GD+GVIH DGY+EVKDR KDVII GGEN+SS EVE+VLY  P V EAAVVA+PDK WGE
Sbjct  326   SGDIGVIHKDGYLEVKDRSKDVIICGGENISSAEVETVLYTKPVVKEAAVVAKPDKMWGE  385

Query  491   TPCAFVSLKKG--IIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKIQKFLLR  318
             TPCAFVSLK    +    TE+E+REFCK +LP +MVPRKV+F   LPKTSTGKI+KFLLR
Sbjct  386   TPCAFVSLKHDYKVDGSVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTGKIRKFLLR  445

Query  317   DIARDLS  297
              +A+ LS
Sbjct  446   QMAKSLS  452



>ref|XP_010940269.1| PREDICTED: benzoate--CoA ligase, peroxisomal-like [Elaeis guineensis]
Length=591

 Score =   353 bits (906),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 227/328 (69%), Gaps = 9/328 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWGMAA GG NVC+R      +  AI  H VTHMC AP+V N+L N       
Sbjct  236   HCNGWTFTWGMAARGGANVCIRATTAREMYRAIADHRVTHMCCAPIVFNILLNATPAER-  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILT GAPPPA +L++++ LGFRV+H YGLTE  G A+ C W++EW++ P  +
Sbjct  295   RPLPTPVSILTGGAPPPAPLLEKIQRLGFRVTHAYGLTEATGPALVCEWRQEWNHRPVHD  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQG+  +     DV    T +SV RDG  +GEIVLRG+S+M GY K+   T   
Sbjct  355   QARLKSRQGISVLTLADVDVKDVQTMRSVPRDGISLGEIVLRGSSIMKGYYKNRAATDAA  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K DGWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVE++LY HP V EAAVVA
Sbjct  415   FK-DGWFLTGDVGVIHPDGYVEIKDRSKDVIISGGENISSVEVETILYRHPMVLEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKK----GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTS  348
              P   WGETPCAF++LK+    G I    E+++  +C+  +  FMVP+KVVFM  LPKTS
Sbjct  474   MPHPHWGETPCAFLTLKRECEQGTI---NEEDIISYCRNSMSRFMVPKKVVFMEELPKTS  530

Query  347   TGKIQKFLLRDIARDLSSADAINANQNG  264
             TGKIQKFLLR+ AR L   D     Q G
Sbjct  531   TGKIQKFLLRETARGLKVTDRNRTPQGG  558



>ref|XP_008804291.1| PREDICTED: benzoate--CoA ligase, peroxisomal-like [Phoenix dactylifera]
Length=590

 Score =   353 bits (906),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 223/314 (71%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWGMAA GG NVC+R      +  AI  H VTHMC AP+V N+L   +     
Sbjct  233   HCNGWTFTWGMAARGGANVCIRATTARDMYRAIGDHRVTHMCCAPIVFNILLEASPAER-  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV +LT GAPPPA +L+++E LGFRV+H YGLTE  G A+ C W+ EW+  P  E
Sbjct  292   RPLIAPVHVLTGGAPPPAPLLEKIERLGFRVTHAYGLTEATGPALVCEWREEWNRRPVDE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +     DV  P T +S+ RDG  +GEIVLRG+S+M GY K+ + T   
Sbjct  352   QARLKARQGISVLTLADVDVKDPETMQSIPRDGKSLGEIVLRGSSIMKGYYKNRDATEAA  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + DGWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVE++LY HP V EAAVVA
Sbjct  412   FR-DGWFLTGDVGVIHPDGYVEIKDRSKDVIISGGENISSVEVETILYQHPMVLEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPT--EKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
              P   WGETPCAF+ LKK    + +  E+++  +C+  +  FMVP+KVVFM  LPKTSTG
Sbjct  471   MPHPHWGETPCAFLKLKKEYCEQGSIQEEDIISYCRNSMSRFMVPKKVVFMEELPKTSTG  530

Query  341   KIQKFLLRDIARDL  300
             KIQKF LR++AR L
Sbjct  531   KIQKFQLREMARGL  544



>ref|XP_003517547.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal-like 
[Glycine max]
 gb|KHN34148.1| Putative acyl-activating enzyme 1, peroxisomal [Glycine soja]
Length=553

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 224/322 (70%), Gaps = 5/322 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW   W +AA GGTNVC R V    I D I +H VTHM GAP VLNM+ N +     
Sbjct  236   HCNGWCLPWAIAAQGGTNVCQRSVTAEGIFDNIFKHKVTHMGGAPTVLNMIINSSPKVQ-  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ++T GAPPP  V+ R+E LGF V+H YGLTET G A  C WK EWDNLP   
Sbjct  295   KPLPGKVQVMTGGAPPPPDVIFRMEELGFNVTHSYGLTETFGPASICTWKPEWDNLPQDA  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGV  VG  G DV  PHT KSV  D   +GE++ RGN+VM GYLKD + T + 
Sbjct  355   QAKLKARQGVAHVGMEGLDVKDPHTMKSVPADAKTMGEVMFRGNTVMNGYLKDLKATQEA  414

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K  GWF+TGD+GV HPDGYIE+KDR KD+IISGGEN+S++E+E V++ HPAV EAAVV 
Sbjct  415   FK-GGWFWTGDLGVKHPDGYIELKDRSKDIIISGGENISTIELEGVIFSHPAVFEAAVVG  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD +WGETPCAFV LK+G  A  T +E+ +FC+ RLP FM PR VVF   LPKTSTGK 
Sbjct  474   RPDDYWGETPCAFVKLKEGCSA--TSEEIIQFCQNRLPRFMAPRTVVF-TDLPKTSTGKT  530

Query  335   QKFLLRDIARDLSSADAINANQ  270
             QKF+LR+ A+ + S    N ++
Sbjct  531   QKFVLREKAKAMGSLTKKNTSR  552



>ref|XP_011096925.1| PREDICTED: LOW QUALITY PROTEIN: butyrate--CoA ligase AAE11, peroxisomal-like 
[Sesamum indicum]
Length=592

 Score =   353 bits (906),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 226/314 (72%), Gaps = 6/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGG--TNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnya  1062
             H NGW++TWG+AA G   TNVC+R      I D+I  H VTHMC AP+V N+L     + 
Sbjct  240   HCNGWTFTWGVAARGAESTNVCIRSTTAVEIYDSIVSHNVTHMCCAPIVFNILLEAKQHE  299

Query  1061  NTKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPA  882
               + +T+PV+ILT GAPPPAA+LQ++E+LGF V H YGLTE  G A+ C W++ W+ LPA
Sbjct  300   R-RQITAPVEILTGGAPPPAALLQKIENLGFHVVHAYGLTEATGPALVCEWQKRWNKLPA  358

Query  881   PERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTS  702
               +A +K+RQG+  +    ADV  P T +SV RDG  +GEIVLRG+S+M GYLKD + T+
Sbjct  359   EGQARLKARQGISILTLADADVKDPQTMESVPRDGKTMGEIVLRGSSIMKGYLKDEKATA  418

Query  701   KCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAV  522
             K  + +GWF+TGDV V+HPDGY+E+KDR KDVIISGGEN+SSVEVE+ LY HP+V EAAV
Sbjct  419   KAFR-NGWFFTGDVAVVHPDGYLEIKDRSKDVIISGGENISSVEVEAALYKHPSVVEAAV  477

Query  521   VARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTG  342
             VA P   WGE+PCAFV+++    A   E ++ + C+  LP +MVP+KV FM  LPKTSTG
Sbjct  478   VAMPHPKWGESPCAFVTMRNS--AAVEEADIIQHCRRNLPNYMVPKKVAFMEELPKTSTG  535

Query  341   KIQKFLLRDIARDL  300
             K+QKF LR IA+  
Sbjct  536   KVQKFQLRAIAKTF  549



>ref|XP_010029595.1| PREDICTED: probable acyl-activating enzyme 2 [Eucalyptus grandis]
 gb|KCW56512.1| hypothetical protein EUGRSUZ_I02233 [Eucalyptus grandis]
Length=593

 Score =   353 bits (905),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/314 (59%), Positives = 225/314 (72%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW  TWG+AA GGTNVCLR+V P  I D I +H VTHM  AP VLNM+ N       
Sbjct  283   HCNGWCLTWGVAAQGGTNVCLRKVSPKGIFDCIAKHSVTHMGAAPTVLNMIVNSAVDDR-  341

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V+++T G+PPP  +L ++E LGF VSH YGLTET G    CAWK EWD+LP+ +
Sbjct  342   RPLPRKVEVMTGGSPPPPQILSKMEDLGFSVSHLYGLTETYGPGTYCAWKPEWDSLPSDQ  401

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             R+ IKSRQGV+ +G    DV  P T +SV  DG  VGEI+ RGN+VM GY K+ E T K 
Sbjct  402   RSNIKSRQGVQHLGLEEVDVRDPVTMESVPSDGKSVGEIMFRGNTVMSGYYKNQEATDKA  461

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               E GWF++GD+ V HPDGY+EVKDRLKDVIISGGEN+S+VEVE+VLY HPAV EAAVVA
Sbjct  462   F-EGGWFHSGDLAVKHPDGYVEVKDRLKDVIISGGENISTVEVETVLYSHPAVLEAAVVA  520

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WG+TPCAFV LK+G       +E+  +C++ LP +M PR VVF   LPKTSTGKI
Sbjct  521   RPDNHWGQTPCAFVKLKEG--CHIDAQEIIGYCRDHLPHYMSPRTVVF-EDLPKTSTGKI  577

Query  335   QKFLLRDIARDLSS  294
             QKF+LR+ A+ + S
Sbjct  578   QKFILREKAKAMGS  591



>ref|XP_006372489.1| AMP-dependent synthetase and ligase family protein [Populus trichocarpa]
 gb|ERP50286.1| AMP-dependent synthetase and ligase family protein [Populus trichocarpa]
Length=547

 Score =   351 bits (901),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 225/315 (71%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      + + I  H VTHMC AP+V N+L     +   
Sbjct  231   HCNGWTFTWGVAARGGTNVCLRNTSAKDMYNNIAEHAVTHMCCAPIVFNILLEARPHER-  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + +TSPV+ILT GAPPPA++LQ++E LGF V+H YGLTE  G A+ C W+++W+ LP  +
Sbjct  290   REITSPVEILTGGAPPPASLLQKIERLGFHVTHAYGLTEATGPALVCEWQKKWNKLPQQD  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +    ADV    T  SV RDG  +GEIVLRG+S+M GY KDPE TSK 
Sbjct  350   QAKLKARQGISILTLADADVKDLDTMVSVPRDGKTMGEIVLRGSSIMKGYFKDPEATSKA  409

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + +GW  TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+ESVLY HP V EAAVVA
Sbjct  410   FR-NGWLATGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELESVLYRHPRVLEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKK---GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+KK   G      E ++  +CK+ LP F VP++V FMA LPKTST
Sbjct  469   MPHPRWGESPCAFISVKKNSSGDTNDVKESDIIAYCKKNLPRFTVPKRVEFMAELPKTST  528

Query  344   GKIQKFLLRDIARDL  300
             GK+ K  LR +A++ 
Sbjct  529   GKVLKIQLRALAQNF  543



>gb|AEO52695.1| benzoyl-CoA/cinnamoyl-CoA ligase [Clarkia breweri]
Length=583

 Score =   352 bits (902),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 233/335 (70%), Gaps = 9/335 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      I   I  H VTHMC AP++ N+L    N    
Sbjct  235   HCNGWTFTWGIAARGGTNVCMRNPTAEGIYRNIAVHKVTHMCCAPIIFNILLEEENRI--  292

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PLTS V+ILT GAPPPAA+LQ +ESLGF V+H YGLTE  G A+ C W+ +W+ L + +
Sbjct  293   -PLTSAVNILTGGAPPPAALLQSIESLGFHVTHAYGLTEATGPALLCEWQSKWNGLSSGD  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQG+  +     DV  P+  KSV  DG  +GEI+LRG+ +M GY KDP+ TS  
Sbjct  352   RARLKARQGINVLTVADVDVKDPNNMKSVAHDGTTMGEIMLRGSGIMKGYYKDPKATSDA  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K  GWF+TGDVGVIHPDGY+E+KDR KDVIISGGEN+SS+E+E VLY HP V EAAVVA
Sbjct  412   FK-GGWFFTGDVGVIHPDGYVEIKDRSKDVIISGGENISSIELEEVLYKHPRVLEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIA----KPTEKEMREFCKERLPLFMVPRKVVFMAALPKTS  348
              P   WGE+PCAF+++KK        + TE E+  FCK+ +P FMVP+KV F+ +LPKTS
Sbjct  471   MPHPRWGESPCAFIAVKKNPNGFRGDEVTEAEIVSFCKKNVPNFMVPKKVEFLDSLPKTS  530

Query  347   TGKIQKFLLRDIARDLSSADAINANQNGIGHEINQ  243
             TGKIQKF LR +A+ L   +  + N+N +  ++ Q
Sbjct  531   TGKIQKFQLRALAKALVVTEK-SVNKNNLKTQLPQ  564



>ref|XP_002272437.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal [Vitis vinifera]
Length=588

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 223/315 (71%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGT+VC+R      +   I  H VTHMC AP+V N+L         
Sbjct  240   HCNGWTFTWGVAARGGTSVCIRNTTAYDMYRNIALHNVTHMCCAPIVFNILLEAKENERQ  299

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L +PV ILT GAPPPA +L+++E+LGF V H YGLTE  G A+ C W+ EW+ LP   
Sbjct  300   R-LKTPVQILTGGAPPPAPLLEKIEALGFHVVHAYGLTEATGPALVCEWQAEWNRLPRDH  358

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +     DV +P T  SV RDG  +GEIVLRG+S+M GY KDPE TSK 
Sbjct  359   QAKLKARQGISILTLADVDVKNPDTMASVPRDGKSMGEIVLRGSSIMKGYFKDPEATSKA  418

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF+TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVES+LY HP V EAAVVA
Sbjct  419   FK-NGWFFTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVEVESILYRHPRVLEAAVVA  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+++ K    +    +E ++ ++C++ LP +M+P+KV  M  LPKT+T
Sbjct  478   MPHPKWGESPCAFITINKNQTGQNDDVSEDDIIQYCRKNLPRYMIPKKVEIMEQLPKTAT  537

Query  344   GKIQKFLLRDIARDL  300
             GKIQKF LR +A+ L
Sbjct  538   GKIQKFELRTLAKTL  552



>ref|XP_001753149.1| predicted protein [Physcomitrella patens]
 gb|EDQ82190.1| predicted protein [Physcomitrella patens]
Length=557

 Score =   350 bits (898),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/317 (56%), Positives = 230/317 (73%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++ WGMAA+ GTNV +R V+  +I D+I +H VTH+CGAPVV N +AN       
Sbjct  242   HCNGWTFIWGMAAIAGTNVIIRNVEAKAIYDSIVKHKVTHLCGAPVVFNTIANAPPQDKK  301

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K L   V  +T GAPPP +VL  +ES+GF V H YGLTET G A+ C WK EW+ L A E
Sbjct  302   K-LPGRVFTITGGAPPPPSVLSNMESMGFTVLHSYGLTETYGPALVCVWKPEWNGLSAEE  360

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA IK+RQGV +VG  G DV+ P T K+V RD   +GEI++RG++VM GY KD + T K 
Sbjct  361   RARIKARQGVATVGLQGLDVLDPDTMKAVPRDAKTIGEIMIRGHTVMKGYFKDEDATRKA  420

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               E GW++TGD+GV+HPDGY+EVKDR KD+IISGGEN+SS+EVESVL+ HP + EAAVVA
Sbjct  421   F-EGGWYHTGDLGVMHPDGYVEVKDRSKDIIISGGENISSIEVESVLFKHPQIMEAAVVA  479

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPDK WGE+PCAFV+L++G +    +  +  +C+E LP F VP+ +VF   LPKT+TGK+
Sbjct  480   RPDKHWGESPCAFVTLREGAMGVNADT-IVAYCREHLPKFYVPKTIVF-CELPKTTTGKV  537

Query  335   QKFLLRDIARDLSSADA  285
             QKF LR++A+ L  + A
Sbjct  538   QKFKLREMAKALPQSVA  554



>gb|EYU33955.1| hypothetical protein MIMGU_mgv1a003358mg [Erythranthe guttata]
Length=590

 Score =   351 bits (900),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 186/329 (57%), Positives = 234/329 (71%), Gaps = 5/329 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R    A +  AI  H VTHMC AP+V N+L     +   
Sbjct  243   HCNGWTFTWGVAARGGTNVCIRNTTAAEMYGAIAAHKVTHMCCAPIVFNILLEAEPHER-  301

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +P+T+PV+ILT GAPPPAA+L+R+E LGF V H YGLTE  G A+ C W++ WD LP+ +
Sbjct  302   RPITTPVEILTGGAPPPAALLERIERLGFHVVHAYGLTEATGPALVCEWQKRWDELPSSD  361

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             R+ +K+RQG+  +     DV  P T +SV RDG  +GEIVLRG+S+M GY KD   TSK 
Sbjct  362   RSRLKARQGLSVLTLADVDVKDPETMESVFRDGKSMGEIVLRGSSIMKGYFKDENATSKA  421

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGDVGV+HPDGY+E+KDR KDVIISGGEN+SSVEVE+ LY HPAV EAAVVA
Sbjct  422   FK-NGWFLTGDVGVVHPDGYVEIKDRSKDVIISGGENISSVEVEAALYKHPAVVEAAVVA  480

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
              P   WGE+PCAF+ ++ G  A   E E+ + C+  LP FMVP+KV FM  LPKTSTGKI
Sbjct  481   MPHPKWGESPCAFLKVRGG--AAVDEAEILKHCRRNLPHFMVPKKVEFMEELPKTSTGKI  538

Query  335   QKFLLRDIARDLSSADA-INANQNGIGHE  252
             QKF LR  A+ L  + A I  + +GI +E
Sbjct  539   QKFQLRSFAKTLVISPAKIKPSNSGINNE  567



>ref|XP_009408181.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=580

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 221/311 (71%), Gaps = 3/311 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      +  AI  H VTHMC AP V ++L         
Sbjct  233   HCNGWTFTWGLAARGGTNVCIRAPTARDMYRAIADHRVTHMCCAPTVFSILLEAGPADR-  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +P+ SPV +LT GAPPPA +L++++ LGF V+H YGLTE  G A+ C W+++W+ LP  E
Sbjct  292   RPIASPVQVLTGGAPPPATLLEKIQRLGFHVTHAYGLTEATGPALVCEWRQQWNRLPMEE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +    ADV    T  SV RDG  +G+IVLRG+S+M GY K+P+ T+  
Sbjct  352   QARLKARQGISVLTLADADVKDTDTMSSVPRDGESLGQIVLRGSSIMKGYYKNPDDTAAA  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K DGWF TGD+GV+HPDGY+E+KDR KD+IISGGEN+SS+EVE+VLY HP V EAAVVA
Sbjct  412   FK-DGWFLTGDLGVVHPDGYVEIKDRAKDIIISGGENISSLEVEAVLYRHPMVLEAAVVA  470

Query  515   RPDKFWGETPCAFVSLKKGII-AKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
              P   WGETPCAF+ +KK        E+++  +C+  +P FMVP+KVVFM  LPKTSTGK
Sbjct  471   MPHPHWGETPCAFLKVKKETQEGSINEEDIISYCRNSMPRFMVPKKVVFMEELPKTSTGK  530

Query  338   IQKFLLRDIAR  306
             IQKFLLR  AR
Sbjct  531   IQKFLLRKAAR  541



>ref|XP_002967798.1| hypothetical protein SELMODRAFT_409095 [Selaginella moellendorffii]
 gb|EFJ31145.1| hypothetical protein SELMODRAFT_409095 [Selaginella moellendorffii]
Length=547

 Score =   349 bits (896),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 228/317 (72%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW +TW +AA GGTN+CLR V   +  DAI    VTH+ GAP VLNM+A+       
Sbjct  231   HCNGWCFTWAIAAQGGTNICLRNVTAKATFDAIAESSVTHLSGAPTVLNMIASSIPSER-  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L   V +   GAPPP A+L  +E LGF V+H YGLTET G A+ CAW+  W++ P  E
Sbjct  290   RDLPHKVAVRVGGAPPPPAILSSMEELGFVVTHSYGLTETYGPALFCAWRPHWNSFPLEE  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV  +G   ADV  P T +SV RDG  +GE+++RG++VM GY +D E T + 
Sbjct  350   RAKLKSRQGVVHLGLHQADVKDPATMESVARDGRTLGEVMVRGSTVMKGYHRDDEAT-RA  408

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               + GWF+TGD+GVIHPDGYI+++DR KD+IISGGEN+SS+EVES+LY HP V EAAVVA
Sbjct  409   AFQGGWFHTGDLGVIHPDGYIQLRDRSKDIIISGGENISSIEVESILYGHPEVLEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFV+LK+   A  + +E+ ++C+ RLP FMVPR VVF  ALPKTSTGK+
Sbjct  469   RPDDFWGETPCAFVTLKRSGGAT-SAREIIDYCRARLPHFMVPRSVVF-GALPKTSTGKV  526

Query  335   QKFLLRDIARDLSSADA  285
             QKFLLRD AR + S  A
Sbjct  527   QKFLLRDRARAMGSLRA  543



>ref|XP_002992588.1| hypothetical protein SELMODRAFT_448826 [Selaginella moellendorffii]
 gb|EFJ06290.1| hypothetical protein SELMODRAFT_448826 [Selaginella moellendorffii]
Length=547

 Score =   349 bits (895),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 227/317 (72%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW +TW +AA GGTN+CLR V   +  DAI    VTH+ GAP VLNM+A+       
Sbjct  231   HCNGWCFTWAIAAQGGTNICLRNVTAKATFDAIAESSVTHLSGAPTVLNMIASSIPSER-  289

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L   V ++  GAPPPAA+L  +E LGF V+H YGLTET G A+ CAW+  W++ P  E
Sbjct  290   RDLPDKVAVIVGGAPPPAAILSSMEELGFVVTHAYGLTETYGPALVCAWRPHWNSFPLEE  349

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV  +G   ADV  P T +SV RDG  +GE+++RG++VM GY +D E T + 
Sbjct  350   RAKLKSRQGVVHLGLHQADVKDPATMESVARDGRTLGEVMVRGSTVMKGYHRDDEAT-RA  408

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               + GWF+TGD+GVIHPDGYI+++DR KD+IISGGEN+SS+EVESVLY HP V EAAVVA
Sbjct  409   AFQGGWFHTGDLGVIHPDGYIQLRDRSKDIIISGGENISSIEVESVLYGHPEVLEAAVVA  468

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFV+LK  I    + + + ++C+ R+P FMVPR VVF   LPKTSTGK+
Sbjct  469   RPDDFWGETPCAFVTLKD-IGGATSARGIIDYCRARMPHFMVPRSVVF-GELPKTSTGKV  526

Query  335   QKFLLRDIARDLSSADA  285
             QKFLLRD AR + S  A
Sbjct  527   QKFLLRDRARAMGSLKA  543



>gb|AFS60176.1| cinnamate:CoA ligase [Hypericum calycinum]
Length=572

 Score =   350 bits (897),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/317 (56%), Positives = 226/317 (71%), Gaps = 5/317 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVC+R      +   I  HGVTHMC AP+V N+L    + A  
Sbjct  229   HCNGWTFTWGIAARGGTNVCIRNTTAEDMYRNIANHGVTHMCCAPIVFNILLEAGSEAR-  287

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +P+T PV +LT GAPPP ++L ++E LGF+++H YGLTE  G A+ C W+ +WD LP  +
Sbjct  288   RPITRPVQVLTGGAPPPESLLAKMEPLGFKITHAYGLTEATGPALVCEWQAQWDGLPKGD  347

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGV  +    ADV +  T +SV RDG  +GEIVLRG+S+M+GY KD E TSK 
Sbjct  348   QAKLKARQGVSILTLADADVKNLATMESVPRDGKTMGEIVLRGSSIMMGYYKDQETTSKA  407

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGDVGV+HPDGYIE+KDR KDVIISGGEN+SSVEVESVLY HP V EAAVVA
Sbjct  408   FK-NGWFATGDVGVVHPDGYIEIKDRSKDVIISGGENISSVEVESVLYKHPRVLEAAVVA  466

Query  515   RPDKFWGETPCAFVSLK---KGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P + WGE+PCAFV+++   KG      E ++  FC+  +P FMVP++V F+A LPK ST
Sbjct  467   MPSEKWGESPCAFVAIRKNEKGSRNDVKEVDILRFCRANMPHFMVPKRVAFLAELPKNST  526

Query  344   GKIQKFLLRDIARDLSS  294
              KI K  LRD+A+   S
Sbjct  527   NKILKAQLRDMAKAFGS  543



>ref|XP_008813690.1| PREDICTED: butyrate--CoA ligase AAE11, peroxisomal-like [Phoenix 
dactylifera]
Length=601

 Score =   350 bits (899),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 229/339 (68%), Gaps = 19/339 (6%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLR------------RVDPASINDAIERHGVTHMCGAPvvl  1092
             H NGW++TWGMAA GG NVC+R                  +  AI  H VTHMC AP+V 
Sbjct  234   HCNGWTFTWGMAARGGANVCIRATTARDXXXXXXXTTARDMYRAIADHHVTHMCSAPIVF  293

Query  1091  nmlanynnyaNTKPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCA  912
             N+L   +     + L +PV +LT GAPPPA +L+++E LGFRV+H YGLTE  G A+ C 
Sbjct  294   NILLEASPAER-RTLAAPVSVLTGGAPPPAPLLEKIERLGFRVTHAYGLTEATGPALVCE  352

Query  911   WKREWDNLPAPERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVML  732
             W+ EW++ PAPE+A +KSRQG+  +     DV    T +SV RDGN +GEIVLRG+S+M 
Sbjct  353   WREEWNHRPAPEQARLKSRQGISVLTLADVDVKDVETMRSVPRDGNSLGEIVLRGSSIMK  412

Query  731   GYLKDPEGTSKCMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLY  552
             GY K+ E T    + DGWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVE++LY
Sbjct  413   GYYKNREATDAAFR-DGWFLTGDVGVIHPDGYVEIKDRSKDVIISGGENISSVEVETILY  471

Query  551   MHPAVDEAAVVARPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRK  381
              HP V EAAVVA P   WGETPCAF+++K+    +P    E+++  +C+  +  FMVP+K
Sbjct  472   RHPMVLEAAVVAMPHPHWGETPCAFLTVKRE--CEPGSIREEDIISYCRNSMSRFMVPKK  529

Query  380   VVFMAALPKTSTGKIQKFLLRDIARDLSSADAINANQNG  264
             VVFM  LPKTSTGKIQKFLLR+ AR L   +     Q G
Sbjct  530   VVFMEELPKTSTGKIQKFLLRETARGLKVTEGNRTPQGG  568



>gb|KDO57304.1| hypothetical protein CISIN_1g038104mg [Citrus sinensis]
Length=567

 Score =   349 bits (895),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 225/324 (69%), Gaps = 5/324 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      +   I +H VTHMC AP+V N+L         
Sbjct  235   HCNGWTFTWGVAARGGTNVCLRNTTAYDMYRNISQHRVTHMCCAPIVFNILLQAKPEER-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K + SPV ILT GAPPPA++L+ +E LGF V+H YGLTE  G A+ C W+  W+ LP P+
Sbjct  294   KEIASPVQILTGGAPPPASLLEEIELLGFHVTHAYGLTEATGPALVCEWQSSWNQLPKPD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +     DV +  T  SV RDG  +GEIVLRG+S+M GYLK+ E TS+ 
Sbjct  354   QAKLKARQGISILTLADVDVKNLDTMSSVPRDGKTMGEIVLRGSSIMKGYLKNEEATSQS  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+E+VL+ HP V EAAVVA
Sbjct  414   FK-NGWFRTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELENVLFRHPRVLEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+K     K     E ++  +C+E L  FMVP+KVV +  LPKT+T
Sbjct  473   MPHPQWGESPCAFISVKTNSAGKTDDVNEADILSYCRENLSRFMVPKKVVILPELPKTAT  532

Query  344   GKIQKFLLRDIARDLSSADAINAN  273
             GKIQKF LR +A++ + +   NA 
Sbjct  533   GKIQKFQLRALAKNFAVSKDHNAQ  556



>gb|KDP43741.1| hypothetical protein JCGZ_22368 [Jatropha curcas]
Length=545

 Score =   348 bits (893),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 224/314 (71%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW  TWG+AA GGTN+CLR+V P  I D I  H VTHM GAP VLNM+ N       
Sbjct  235   HCNGWCLTWGVAAQGGTNICLRKVSPKRIFDCIAEHKVTHMGGAPTVLNMIVNSPVCDR-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V+++T GAPPP  ++ ++E LGF VSH YGLTET G    CAWK EWD+L   E
Sbjct  294   KPLPHKVEVMTGGAPPPPQIIFKMEELGFGVSHVYGLTETYGPGTYCAWKPEWDSLSHNE  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             R  +K+RQG+  +G    DV  P T +SV  DG   GEI+ RGN+VM GY KD EGT + 
Sbjct  354   RVKLKARQGIHHLGLEDVDVKDPITEESVPADGKTFGEIMFRGNTVMSGYFKDLEGTKEA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K  GWF +GD+ V H DGYIEVKDRLKD+IISGGEN+S+VEVE+VLY HPA+ EAAVVA
Sbjct  414   FK-GGWFRSGDLAVKHSDGYIEVKDRLKDIIISGGENISTVEVETVLYGHPAILEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WG+TPCAFV LK+G  A  TE+++ +FC+++LP +M PR V+F   LP+TSTGK+
Sbjct  473   RPDDHWGQTPCAFVKLKEGFDA--TEQDIIKFCRDKLPHYMAPRTVIF-EDLPRTSTGKV  529

Query  335   QKFLLRDIARDLSS  294
             QKF+LR+ A+ + S
Sbjct  530   QKFILREKAKAMGS  543



>ref|XP_006430358.1| hypothetical protein CICLE_v10011382mg [Citrus clementina]
 gb|ESR43598.1| hypothetical protein CICLE_v10011382mg [Citrus clementina]
Length=567

 Score =   349 bits (895),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 225/324 (69%), Gaps = 5/324 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      +   I +H VTHMC AP+V N+L         
Sbjct  235   HCNGWTFTWGVAARGGTNVCLRNTTAYDMYRNISQHRVTHMCCAPIVFNILLQAKPEER-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K + SPV ILT GAPPPA++L+ +E LGF V+H YGLTE  G A+ C W+  W+ LP P+
Sbjct  294   KEIASPVQILTGGAPPPASLLEEIELLGFHVTHAYGLTEATGPALVCEWQSSWNQLPKPD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +     DV +  T  SV RDG  +GEIVLRG+S+M GYLK+ E TS+ 
Sbjct  354   QAKLKARQGISILTLADVDVKNLDTMSSVPRDGKTMGEIVLRGSSIMKGYLKNEEATSQS  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+E+VL+ HP V EAAVVA
Sbjct  414   FK-NGWFRTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELENVLFRHPRVLEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+K     K     E ++  +C+E L  FMVP+KVV +  LPKT+T
Sbjct  473   MPHPQWGESPCAFISVKTNSAGKTDDVNEADILSYCRENLSRFMVPKKVVILPELPKTAT  532

Query  344   GKIQKFLLRDIARDLSSADAINAN  273
             GKIQKF LR +A++ + +   NA 
Sbjct  533   GKIQKFQLRALAKNFAVSKDHNAQ  556



>ref|XP_006340821.1| PREDICTED: probable acyl-activating enzyme 2-like [Solanum tuberosum]
Length=560

 Score =   348 bits (893),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 223/314 (71%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW  TWG+AA+GGT++CLR+V P +I + I  H VTHM GAP VLNML N       
Sbjct  250   HCNGWCLTWGLAALGGTSICLRQVYPKNIFENIAEHKVTHMSGAPTVLNMLVNSPVSDR-  308

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V+I+T G+PPP  ++ ++E LGFRV H YGLTET G    C W+ EWD+LP  E
Sbjct  309   KPLPHSVNIMTGGSPPPPQIISKMEELGFRVHHLYGLTETYGPGTYCLWRPEWDSLPPNE  368

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +  +K+RQGV+ +     DV+ P T + V  DG  +GEI+ RGN+VM  YLKD E T + 
Sbjct  369   KYKLKARQGVQHLCSEAVDVMDPLTMEKVPEDGKTIGEIMFRGNTVMSEYLKDEEATKEA  428

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K  GWF++GD+ V HPDGYIEVKDRLKD++ISGGEN+S+VEVE VLY HPA+ E AVVA
Sbjct  429   FK-GGWFHSGDLAVKHPDGYIEVKDRLKDIVISGGENISTVEVERVLYSHPAIFETAVVA  487

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WG+TPCAFV LK G  +  +++E+  FC++ LP +M PR V+F   LPKTSTGKI
Sbjct  488   RPDNHWGQTPCAFVKLKDG--SNASDQEIINFCRDNLPHYMAPRTVIFQ-DLPKTSTGKI  544

Query  335   QKFLLRDIARDLSS  294
             QKF+LR+ AR L S
Sbjct  545   QKFILREKARALGS  558



>ref|XP_006481939.1| PREDICTED: probable acyl-activating enzyme 12, peroxisomal-like 
[Citrus sinensis]
Length=567

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 224/324 (69%), Gaps = 5/324 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      +   I +H VTHMC AP+V N+L         
Sbjct  235   HCNGWTFTWGVAARGGTNVCLRNTTAYDMYRNISQHRVTHMCCAPIVFNILLQAKPEER-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             K + SPV ILT GAPPPA++L+ +E LGF V+H YGLTE  G A+ C W+  W+ LP P+
Sbjct  294   KEIASPVQILTGGAPPPASLLEEIELLGFHVTHAYGLTEATGPALVCEWQSSWNQLPKPD  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +     DV +  T  SV RDG  +GEIVLRG+S+M GYLK+ E T++ 
Sbjct  354   QAKLKARQGISILTLADVDVKNLDTMSSVPRDGKTMGEIVLRGSSIMKGYLKNEEATTES  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+E+VL+ HP V EAAVVA
Sbjct  414   FK-NGWFRTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELENVLFRHPRVLEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+S+K     K     E ++  +C+E L  FMVP+KVV +  LPKTST
Sbjct  473   MPHPQWGESPCAFISVKTNSAGKTDDVNEADILSYCRENLSRFMVPKKVVILPELPKTST  532

Query  344   GKIQKFLLRDIARDLSSADAINAN  273
             GKIQKF LR +A + + +   NA 
Sbjct  533   GKIQKFQLRALANNFAVSKDHNAQ  556



>ref|XP_002465916.1| hypothetical protein SORBIDRAFT_01g048050 [Sorghum bicolor]
 gb|EER92914.1| hypothetical protein SORBIDRAFT_01g048050 [Sorghum bicolor]
Length=546

 Score =   347 bits (890),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 220/322 (68%), Gaps = 5/322 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW+  WG+A  GGTNVCLR      I D+I RHGVTHM GAP VLNM+AN       
Sbjct  229   HCNGWNLPWGVAMQGGTNVCLRHFTAGVIFDSIARHGVTHMGGAPTVLNMIANAPPADRM  288

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL  PV ++T GAPPP  VL  VE LGF V H YGLTET G A  C W  EWD LPA  
Sbjct  289   -PLPGPVRVMTGGAPPPPRVLFAVEELGFVVYHIYGLTETYGPATVCTWMPEWDALPAEH  347

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQG   +    ADV +P T + V  DG  VGE++ RGN+VM GY KD + T + 
Sbjct  348   RARLKARQGFHHIAMQDADVKNPTTMECVPHDGETVGEVMFRGNTVMSGYYKDLKATKES  407

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M   GW +TGD+ V HPDGYIE+KDR KD+IISGGEN+SS+EVESV++ HPAV EAAVVA
Sbjct  408   MA-GGWLHTGDLAVRHPDGYIELKDRAKDIIISGGENISSIEVESVIFSHPAVLEAAVVA  466

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WGETPCAFV LK G  A  TE E+  FC+ERLP +M P+ VVF   +PKTSTGK 
Sbjct  467   RPDDHWGETPCAFVKLKDG--ASATEAEIISFCRERLPHYMAPKTVVF-EDMPKTSTGKT  523

Query  335   QKFLLRDIARDLSSADAINANQ  270
             QKF+LRD AR + S   I +++
Sbjct  524   QKFVLRDKARAMGSLTKIASSK  545



>gb|KDO80508.1| hypothetical protein CISIN_1g036361mg, partial [Citrus sinensis]
Length=485

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 203/249 (82%), Gaps = 3/249 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             HANGW YTWGMAAVG TN+CLRR D ++I+D I++H VTHMCGAPVVLNM++N  ++   
Sbjct  240   HANGWGYTWGMAAVGATNICLRRFDASAISDLIQKHNVTHMCGAPVVLNMISNSPDF---  296

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL +PV ILTAGAPPPA VL R ES+GF V HGYGLTET GL V+C+WK EWD LP  E
Sbjct  297   EPLKTPVQILTAGAPPPAPVLSRTESMGFVVCHGYGLTETAGLVVSCSWKPEWDKLPLEE  356

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQGV++VG T  DVV+P TG+SVKRDG  +GE+VLRG  V +GY KD E T +C
Sbjct  357   RARLKARQGVKTVGLTEVDVVNPETGESVKRDGVSLGEVVLRGGCVTVGYFKDKESTRRC  416

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             + ++GWFYTGD+ V+H DGY+E+KDR KDVIISGGEN+ S EVESVLY + AV+EAAVVA
Sbjct  417   ISDNGWFYTGDIAVMHVDGYVEIKDRSKDVIISGGENICSAEVESVLYSNTAVNEAAVVA  476

Query  515   RPDKFWGET  489
             RPDKFWGET
Sbjct  477   RPDKFWGET  485



>ref|XP_002992620.1| hypothetical protein SELMODRAFT_236556 [Selaginella moellendorffii]
 gb|EFJ06322.1| hypothetical protein SELMODRAFT_236556 [Selaginella moellendorffii]
Length=552

 Score =   347 bits (889),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 227/317 (72%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW +TW +AA GGTN+CLR V   +  DAI    VTH+ GAP VLNM+A+       
Sbjct  236   HCNGWCFTWAIAAQGGTNICLRNVTSKATFDAIAESSVTHLSGAPTVLNMIASSIPSER-  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L   V +   GAPPP A+L  +E LGF V+H YGLTET G A+ CAW+  W++ P  E
Sbjct  295   RDLPDKVAVRVGGAPPPPAILSSMEELGFVVTHSYGLTETYGPALFCAWRPHWNSFPLEE  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV  +G   ADV  P T +SV RDG  +GE+++RG++VM GY +D E T + 
Sbjct  355   RAKLKSRQGVVHLGLHQADVKDPATMESVARDGRTLGEVMVRGSTVMKGYHRDDEAT-RA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               + GWF+TGD+GVIHPDGYI+++DR KD+IISGGEN+SS+EVESVLY HP V EAAVVA
Sbjct  414   AFQGGWFHTGDLGVIHPDGYIQLRDRSKDIIISGGENISSIEVESVLYGHPEVLEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFV+LK+   A  + +E+ ++C+ RLP FM PR VVF  ALPKTSTGK+
Sbjct  474   RPDDFWGETPCAFVTLKRSGGAT-SAREIIDYCRARLPHFMNPRSVVF-GALPKTSTGKV  531

Query  335   QKFLLRDIARDLSSADA  285
             QKFLLRD AR + S  A
Sbjct  532   QKFLLRDRARAMGSLRA  548



>ref|XP_009401909.1| PREDICTED: LOW QUALITY PROTEIN: butyrate--CoA ligase AAE11, peroxisomal-like 
[Musa acuminata subsp. malaccensis]
Length=583

 Score =   348 bits (892),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 224/319 (70%), Gaps = 5/319 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NG ++TWG+AA GG NVC+R      +  AI  H VTHMC AP+V  +L         
Sbjct  235   HCNGXTFTWGVAARGGVNVCIRNTSAGEMYQAIADHRVTHMCCAPIVFTILLEAGLSER-  293

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +P+ SPV +LT GAPPPA +L+++E +GF+V+H YGLTE  G A+ C W+ EWD  P+ +
Sbjct  294   RPIASPVQVLTGGAPPPAPLLEKIERMGFKVTHAYGLTEATGPALVCEWRSEWDQRPSED  353

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQG+  +     DV +  T  SV RDG  VGEIVLRG+S+M GY K+ + T++ 
Sbjct  354   RARLKARQGISVLTLADVDVKNAKTMASVPRDGRSVGEIVLRGSSIMKGYFKNTKDTAEA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             ++ DGWF+TGDV V+HPDGY+E+KDR KDVIISGGEN+SSVEVE+VLY HP V EAAVVA
Sbjct  414   LR-DGWFFTGDVAVVHPDGYLEIKDRSKDVIISGGENISSVEVETVLYKHPMVVEAAVVA  472

Query  515   RPDKFWGETPCAFVSLKK---GIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGETPCAFV+LKK   G     TE+ +  +C+  +  FMVP+KVVF+  LPKTST
Sbjct  473   MPHPRWGETPCAFVTLKKKCGGGDNTATEEAIITYCRANMSRFMVPKKVVFVEELPKTST  532

Query  344   GKIQKFLLRDIARDLSSAD  288
             GKIQKF LR++A+    A+
Sbjct  533   GKIQKFQLREMAKRFKVAE  551



>ref|XP_003538370.1| PREDICTED: probable acyl-activating enzyme 12, peroxisomal-like 
[Glycine max]
Length=620

 Score =   348 bits (893),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 229/347 (66%), Gaps = 16/347 (5%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      I   I  H VTHMC AP+V N++         
Sbjct  253   HCNGWTFTWGLAARGGTNVCLRTTAARDIYSNIVLHNVTHMCCAPIVFNIILEAKQSEKI  312

Query  1055  K---PLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLP  885
                    SPV+ILT GAPPPA++L+++ESLGF V+H YGLTE  G A+ C W++EW+ LP
Sbjct  313   DIKLKRNSPVEILTGGAPPPASLLEQIESLGFHVTHAYGLTEATGPALVCEWQKEWNMLP  372

Query  884   APERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGT  705
               E+A +K+RQGV  +   G DV +  T +SV +DG  +GEIVL+G+ +M+GY KD E T
Sbjct  373   KKEQAQLKARQGVSVLTMAGVDVKNLDTMESVPKDGRTMGEIVLKGSGIMMGYFKDHEAT  432

Query  704   SKCM-----KEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPA  540
             SK        +  WF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVES+LY HP 
Sbjct  433   SKAFFGSNNSKGDWFRTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVEVESLLYRHPR  492

Query  539   VDEAAVVARPDKFWGETPCAFVSLK--------KGIIAKPTEKEMREFCKERLPLFMVPR  384
             V EAAVVA P   WGE+PCAFVSL+           I   TE E+  +C++ LP FMVP+
Sbjct  493   VLEAAVVAMPHPRWGESPCAFVSLRKNNNNNNSSKKIDHVTEAEIIAYCRKNLPHFMVPK  552

Query  383   KVVFMAALPKTSTGKIQKFLLRDIARDLSSADAINANQNGIGHEINQ  243
              V FM  LPKTSTGKIQKF LR +A+    ++     +N I  + +Q
Sbjct  553   VVKFMEELPKTSTGKIQKFELRVMAKAFMVSENNVQTKNNINKKSSQ  599



>ref|XP_007032206.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
 gb|EOY03132.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
Length=645

 Score =   348 bits (894),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 234/349 (67%), Gaps = 11/349 (3%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTN+CLR      +   I  H VTHMC AP+V N+L     +   
Sbjct  300   HCNGWTFTWGIAARGGTNICLRNTTAYDMYRNIAFHKVTHMCCAPIVFNILLEAKPHER-  358

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + + SPV ILT GAPPPA++L+++E LGF V+H YGLTE  G A+ C W+  W++LP   
Sbjct  359   REIASPVQILTGGAPPPASLLEKMELLGFHVTHAYGLTEATGPALVCEWQARWNHLPRER  418

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQG+  +     DV +  T  SV RDG  +GEIVLRG+S+M GYLKDPE T+K 
Sbjct  419   QAGLKARQGISILTLADVDVKNMETMASVPRDGKTMGEIVLRGSSIMKGYLKDPEATTKA  478

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              K +GWF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVE+ESVLY HP V EAAVVA
Sbjct  479   FK-NGWFITGDVGVIHPDGYLEIKDRSKDVIISGGENISSVELESVLYRHPRVLEAAVVA  537

Query  515   RPDKFWGETPCAFVSLKKGIIAKP---TEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
              P   WGE+PCAF+++K+    K     E ++  +C++ LP +MVP+KV F+  LPKTST
Sbjct  538   MPHPRWGESPCAFIAVKENAAGKTEDVKEADIISYCRKNLPNYMVPKKVEFLQQLPKTST  597

Query  344   GKIQKFLLRDIARDLSSADAINANQNGIGHEINQA*TSFPLIPASEFVL  198
             GKIQKF LR +A+      + + ++N    +  Q     P     E +L
Sbjct  598   GKIQKFQLRALAK------SFHVSENSTRKKSTQVNKETPFYQPHEHIL  640



>ref|XP_002968051.1| hypothetical protein SELMODRAFT_440236 [Selaginella moellendorffii]
 gb|EFJ31398.1| hypothetical protein SELMODRAFT_440236 [Selaginella moellendorffii]
Length=552

 Score =   346 bits (887),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 177/317 (56%), Positives = 227/317 (72%), Gaps = 4/317 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW +TW +AA GGTN+CLR V   +  DAI    VTH+ GAP VLNM+A+       
Sbjct  236   HCNGWCFTWAIAAQGGTNICLRNVTAKATFDAIAESSVTHLSGAPTVLNMIASSMPSER-  294

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             + L   V ++  GAPPPAA+L  +E LGF V+H YGLTET G A+ C+W+  W++ P  E
Sbjct  295   RDLPDKVAVIVGGAPPPAAILSSMEELGFVVTHAYGLTETYGPALVCSWRPHWNSFPLEE  354

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +KSRQGV  +G   ADV  P T +SV RDG  +GE+++RG++VM GY +D E T + 
Sbjct  355   RAKLKSRQGVVHLGLHQADVKDPATMESVARDGRTLGEVMVRGSTVMKGYHRDDEAT-RA  413

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               + GWF+TGD+GV+HPDGYI+++DR KD+IISGGEN+SS+EVESVLY HP V EAAVVA
Sbjct  414   AFQGGWFHTGDLGVLHPDGYIQLRDRSKDIIISGGENISSIEVESVLYGHPEVLEAAVVA  473

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD FWGETPCAFV+LK  I    + + + ++C+ R+P FMVPR +VF   LPKTSTGK+
Sbjct  474   RPDDFWGETPCAFVTLKD-IGGATSARGIIDYCRARMPHFMVPRSLVF-GELPKTSTGKV  531

Query  335   QKFLLRDIARDLSSADA  285
             QKFLLRD AR + S  A
Sbjct  532   QKFLLRDRARAMGSLKA  548



>gb|KHN08765.1| Putative acyl-activating enzyme 12, peroxisomal [Glycine soja]
Length=615

 Score =   347 bits (891),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 223/324 (69%), Gaps = 14/324 (4%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      I   I  H VTHMC AP+V N++         
Sbjct  253   HCNGWTFTWGVAARGGTNVCLRTTAARDIYRNIVVHNVTHMCCAPIVFNIILEAKQSERI  312

Query  1055  K------PLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWD  894
                       SPV+ILT GAPPPA++L+++ESLGF V+H YGLTE  G A+ C WK+EW+
Sbjct  313   DIKVINGKRKSPVEILTGGAPPPASLLEQIESLGFHVTHAYGLTEATGPALVCEWKKEWN  372

Query  893   NLPAPERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDP  714
              LP  E+A +K+RQGV  +     DV +  T +SV RDG  +GEIVL+G+ +M+GY KD 
Sbjct  373   MLPKKEQAQLKARQGVSVLTMADVDVKNLETMESVARDGRTMGEIVLKGSGIMMGYFKDH  432

Query  713   EGTSKCMKEDG-WFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAV  537
             + +SK   ++G WF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVES+LY HP V
Sbjct  433   KASSKAFGKNGDWFKTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVEVESLLYKHPRV  492

Query  536   DEAAVVARPDKFWGETPCAFVSLKKGI-------IAKPTEKEMREFCKERLPLFMVPRKV  378
              EAAVVA P   WGETPCAFVSL+K         I   TE E+  +C++ LP FMVP+ V
Sbjct  493   LEAAVVAMPHPRWGETPCAFVSLRKNNNNSSSSKIDDVTEAEIIAYCRKNLPHFMVPKVV  552

Query  377   VFMAALPKTSTGKIQKFLLRDIAR  306
              FM  LPKTSTGKIQKF LR +A+
Sbjct  553   KFMEELPKTSTGKIQKFELRVMAK  576



>ref|XP_006602034.1| PREDICTED: probable acyl-activating enzyme 12, peroxisomal-like 
[Glycine max]
Length=615

 Score =   347 bits (891),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 223/324 (69%), Gaps = 14/324 (4%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      I   I  H VTHMC AP+V N++         
Sbjct  253   HCNGWTFTWGVAARGGTNVCLRTTAARDIYRNIVVHNVTHMCCAPIVFNIILEAKQSERI  312

Query  1055  K------PLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWD  894
                       SPV+ILT GAPPPA++L+++ESLGF V+H YGLTE  G A+ C WK+EW+
Sbjct  313   DIKVINGKRKSPVEILTGGAPPPASLLEQIESLGFHVTHAYGLTEATGPALVCEWKKEWN  372

Query  893   NLPAPERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDP  714
              LP  E+A +K+RQGV  +     DV +  T +SV RDG  +GEIVL+G+ +M+GY KD 
Sbjct  373   MLPKKEQAQLKARQGVSVLTMADVDVKNLETMESVARDGRTMGEIVLKGSGIMMGYFKDH  432

Query  713   EGTSKCMKEDG-WFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAV  537
             + +SK   ++G WF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVES+LY HP V
Sbjct  433   KASSKAFGKNGDWFKTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVEVESLLYKHPRV  492

Query  536   DEAAVVARPDKFWGETPCAFVSLKKGI-------IAKPTEKEMREFCKERLPLFMVPRKV  378
              EAAVVA P   WGETPCAFVSL+K         I   TE E+  +C++ LP FMVP+ V
Sbjct  493   LEAAVVAMPHPRWGETPCAFVSLRKNNNNSSSSKIDDVTEAEIIAYCRKNLPHFMVPKVV  552

Query  377   VFMAALPKTSTGKIQKFLLRDIAR  306
              FM  LPKTSTGKIQKF LR +A+
Sbjct  553   KFMEELPKTSTGKIQKFELRVMAK  576



>gb|EYU21630.1| hypothetical protein MIMGU_mgv1a004128mg [Erythranthe guttata]
Length=543

 Score =   345 bits (885),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 225/314 (72%), Gaps = 7/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW   WG+AA+GGTNVCLR+V P  I  AI  H VTHM GAP VLNM+ N  +    
Sbjct  235   HCNGWCLIWGLAALGGTNVCLRQVLPEQIFAAIALHHVTHMGGAPTVLNMIVNSTHR---  291

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V+I+T GAPPP ++L ++E LGF VSH YGLTET G A +C WK EWD+LP  E
Sbjct  292   KPLPHKVEIMTGGAPPPPSILSKIEELGFNVSHLYGLTETYGPATSCVWKPEWDSLPLEE  351

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             R  +K+RQGV   G    DV    T KSV  DG  +GEI+ RGN+VM GYLKD + T + 
Sbjct  352   RFKLKARQGVEHYGLEEVDVRDSKTMKSVPNDGVTMGEIMFRGNTVMSGYLKDAKATEEA  411

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
                 GWF +GD+ V H DGY+E+KDRLKD++ISGGEN+S+VEVE+VLY HPAV EA+VVA
Sbjct  412   FS-GGWFRSGDLAVKHEDGYLELKDRLKDIVISGGENVSTVEVETVLYRHPAVLEASVVA  470

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WG+T CAFV +K+G+  + + KE+ +FC++RLP +M PR VVF   +PKTSTGKI
Sbjct  471   RPDDHWGQTVCAFVKIKEGL--EVSSKEIIDFCRDRLPHYMAPRTVVF-EDIPKTSTGKI  527

Query  335   QKFLLRDIARDLSS  294
             QKF+LR+ A+ + S
Sbjct  528   QKFILREKAKAMGS  541



>ref|XP_010536456.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal [Tarenaya 
hassleriana]
Length=557

 Score =   345 bits (886),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 221/314 (70%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW   WG AA+GGTN+CLR V    I D+I RH VTH+ GAP VLNM+ N       
Sbjct  240   HCNGWCMLWGTAALGGTNICLRNVTAKGIFDSISRHKVTHLGGAPTVLNMIINAPASER-  298

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V I+T  APPP  VL ++E LGF V+H YGLTET G    C+WK EWD+LP  E
Sbjct  299   KPLPGKVSIMTGAAPPPPHVLYQMEELGFSVTHSYGLTETYGPGTVCSWKPEWDSLPRDE  358

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +K+RQGV  +G    DV  P T KSV  DG  +GE+V RGN+VM GY K+PE T + 
Sbjct  359   QARLKARQGVNHLGIEEVDVKDPVTMKSVPSDGKTIGEVVFRGNTVMNGYFKNPEATKEA  418

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              +  GWF+TGD+GV H DGYI++KDR KD+IISGGEN+SS+EVESVLY HP V EAAVV 
Sbjct  419   FR-GGWFWTGDLGVKHSDGYIKLKDRSKDIIISGGENISSIEVESVLYTHPYVLEAAVVG  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD+ WGETPCAFV LK G  ++ + +E+ ++C+ERLP +M P+ +VF   LPKTSTGK+
Sbjct  478   RPDEHWGETPCAFVKLKSG--SRTSPEELVKYCRERLPHYMAPKTIVF-EDLPKTSTGKV  534

Query  335   QKFLLRDIARDLSS  294
             QK++LR  A  + S
Sbjct  535   QKYVLRKKAEAMGS  548



>gb|KHN24179.1| Putative acyl-activating enzyme 12, peroxisomal [Glycine soja]
Length=620

 Score =   347 bits (891),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 228/348 (66%), Gaps = 17/348 (5%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW++TWG+AA GGTNVCLR      I   I  H VTHMC AP+V N++         
Sbjct  252   HCNGWTFTWGLAARGGTNVCLRTTAARDIYSNIVLHNVTHMCCAPIVFNIILEAKQSEKI  311

Query  1055  K---PLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLP  885
                    SPV+ILT GAPPPA++L+++ESLGF V+H YGLTE  G A+ C W++EW+ LP
Sbjct  312   DIKLKRNSPVEILTGGAPPPASLLEQIESLGFHVTHAYGLTEATGPALVCEWQKEWNMLP  371

Query  884   APERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGT  705
               E+A +K+RQGV  +   G DV +  T +SV +DG  +GEIVL+G+ +M+GY KD E T
Sbjct  372   KKEQAQLKARQGVSVLTMAGVDVKNLDTMESVPKDGRTMGEIVLKGSGIMMGYFKDHEAT  431

Query  704   SKCM-----KEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPA  540
             SK           WF TGDVGVIHPDGY+E+KDR KDVIISGGEN+SSVEVES+LY HP 
Sbjct  432   SKAFFGSNNSNGDWFRTGDVGVIHPDGYLEIKDRSKDVIISGGENISSVEVESLLYRHPR  491

Query  539   VDEAAVVARPDKFWGETPCAFVSLK---------KGIIAKPTEKEMREFCKERLPLFMVP  387
             V EAAVVA P   WGE+PCAFVSL+            I   TE E+  +C++ LP FMVP
Sbjct  492   VLEAAVVAMPHPRWGESPCAFVSLRKNNNNNNNSSKKIDHVTEAEIIAYCRKNLPHFMVP  551

Query  386   RKVVFMAALPKTSTGKIQKFLLRDIARDLSSADAINANQNGIGHEINQ  243
             + V FM  LPKTSTGKIQKF LR +A+    ++     +N I  + +Q
Sbjct  552   KVVKFMEELPKTSTGKIQKFELRVMAKAFMVSENNVQTKNNINKKSSQ  599



>ref|XP_004145598.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal-like 
[Cucumis sativus]
 ref|XP_004164116.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal-like 
[Cucumis sativus]
 gb|KGN55494.1| hypothetical protein Csa_4G658540 [Cucumis sativus]
Length=559

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 227/314 (72%), Gaps = 4/314 (1%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGWS TWG+AA GGTN+C R V+   I   I  H VTHM GAP VLNM+ N       
Sbjct  240   HCNGWSMTWGVAAQGGTNICQRNVNAKEIFANISLHNVTHMGGAPTVLNMIVNAPITEQ-  298

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ++T GAPPP+ +L ++  LGF + H YGLTET G+A  C WK EWD+LP  +
Sbjct  299   KPLLGKVTVMTGGAPPPSNILYKMRELGFLIVHCYGLTETYGVATFCHWKPEWDSLPDEK  358

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             +A +KSRQG++ +G  G D+ +P T +SV  DG  +GE+++RGN+VM+GYLKD + T + 
Sbjct  359   QAKLKSRQGMQHIGVEGVDIKNPITMESVPADGKTMGEVMIRGNTVMIGYLKDVKATEEA  418

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
                 GWF +GD+GV HPDGYIE+KDR KD+IISGGEN+S++EVESVL+ HP+V EAA+V 
Sbjct  419   FN-GGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFNHPSVLEAAIVG  477

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WGETPCAFV+LK G  +  TE+E+ +FC++ LP +M P+ VVF + LPK+STGKI
Sbjct  478   RPDDHWGETPCAFVNLKHG--SNATEEEIIKFCRDNLPHYMAPKTVVFKSDLPKSSTGKI  535

Query  335   QKFLLRDIARDLSS  294
             QK +L++ A+ + +
Sbjct  536   QKLILKEEAKAMGT  549



>ref|XP_007046541.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
 gb|EOX90698.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
Length=588

 Score =   346 bits (888),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 223/314 (71%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW  TWG+AA GGTN+CLR V P  I + I  H VTHM GAP VLNM+ N       
Sbjct  278   HCNGWCLTWGVAAQGGTNICLRSVSPKEIFENIVLHNVTHMGGAPTVLNMIVNSRVSDQ-  336

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL+  V+I+T G+PPP  +L ++E LGF V+H YGLTET G    CAWK EWD+L   E
Sbjct  337   KPLSHKVEIMTGGSPPPPQILFKMEELGFSVNHLYGLTETYGPGTYCAWKPEWDSLLPDE  396

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             ++ +K+RQG++ +G    D+  P T +SV  DG  +GEI+ RGN+VM GYLKD + T K 
Sbjct  397   QSKLKARQGMQHLGLEEVDIRDPVTMESVPADGKTMGEIMFRGNTVMSGYLKDLQATEKA  456

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
                 GWF +GD+ V HPDGYIEVKDRLKD+IISGGEN+S+VEVE+VLY HPAV EAAVVA
Sbjct  457   FS-GGWFRSGDLAVKHPDGYIEVKDRLKDIIISGGENISTVEVETVLYGHPAVLEAAVVA  515

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WG+TPCAFV LK+G       +E+  FC++ LP +M PR V+F A LP+TSTGKI
Sbjct  516   RPDNHWGQTPCAFVKLKEGFAVN--AQELIRFCRDHLPHYMAPRTVIF-AELPRTSTGKI  572

Query  335   QKFLLRDIARDLSS  294
             QKF+LR+ A+ L S
Sbjct  573   QKFILREKAKALGS  586



>dbj|BAK01634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=567

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 226/315 (72%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW YTW +AA+ GT++CLR+V   +I  AI   GVTH CGAPVVLN + N       
Sbjct  247   HCNGWCYTWTLAAICGTSICLRQVTAKAIFSAIANQGVTHFCGAPVVLNTIINAPPVDTI  306

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL   VD++TAGA PP +VL  +  LGFRVSH YGL+ET G +  CAWK EWD LP  E
Sbjct  307   LPLPRVVDVMTAGAAPPPSVLAAMSKLGFRVSHTYGLSETYGPSTVCAWKPEWDILPDDE  366

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA ++SRQG+R VG  G DVV P +   V  DG+ +GEIV+RGN+VM GYLK+P+  ++ 
Sbjct  367   RARLQSRQGIRYVGLEGLDVVDPKSMAPVPADGSTLGEIVMRGNAVMKGYLKNPKANAEA  426

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               E+GWF++GD+GV HPDGYIEVKDR KD+IISGGEN+SS+EVE  +YMHPAV EA+VVA
Sbjct  427   F-ENGWFHSGDLGVRHPDGYIEVKDRAKDIIISGGENISSLEVEKAVYMHPAVLEASVVA  485

Query  515   RPDKFWGETPCAFVSLKKGIIAK---PTEKEMREFCKERLPLFMVPRKVVFMAALPKTST  345
             R D+ WGE+PCAFV+LK G+ +         + +FC+ERLP + VP+ VVF   LPKT+T
Sbjct  486   RADEQWGESPCAFVTLKDGVDSSDEAAMAANVIKFCRERLPGYWVPKSVVF-GPLPKTAT  544

Query  344   GKIQKFLLRDIARDL  300
             GKI+K  LR  A++L
Sbjct  545   GKIKKHELRAKAKEL  559



>ref|XP_004509425.1| PREDICTED: probable acyl-activating enzyme 2-like [Cicer arietinum]
Length=586

 Score =   346 bits (887),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 224/314 (71%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW   WG+AA  GTN+CLR+V P +I D I +H VTHM GAP VLNM+ N       
Sbjct  266   HCNGWCLPWGVAAQFGTNICLRKVSPENIFDNIIQHKVTHMGGAPTVLNMIVNSALTYR-  324

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL   V ++TAG+PPP  +L ++E +GF +SH YGLTET G    CAW+ EWD LP  E
Sbjct  325   KPLKHKVVVMTAGSPPPPQILSKMEEIGFSISHLYGLTETYGPGTFCAWRPEWDMLPPQE  384

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             R+ +KSRQGV  VG    DV  P T +SV  DG  VGE++ RGN+VM GY +D + T + 
Sbjct  385   RSKMKSRQGVPHVGLEEIDVKDPATMESVVADGKSVGEVMFRGNTVMSGYYRDLKATKEA  444

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
              + DGWF++GD+ V H DGYIEVKDRLKDVI+SGGEN+SSVEVE+VLY HPAV EAAVVA
Sbjct  445   FR-DGWFHSGDLAVKHCDGYIEVKDRLKDVILSGGENISSVEVETVLYSHPAVLEAAVVA  503

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WGETPCAF+ LK G  +    +E+  FC+ERLP +M P+ ++F+  +PKTSTGKI
Sbjct  504   RPDDHWGETPCAFLKLKDG--SDANAEEIITFCRERLPHYMAPKTIIFL-EMPKTSTGKI  560

Query  335   QKFLLRDIARDLSS  294
             QK++LR+ A+ L S
Sbjct  561   QKYILREKAKALGS  574



>ref|XP_008650750.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal [Zea 
mays]
 tpg|DAA43215.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=644

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 218/315 (69%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW+  WG+A  GGTNVCLR      I D+I RHGVTHM GAP VLNM+AN       
Sbjct  324   HCNGWNLPWGVAMQGGTNVCLRHFTGEVIFDSITRHGVTHMGGAPTVLNMMANARTATAE  383

Query  1055  -KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAP  879
              KPL  PV ++T GAPPP  VL  VE LGF V   YGLTET G A  C W  EWD LPA 
Sbjct  384   RKPLPWPVRVMTGGAPPPPRVLFAVEELGFVVYQIYGLTETYGPATVCTWMPEWDALPAE  443

Query  878   ERAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSK  699
             ERA +K+RQG   V     DV++P T +SV  DG  VGE++ RGN+VM GY KD + T +
Sbjct  444   ERARLKARQGFHHVAMQDVDVMNPSTMESVPHDGQTVGEVMFRGNTVMSGYYKDLKATKE  503

Query  698   CMKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVV  519
              M   GW +TGD+ V HPDGYI++KDR KD+IISGGEN+SS+EVESV++ HPAV EAAVV
Sbjct  504   SMA-GGWLHTGDLAVRHPDGYIQIKDRAKDIIISGGENISSIEVESVIFSHPAVLEAAVV  562

Query  518   ARPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGK  339
             ARPD  WGETPCAFV LK G  A  TE E+  FC+E+LP +M P+ VVF   LPKTSTGK
Sbjct  563   ARPDHHWGETPCAFVKLKDG--ASATEAEIINFCREKLPHYMAPKTVVF-EDLPKTSTGK  619

Query  338   IQKFLLRDIARDLSS  294
              QKF+LRD AR + S
Sbjct  620   TQKFVLRDKARAMGS  634



>ref|XP_003558087.1| PREDICTED: acetate/butyrate--CoA ligase AAE7, peroxisomal-like 
[Brachypodium distachyon]
Length=567

 Score =   345 bits (884),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 224/315 (71%), Gaps = 5/315 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW YTW +AA+ GTN+CLR+V   +I  AI   GVTH C AP+VLN + N       
Sbjct  247   HCNGWCYTWALAAICGTNICLRQVTAKAIFSAIASQGVTHFCAAPIVLNAIINAPPADTI  306

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
              PL   VD++TAGA PP +VL  +  LGFRV+H YGL+ET G +  CAWK EWD+LPA E
Sbjct  307   LPLPRVVDVMTAGAAPPPSVLASMSKLGFRVTHTYGLSETYGPSTVCAWKPEWDSLPADE  366

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA + +RQG+R VG  G DVV P +   V  DG+ +GEIV+RGN+VM GYLK+P+  ++ 
Sbjct  367   RARLHARQGIRYVGMEGLDVVDPKSMAPVPADGSTLGEIVMRGNAVMKGYLKNPKANAEA  426

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
               E+GWF++GD+GV HPDGYIEVKDR KD+IISGGEN+SS+EVE  +Y+HPAV EA+VVA
Sbjct  427   F-ENGWFHSGDLGVRHPDGYIEVKDRAKDIIISGGENISSLEVEKAVYLHPAVLEASVVA  485

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEK---EMREFCKERLPLFMVPRKVVFMAALPKTST  345
             R D+ WGE+PCAF++LK G+           +  FC+ERLP + VP+ VVF   LPKT+T
Sbjct  486   RSDEQWGESPCAFITLKDGVDGSNEAALAGNIMSFCRERLPGYWVPKSVVF-GPLPKTAT  544

Query  344   GKIQKFLLRDIARDL  300
             GKI+K  LR  A++L
Sbjct  545   GKIKKHELRAKAKEL  559



>ref|XP_010266145.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal isoform 
X3 [Nelumbo nucifera]
Length=471

 Score =   342 bits (876),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 222/323 (69%), Gaps = 5/323 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW   WG+A  GGTN+CLR+V P  I D+I  H VTHM GAP VLN + N       
Sbjct  154   HCNGWCLIWGVAVQGGTNICLRKVSPKGIFDSIVLHKVTHMGGAPTVLNTIVNAAASDR-  212

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             +PL   V+++T G+PP   +L ++E LGF VSH YGLTET G    C WK EWD+LP  +
Sbjct  213   RPLPHKVEVMTGGSPPHPHILSKMEELGFGVSHLYGLTETYGPGTVCTWKPEWDSLPPSQ  272

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA IKSRQG+  VG    D+  P T KSV  DG  +GE++ RGN+VM GY KD + T + 
Sbjct  273   RAKIKSRQGIYHVGLEEVDIRDPITMKSVPPDGKTIGEVMFRGNTVMSGYFKDLKATEEA  332

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
                 GWF +GD+G+ H DGYIE+KDR KD+IISGGEN+SS+EVESVL+ HPA+ EAAVVA
Sbjct  333   F-SGGWFRSGDLGIKHADGYIELKDRSKDIIISGGENISSIEVESVLFSHPAILEAAVVA  391

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WG+TPCAFV LK+G  A  + +E+ +FC++RLP +M PR V+F   LPKT TGK 
Sbjct  392   RPDDHWGDTPCAFVKLKEGKNA--SAEEIIKFCRDRLPHYMAPRTVIF-EDLPKTYTGKT  448

Query  335   QKFLLRDIARDLSSADAINANQN  267
             QKF LR+ A+ + S    NAN+N
Sbjct  449   QKFALREKAKAMGSLTKGNANKN  471



>ref|XP_004985815.1| PREDICTED: probable acyl-activating enzyme 1, peroxisomal-like 
[Setaria italica]
Length=637

 Score =   347 bits (889),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/314 (59%), Positives = 218/314 (69%), Gaps = 5/314 (2%)
 Frame = -2

Query  1235  HANGWSYTWGMAAVGGTNVCLRRVDPASINDAIERHGVTHMCGAPvvlnmlanynnyaNT  1056
             H NGW+  WG+A  GGTNVCLR      I D+I RHGVTHM GAP VLNM+AN       
Sbjct  320   HCNGWNLPWGVAMQGGTNVCLRHFTAKVIFDSIARHGVTHMGGAPTVLNMIANLPAADR-  378

Query  1055  KPLTSPVDILTAGAPPPAAVLQRVESLGFRVSHGYGLTETGGLAVTCAWKREWDNLPAPE  876
             KPL  PV ++T GAPPP  VL  VE LGF V H YGLTET G A  C W  EWD LPA E
Sbjct  379   KPLPGPVRVMTGGAPPPPRVLFAVEELGFVVYHIYGLTETYGPATVCTWMPEWDALPAEE  438

Query  875   RAAIKSRQGVRSVGFTGADVVHPHTGKSVKRDGNMVGEIVLRGNSVMLGYLKDPEGTSKC  696
             RA +K+RQG   +     DV +P T +SV  DG  +GE++ RGN+VM GY KD + T + 
Sbjct  439   RARLKARQGSHHIAMQDVDVKNPDTMESVPHDGRTLGEVMFRGNTVMSGYYKDLKATQES  498

Query  695   MKEDGWFYTGDVGVIHPDGYIEVKDRLKDVIISGGENLSSVEVESVLYMHPAVDEAAVVA  516
             M   GW ++GD+ V HPDGYI+++DR KD+IISGGEN+SS+EVESV++ HPAV EAAVVA
Sbjct  499   MA-GGWLHSGDLAVRHPDGYIQLRDRAKDIIISGGENISSIEVESVIFSHPAVLEAAVVA  557

Query  515   RPDKFWGETPCAFVSLKKGIIAKPTEKEMREFCKERLPLFMVPRKVVFMAALPKTSTGKI  336
             RPD  WGETPCAFV LK G  A  TE E+  FC+ERLP +M P+ VVF   LPKTSTGK 
Sbjct  558   RPDDHWGETPCAFVKLKDG--ASATEAEIISFCRERLPHYMAPKTVVF-EDLPKTSTGKT  614

Query  335   QKFLLRDIARDLSS  294
             QKF+LRD AR + S
Sbjct  615   QKFVLRDKARAMGS  628



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3179161390600