BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16061_g2_i1 len=821 path=[2319:0-211 1522:212-252 2570:253-820]

Length=821
                                                                      Score     E

ref|XP_004241771.1|  PREDICTED: uncharacterized protein At2g34160       204   3e-62   
ref|XP_009771917.1|  PREDICTED: uncharacterized protein At2g34160...    203   5e-62   
ref|XP_006353679.1|  PREDICTED: uncharacterized protein At2g34160...    202   9e-62   
ref|XP_004241781.1|  PREDICTED: uncharacterized protein At2g34160       202   9e-62   
ref|XP_009785780.1|  PREDICTED: uncharacterized protein At2g34160...    202   9e-62   
ref|XP_006353694.1|  PREDICTED: uncharacterized protein At2g34160...    202   1e-61   
ref|XP_009606374.1|  PREDICTED: uncharacterized protein At2g34160...    201   5e-61   
ref|XP_009627569.1|  PREDICTED: uncharacterized protein At2g34160...    200   6e-61   
emb|CDP13492.1|  unnamed protein product                                196   5e-59   
ref|XP_007013844.1|  Alba DNA/RNA-binding protein                       186   3e-55   
ref|XP_002515535.1|  conserved hypothetical protein                     185   5e-55   Ricinus communis
gb|KDP33611.1|  hypothetical protein JCGZ_07182                         185   5e-55   
ref|XP_010925231.1|  PREDICTED: uncharacterized protein At2g34160...    185   8e-55   
ref|XP_006483339.1|  PREDICTED: uncharacterized protein At2g34160...    184   9e-55   
ref|XP_011039708.1|  PREDICTED: uncharacterized protein At2g34160...    184   1e-54   
ref|XP_011093556.1|  PREDICTED: uncharacterized protein At2g34160...    184   2e-54   
ref|XP_002324292.1|  hypothetical protein POPTR_0018s01550g             183   4e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011026458.1|  PREDICTED: uncharacterized protein At2g34160...    183   4e-54   
ref|XP_002308658.1|  hypothetical protein POPTR_0006s26820g             182   1e-53   Populus trichocarpa [western balsam poplar]
gb|ABK94195.1|  unknown                                                 181   3e-53   Populus trichocarpa [western balsam poplar]
gb|EYU23047.1|  hypothetical protein MIMGU_mgv1a016236mg                180   4e-53   
ref|XP_004965953.1|  PREDICTED: uncharacterized protein At2g34160...    180   7e-53   
ref|XP_002524472.1|  conserved hypothetical protein                     179   2e-52   Ricinus communis
ref|NP_001236789.1|  uncharacterized protein LOC100305539               179   2e-52   
ref|XP_006450467.1|  hypothetical protein CICLE_v10009882mg             179   2e-52   
gb|KHN47771.1|  Hypothetical protein glysoja_029189                     179   2e-52   
gb|KHF98627.1|  hypothetical protein F383_16439                         178   3e-52   
ref|XP_007135740.1|  hypothetical protein PHAVU_010G154500g             178   3e-52   
ref|XP_007150730.1|  hypothetical protein PHAVU_005G176200g             178   3e-52   
gb|KHN01341.1|  Hypothetical protein glysoja_009547                     178   3e-52   
ref|XP_008351650.1|  PREDICTED: uncharacterized protein At2g34160...    178   3e-52   
gb|KHF98816.1|  hypothetical protein F383_17190                         178   4e-52   
gb|KHN44168.1|  Hypothetical protein glysoja_031829                     178   4e-52   
ref|XP_002437246.1|  hypothetical protein SORBIDRAFT_10g023460          177   6e-52   Sorghum bicolor [broomcorn]
ref|XP_010093232.1|  Uncharacterized protein L484_022390                177   8e-52   
ref|XP_006303421.1|  hypothetical protein CARUB_v10010630mg             177   8e-52   
emb|CDP10391.1|  unnamed protein product                                177   9e-52   
ref|XP_004150019.1|  PREDICTED: uncharacterized protein At2g34160...    177   1e-51   
ref|XP_004506910.1|  PREDICTED: uncharacterized protein At2g34160...    177   1e-51   
ref|XP_002285115.1|  PREDICTED: uncharacterized protein At2g34160       177   1e-51   Vitis vinifera
ref|XP_009407663.1|  PREDICTED: uncharacterized protein At2g34160...    176   1e-51   
ref|NP_001058008.1|  Os06g0602600                                       176   1e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009778747.1|  PREDICTED: uncharacterized protein At2g34160...    176   1e-51   
ref|XP_008784950.1|  PREDICTED: uncharacterized protein At2g34160...    176   1e-51   
ref|XP_009626436.1|  PREDICTED: uncharacterized protein At2g34160...    176   1e-51   
ref|XP_002879480.1|  nucleic acid binding protein                       176   1e-51   
gb|KEH28695.1|  alba DNA/RNA-binding protein                            176   2e-51   
ref|NP_001238733.1|  uncharacterized protein LOC100527358               176   2e-51   
gb|KFK36323.1|  hypothetical protein AALP_AA4G107800                    176   2e-51   
ref|XP_011081577.1|  PREDICTED: uncharacterized protein At2g34160...    175   3e-51   
ref|XP_009626435.1|  PREDICTED: uncharacterized protein At2g34160...    176   3e-51   
emb|CBI36290.3|  unnamed protein product                                175   3e-51   
ref|NP_564325.1|  Alba DNA/RNA-binding protein                          175   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250057.1|  PREDICTED: uncharacterized protein At2g34160...    175   5e-51   
ref|NP_565781.1|  Alba DNA/RNA-binding protein                          175   6e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499438.1|  PREDICTED: uncharacterized protein At2g34160...    174   6e-51   
gb|EPS62998.1|  hypothetical protein M569_11792                         174   6e-51   
ref|XP_007013411.1|  Alba DNA/RNA-binding protein                       174   7e-51   
ref|XP_011081297.1|  PREDICTED: uncharacterized protein At2g34160...    174   9e-51   
ref|XP_009626434.1|  PREDICTED: uncharacterized protein At2g34160...    177   1e-50   
ref|XP_006295225.1|  hypothetical protein CARUB_v10024310mg             174   1e-50   
ref|XP_009343699.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    175   1e-50   
ref|NP_001236521.1|  uncharacterized protein LOC100527472               174   1e-50   
ref|XP_010509790.1|  PREDICTED: uncharacterized protein At2g34160       174   2e-50   
emb|CDY50785.1|  BnaA09g54140D                                          174   2e-50   
ref|XP_002285046.1|  PREDICTED: uncharacterized protein At2g34160       174   2e-50   Vitis vinifera
ref|XP_010914880.1|  PREDICTED: uncharacterized protein At2g34160...    173   2e-50   
ref|XP_010061927.1|  PREDICTED: uncharacterized protein At2g34160...    173   2e-50   
ref|XP_010469393.1|  PREDICTED: uncharacterized protein At2g34160...    173   2e-50   
ref|XP_010538212.1|  PREDICTED: uncharacterized protein At2g34160...    173   2e-50   
ref|XP_003563670.1|  PREDICTED: uncharacterized protein At2g34160...    173   2e-50   
ref|XP_004302971.1|  PREDICTED: uncharacterized protein At2g34160...    173   2e-50   
ref|XP_010097254.1|  Uncharacterized protein L484_025803                173   3e-50   
dbj|BAJ98262.1|  predicted protein                                      173   3e-50   
ref|XP_009403457.1|  PREDICTED: uncharacterized protein At2g34160...    173   3e-50   
ref|XP_006415602.1|  hypothetical protein EUTSA_v10009096mg             173   3e-50   
ref|XP_002890797.1|  nucleic acid binding protein                       173   3e-50   
gb|KFK44753.1|  hypothetical protein AALP_AA1G298400                    173   3e-50   
ref|XP_008339666.1|  PREDICTED: uncharacterized protein At2g34160...    174   4e-50   
ref|XP_006450953.1|  hypothetical protein CICLE_v10009883mg             172   5e-50   
ref|XP_007215146.1|  hypothetical protein PRUPE_ppa013322mg             172   5e-50   
ref|XP_008243714.1|  PREDICTED: uncharacterized protein At2g34160...    172   5e-50   
ref|XP_008457716.1|  PREDICTED: uncharacterized protein At2g34160...    172   6e-50   
ref|XP_010413770.1|  PREDICTED: uncharacterized protein At2g34160...    172   7e-50   
ref|XP_009115263.1|  PREDICTED: uncharacterized protein At2g34160...    172   8e-50   
ref|XP_010254376.1|  PREDICTED: uncharacterized protein At2g34160...    172   8e-50   
ref|XP_008219479.1|  PREDICTED: uncharacterized protein At2g34160...    172   8e-50   
ref|XP_004139317.1|  PREDICTED: uncharacterized protein At2g34160...    172   1e-49   
ref|XP_009381121.1|  PREDICTED: uncharacterized protein At2g34160...    171   1e-49   
ref|XP_008792056.1|  PREDICTED: uncharacterized protein At2g34160...    171   1e-49   
gb|EMT03371.1|  hypothetical protein F775_28656                         171   1e-49   
emb|CDY17226.1|  BnaA05g09620D                                          171   1e-49   
gb|AGS17822.1|  hypothetical protein                                    172   2e-49   
ref|XP_010049985.1|  PREDICTED: uncharacterized protein At2g34160...    171   2e-49   
ref|XP_009143800.1|  PREDICTED: uncharacterized protein At2g34160       171   3e-49   
ref|XP_009102872.1|  PREDICTED: uncharacterized protein At2g34160...    170   3e-49   
gb|EYU24652.1|  hypothetical protein MIMGU_mgv1a016184mg                170   4e-49   
ref|XP_009402892.1|  PREDICTED: uncharacterized protein At2g34160...    170   4e-49   
ref|XP_007225832.1|  hypothetical protein PRUPE_ppa011574mg             172   4e-49   
ref|XP_006656212.1|  PREDICTED: uncharacterized protein At2g34160...    169   7e-49   
ref|XP_004168112.1|  PREDICTED: uncharacterized protein At2g34160...    169   7e-49   
ref|XP_010549407.1|  PREDICTED: uncharacterized protein At2g34160...    169   8e-49   
ref|XP_008366692.1|  PREDICTED: uncharacterized protein At2g34160...    169   9e-49   
emb|CDX94654.1|  BnaC07g10040D                                          169   1e-48   
ref|XP_009388523.1|  PREDICTED: uncharacterized protein At2g34160...    169   1e-48   
gb|AFK38642.1|  unknown                                                 169   1e-48   
gb|AFK35646.1|  unknown                                                 169   1e-48   
gb|AFK40867.1|  unknown                                                 169   1e-48   
emb|CDY15643.1|  BnaA07g08140D                                          169   1e-48   
ref|XP_009109679.1|  PREDICTED: uncharacterized protein At2g34160...    168   2e-48   
ref|XP_006410558.1|  hypothetical protein EUTSA_v10017416mg             168   2e-48   
ref|XP_004951528.1|  PREDICTED: uncharacterized protein At2g34160...    168   3e-48   
ref|XP_006647046.1|  PREDICTED: uncharacterized protein At2g34160...    167   4e-48   
gb|KHF97780.1|  hypothetical protein F383_15777                         167   4e-48   
emb|CDY43326.1|  BnaC03g58980D                                          167   5e-48   
emb|CDX99800.1|  BnaC05g22220D                                          167   6e-48   
ref|XP_001768991.1|  predicted protein                                  166   9e-48   
ref|XP_002453505.1|  hypothetical protein SORBIDRAFT_04g007020          167   1e-47   Sorghum bicolor [broomcorn]
ref|XP_009348607.1|  PREDICTED: uncharacterized protein At2g34160...    166   1e-47   
ref|XP_006837817.1|  hypothetical protein AMTR_s00104p00132470          165   3e-47   
ref|XP_006356204.1|  PREDICTED: uncharacterized protein At2g34160...    165   3e-47   
ref|XP_004486682.1|  PREDICTED: uncharacterized protein At2g34160...    165   3e-47   
ref|XP_004968373.1|  PREDICTED: uncharacterized protein At2g34160...    165   5e-47   
ref|XP_008394068.1|  PREDICTED: uncharacterized protein At2g34160...    165   5e-47   
ref|XP_004241699.1|  PREDICTED: uncharacterized protein At2g34160...    164   6e-47   
gb|ABK22189.1|  unknown                                                 164   6e-47   Picea sitchensis
ref|XP_003597872.1|  hypothetical protein MTR_2g103500                  164   7e-47   
ref|XP_009355722.1|  PREDICTED: uncharacterized protein At2g34160...    164   9e-47   
emb|CDO98136.1|  unnamed protein product                                164   1e-46   
ref|XP_010526208.1|  PREDICTED: uncharacterized protein At2g34160...    163   1e-46   
dbj|BAD15498.1|  unknown protein                                        164   2e-46   Oryza sativa Japonica Group [Japonica rice]
pdb|1VM0|A  Chain A, X-Ray Structure Of Gene Product From Arabido...    163   2e-46   
ref|XP_009408969.1|  PREDICTED: uncharacterized protein At2g34160...    162   4e-46   
ref|NP_001143331.1|  uncharacterized protein LOC100275927               162   4e-46   Zea mays [maize]
gb|KHG16323.1|  hypothetical protein F383_08228                         162   5e-46   
ref|XP_008659718.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    160   2e-45   
ref|XP_010525972.1|  PREDICTED: uncharacterized protein At2g34160...    160   2e-45   
gb|ABK24162.1|  unknown                                                 160   4e-45   Picea sitchensis
gb|ABR26175.1|  unknown                                                 159   4e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_001769016.1|  predicted protein                                  159   9e-45   
ref|XP_007030533.1|  Alba DNA/RNA-binding protein                       158   1e-44   
ref|XP_006450468.1|  hypothetical protein CICLE_v10009882mg             158   1e-44   
ref|XP_004304756.1|  PREDICTED: uncharacterized protein At2g34160...    159   1e-44   
ref|XP_011032375.1|  PREDICTED: uncharacterized protein At2g34160       159   2e-44   
ref|NP_001142884.1|  uncharacterized protein LOC100275297               158   2e-44   Zea mays [maize]
gb|KDP32385.1|  hypothetical protein JCGZ_13310                         157   2e-44   
gb|AGT16645.1|  hypothetical protein SHCRBa_170_C07_R_130               158   3e-44   
ref|XP_006643815.1|  PREDICTED: uncharacterized protein At2g34160...    158   3e-44   
ref|XP_004968371.1|  PREDICTED: uncharacterized protein At2g34160...    158   4e-44   
ref|XP_004139384.1|  PREDICTED: uncharacterized protein At2g34160...    157   4e-44   
ref|XP_008456222.1|  PREDICTED: uncharacterized protein At2g34160       157   4e-44   
ref|XP_010688018.1|  PREDICTED: uncharacterized protein At2g34160...    157   4e-44   
ref|XP_010549408.1|  PREDICTED: uncharacterized protein At2g34160...    157   4e-44   
gb|KHG14530.1|  hypothetical protein F383_02218                         157   5e-44   
ref|NP_001281224.1|  LOC100284257                                       157   5e-44   
gb|ABK26422.1|  unknown                                                 157   5e-44   Picea sitchensis
ref|XP_006382820.1|  hypothetical protein POPTR_0005s05780g             157   8e-44   
dbj|BAJ87819.1|  predicted protein                                      156   9e-44   
ref|NP_001288491.1|  uncharacterized protein LOC103649688               157   9e-44   
ref|NP_001141319.1|  uncharacterized protein LOC100273410               156   1e-43   Zea mays [maize]
gb|ACN31274.1|  unknown                                                 156   2e-43   Zea mays [maize]
ref|XP_003571486.1|  PREDICTED: uncharacterized protein At2g34160...    155   2e-43   
ref|XP_002521944.1|  conserved hypothetical protein                     156   2e-43   Ricinus communis
ref|XP_008243713.1|  PREDICTED: uncharacterized protein At2g34160...    156   2e-43   
ref|XP_004495605.1|  PREDICTED: uncharacterized protein At2g34160...    155   2e-43   
ref|XP_002319085.2|  hypothetical protein POPTR_0013s04020g             156   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010675061.1|  PREDICTED: uncharacterized protein At2g34160       155   3e-43   
ref|XP_009372174.1|  PREDICTED: uncharacterized protein At2g34160       155   3e-43   
ref|XP_011038549.1|  PREDICTED: uncharacterized protein At2g34160...    155   3e-43   
gb|KEH43002.1|  alba DNA/RNA-binding protein                            154   4e-43   
ref|XP_004291467.1|  PREDICTED: uncharacterized protein At2g34160...    154   4e-43   
ref|XP_010519975.1|  PREDICTED: uncharacterized protein At2g34160...    155   4e-43   
ref|XP_004230078.2|  PREDICTED: uncharacterized protein At2g34160       155   6e-43   
ref|XP_007206133.1|  hypothetical protein PRUPE_ppa013191mg             154   6e-43   
ref|XP_006410557.1|  hypothetical protein EUTSA_v10017416mg             154   7e-43   
emb|CAN60466.1|  hypothetical protein VITISV_012496                     155   7e-43   Vitis vinifera
ref|XP_008370716.1|  PREDICTED: uncharacterized protein At2g34160...    154   8e-43   
ref|XP_002455102.1|  hypothetical protein SORBIDRAFT_03g004340          154   9e-43   Sorghum bicolor [broomcorn]
ref|XP_009151257.1|  PREDICTED: uncharacterized protein At2g34160...    154   1e-42   
ref|XP_010417092.1|  PREDICTED: uncharacterized protein At2g34160...    154   1e-42   
ref|XP_010670649.1|  PREDICTED: uncharacterized protein At2g34160...    154   1e-42   
gb|KDP23684.1|  hypothetical protein JCGZ_23517                         154   2e-42   
ref|XP_003535371.1|  PREDICTED: uncharacterized protein At2g34160...    153   2e-42   
emb|CDP06841.1|  unnamed protein product                                152   2e-42   
ref|XP_006395024.1|  hypothetical protein EUTSA_v10005588mg             154   2e-42   
ref|XP_006487872.1|  PREDICTED: uncharacterized protein At2g34160...    153   3e-42   
ref|XP_009630719.1|  PREDICTED: uncharacterized protein At2g34160       153   3e-42   
ref|XP_009364477.1|  PREDICTED: uncharacterized protein At2g34160...    152   4e-42   
ref|XP_008350636.1|  PREDICTED: uncharacterized protein At2g34160...    152   5e-42   
ref|XP_009134767.1|  PREDICTED: uncharacterized protein At2g34160...    152   5e-42   
ref|NP_001042157.1|  Os01g0173100                                       152   6e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010463944.1|  PREDICTED: uncharacterized protein At2g34160...    152   6e-42   
ref|XP_011091961.1|  PREDICTED: uncharacterized protein At2g34160...    152   6e-42   
ref|XP_010550911.1|  PREDICTED: uncharacterized protein At2g34160       152   6e-42   
gb|KDO48762.1|  hypothetical protein CISIN_1g038360mg                   152   7e-42   
gb|AFK44427.1|  unknown                                                 151   7e-42   
ref|XP_009124184.1|  PREDICTED: uncharacterized protein At2g34160...    152   9e-42   
ref|XP_006299145.1|  hypothetical protein CARUB_v10015288mg             152   1e-41   
ref|XP_009790071.1|  PREDICTED: uncharacterized protein At2g34160       152   1e-41   
ref|XP_003569410.1|  PREDICTED: uncharacterized protein At2g34160...    151   1e-41   
ref|XP_003566493.2|  PREDICTED: uncharacterized protein At2g34160...    150   2e-41   
gb|EYU30530.1|  hypothetical protein MIMGU_mgv1a015883mg                150   2e-41   
gb|KFK37876.1|  hypothetical protein AALP_AA3G040800                    151   2e-41   
dbj|BAJ86084.1|  predicted protein                                      150   3e-41   
emb|CDM81981.1|  unnamed protein product                                150   3e-41   
ref|XP_002966653.1|  hypothetical protein SELMODRAFT_86023              149   4e-41   
ref|XP_002978089.1|  hypothetical protein SELMODRAFT_176795             149   4e-41   
ref|XP_010102274.1|  Uncharacterized protein L484_024556                151   4e-41   
ref|XP_006408171.1|  hypothetical protein EUTSA_v10021676mg             150   4e-41   
ref|XP_009111897.1|  PREDICTED: uncharacterized protein At2g34160...    150   4e-41   
ref|XP_006347728.1|  PREDICTED: uncharacterized protein At2g34160...    150   5e-41   
ref|XP_002884455.1|  nucleic acid binding protein                       149   9e-41   
ref|XP_002962432.1|  hypothetical protein SELMODRAFT_141130             148   1e-40   
ref|XP_011087389.1|  PREDICTED: uncharacterized protein At2g34160...    147   2e-40   
ref|XP_010485843.1|  PREDICTED: uncharacterized protein At2g34160...    149   2e-40   
ref|XP_002440693.1|  hypothetical protein SORBIDRAFT_09g005260          147   2e-40   Sorghum bicolor [broomcorn]
gb|KGN60668.1|  hypothetical protein Csa_2G006140                       146   2e-40   
ref|XP_009124986.1|  PREDICTED: uncharacterized protein At2g34160...    148   3e-40   
ref|NP_187113.1|  DUO1-activated nucleic acid binding protein           148   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004960818.1|  PREDICTED: uncharacterized protein At2g34160...    147   4e-40   
emb|CDX74179.1|  BnaA03g28680D                                          148   4e-40   
emb|CDY40664.1|  BnaC03g33800D                                          148   4e-40   
ref|XP_003555573.1|  PREDICTED: uncharacterized protein At2g34160...    146   7e-40   
gb|AFW87068.1|  hypothetical protein ZEAMMB73_637233                    145   9e-40   
ref|XP_004486681.1|  PREDICTED: uncharacterized protein At2g34160...    143   1e-38   
ref|XP_003520842.1|  PREDICTED: uncharacterized protein At2g34160...    142   2e-38   
gb|KHN31472.1|  Hypothetical protein glysoja_035579                     142   2e-38   
emb|CDX86203.1|  BnaA06g29200D                                          143   3e-38   
emb|CDY41887.1|  BnaC05g47170D                                          142   6e-38   
ref|XP_008656129.1|  PREDICTED: uncharacterized protein At2g34160...    142   1e-37   
emb|CDY50744.1|  BnaAnng10510D                                          141   1e-37   
ref|XP_009396606.1|  PREDICTED: uncharacterized protein At2g34160...    140   2e-37   
gb|EMT17314.1|  hypothetical protein F775_31902                         141   2e-37   
ref|XP_009111898.1|  PREDICTED: uncharacterized protein At2g34160...    140   3e-37   
ref|XP_010027179.1|  PREDICTED: uncharacterized protein At2g34160       139   4e-37   
ref|XP_007147186.1|  hypothetical protein PHAVU_006G103000g             141   5e-37   
gb|KHG08649.1|  hypothetical protein F383_35638                         136   2e-36   
ref|XP_009396723.1|  PREDICTED: uncharacterized protein At2g34160...    137   3e-36   
emb|CDY21118.1|  BnaA01g33490D                                          137   3e-36   
emb|CBI26374.3|  unnamed protein product                                137   3e-36   
ref|XP_002280347.1|  PREDICTED: uncharacterized protein At2g34160...    137   3e-36   Vitis vinifera
ref|XP_006577294.1|  PREDICTED: uncharacterized protein At2g34160...    137   3e-36   
ref|XP_010274159.1|  PREDICTED: uncharacterized protein At2g34160...    137   4e-36   
ref|XP_010905447.1|  PREDICTED: uncharacterized protein At2g34160...    137   5e-36   
emb|CDY30010.1|  BnaC01g39980D                                          137   6e-36   
ref|XP_010672114.1|  PREDICTED: uncharacterized protein At2g34160...    135   3e-35   
ref|XP_006583129.1|  PREDICTED: uncharacterized protein At2g34160...    132   1e-34   
gb|AFW81391.1|  hypothetical protein ZEAMMB73_168635                    134   2e-34   
ref|XP_010932895.1|  PREDICTED: uncharacterized protein At2g34160...    132   2e-34   
ref|XP_004968372.1|  PREDICTED: uncharacterized protein At2g34160...    132   2e-34   
gb|ADA61009.1|  unknown                                                 130   3e-34   Dimocarpus longan [longan]
ref|XP_006664564.1|  PREDICTED: uncharacterized protein At2g34160...    132   3e-34   
ref|NP_001066795.1|  Os12g0489300                                       132   5e-34   Oryza sativa Japonica Group [Japonica rice]
gb|KHN43179.1|  Hypothetical protein glysoja_001762                     130   7e-34   
ref|NP_001236091.1|  uncharacterized protein LOC100305998               130   7e-34   
ref|XP_008662548.1|  PREDICTED: uncharacterized protein At2g34160...    132   9e-34   
ref|XP_002443196.1|  hypothetical protein SORBIDRAFT_08g015030          132   9e-34   Sorghum bicolor [broomcorn]
ref|XP_004964126.1|  PREDICTED: uncharacterized protein At2g34160...    132   1e-33   
emb|CDM85818.1|  unnamed protein product                                131   2e-33   
gb|EAY72729.1|  hypothetical protein OsI_00594                          129   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_003575507.1|  PREDICTED: uncharacterized protein At2g34160...    130   3e-33   
emb|CDY00026.1|  BnaC09g02750D                                          128   4e-33   
dbj|BAK08244.1|  predicted protein                                      130   4e-33   
emb|CDY57017.1|  BnaA09g03470D                                          128   5e-33   
gb|EPS61680.1|  nucleic acid binding protein                            127   6e-33   
gb|KDO61695.1|  hypothetical protein CISIN_1g032962mg                   125   2e-32   
gb|EMT04756.1|  hypothetical protein F775_33190                         121   1e-30   
ref|XP_006356205.1|  PREDICTED: uncharacterized protein At2g34160...    120   2e-30   
emb|CBI17465.3|  unnamed protein product                                123   3e-30   
ref|XP_008345770.1|  PREDICTED: uncharacterized protein At2g34160...    117   5e-29   
ref|XP_010932894.1|  PREDICTED: uncharacterized protein At2g34160...    118   1e-28   
ref|XP_005648128.1|  hypothetical protein COCSUDRAFT_53397              117   2e-28   
ref|XP_007144840.1|  hypothetical protein PHAVU_007G1886000g            112   2e-27   
emb|CDO99171.1|  unnamed protein product                                112   6e-27   
ref|XP_010541761.1|  PREDICTED: uncharacterized protein At2g34160...    109   3e-26   
ref|XP_009378793.1|  PREDICTED: uncharacterized protein At2g34160...    110   1e-25   
ref|XP_011073496.1|  PREDICTED: uncharacterized protein At2g34160...    109   2e-25   
ref|XP_010087791.1|  Uncharacterized protein L484_016362                108   3e-25   
ref|XP_004511396.1|  PREDICTED: uncharacterized protein At2g34160...    107   4e-25   
gb|EMT11085.1|  hypothetical protein F775_17922                         106   5e-25   
ref|XP_003517563.1|  PREDICTED: uncharacterized protein At2g34160...    107   7e-25   
ref|XP_004134424.1|  PREDICTED: uncharacterized protein At2g34160...    107   9e-25   
ref|XP_008224416.1|  PREDICTED: uncharacterized protein At2g34160...    106   2e-24   
ref|XP_007157093.1|  hypothetical protein PHAVU_002G042200g             106   2e-24   
ref|XP_008438573.1|  PREDICTED: uncharacterized protein At2g34160...    105   5e-24   
ref|XP_003610783.1|  hypothetical protein MTR_5g006970                  103   1e-23   
ref|XP_002947084.1|  hypothetical protein VOLCADRAFT_73065              101   5e-23   
gb|KDO61696.1|  hypothetical protein CISIN_1g032962mg                 99.8    1e-22   
gb|EMT05887.1|  hypothetical protein F775_20281                         100   1e-22   
ref|XP_001695217.1|  predicted protein                                99.8    4e-22   
gb|EEC69301.1|  hypothetical protein OsI_38366                        99.0    6e-22   
ref|XP_005708955.1|  hypothetical protein Gasu_05200                  98.2    1e-21   
ref|XP_008343506.1|  PREDICTED: uncharacterized protein At2g34160...  98.6    2e-21   
ref|XP_008354860.1|  PREDICTED: uncharacterized protein At2g34160...  98.2    2e-21   
ref|XP_005642923.1|  hypothetical protein COCSUDRAFT_34555            95.9    2e-20   
gb|EAZ01574.1|  hypothetical protein OsI_23607                        89.7    3e-19   
ref|XP_006838832.1|  hypothetical protein AMTR_s00002p00263340        91.3    4e-19   
ref|XP_009355687.1|  PREDICTED: uncharacterized protein At2g34160...  87.8    2e-18   
gb|AFW80168.1|  hypothetical protein ZEAMMB73_176081                  87.8    2e-18   
ref|XP_007035000.1|  Alba DNA/RNA-binding-like protein                90.5    3e-18   
gb|AEW07704.1|  hypothetical protein 0_9389_01                        86.7    4e-18   
ref|XP_002679849.1|  hypothetical protein NAEGRDRAFT_78957            87.0    1e-17   
ref|XP_005648898.1|  hypothetical protein COCSUDRAFT_9336             84.7    5e-17   
ref|XP_005851893.1|  hypothetical protein CHLNCDRAFT_133491           84.7    1e-16   
emb|CDY28657.1|  BnaC09g32180D                                        84.3    3e-16   
emb|CDY68615.1|  BnaCnng59770D                                        82.4    2e-15   
ref|XP_006423981.1|  hypothetical protein CICLE_v10030104mg           78.6    4e-15   
ref|XP_006427732.1|  hypothetical protein CICLE_v10026994mg           77.8    4e-15   
gb|AGU71348.1|  nucleic acid binding protein                          77.4    6e-15   
gb|KDO45901.1|  hypothetical protein CISIN_1g0446801mg                77.8    1e-14   
ref|NP_001046231.1|  Os02g0202500                                     76.3    2e-14   
ref|XP_006423982.1|  hypothetical protein CICLE_v10030008mg           76.6    2e-14   
gb|EMS48456.1|  hypothetical protein TRIUR3_16544                     77.0    3e-14   
ref|XP_003565400.1|  PREDICTED: uncharacterized protein At2g34160...  75.1    7e-14   
gb|KDO37858.1|  hypothetical protein CISIN_1g046541mg                 74.7    1e-13   
ref|XP_011073497.1|  PREDICTED: uncharacterized protein At2g34160...  75.5    2e-13   
emb|CDX79500.1|  BnaC03g18360D                                        75.9    2e-13   
ref|XP_007134910.1|  hypothetical protein PHAVU_010G086100g           70.5    2e-12   
gb|AGU71361.1|  nucleic acid binding protein                          69.3    4e-12   
emb|CDY53532.1|  BnaCnng25360D                                        72.4    9e-12   
gb|EJY72180.1|  hypothetical protein OXYTRI_06822                     65.1    6e-10   
gb|AER08632.1|  nuclear acid binding protein                          60.1    8e-09   
ref|XP_002502468.1|  predicted protein                                62.0    9e-09   
gb|EJY69530.1|  hypothetical protein OXYTRI_09731                     60.8    2e-08   
emb|CDW76321.1|  alba dna rna-binding protein                         60.8    3e-08   
emb|CDY43106.1|  BnaC05g36710D                                        59.7    5e-08   
emb|CDY07574.1|  BnaC06g14900D                                        59.7    5e-08   
emb|CDY30047.1|  BnaC05g09730D                                        59.7    5e-08   
ref|XP_008345951.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    2e-07   
emb|CDY50840.1|  BnaA10g28170D                                        57.8    4e-07   
ref|XP_002873188.1|  hypothetical protein ARALYDRAFT_487296           57.8    7e-07   
emb|CDW77678.1|  uncharacterized protein at2g34160-like               56.2    1e-06   
emb|CCW61900.1|  unnamed protein product                              55.5    2e-06   
ref|XP_001563170.1|  conserved hypothetical protein                   54.7    4e-06   
ref|XP_010697117.1|  hypothetical protein LPMP_130340                 54.7    4e-06   
ref|XP_001464059.1|  conserved hypothetical protein                   53.9    8e-06   
gb|AAK81869.1|AF398369_1  unknown                                     53.9    8e-06   
ref|XP_003859239.1|  hypothetical protein, conserved                  53.5    8e-06   
ref|XP_001681789.1|  conserved hypothetical protein                   53.5    1e-05   
ref|XP_003873246.1|  conserved hypothetical protein                   52.4    2e-05   
ref|XP_828522.1|  hypothetical protein                                51.6    4e-05   
gb|EPY33131.1|  hypothetical protein AGDE_08337                       50.8    7e-05   
gb|EPY38160.1|  hypothetical protein AGDE_05771                       50.8    8e-05   
ref|XP_005820315.1|  hypothetical protein GUITHDRAFT_148003           50.8    1e-04   
emb|CCC52973.1|  conserved hypothetical protein                       50.1    1e-04   
emb|CCW66843.1|  unnamed protein product                              50.1    2e-04   
ref|XP_005536967.1|  hypothetical protein CYME_CMM039C                51.2    2e-04   
gb|EFA76360.1|  hypothetical protein PPL_10125                        49.3    3e-04   
ref|XP_009310830.1|  hypothetical protein DQ04_03131080               49.3    3e-04   
ref|XP_009310829.1|  hypothetical protein DQ04_03131070               48.1    7e-04   



>ref|XP_004241771.1| PREDICTED: uncharacterized protein At2g34160 [Solanum lycopersicum]
Length=128

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 109/117 (93%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N +++S T    QKKNRIQVSNTKKSLFFYVNLSKRY+QQYNEVELSALGMA
Sbjct  1    MEGITEGVNKMSVSET----QKKNRIQVSNTKKSLFFYVNLSKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVVT+AEILKNNGFA+EKKIRTLTVDMRDEPG+RP+ KA+IE+VLGKTEKFDELM
Sbjct  57   ISTVVTIAEILKNNGFAVEKKIRTLTVDMRDEPGARPIPKAKIEIVLGKTEKFDELM  113



>ref|XP_009771917.1| PREDICTED: uncharacterized protein At2g34160-like [Nicotiana 
sylvestris]
Length=127

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+ N++++ T    QKKNRIQVSNTKKSLFFYVNLSKRY+QQYNEVELSALGMA
Sbjct  1    MEGITEGVKNISVTET----QKKNRIQVSNTKKSLFFYVNLSKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVVTVAEILKNNGFA+EKKIRTLT+DMRDEPG+RP+ KA+IE+VLGKTEKFDELM
Sbjct  57   ISTVVTVAEILKNNGFAVEKKIRTLTIDMRDEPGARPIPKAKIEIVLGKTEKFDELM  113



>ref|XP_006353679.1| PREDICTED: uncharacterized protein At2g34160-like [Solanum tuberosum]
Length=128

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N +++S T    QKKNRIQVSNTKKSLFFYVNLSKRY+QQYNEVELSALGMA
Sbjct  1    MEGITEGVNKMSVSET----QKKNRIQVSNTKKSLFFYVNLSKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVVT+AEILKNNGFA+EKKIRTLTVDMRD+PG+RP+ KA+IE+VLGKTEKFDELM
Sbjct  57   ISTVVTIAEILKNNGFAVEKKIRTLTVDMRDDPGARPIPKAKIEIVLGKTEKFDELM  113



>ref|XP_004241781.1| PREDICTED: uncharacterized protein At2g34160 [Solanum lycopersicum]
Length=128

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+N +++S T    QKKNRIQVSNTKKSLFFYVNLSKRY+QQYNEVELSALGMA
Sbjct  1    MEGITDGVNKMSVSET----QKKNRIQVSNTKKSLFFYVNLSKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVVT+AEILKNNGFA+EKKIRTLTVDMRDEPG+RP+ KA+IE+VLGKTEKFDELM
Sbjct  57   ISTVVTIAEILKNNGFAVEKKIRTLTVDMRDEPGARPIPKAKIEIVLGKTEKFDELM  113



>ref|XP_009785780.1| PREDICTED: uncharacterized protein At2g34160-like [Nicotiana 
sylvestris]
Length=127

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 110/117 (94%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+++S   +  QKKNRIQVSNTK+SLFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEGITEGVNNMSVSEIQN--QKKNRIQVSNTKRSLFFYVNLAKRYMQQYNEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVVTVAEILKNNGFA+EKKIRTLTVDMRDEPG+RP+ KA+IEVV+GKTEKFDELM
Sbjct  59   ISTVVTVAEILKNNGFAVEKKIRTLTVDMRDEPGARPIPKAKIEVVMGKTEKFDELM  115



>ref|XP_006353694.1| PREDICTED: uncharacterized protein At2g34160-like [Solanum tuberosum]
Length=128

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N +++S T    QKKNRIQVSNTKKSLFFYVNLSKRY+QQYNEVELSALGMA
Sbjct  1    MEGITEGVNKMSVSET----QKKNRIQVSNTKKSLFFYVNLSKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVVT+AEILKNNGFA+EKKI+TLTVDMRDEPG+RP+ KA+IE+VLGKTEKFDELM
Sbjct  57   ISTVVTIAEILKNNGFAVEKKIKTLTVDMRDEPGARPIPKAKIEIVLGKTEKFDELM  113



>ref|XP_009606374.1| PREDICTED: uncharacterized protein At2g34160-like [Nicotiana 
tomentosiformis]
Length=127

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 110/117 (94%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N++++S   +  QKKNRIQVSNTK+SLFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEGITEGVNSMSVSEIQN--QKKNRIQVSNTKRSLFFYVNLAKRYMQQYNEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVVTVAEILKNNGFA+EKKIRTLTVDMRDEPG+RP+ KA+IEVV+GKTEKFDELM
Sbjct  59   ISTVVTVAEILKNNGFAVEKKIRTLTVDMRDEPGARPIPKAKIEVVMGKTEKFDELM  115



>ref|XP_009627569.1| PREDICTED: uncharacterized protein At2g34160-like [Nicotiana 
tomentosiformis]
Length=127

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 109/117 (93%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+ N++++ T+    KKNRIQVSNTKKSLFFYVNLSKRY+QQYNEVELSALGMA
Sbjct  1    MEGITEGVKNISVTETH----KKNRIQVSNTKKSLFFYVNLSKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVVTVAEILKNNGFA+EKKI+TLT+DMRDEPG+RP+ KA+IE+VLGKTEKFDELM
Sbjct  57   ISTVVTVAEILKNNGFAVEKKIKTLTIDMRDEPGARPIPKAKIEIVLGKTEKFDELM  113



>emb|CDP13492.1| unnamed protein product [Coffea canephora]
Length=130

 Score =   196 bits (497),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 107/117 (91%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+  VN++ T    QK+NRIQVSNTKKSLFFYVNL+KRYLQQYNEVELSALGMA
Sbjct  1    MEGITEGVKKVNLNETT---QKRNRIQVSNTKKSLFFYVNLAKRYLQQYNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNGFA+EKKIRTLTVDMRDEPG++PV KA+IE+VLGKT+ FDELM
Sbjct  58   IATVVTIAEILKNNGFAVEKKIRTLTVDMRDEPGAQPVPKAKIEIVLGKTDNFDELM  114



>ref|XP_007013844.1| Alba DNA/RNA-binding protein [Theobroma cacao]
 gb|EOY31463.1| Alba DNA/RNA-binding protein [Theobroma cacao]
Length=130

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+NI+ + S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEGITEGVNNLNITDS-SASNKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDMR+E G RPV KA+IE++LGK+EKFDELM
Sbjct  60   IATVVTIAEILKNNGLAVEKKIMTSTVDMREESGGRPVQKAKIEILLGKSEKFDELM  116



>ref|XP_002515535.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46984.1| conserved hypothetical protein [Ricinus communis]
Length=128

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEA+TEG+NN+NI   N    KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAVTEGVNNMNI---NDASNKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG AIEKKI T TVDMR++ G RPV KA+IE++LGKTEKFDELM
Sbjct  58   IATVVTIAEILKNNGLAIEKKIMTSTVDMREDTGGRPVPKAKIEILLGKTEKFDELM  114



>gb|KDP33611.1| hypothetical protein JCGZ_07182 [Jatropha curcas]
Length=131

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+NI+   S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEGITEGVNNLNITDPAS-ANKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDMR+E G RPV KA+IE++LGKTEKFDELM
Sbjct  60   IATVVTIAEILKNNGLAVEKKITTSTVDMREETGGRPVPKAKIEILLGKTEKFDELM  116



>ref|XP_010925231.1| PREDICTED: uncharacterized protein At2g34160-like [Elaeis guineensis]
Length=133

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            M+AITEG+NN++++ +N++  K+NRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MDAITEGVNNLSVTDSNTDSNKENRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  60

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVDM+DE   RP+ KA+IE++LGKTE FDELM
Sbjct  61   IATVVTVAEILKNNGLAVEKKIMTSTVDMKDESRGRPIQKAKIEILLGKTESFDELM  117



>ref|XP_006483339.1| PREDICTED: uncharacterized protein At2g34160-like [Citrus sinensis]
 gb|KDO61694.1| hypothetical protein CISIN_1g032962mg [Citrus sinensis]
Length=130

 Score =   184 bits (468),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+NIS   S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEVITEGVNNINISDA-SAASKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVD+R+E G RPV KA+IE++LGK+EKFDELM
Sbjct  60   IATVVTIAEILKNNGLAVEKKITTSTVDIREETGGRPVQKAKIEILLGKSEKFDELM  116



>ref|XP_011039708.1| PREDICTED: uncharacterized protein At2g34160-like [Populus euphratica]
Length=134

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 105/119 (88%), Gaps = 2/119 (2%)
 Frame = +3

Query  72   MEAITEGINNVNIS--STNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALG  245
            ME ITE +NN+NI+  +T+S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALG
Sbjct  1    MEVITEAVNNLNIAGATTDSANNKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALG  60

Query  246  MAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            MAI+TVVT+AEILKNNG A+EKKI T TVDMR+E G RPV KA+IE++LGKTEKFDELM
Sbjct  61   MAIATVVTIAEILKNNGLAVEKKIMTSTVDMREETGGRPVPKAKIEILLGKTEKFDELM  119



>ref|XP_011093556.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=129

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+ N++IS    + QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVTNISISG---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVV+VAEILKNNGFA+EKKI T TV++RDE   RP+SKA+IE+VLGKTEKFDELM
Sbjct  58   ISTVVSVAEILKNNGFAVEKKIMTSTVEIRDESRGRPISKAKIEIVLGKTEKFDELM  114



>ref|XP_002324292.1| hypothetical protein POPTR_0018s01550g [Populus trichocarpa]
 gb|EEF02857.1| hypothetical protein POPTR_0018s01550g [Populus trichocarpa]
Length=133

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = +3

Query  72   MEAITEGINNVNI-SSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
            ME ITEG+ N+NI ++ +S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGM
Sbjct  1    MEGITEGVTNLNITAAADSGNNKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGM  60

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVT+AEILKNNG A+EKKI T TVDMR+E G RPV KA+IE++LGKTEKFDELM
Sbjct  61   AIATVVTIAEILKNNGLAVEKKITTSTVDMREETGGRPVPKAKIEILLGKTEKFDELM  118



>ref|XP_011026458.1| PREDICTED: uncharacterized protein At2g34160-like [Populus euphratica]
Length=133

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = +3

Query  72   MEAITEGINNVNIS-STNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
            ME ITEG+ N+NI+ + +S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGM
Sbjct  1    MEGITEGVTNLNITVAADSGNNKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGM  60

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVT+AEILKNNG A+EKKI T TVDMR+E G RPV KA+IE++LGKTEKFDELM
Sbjct  61   AIATVVTIAEILKNNGLAVEKKIMTSTVDMREETGGRPVPKAKIEILLGKTEKFDELM  118



>ref|XP_002308658.1| hypothetical protein POPTR_0006s26820g [Populus trichocarpa]
 gb|ABK95401.1| unknown [Populus trichocarpa]
 gb|EEE92181.1| hypothetical protein POPTR_0006s26820g [Populus trichocarpa]
Length=136

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 4/121 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISST----NSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSA  239
            ME ITEG+NN+NI++     +S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSA
Sbjct  1    MEVITEGVNNLNIAAAAATTDSANNKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSA  60

Query  240  LGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDEL  419
            LGMAI+TVVT+AEILKNNG A+EKKI T TVDMR+E G RPV KA+IE++LGKTEKFDEL
Sbjct  61   LGMAIATVVTIAEILKNNGLAVEKKIMTSTVDMREETGGRPVPKAKIEILLGKTEKFDEL  120

Query  420  M  422
            M
Sbjct  121  M  121



>gb|ABK94195.1| unknown [Populus trichocarpa]
Length=133

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 1/118 (1%)
 Frame = +3

Query  72   MEAITEGINNVNI-SSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
            ME ITEG+ N+NI ++ +S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGM
Sbjct  1    MEGITEGVTNLNITAAADSGNNKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGM  60

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVT+AEILKNNG A+EKKI T TVDMR+E G RPV KA+IE++LGKT KFDELM
Sbjct  61   AIATVVTIAEILKNNGLAVEKKITTSTVDMREETGGRPVPKAKIEILLGKTGKFDELM  118



>gb|EYU23047.1| hypothetical protein MIMGU_mgv1a016236mg [Erythranthe guttata]
Length=129

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT G+ N++I+    + QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITAGVTNISIAG---DAQKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVV++AEILKNNGFA+EKKI T TV++RDE   RP+SKA+IE+VLGKTEKFDELM
Sbjct  58   ISTVVSIAEILKNNGFAVEKKITTSTVEIRDEARGRPISKAKIEIVLGKTEKFDELM  114



>ref|XP_004965953.1| PREDICTED: uncharacterized protein At2g34160-like [Setaria italica]
Length=130

 Score =   180 bits (456),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 102/117 (87%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+NN+ I+    EP KKNRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGMA
Sbjct  1    MEEVTEGVNNLAIT----EPHKKNRIQVSNTKKPLFFYVNLAKRYMQQHEEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+  SRP+ KA+IE+VLGKTEKFDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDVKDDSRSRPIQKAKIEIVLGKTEKFDELM  113



>ref|XP_002524472.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37912.1| conserved hypothetical protein [Ricinus communis]
Length=130

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N++    +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVNNINLAG---DLHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG AIE+KI T TVDM+DE   RPV KA+IE++LGKTE FDELM
Sbjct  58   IATVVTVAEILKNNGLAIERKIMTSTVDMKDESRGRPVQKAKIEILLGKTENFDELM  114



>ref|NP_001236789.1| uncharacterized protein LOC100305539 [Glycine max]
 gb|ACU13271.1| unknown [Glycine max]
Length=144

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 102/117 (87%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITEG+NN+NIS    +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  12   MEAITEGVNNINIS----DSYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  67

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNN  AIEKKI T TVD++D+   RPV KA+IE++LGKTEKFDELM
Sbjct  68   IATVVTVAEILKNNELAIEKKITTSTVDIKDDSRGRPVQKAKIEILLGKTEKFDELM  124



>ref|XP_006450467.1| hypothetical protein CICLE_v10009882mg [Citrus clementina]
 gb|ESR63707.1| hypothetical protein CICLE_v10009882mg [Citrus clementina]
Length=130

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+NIS   S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEVITEGVNNINISDA-SAASKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            I+TVVT+AEILKNNG A+EKKI T TVD+R+E G RPV KA+IE++LGK+EKFD
Sbjct  60   IATVVTIAEILKNNGLAVEKKITTSTVDIREETGGRPVQKAKIEILLGKSEKFD  113



>gb|KHN47771.1| Hypothetical protein glysoja_029189 [Glycine soja]
Length=133

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 102/117 (87%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITEG+NN+NIS +     KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAITEGVNNINISDS----YKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNN  AIEKKI T TVD++D+   RPV KA+IE++LGKTEKFDELM
Sbjct  57   IATVVTVAEILKNNELAIEKKITTSTVDIKDDSRGRPVQKAKIEILLGKTEKFDELM  113



>gb|KHF98627.1| hypothetical protein F383_16439 [Gossypium arboreum]
Length=125

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAIT+G+NN+N+++   +  KKNRIQVSN+KK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAITQGVNNINMAT---DSHKKNRIQVSNSKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDM++E   RPV KA+IE++LGKTE FDELM
Sbjct  58   IATVVTIAEILKNNGLAVEKKITTATVDMKEESRGRPVQKAKIEILLGKTENFDELM  114



>ref|XP_007135740.1| hypothetical protein PHAVU_010G154500g [Phaseolus vulgaris]
 gb|ESW07734.1| hypothetical protein PHAVU_010G154500g [Phaseolus vulgaris]
Length=131

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITEG+NN+NI+    E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAITEGVNNINIT----EAYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE++LGKT  FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEILLGKTANFDELM  113



>ref|XP_007150730.1| hypothetical protein PHAVU_005G176200g [Phaseolus vulgaris]
 gb|ESW22724.1| hypothetical protein PHAVU_005G176200g [Phaseolus vulgaris]
Length=129

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITEG+NN+NI+    +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAITEGVNNINIT----DSYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGKT  FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKITTSTVDIKDDSRGRPVQKAKIEIVLGKTANFDELM  113



>gb|KHN01341.1| Hypothetical protein glysoja_009547 [Glycine soja]
Length=134

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITEG+NN+NIS +     KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAITEGVNNINISDS----YKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNN  A+EKKI T TVD++D+   RPV KA+IE++LGKTEKFDELM
Sbjct  57   IATVVTVAEILKNNELAVEKKITTSTVDIKDDSRGRPVQKAKIEILLGKTEKFDELM  113



>ref|XP_008351650.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
 ref|XP_009362527.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
 ref|XP_009362536.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
 ref|XP_009348776.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=131

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+ +++++S   KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITEGVNNITVNASDS--HKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGK+E FD+LM
Sbjct  59   IATVVTIAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEIVLGKSEDFDDLM  115



>gb|KHF98816.1| hypothetical protein F383_17190 [Gossypium arboreum]
Length=132

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+N+++   +  KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITQGVNNINLAA---DSHKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDM+++   RPV KA+IE++LGKTE FDELM
Sbjct  58   IATVVTIAEILKNNGLAVEKKITTTTVDMKEDSRGRPVQKAKIEILLGKTENFDELM  114



>gb|KHN44168.1| Hypothetical protein glysoja_031829 [Glycine soja]
Length=133

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+NI+ ++S   KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MEGITEGVNNININISDS--YKKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGKTE FDELM
Sbjct  59   IATVVTVAEILKNNGLAVEKKITTSTVDIKDDSRGRPVQKAKIEIVLGKTENFDELM  115



>ref|XP_002437246.1| hypothetical protein SORBIDRAFT_10g023460 [Sorghum bicolor]
 gb|EER88613.1| hypothetical protein SORBIDRAFT_10g023460 [Sorghum bicolor]
Length=129

 Score =   177 bits (449),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+NN+ I+    EP KKNRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGMA
Sbjct  1    MEEVTEGVNNLAIT----EPHKKNRIQVSNTKKPLFFYVNLAKRYMQQHEEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+  +RP+ KA+IE+VLGKT+KFDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDVKDDTRARPIQKAKIEIVLGKTDKFDELM  113



>ref|XP_010093232.1| Uncharacterized protein L484_022390 [Morus notabilis]
 gb|EXB53734.1| Uncharacterized protein L484_022390 [Morus notabilis]
Length=131

 Score =   177 bits (448),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N +NI S   +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVNAINIGS--GDTYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVDM+D+   RP+ KA+IE+VLGKTE FDELM
Sbjct  59   IATVVTVAEILKNNGLAVEKKIMTSTVDMKDDSRGRPIQKAKIEIVLGKTENFDELM  115



>ref|XP_006303421.1| hypothetical protein CARUB_v10010630mg [Capsella rubella]
 gb|EOA36319.1| hypothetical protein CARUB_v10010630mg [Capsella rubella]
Length=130

 Score =   177 bits (448),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEEITEGVNNMNLAV---DTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYTDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ LGK+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLGKSEKFDELM  114



>emb|CDP10391.1| unnamed protein product [Coffea canephora]
Length=137

 Score =   177 bits (449),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 5/122 (4%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNS-----EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELS  236
            ME +T  +NN+NIS         +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELS
Sbjct  1    MEEVTAAVNNINISGGGGGGGGGDLHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELS  60

Query  237  ALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDE  416
            ALG+AISTVV+VAEILKNNGFA+EKKI T TV+MRD+   RP+SKA+IE+VLGKTEKFDE
Sbjct  61   ALGLAISTVVSVAEILKNNGFAVEKKIMTSTVEMRDDSRGRPISKAKIEIVLGKTEKFDE  120

Query  417  LM  422
            LM
Sbjct  121  LM  122



>ref|XP_004150019.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
 ref|XP_008444017.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis melo]
 gb|KGN65316.1| hypothetical protein Csa_1G320340 [Cucumis sativus]
Length=130

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N++ +++   + QKKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITEGVNSITLTA---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGKTE FDELM
Sbjct  58   IATVVTVAEILKNNGLALEKKIMTSTVDIKDDSRGRPVQKAKIEIVLGKTENFDELM  114



>ref|XP_004506910.1| PREDICTED: uncharacterized protein At2g34160-like [Cicer arietinum]
Length=133

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITEG+NN+NIS +     KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAITEGVNNINISDS----IKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE++LGKT  FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEILLGKTANFDELM  113



>ref|XP_002285115.1| PREDICTED: uncharacterized protein At2g34160 [Vitis vinifera]
 emb|CBI28181.3| unnamed protein product [Vitis vinifera]
Length=130

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N++NI+ ++    KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVNSMNIADSH----KKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDM+DE   RP+ KA+IE++LGKTE FDELM
Sbjct  57   IATVVTIAEILKNNGLAVEKKIMTSTVDMKDESRGRPIQKAKIEILLGKTENFDELM  113



>ref|XP_009407663.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=132

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 3/118 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+++++ +S   KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITEGVNNLHVTAADS--HKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEP-GSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+ EILKNNG AIEKKI T TVD++DE  G RP+ KA+IE++LGKTE FDELM
Sbjct  59   IATVVTITEILKNNGLAIEKKITTSTVDVKDESRGGRPMQKAKIEILLGKTENFDELM  116



>ref|NP_001058008.1| Os06g0602600 [Oryza sativa Japonica Group]
 dbj|BAD35458.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19922.1| Os06g0602600 [Oryza sativa Japonica Group]
 gb|EAZ01577.1| hypothetical protein OsI_23611 [Oryza sativa Indica Group]
 gb|EAZ37563.1| hypothetical protein OsJ_21893 [Oryza sativa Japonica Group]
 dbj|BAH00577.1| unnamed protein product [Oryza sativa Japonica Group]
Length=132

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TE ++N++I+    EP KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEVTEAVSNLSIT----EPHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+  SRP+ KA+IE++LGKTEKFDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDVKDDSRSRPMQKAKIEILLGKTEKFDELM  113



>ref|XP_009778747.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Nicotiana sylvestris]
Length=128

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ++EG+NN+NIS    + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  2    MEELSEGVNNMNISG--GDLQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVV++AEILK+NGFA+EKKI T TVD++D    RPVSKA+IEV+LGK+EKFD+LM
Sbjct  60   IATVVSIAEILKSNGFAVEKKIMTSTVDVKDGSRGRPVSKAKIEVLLGKSEKFDDLM  116



>ref|XP_008784950.1| PREDICTED: uncharacterized protein At2g34160-like [Phoenix dactylifera]
Length=129

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN++++  N    KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MEEITEGVNNLSVTDLN----KKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVDM+DE   RP+ KA+IE++LGKTE FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDMKDESRGRPIQKAKIEILLGKTESFDELM  113



>ref|XP_009626436.1| PREDICTED: uncharacterized protein At2g34160-like isoform X3 
[Nicotiana tomentosiformis]
 ref|XP_009778746.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Nicotiana sylvestris]
Length=131

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ++EG+NN+NIS    + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  2    MEELSEGVNNMNISG--GDLQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVV++AEILK+NGFA+EKKI T TVD++D    RPVSKA+IEV+LGK+EKFD+LM
Sbjct  60   IATVVSIAEILKSNGFAVEKKIMTSTVDVKDGSRGRPVSKAKIEVLLGKSEKFDDLM  116



>ref|XP_002879480.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55739.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=130

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  1    MEEITDGVNNMNLAV---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLAKSEKFDELM  114



>gb|KEH28695.1| alba DNA/RNA-binding protein [Medicago truncatula]
Length=133

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITEG+NNVNI+    +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAITEGVNNVNIT----DSIKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE++LGKT  FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEILLGKTANFDELM  113



>ref|NP_001238733.1| uncharacterized protein LOC100527358 [Glycine max]
 gb|ACU16443.1| unknown [Glycine max]
Length=133

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 102/117 (87%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+NI+ ++S   KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MEGITEGVNNININISDS--YKKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG  +EKKI T TVD++D+   RPV KA+IE+VLGKTE FDELM
Sbjct  59   IATVVTVAEILKNNGLTVEKKITTSTVDIKDDSRGRPVQKAKIEIVLGKTENFDELM  115



>gb|KFK36323.1| hypothetical protein AALP_AA4G107800 [Arabis alpina]
Length=129

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G++N+N+S    + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  1    MEEITDGVSNINLSV---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD+RD+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIRDDSRGRPVQKAKIEITLVKSEKFDELM  114



>ref|XP_011081577.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=121

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E  KKNRIQVSN+KKSLFFYVNLSKRYLQQYNEVELS LGMAISTVV++AEILKNNGFA
Sbjct  6    TEEVKKNRIQVSNSKKSLFFYVNLSKRYLQQYNEVELSGLGMAISTVVSIAEILKNNGFA  65

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            +EKKIRTLTVDMRD+PG+RP+ KA+IE++LGK+  FDELM
Sbjct  66   VEKKIRTLTVDMRDDPGARPLPKAKIEILLGKSANFDELM  105



>ref|XP_009626435.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Nicotiana tomentosiformis]
Length=132

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ++EG+NN+NIS    + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  2    MEELSEGVNNMNISG--GDLQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVV++AEILK+NGFA+EKKI T TVD++D    RPVSKA+IEV+LGK+EKFD+LM
Sbjct  60   IATVVSIAEILKSNGFAVEKKIMTSTVDVKDGSRGRPVSKAKIEVLLGKSEKFDDLM  116



>emb|CBI36290.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITE +NN+NIS    +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEAVNNINIS----DLHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDM+DE   RPV KA+IE++LGKT  FDELM
Sbjct  57   IATVVTIAEILKNNGLAVEKKITTSTVDMKDESRGRPVQKAKIEILLGKTANFDELM  113



>ref|NP_564325.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana]
 gb|AAF88114.1|AC021043_7 Unknown protein [Arabidopsis thaliana]
 gb|AAK97729.1| At1g29250/F28N24_8 [Arabidopsis thaliana]
 gb|AAL31130.1| At1g29250/F28N24_8 [Arabidopsis thaliana]
 gb|AAM63005.1| unknown [Arabidopsis thaliana]
 gb|AEE31065.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana]
Length=130

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEEITEGVNNMNLAV---DTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYTDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLAKSEKFDELM  114



>ref|XP_010250057.1| PREDICTED: uncharacterized protein At2g34160-like [Nelumbo nucifera]
 ref|XP_010250058.1| PREDICTED: uncharacterized protein At2g34160-like [Nelumbo nucifera]
Length=129

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+NN+ IS ++    KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEVTEGVNNLAISDSH----KKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDM+DE   RP+ KA+IE++L KTE FDELM
Sbjct  57   IATVVTIAEILKNNGLAVEKKITTSTVDMKDESRGRPIQKAKIEILLAKTENFDELM  113



>ref|NP_565781.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana]
 sp|O22969.1|Y2416_ARATH RecName: Full=Uncharacterized protein At2g34160 [Arabidopsis 
thaliana]
 gb|AAB67633.1| expressed protein [Arabidopsis thaliana]
 gb|AAM60985.1| unknown [Arabidopsis thaliana]
 dbj|BAC42164.1| unknown protein [Arabidopsis thaliana]
 gb|ABH04611.1| At2g34160 [Arabidopsis thaliana]
 gb|AEC08926.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana]
Length=130

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+N+++   + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  1    MEEITDGVNNMNLAT---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTV EILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVTEILKNNGFAVEKKIMTSTVDIKDDARGRPVQKAKIEITLVKSEKFDELM  114



>ref|XP_010499438.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
 ref|XP_010460695.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
 ref|XP_010478281.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=128

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEEITEGVNNMNLAV---DTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYTDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ LGK+E FDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLGKSENFDELM  114



>gb|EPS62998.1| hypothetical protein M569_11792, partial [Genlisea aurea]
Length=115

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG++ + IS    E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEQITEGVDKIKIS----ESQKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVV+VAEILKNNGFA+EKKI T TV+++D+   RPV KA+IEVVLGKT  FDELM
Sbjct  57   ISTVVSVAEILKNNGFALEKKITTSTVEIKDDSRGRPVQKAKIEVVLGKTANFDELM  113



>ref|XP_007013411.1| Alba DNA/RNA-binding protein [Theobroma cacao]
 gb|EOY31030.1| Alba DNA/RNA-binding protein [Theobroma cacao]
Length=130

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+N+ +   +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITQGVNNMNLGA---DSHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDM+++   RPV KA+IE++LGKTE FDELM
Sbjct  58   IATVVTIAEILKNNGLAVEKKIMTSTVDMKEDSRGRPVQKAKIEILLGKTENFDELM  114



>ref|XP_011081297.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=127

 Score =   174 bits (441),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME I +G+N +NI+    E QKKNRIQVSNTKK LFFYVNLSKRY+QQ+NEVELSALGMA
Sbjct  1    MEEIADGLNKMNIA----ESQKKNRIQVSNTKKPLFFYVNLSKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVV+VAEILKNNGFA+EKKI T TV+++DE   RP+ KA+IE+VLGKT  FDELM
Sbjct  57   ISTVVSVAEILKNNGFAVEKKIMTSTVEIKDESRGRPIQKAKIEIVLGKTANFDELM  113



>ref|XP_009626434.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Nicotiana tomentosiformis]
Length=202

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ++EG+NN+NIS    + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  2    MEELSEGVNNMNISG--GDLQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVV++AEILK+NGFA+EKKI T TVD++D    RPVSKA+IEV+LGK+EKFD+LM
Sbjct  60   IATVVSIAEILKSNGFAVEKKIMTSTVDVKDGSRGRPVSKAKIEVLLGKSEKFDDLM  116



>ref|XP_006295225.1| hypothetical protein CARUB_v10024310mg [Capsella rubella]
 gb|EOA28123.1| hypothetical protein CARUB_v10024310mg [Capsella rubella]
Length=130

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G++N+N+++   + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  1    MEEITDGVSNMNLAN---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTTTVDIKDDSRGRPVQKAKIEITLVKSEKFDELM  114



>ref|XP_009343699.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At2g34160-like 
[Pyrus x bretschneideri]
 ref|XP_009343704.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At2g34160-like 
[Pyrus x bretschneideri]
Length=161

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 103/118 (87%), Gaps = 2/118 (2%)
 Frame = +3

Query  69   TMEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
             ME +T+G+NN+ I++++S   KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGM
Sbjct  30   AMEEVTDGVNNITINASDS--HKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGM  87

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVT+AEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGK+E FD+LM
Sbjct  88   AIATVVTIAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEIVLGKSENFDDLM  145



>ref|NP_001236521.1| uncharacterized protein LOC100527472 [Glycine max]
 gb|ACU16564.1| unknown [Glycine max]
 gb|KHN22459.1| Hypothetical protein glysoja_024968 [Glycine soja]
Length=131

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+NIS +     KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MEDITEGVNNINISDS----YKKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNN  A+EKKIRT TVD++D+   RPV KA+IE+VLGKT  FDELM
Sbjct  57   IATVVTVAEILKNNRLAVEKKIRTSTVDIKDDSRGRPVQKAKIEIVLGKTANFDELM  113



>ref|XP_010509790.1| PREDICTED: uncharacterized protein At2g34160 [Camelina sativa]
Length=130

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 103/117 (88%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+N+++   + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  1    MEEITDGVNNMNLAT---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKN+GFA+EKKI T TVD++D+   RPV KA+IE+ L K++KFDELM
Sbjct  58   IATVVTVAEILKNSGFAVEKKIMTTTVDIKDDSRGRPVQKAKIEITLVKSDKFDELM  114



>emb|CDY50785.1| BnaA09g54140D [Brassica napus]
Length=130

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+   S   + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEGITEGVNNM---SLGVDTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYADVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T+TVD++D+   RPV KA+IE+ L K++KFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTMTVDIKDDSRGRPVQKAKIEITLAKSDKFDELM  114



>ref|XP_002285046.1| PREDICTED: uncharacterized protein At2g34160 [Vitis vinifera]
 emb|CBI21021.3| unnamed protein product [Vitis vinifera]
Length=130

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+N +NIS ++    KKNRIQVSNTKK LFFYVNL+KR++QQYN+VELSALGMA
Sbjct  1    MENLTEGVNKLNISDSS---LKKNRIQVSNTKKPLFFYVNLAKRFMQQYNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EK+I T TVD+RDE G RP+ KA+IE++LGKTE FDELM
Sbjct  58   IATVVTIAEILKNNGLAVEKRITTSTVDIRDEFGGRPLQKAKIEILLGKTENFDELM  114



>ref|XP_010914880.1| PREDICTED: uncharacterized protein At2g34160-like [Elaeis guineensis]
Length=129

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN++++ +N    KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVNNLSVTDSN----KKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+ EILKNNG A+EKKI T TVD++DE   RP+ KA+IE++LGKTE FDELM
Sbjct  57   IATVVTITEILKNNGLAVEKKIMTSTVDVKDESRGRPIQKAKIEILLGKTENFDELM  113



>ref|XP_010061927.1| PREDICTED: uncharacterized protein At2g34160-like [Eucalyptus 
grandis]
 gb|KCW68973.1| hypothetical protein EUGRSUZ_F02537 [Eucalyptus grandis]
Length=129

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEGINN+ I+    +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEVTEGINNIAIT----DSHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGKT  FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEIVLGKTANFDELM  113



>ref|XP_010469393.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=130

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+N+++   + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  1    MEEITDGVNNMNLAT---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE+ L K++KFDELM
Sbjct  58   IATVVTVAEILKNNGLAVEKKIMTTTVDIKDDSRGRPVQKAKIEITLVKSDKFDELM  114



>ref|XP_010538212.1| PREDICTED: uncharacterized protein At2g34160-like [Tarenaya hassleriana]
Length=130

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N +N++    +  KKN IQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITEGVNKMNLAG---DTYKKNLIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE++LGK+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEIMLGKSEKFDELM  114



>ref|XP_003563670.1| PREDICTED: uncharacterized protein At2g34160-like [Brachypodium 
distachyon]
Length=132

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TE +NN+ I+    EP KKNRIQVSNTKK LFFYVNL+KRY+Q +NEVELSALGMA
Sbjct  1    MEEVTEAVNNLAIT----EPHKKNRIQVSNTKKPLFFYVNLAKRYMQVHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD+ DE  SRP+ KA+IE+VLGKTE FDELM
Sbjct  57   IATVVTVAEILKNNGLAMEKKIMTSTVDVNDESRSRPMQKAKIEIVLGKTENFDELM  113



>ref|XP_004302971.1| PREDICTED: uncharacterized protein At2g34160-like [Fragaria vesca 
subsp. vesca]
Length=136

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 5/120 (4%)
 Frame = +3

Query  72   MEA---ITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSAL  242
            MEA   ITE +NNVNI+  NS+  KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSAL
Sbjct  1    MEAVGEITEAMNNVNIN--NSDSHKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSAL  58

Query  243  GMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            GMAI+TVVT+AEILKNNG A+EKKI T TVD++D+   RPV KA+IE++LGKT  FD+LM
Sbjct  59   GMAIATVVTIAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEILLGKTANFDDLM  118



>ref|XP_010097254.1| Uncharacterized protein L484_025803 [Morus notabilis]
 gb|EXB67321.1| Uncharacterized protein L484_025803 [Morus notabilis]
Length=129

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 4/114 (4%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+NIS    + QK+NRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITDGVNNINIS----DSQKRNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            I+TVVT+AEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGKTE FD
Sbjct  57   IATVVTIAEILKNNGLALEKKIMTSTVDIKDDSRGRPVQKAKIEIVLGKTENFD  110



>dbj|BAJ98262.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=132

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+ N+ ++    EPQKKNRIQVSNTKK LFFYVNL+KRY+Q +NEVELSALGMA
Sbjct  1    MEEVTEGVKNLAVT----EPQKKNRIQVSNTKKPLFFYVNLAKRYMQMHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD+ DE   RP+ KA+IE+VLGKTE FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDVNDESRGRPMQKAKIEIVLGKTENFDELM  113



>ref|XP_009403457.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=129

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+++++   +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITDGVNNLSVTA---DSYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVD+ DE   RP+ KA+IE++LGKTEKFDELM
Sbjct  58   IATVVTIAEILKNNGLAVEKKIMTSTVDVNDESRGRPLQKAKIEILLGKTEKFDELM  114



>ref|XP_006415602.1| hypothetical protein EUTSA_v10009096mg [Eutrema salsugineum]
 gb|ESQ33955.1| hypothetical protein EUTSA_v10009096mg [Eutrema salsugineum]
Length=130

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN++++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEGITEGVNNMSLAV---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYTDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+    PV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSKGHPVQKAKIEITLAKSEKFDELM  114



>ref|XP_002890797.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67056.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=130

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGM 
Sbjct  1    MEEITEGVNNMNLAV---DTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYTDVELSALGMG  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLAKSEKFDELM  114



>gb|KFK44753.1| hypothetical protein AALP_AA1G298400 [Arabis alpina]
Length=130

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN++++  N   QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEEITEGVNNMSLAIDN---QKKNRIQVSNTKKPLFFYVNLAKRYMQQYTDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDE+M
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLAKSEKFDEIM  114



>ref|XP_008339666.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=161

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +3

Query  69   TMEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
             ME IT+G+NN+ I++++S   KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGM
Sbjct  30   AMEEITDGVNNITINASDS--HKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGM  87

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVT+AEILKNNG A+EK I T TVD++D+   RPV KA+IE+VLGK+E FD+LM
Sbjct  88   AIATVVTIAEILKNNGLAVEKXIMTSTVDIKDDSRGRPVQKAKIEIVLGKSENFDDLM  145



>ref|XP_006450953.1| hypothetical protein CICLE_v10009883mg [Citrus clementina]
 ref|XP_006475824.1| PREDICTED: uncharacterized protein At2g34160-like [Citrus sinensis]
 gb|ESR64193.1| hypothetical protein CICLE_v10009883mg [Citrus clementina]
 gb|KDO80280.1| hypothetical protein CISIN_1g032942mg [Citrus sinensis]
Length=130

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N++    +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVNNMNLAV---DANKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVDMRDE   RPV KA+IE+ L KT  FDELM
Sbjct  58   IATVVTVAEILKNNGLAVEKKIMTSTVDMRDESRGRPVQKAKIEIWLEKTANFDELM  114



>ref|XP_007215146.1| hypothetical protein PRUPE_ppa013322mg [Prunus persica]
 gb|EMJ16345.1| hypothetical protein PRUPE_ppa013322mg [Prunus persica]
Length=129

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+ I+ +     KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITEGVNNIIIADS----HKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVD++D+   RPV KA+IE++LGK+E FD+LM
Sbjct  57   IATVVTIAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEIILGKSENFDDLM  113



>ref|XP_008243714.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Prunus mume]
Length=129

 Score =   172 bits (436),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+ I+ +     KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITEGVNNIIIADS----HKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVD++D+   RPV KA+IE++LGK+E FD+LM
Sbjct  57   IATVVTIAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEIILGKSENFDDLM  113



>ref|XP_008457716.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis melo]
Length=131

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME I EG+N++N+SS   +  KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MEEIVEGVNSINLSS---DSFKKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE++LGKTE FDELM
Sbjct  58   IATVVTVAEILKNNGLAVEKKIATSTVDIKDDSRGRPVQKAKIEILLGKTENFDELM  114



>ref|XP_010413770.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=130

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+N++N+++   + QKKNRIQVSNTKK LFFYVNL+KRY+QQYN+VELSALGMA
Sbjct  1    MEEITDGVNSMNLAT---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG AIEKKI T TVD++D+   RPV KA+IE+ L K++KFDELM
Sbjct  58   IATVVTVAEILKNNGLAIEKKIMTTTVDIKDDSRGRPVQKAKIEITLVKSDKFDELM  114



>ref|XP_009115263.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=130

 Score =   172 bits (435),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+   S   + QKKNRI+VSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEGITEGVNNM---SLGVDTQKKNRIKVSNTKKPLFFYVNLAKRYMQQYADVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T+TVD++D+   RPV KA+IE+ L K++KFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTMTVDIKDDSRGRPVQKAKIEITLAKSDKFDELM  114



>ref|XP_010254376.1| PREDICTED: uncharacterized protein At2g34160-like [Nelumbo nucifera]
Length=129

 Score =   172 bits (435),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+ I  ++    KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVNNIAIIDSH----KKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDM+DE   RP+ KA+IE++L KTE FD+LM
Sbjct  57   IATVVTIAEILKNNGLAVEKKITTSTVDMKDESRGRPIQKAKIEILLAKTENFDDLM  113



>ref|XP_008219479.1| PREDICTED: uncharacterized protein At2g34160-like [Prunus mume]
Length=136

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+NN+ I+ + S   KKNRIQVSNTKK LFFYVNL+KRY++Q NEVELSALGMA
Sbjct  1    MEGVTEGVNNLQITDS-SYNNKKNRIQVSNTKKPLFFYVNLAKRYMEQNNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A EKKI T T+DMR++ G RP+ KA+IE++LGK+EKFDE+M
Sbjct  60   IATVVTIAEILKNNGLAFEKKITTSTIDMREDAGGRPIQKAKIEILLGKSEKFDEIM  116



>ref|XP_004139317.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
 ref|XP_004159379.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
Length=131

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME I EG+N++N+SS   +  KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MEEIVEGVNSINLSS---DSFKKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE++LGKTE FDELM
Sbjct  58   IATVVTVAEILKNNGLALEKKIATSTVDIKDDSRGRPVQKAKIEILLGKTENFDELM  114



>ref|XP_009381121.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=129

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEGINN+   S N++  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEVTEGINNL---SVNADSYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+E+KI T  VD++DE   RP+ KA+IE++LGKTE FDELM
Sbjct  58   IATVVTIAEILKNNGLAVERKIMTSMVDVKDESRGRPMQKAKIEILLGKTENFDELM  114



>ref|XP_008792056.1| PREDICTED: uncharacterized protein At2g34160-like [Phoenix dactylifera]
Length=129

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 100/114 (88%), Gaps = 4/114 (4%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN++++ +N    KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVNNLSVADSN----KKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            I+TVVT+AEILKNNG A+EKKI T TVD++DE   RP+ KA+IE++LGKTEKFD
Sbjct  57   IATVVTIAEILKNNGLAVEKKIMTSTVDVKDESRGRPIQKAKIEILLGKTEKFD  110



>gb|EMT03371.1| hypothetical protein F775_28656 [Aegilops tauschii]
Length=132

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+ N+ ++    EP KKNRIQVSNTKK LFFYVNL+KRY+Q +NEVELSALGMA
Sbjct  1    MEEVTEGVKNLAVT----EPHKKNRIQVSNTKKPLFFYVNLAKRYMQMHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD+ DE   RP+ KA+IE+VLGKTE FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKIMTSTVDVNDESRGRPMQKAKIEIVLGKTENFDELM  113



>emb|CDY17226.1| BnaA05g09620D [Brassica napus]
Length=130

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+Q++N+VELSALGMA
Sbjct  1    MEEITDGVNNMNLAG---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQEHNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNGFA+EKKI T TVD++D    RPV K +IE+ LGK+EKFDELM
Sbjct  58   IATVVTIAEILKNNGFAVEKKIMTSTVDIKDGSRGRPVQKPKIEITLGKSEKFDELM  114



>gb|AGS17822.1| hypothetical protein, partial [Elaeis guineensis]
Length=175

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN++++ +N    KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  23   MEEITEGVNNLSVTDSN----KKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  78

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+ EILKNNG A+EKKI T TVD++DE   RP+ KA+IE++LGKTE FDELM
Sbjct  79   IATVVTITEILKNNGLAVEKKIMTSTVDVKDESRGRPIQKAKIEILLGKTENFDELM  135



>ref|XP_010049985.1| PREDICTED: uncharacterized protein At2g34160-like [Eucalyptus 
grandis]
 gb|KCW82825.1| hypothetical protein EUGRSUZ_C04193 [Eucalyptus grandis]
Length=147

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 1/118 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKN-RIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
            ME ITEG++++ ++  +S   KKN RIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGM
Sbjct  3    MEQITEGVSSIALTDGDSSSVKKNNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGM  62

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVT+AEILKNNGFA EKKI T TV ++DE   RPV KA+IE++LGK+EKFDELM
Sbjct  63   AIATVVTIAEILKNNGFAAEKKITTSTVGIKDESRGRPVQKAKIEILLGKSEKFDELM  120



>ref|XP_009143800.1| PREDICTED: uncharacterized protein At2g34160 [Brassica rapa]
 emb|CDY63142.1| BnaCnng41440D [Brassica napus]
Length=130

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+Q++N+VELSALGMA
Sbjct  1    MEEITDGVNNMNLAV---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQEHNDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNGFA+EKKI T TVD++D    RPV K +IE+ LGK+EKFDELM
Sbjct  58   IATVVTIAEILKNNGFAVEKKIMTSTVDIKDGSRGRPVQKPKIEITLGKSEKFDELM  114



>ref|XP_009102872.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
 emb|CDY15644.1| BnaA07g08150D [Brassica napus]
Length=130

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N++   S   + QKKNRIQVS+TKK LFFYVNL+KRY+QQY++VELSALGMA
Sbjct  1    MEGITEGVNSM---SLGVDTQKKNRIQVSHTKKPLFFYVNLAKRYMQQYSDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLSKSEKFDELM  114



>gb|EYU24652.1| hypothetical protein MIMGU_mgv1a016184mg [Erythranthe guttata]
Length=131

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N +NI+ +     KKNRIQVSNTKK LFFYVNLSKRYLQQ +EVELSALGMA
Sbjct  4    MEEITEGVNKINIADS----PKKNRIQVSNTKKPLFFYVNLSKRYLQQNDEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVV++AEILKNNGFA+EKKI T TV+++D+   RPV KA+IE+VLGKT  FDELM
Sbjct  60   ISTVVSIAEILKNNGFAVEKKITTSTVEIKDDSRGRPVQKAKIEIVLGKTANFDELM  116



>ref|XP_009402892.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=127

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 2/117 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME I EG+NN++I++ +S   K NRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEIAEGVNNLHIAAPDS--YKNNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVD++DE    P+ KA+IE++LGKTE FDELM
Sbjct  59   IATVVTIAEILKNNGLAVEKKITTSTVDVKDESRGWPIQKAKIEILLGKTENFDELM  115



>ref|XP_007225832.1| hypothetical protein PRUPE_ppa011574mg [Prunus persica]
 gb|EMJ27031.1| hypothetical protein PRUPE_ppa011574mg [Prunus persica]
Length=205

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 102/118 (86%), Gaps = 1/118 (1%)
 Frame = +3

Query  69   TMEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
            TM+ +TEG+NN+ I+ + S   KKNRIQVSNTKK LFFYVNL+KRY++Q NEVELSALGM
Sbjct  69   TMDGVTEGVNNLQITDS-SYNNKKNRIQVSNTKKPLFFYVNLAKRYMEQNNEVELSALGM  127

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVT+AEILKNNG A EKKI T T+DMR++ G RP+ KA+IE++LGK+EKFDE+M
Sbjct  128  AIATVVTIAEILKNNGLAFEKKITTSTIDMREDAGGRPIQKAKIEILLGKSEKFDEIM  185



>ref|XP_006656212.1| PREDICTED: uncharacterized protein At2g34160-like [Oryza brachyantha]
Length=132

 Score =   169 bits (429),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TE +N+++++    E  KKNRIQVSNTKK LFFYVNL+KRY+Q +NEVELSALGMA
Sbjct  1    MEEVTEAVNSLSLA----EAHKKNRIQVSNTKKPLFFYVNLAKRYMQLHNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG AIEKKI T TVD++D+  SRP+ KA+IE+VLGKTE FDELM
Sbjct  57   IATVVTVAEILKNNGLAIEKKIMTSTVDVKDDSRSRPMQKAKIEIVLGKTENFDELM  113



>ref|XP_004168112.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
Length=129

 Score =   169 bits (429),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N++ +++   + QKKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITEGVNSITLTA---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+E +I T TVD++D+   RPV KA+IE+VLGKTE FDELM
Sbjct  58   IATVVTVAEILKNNGLALE-RIMTSTVDIKDDSRGRPVQKAKIEIVLGKTENFDELM  113



>ref|XP_010549407.1| PREDICTED: uncharacterized protein At2g34160 isoform X1 [Tarenaya 
hassleriana]
Length=130

 Score =   169 bits (428),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 3/113 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY+EVELSALGMA
Sbjct  1    MEEITEGVNNMNLAV---DTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYDEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKF  410
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA++E+ LGK+EKF
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKMEITLGKSEKF  110



>ref|XP_008366692.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=133

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME + EG+NN+ I+   S  +KKNRIQVSNTKK LFFYVNL+KRY+Q  NEVELSALGMA
Sbjct  1    MEGLAEGVNNLRITDA-SYNKKKNRIQVSNTKKPLFFYVNLAKRYMQHNNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EK+I T T+DMR++ G RP+ KA+IE++LGK+EKFDE+M
Sbjct  60   IATVVTIAEILKNNGLALEKRIMTSTIDMREDAGGRPIQKAKIEILLGKSEKFDEIM  116



>emb|CDX94654.1| BnaC07g10040D [Brassica napus]
Length=130

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N++   S   + QKK+RIQVS+TKK LFFYVNL+KRY+QQY++VELSALGMA
Sbjct  1    MEGITEGVNSM---SLGVDTQKKSRIQVSHTKKPLFFYVNLAKRYMQQYSDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLAKSEKFDELM  114



>ref|XP_009388523.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=131

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NNV+I++  ++  K NRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MEEITEGVNNVHITA--ADAHKSNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKF  410
            I+TVVT+AEILKNNG AIEKKI T TVD++DE   RP+ KA+IE++LGKTEKF
Sbjct  59   IATVVTIAEILKNNGLAIEKKITTSTVDVKDESRGRPIQKAKIEILLGKTEKF  111



>gb|AFK38642.1| unknown [Lotus japonicus]
Length=135

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITE +NN++IS +     KKNRIQVSNTKK LFFYVNL+KRY+QQ+N+VELSALGMA
Sbjct  1    MEAITEAVNNIDISDS----YKKNRIQVSNTKKPLFFYVNLAKRYMQQHNDVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TV+++D+   RPV KA+IE++LGKT  FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKITTSTVEIKDDSRIRPVQKAKIEILLGKTANFDELM  113



>gb|AFK35646.1| unknown [Lotus japonicus]
Length=135

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITE +NN++IS +     KKNRIQVSNTKK LFFYVNL+KRY+QQ+N+VELSALGMA
Sbjct  1    MEAITEAVNNIDISDS----YKKNRIQVSNTKKPLFFYVNLAKRYMQQHNDVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TV+++D+   RPV KA+IE++LGKT  FDELM
Sbjct  57   IATVVTVAEILKNNGLAVEKKITTSTVEIKDDSRIRPVQKAKIEILLGKTANFDELM  113



>gb|AFK40867.1| unknown [Lotus japonicus]
Length=136

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            MEAITEG+NN+NIS+ N++  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEAITEGVNNINISTNNNDSFKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  60

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGKT  FDELM
Sbjct  61   IATVVTVAEILKNNGLAVEKKILTSTVDIKDDSRGRPVQKAKIEIVLGKTAHFDELM  117



>emb|CDY15643.1| BnaA07g08140D [Brassica napus]
Length=130

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N++   S   + QKK+RIQVS+TKK LFFYVNL+KRY+QQY++VELSALGMA
Sbjct  1    MEGITEGVNSM---SLGVDTQKKSRIQVSHTKKPLFFYVNLAKRYMQQYSDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA+IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLSKSEKFDELM  114



>ref|XP_009109679.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
 emb|CDX90176.1| BnaA08g18080D [Brassica napus]
Length=130

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN++++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEGITEGVNNMSLAV---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYADVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKN+GFA+EKKI T TVD++D    RPV K +IE+ L K+EKFDELM
Sbjct  58   IATVVTVAEILKNSGFAVEKKIMTSTVDIKDGARGRPVQKPKIEITLAKSEKFDELM  114



>ref|XP_006410558.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum]
 gb|ESQ52011.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum]
Length=130

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT G+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITAGVNNMNLAV---DDQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             +TVVT+AEILKNNGFA+EKKI T TV+++D+   RPV K +IE+ L K+EKFDELM
Sbjct  58   TATVVTIAEILKNNGFAVEKKIMTSTVEIKDDSRGRPVQKVKIEITLVKSEKFDELM  114



>ref|XP_004951528.1| PREDICTED: uncharacterized protein At2g34160-like [Setaria italica]
Length=143

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 10/127 (8%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNS----------EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYN  221
            ME +TE +NN++IS   +          E  KKNRIQVSNTKK LFFYVNL+KRY+Q +N
Sbjct  1    MEEVTEAVNNLSISGGGAAAAAADDAGAEGHKKNRIQVSNTKKPLFFYVNLAKRYMQLHN  60

Query  222  EVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKT  401
            EVELSALGMAI+TVVTVAEILKNNG A+ KKI T TVD++DE  SRP+ KA+IE++LGKT
Sbjct  61   EVELSALGMAIATVVTVAEILKNNGLAVVKKIMTSTVDVKDETRSRPIQKAKIEILLGKT  120

Query  402  EKFDELM  422
            EKFDELM
Sbjct  121  EKFDELM  127



>ref|XP_006647046.1| PREDICTED: uncharacterized protein At2g34160-like [Oryza brachyantha]
Length=138

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 99/119 (83%), Gaps = 2/119 (2%)
 Frame = +3

Query  72   MEAITEGINNVNI--SSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALG  245
            ME +TE + N+ I   +  +E  KKNRIQVSNTKK LFFYVNL+KRY+Q +NEVELSALG
Sbjct  1    MEEVTEAVGNLAIEGGAAGAEAHKKNRIQVSNTKKPLFFYVNLAKRYMQLHNEVELSALG  60

Query  246  MAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            MAI+TVVTVAEILKNNG A+EKKI T TVD++D+  SRP+ KA+IE++L KT+KFDELM
Sbjct  61   MAIATVVTVAEILKNNGLAVEKKIMTSTVDVKDDSRSRPIQKAKIEILLSKTDKFDELM  119



>gb|KHF97780.1| hypothetical protein F383_15777 [Gossypium arboreum]
Length=134

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 100/115 (87%), Gaps = 2/115 (2%)
 Frame = +3

Query  72   MEAITEGINNVNI--SSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALG  245
            ME ITEG+NN+NI  SS ++   KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALG
Sbjct  1    MEGITEGVNNLNIMDSSPSNNNNKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALG  60

Query  246  MAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKF  410
            MAI+TVVT+AEILKNNG A+EKKI T T+DMR+E G RPV KA+IE++L K+EKF
Sbjct  61   MAIATVVTIAEILKNNGLAVEKKIMTSTIDMREESGGRPVQKAKIEILLAKSEKF  115



>emb|CDY43326.1| BnaC03g58980D [Brassica napus]
Length=130

 Score =   167 bits (423),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN++++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEGITEGVNNMSLAV---DSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYADVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKN+GFA+EKKI T TVD++D    RPV K +IE+ L K++KFDELM
Sbjct  58   IATVVTVAEILKNSGFAVEKKIMTSTVDIKDGARGRPVQKPKIEITLAKSDKFDELM  114



>emb|CDX99800.1| BnaC05g22220D [Brassica napus]
Length=130

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+ ++   S   + QKKNRIQVSNTKK LFFYVNL+KRY+QQY +VELSALGMA
Sbjct  1    MEGITEGVKSM---SLGVDTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYTDVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFA+EKKI T+TVD++ +   RPV KA+IE+ L K++KFDELM
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTMTVDIKGDSRGRPVQKAKIEITLAKSDKFDELM  114



>ref|XP_001768991.1| predicted protein [Physcomitrella patens]
 ref|XP_001769017.1| predicted protein [Physcomitrella patens]
 gb|EDQ66189.1| predicted protein [Physcomitrella patens]
 gb|EDQ66215.1| predicted protein [Physcomitrella patens]
Length=131

 Score =   166 bits (421),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+ ++++     +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGMA
Sbjct  1    MEEITEGVADMSVY----DAHKKNRIQVSNTKKPLFFYVNLAKRYMQQHEEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG AIEK+I T TVDM+DE   RP+ KA++E++LGK+E FDELM
Sbjct  57   IATVVTVAEILKNNGLAIEKRILTSTVDMKDETRGRPIQKAKVEIILGKSEHFDELM  113



>ref|XP_002453505.1| hypothetical protein SORBIDRAFT_04g007020 [Sorghum bicolor]
 gb|EES06481.1| hypothetical protein SORBIDRAFT_04g007020 [Sorghum bicolor]
Length=141

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 8/125 (6%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEP--------QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEV  227
            ME +TE +NN++IS   +           KKNRIQVSNTKK LFFYVNL+KRY+Q +NEV
Sbjct  1    MEEVTEAVNNLSISGGGATAGAGAGAEGHKKNRIQVSNTKKPLFFYVNLAKRYMQLHNEV  60

Query  228  ELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEK  407
            ELSALGMAI+TVVTVAEILKNNG A+EKKI T TVD++DE   RP+ KA+IE++LGKT+K
Sbjct  61   ELSALGMAIATVVTVAEILKNNGLAVEKKIMTSTVDVKDETRPRPIQKAKIEILLGKTDK  120

Query  408  FDELM  422
            FDELM
Sbjct  121  FDELM  125



>ref|XP_009348607.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=135

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME + E +NN+ I+  +     KNRIQVSNTKK +FFYVNL+KRY+QQ NEVELSALGMA
Sbjct  1    MEGLAEEVNNLQITDASYNKNNKNRIQVSNTKKPVFFYVNLAKRYMQQNNEVELSALGMA  60

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EK+I+T T++MR++ G RP+ KA+IE++LGK+EKFDE+M
Sbjct  61   IATVVTIAEILKNNGLAVEKRIKTSTINMREDAGGRPIQKAKIEILLGKSEKFDEIM  117



>ref|XP_006837817.1| hypothetical protein AMTR_s00104p00132470 [Amborella trichopoda]
 gb|ERN00386.1| hypothetical protein AMTR_s00104p00132470 [Amborella trichopoda]
Length=132

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 96/115 (83%), Gaps = 4/115 (3%)
 Frame = +3

Query  69   TMEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
             +E +TE ++N+++S    E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGM
Sbjct  3    AIEEVTEAVSNLHVS----ESHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGM  58

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            AI+TVVT+AEILKNNG AIEKKI T TVDM+DE   RP+ KA+IE++LGKT  FD
Sbjct  59   AIATVVTIAEILKNNGLAIEKKIMTSTVDMKDESRGRPIQKAKIEILLGKTANFD  113



>ref|XP_006356204.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Solanum tuberosum]
Length=127

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME + EG++N+N+  +    Q+KNRIQVSNTKK LFFYVNLSKRY+QQYNEVELSALGMA
Sbjct  1    MEELAEGVSNLNLVDS----QRKNRIQVSNTKKPLFFYVNLSKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVV++AEILKNNG A EKKI T TVD++++   RPV KA+IE+VLGKT  FDELM
Sbjct  57   ISTVVSIAEILKNNGLATEKKIMTSTVDVKEDMRGRPVQKAKIEIVLGKTVNFDELM  113



>ref|XP_004486682.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Cicer arietinum]
Length=134

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N  + NS+  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEGITEGLNNIN-INNNSDSYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA+IE+VLGKT  FDELM
Sbjct  60   IATVVTVAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEIVLGKTANFDELM  116



>ref|XP_004968373.1| PREDICTED: uncharacterized protein At2g34160-like isoform X3 
[Setaria italica]
Length=134

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            +E ITEG+ N++++    +    NRIQVSNTKK LFFYVNL+KRY+QQ+ +VELSALGMA
Sbjct  3    VEEITEGVKNLSVAG---DAAASNRIQVSNTKKPLFFYVNLAKRYMQQHGDVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVTVAEILKNNGFAIEKKIRT TV++ DE   RP  KA+IE+VLGK++KFDELM
Sbjct  60   IATVVTVAEILKNNGFAIEKKIRTSTVEINDESRGRPFQKAKIEIVLGKSDKFDELM  116



>ref|XP_008394068.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=138

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME + E +NN+ I+  +     KNRIQVSNTKK +FFYVNL+KRY+QQ NEVELSALGMA
Sbjct  1    MEGLAEEVNNLQITDASYNKNNKNRIQVSNTKKPVFFYVNLAKRYMQQNNEVELSALGMA  60

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EK+I T T++MR++ G RP+ KA+IE++LGK+EKFDE+M
Sbjct  61   IATVVTIAEILKNNGLAVEKRIMTSTINMREDAGGRPIQKAKIEILLGKSEKFDEIM  117



>ref|XP_004241699.1| PREDICTED: uncharacterized protein At2g34160-like [Solanum lycopersicum]
Length=127

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (83%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME + EG++N+N+  +    QKKNRIQVSNTKK LFFYVNLSKRY+QQYNEVELSALGMA
Sbjct  1    MEELAEGVSNLNLVDS----QKKNRIQVSNTKKPLFFYVNLSKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVV++AEILKNNG A EKKI T TVD+ ++   RP+ KA+IE+VLGKT  FDELM
Sbjct  57   ISTVVSIAEILKNNGLATEKKIMTSTVDVNEDMRGRPIQKAKIEIVLGKTVNFDELM  113



>gb|ABK22189.1| unknown [Picea sitchensis]
Length=132

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = +3

Query  69   TMEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
             ME ITE + N++++  +    KKNRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGM
Sbjct  2    AMEEITERVGNMDLNDVH----KKNRIQVSNTKKPLFFYVNLAKRYMQQHEEVELSALGM  57

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVTVAEILKNNG A+EKKI T T+DMRDE   RP+ KA++E++LGK+E+F++LM
Sbjct  58   AIATVVTVAEILKNNGLAVEKKISTSTIDMRDESRGRPIQKAKVEIILGKSEQFNDLM  115



>ref|XP_003597872.1| hypothetical protein MTR_2g103500 [Medicago truncatula]
 gb|AES68123.1| alba DNA/RNA-binding protein [Medicago truncatula]
 gb|AFK35428.1| unknown [Medicago truncatula]
Length=136

 Score =   164 bits (416),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 1/118 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTN-SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
            ME ITEG+NN+NI++ N S+  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGM
Sbjct  1    MEGITEGVNNININNNNNSDSYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGM  60

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVTVAEILKNNG A+EKK+ T TVD++D+   RPV KA+IE+VLGKT  FDELM
Sbjct  61   AIATVVTVAEILKNNGLAVEKKVMTSTVDIKDDSRGRPVQKAKIEIVLGKTANFDELM  118



>ref|XP_009355722.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=134

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME + E +NN+ I+  +     KNRIQVSNTKK +FFYV+L+KRY+QQ NEVELSALGMA
Sbjct  1    MEGLAEEVNNLQITDASYNKNNKNRIQVSNTKKPVFFYVSLAKRYMQQNNEVELSALGMA  60

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EK+I+T T++MR++ G RP+ KA+IE++LGK+EKFDE+M
Sbjct  61   IATVVTIAEILKNNGLAVEKRIKTSTINMREDAGGRPIQKAKIEILLGKSEKFDEIM  117



>emb|CDO98136.1| unnamed protein product [Coffea canephora]
Length=140

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT+G+NN+NI+++N++ QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITDGVNNININNSNNDLQKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  60

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVV+VAEILKNNG A+EK+I T TV+++D+   RPV KA+IE+VLGK+ KFDELM
Sbjct  61   IATVVSVAEILKNNGLAVEKRIVTSTVEIKDDSRGRPVQKAKIEIVLGKSAKFDELM  117



>ref|XP_010526208.1| PREDICTED: uncharacterized protein At2g34160-like [Tarenaya hassleriana]
Length=126

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 99/117 (85%), Gaps = 6/117 (5%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            M A+ EG+  ++I+       KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MAAVVEGMQKLSIADA-----KKNRIQVSNTKKPLFFYVNLAKRYMQQHSEVELSALGMA  55

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ISTVV++AEILK+NGFA+EK+I T TVDMR+E G RPV K +IE++LGK+EKFDELM
Sbjct  56   ISTVVSIAEILKSNGFAVEKRIMTSTVDMREEIG-RPVHKPKIEIMLGKSEKFDELM  111



>dbj|BAD15498.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC72700.1| hypothetical protein OsI_06285 [Oryza sativa Indica Group]
 gb|EEE56518.1| hypothetical protein OsJ_05802 [Oryza sativa Japonica Group]
Length=145

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 8/125 (6%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEP--------QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEV  227
            ME +TE + N+ I++  +           KKNRIQVSNTKK LFFYVNL+KRY+Q +NEV
Sbjct  1    MEEVTEAVGNLTIAAGEAAGAGGGAAEAHKKNRIQVSNTKKPLFFYVNLAKRYMQLHNEV  60

Query  228  ELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEK  407
            ELSALGMAI+TVVTVAEILKNNG A+EKKI T TVD++D+  SRP+ KA+IE+VLGKT+K
Sbjct  61   ELSALGMAIATVVTVAEILKNNGLAVEKKIMTSTVDVKDDSRSRPMQKAKIEIVLGKTDK  120

Query  408  FDELM  422
            FDELM
Sbjct  121  FDELM  125



>pdb|1VM0|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At2g34160
 pdb|1VM0|B Chain B, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At2g34160
 pdb|2Q3V|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At2g34160
 pdb|2Q3V|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At2g34160
Length=130

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +3

Query  75   EAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAI  254
            E IT+G+NN N+++   + QKKNRIQVSNTKK LFFYVNL+KRY QQYN+VELSALG AI
Sbjct  2    EEITDGVNNXNLAT---DSQKKNRIQVSNTKKPLFFYVNLAKRYXQQYNDVELSALGXAI  58

Query  255  STVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDEL  419
            +TVVTV EILKNNGFA+EKKI T  VD++D+   RPV KA+IE+ L K+EKFDEL
Sbjct  59   ATVVTVTEILKNNGFAVEKKIXTSIVDIKDDARGRPVQKAKIEITLVKSEKFDEL  113



>ref|XP_009408969.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=128

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+++++   +  K+NRI VSNTKK LFFYVNL+KRY+QQY+E ELSALGMA
Sbjct  1    MEQITEGVNNLSVAA---DSFKENRILVSNTKKPLFFYVNLAKRYMQQYDEAELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I TVVT+AEILKNNGFA+EKKI T  VD+ DE   R + KARIE++LGKTE FDELM
Sbjct  58   IGTVVTIAEILKNNGFAVEKKIMTSMVDVEDETRGRLLQKARIEILLGKTENFDELM  114



>ref|NP_001143331.1| uncharacterized protein LOC100275927 [Zea mays]
 gb|ACG30858.1| hypothetical protein [Zea mays]
 gb|ACR37059.1| unknown [Zea mays]
 gb|AFW66116.1| (uaz270(357)), mRNA [Zea mays]
Length=139

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 6/120 (5%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNS------EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVEL  233
            M+ +TE +NN+NIS   +      E  KKNRIQVSNTKK LFFYVNL+KRY+Q +NEVEL
Sbjct  1    MDEVTEAVNNLNISGVGAAGVAGAEGHKKNRIQVSNTKKPLFFYVNLAKRYMQLHNEVEL  60

Query  234  SALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            SALGMAI+TVVTVAEILKNNG A+ K I T TVD++DE  +RP+ KA+IE++LGKTEKFD
Sbjct  61   SALGMAIATVVTVAEILKNNGLAVAKSIMTSTVDIKDETRTRPIQKAKIEILLGKTEKFD  120



>gb|KHG16323.1| hypothetical protein F383_08228 [Gossypium arboreum]
Length=122

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 6/113 (5%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            M   TEG+++   S++NS   KKNRIQVSNT+K LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MVGTTEGVDS---SASNS---KKNRIQVSNTQKPLFFYVNLAKRYMQQYNEVELSALGMA  54

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKF  410
            I+TVVT+AEILKNNG A+EKKI T T+DMR+E G RPV KA+IE++LGK+EKF
Sbjct  55   IATVVTIAEILKNNGLAVEKKIMTSTIDMREESGGRPVQKAKIEILLGKSEKF  107



>ref|XP_008659718.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At2g34160-like 
[Zea mays]
Length=129

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 4/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+NN+ I+    EPQ KN+IQVSNTKK LFFYVNL+KRY+QQ+ EVELS LGM 
Sbjct  1    MEELTEGVNNLAIT----EPQMKNKIQVSNTKKPLFFYVNLAKRYMQQHEEVELSTLGMT  56

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+T+VTVAEILKNN   +EKKI T T D++D+  + P+ KA+IE+VL KTEKFDELM
Sbjct  57   IATMVTVAEILKNNRLVVEKKIMTSTADVKDDSRAHPIQKAKIEIVLAKTEKFDELM  113



>ref|XP_010525972.1| PREDICTED: uncharacterized protein At2g34160-like [Tarenaya hassleriana]
Length=125

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 6/117 (5%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            M A+ EG+  ++I+       +KNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MAAVIEGMKKLSIADA-----RKNRIQVSNTKKPLFFYVNLAKRYMQQHSEVELSALGMA  55

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVV +AEILK+NGFA+EKKI T  VDMR+E G RPV K +IE++LGKTEKFDELM
Sbjct  56   IATVVNIAEILKSNGFAVEKKIMTSMVDMREEIG-RPVHKPKIEIMLGKTEKFDELM  111



>gb|ABK24162.1| unknown [Picea sitchensis]
 gb|ACN41069.1| unknown [Picea sitchensis]
Length=142

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 97/118 (82%), Gaps = 3/118 (3%)
 Frame = +3

Query  69   TMEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
             ME I+EG+ NVN++  N   QKKNRIQVSNTK+ LFFYVNL+KRYL+ + EVELS LGM
Sbjct  12   AMEEISEGMANVNLNDNN---QKKNRIQVSNTKQPLFFYVNLAKRYLKNHEEVELSGLGM  68

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVVTVAEILKNNG A+EK+I T TVDM+D+  SRP+ KA+IE++L K+  F+ELM
Sbjct  69   AIATVVTVAEILKNNGLAVEKRILTSTVDMKDDTRSRPIQKAKIEIILRKSHNFEELM  126



>gb|ABR26175.1| unknown [Oryza sativa Indica Group]
Length=126

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  132  QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEK  311
             KKNRIQVSNTKK LFFYVNL+KRY+Q +NEVELSALGMAI+TVVTVAEILKNNG A+EK
Sbjct  10   HKKNRIQVSNTKKPLFFYVNLAKRYMQLHNEVELSALGMAIATVVTVAEILKNNGLAVEK  69

Query  312  KIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            KI T TVD++D+  SRP+ KA+IE+VLGKT+KFDELM
Sbjct  70   KIMTSTVDVKDDSRSRPMQKAKIEIVLGKTDKFDELM  106



>ref|XP_001769016.1| predicted protein [Physcomitrella patens]
 gb|EDQ66214.1| predicted protein [Physcomitrella patens]
Length=121

 Score =   159 bits (401),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGMAI+TVVTVAEILKNNG AI
Sbjct  5    DAHKKNRIQVSNTKKPLFFYVNLAKRYMQQHEEVELSALGMAIATVVTVAEILKNNGLAI  64

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EK+I T TVDM+DE   RP+ KA++E++LGK+E FDELM
Sbjct  65   EKRILTSTVDMKDETRGRPIQKAKVEIILGKSEHFDELM  103



>ref|XP_007030533.1| Alba DNA/RNA-binding protein [Theobroma cacao]
 gb|EOY11035.1| Alba DNA/RNA-binding protein [Theobroma cacao]
Length=125

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  ISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILK  287
            +++   + QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILK
Sbjct  6    VAAAEGDAQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILK  65

Query  288  NNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            NNG AIEKK+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  66   NNGLAIEKKVMTSTVGMKDENKGRVVQKAKIEIVLGKSEKFDLLM  110



>ref|XP_006450468.1| hypothetical protein CICLE_v10009882mg [Citrus clementina]
 gb|ESR63708.1| hypothetical protein CICLE_v10009882mg [Citrus clementina]
Length=126

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+NIS   S   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEVITEGVNNINISDA-SAASKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARI  380
            I+TVVT+AEILKNNG A+EKKI T TVD+R+E G RPV KA++
Sbjct  60   IATVVTIAEILKNNGLAVEKKITTSTVDIREETGGRPVQKAKV  102



>ref|XP_004304756.1| PREDICTED: uncharacterized protein At2g34160-like [Fragaria vesca 
subsp. vesca]
Length=157

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  132  QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEK  311
            QKKNRIQVSNTKK LFFYVNL+KRYL+Q+NEVELSALGMAI+TVVT+AEILKNNG AIEK
Sbjct  43   QKKNRIQVSNTKKPLFFYVNLAKRYLEQHNEVELSALGMAITTVVTIAEILKNNGLAIEK  102

Query  312  KIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            K+ T TV MRDE   R V KA+IE+VLGK+EKFDE+M
Sbjct  103  KVSTSTVGMRDENKGRLVQKAKIEIVLGKSEKFDEIM  139



>ref|XP_011032375.1| PREDICTED: uncharacterized protein At2g34160 [Populus euphratica]
Length=150

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  NISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEIL  284
            N ++T    QKKNRIQVSNTKK LFFYVNL+KRYLQQYNEV+LSALGMAI+TVVT+AEIL
Sbjct  26   NDTTTTLAQQKKNRIQVSNTKKPLFFYVNLAKRYLQQYNEVQLSALGMAITTVVTIAEIL  85

Query  285  KNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            KNNG A EKK+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  86   KNNGLATEKKLLTSTVCMKDENKGRQVQKAKIEIVLGKSEKFDSLM  131



>ref|NP_001142884.1| uncharacterized protein LOC100275297 [Zea mays]
 gb|ACG27306.1| hypothetical protein [Zea mays]
Length=146

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 10/126 (8%)
 Frame = +3

Query  75   EAITEGINNVNISSTNSEPQ----------KKNRIQVSNTKKSLFFYVNLSKRYLQQYNE  224
            E ITEG+ N+ ++   +               NRIQVSNTKK LFFYVNL+KRY+QQ+ +
Sbjct  4    EEITEGLKNLTVTGDAAASGGEGQRRGGGISSNRIQVSNTKKPLFFYVNLAKRYMQQHGD  63

Query  225  VELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTE  404
            VELSALGMAI+TVVTVAEILKNNGFA+EKKIRT TVD+ DE   RP  KA+IE++LGK++
Sbjct  64   VELSALGMAIATVVTVAEILKNNGFAVEKKIRTSTVDINDESRGRPFQKAKIEIILGKSD  123

Query  405  KFDELM  422
            +FDELM
Sbjct  124  RFDELM  129



>gb|KDP32385.1| hypothetical protein JCGZ_13310 [Jatropha curcas]
Length=108

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NNV I  T  +  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEEITEGVNNVTI--TGGDLHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  58

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARI  380
            I+TVVTVAEILKNNG AIEKKI T TVDMRDE   RPV KA++
Sbjct  59   IATVVTVAEILKNNGLAIEKKIMTSTVDMRDEARGRPVQKAKM  101



>gb|AGT16645.1| hypothetical protein SHCRBa_170_C07_R_130 [Saccharum hybrid cultivar 
R570]
Length=147

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 97/128 (76%), Gaps = 11/128 (9%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNS-----------EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQY  218
            +E ITEG+ N+ ++   +                NRIQVSNTKK LFFYVNL+KRY+QQ+
Sbjct  3    VEEITEGVKNLAVAGDAAAVSGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAKRYMQQH  62

Query  219  NEVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGK  398
             +VELSALGMAI+TVVTVAEILKNNGFA+EKKIRT TV++ DE   RP  KA+IE++LGK
Sbjct  63   GDVELSALGMAIATVVTVAEILKNNGFAVEKKIRTSTVEINDESRGRPFQKAKIEIILGK  122

Query  399  TEKFDELM  422
            ++KFDELM
Sbjct  123  SDKFDELM  130



>ref|XP_006643815.1| PREDICTED: uncharacterized protein At2g34160-like [Oryza brachyantha]
Length=147

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 97/130 (75%), Gaps = 12/130 (9%)
 Frame = +3

Query  69   TMEAITEGINNVNISST------------NSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQ  212
             +E +TEG+ N+ +                +     NRIQVSNTKK LFFYVNL+KRY+Q
Sbjct  2    AVEEVTEGVRNLTVEGDAAGAAAGEGAVRRAAGSSSNRIQVSNTKKPLFFYVNLAKRYMQ  61

Query  213  QYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVL  392
            Q+ +VELSALGMAI+TVVTVAEILKNNGFA+EKKIRT TV++ DE   RP+ KA+IE+VL
Sbjct  62   QHGDVELSALGMAIATVVTVAEILKNNGFAVEKKIRTSTVEINDESRVRPLQKAKIEIVL  121

Query  393  GKTEKFDELM  422
            GK+EKFDELM
Sbjct  122  GKSEKFDELM  131



>ref|XP_004968371.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Setaria italica]
Length=152

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 101/132 (77%), Gaps = 15/132 (11%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEP--------QKK-------NRIQVSNTKKSLFFYVNLSKRY  206
            +E ITEG+ N++++   +          QK+       NRIQVSNTKK LFFYVNL+KRY
Sbjct  3    VEEITEGVKNLSVAGDAAASGAGNGGEGQKRGGSGGSSNRIQVSNTKKPLFFYVNLAKRY  62

Query  207  LQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEV  386
            +QQ+ +VELSALGMAI+TVVTVAEILKNNGFAIEKKIRT TV++ DE   RP  KA+IE+
Sbjct  63   MQQHGDVELSALGMAIATVVTVAEILKNNGFAIEKKIRTSTVEINDESRGRPFQKAKIEI  122

Query  387  VLGKTEKFDELM  422
            VLGK++KFDELM
Sbjct  123  VLGKSDKFDELM  134



>ref|XP_004139384.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
 ref|XP_004173075.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
 gb|KGN60788.1| hypothetical protein Csa_2G010240 [Cucumis sativus]
Length=143

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNG A
Sbjct  14   TETQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILKNNGLA  73

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             EKK+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  74   TEKKVLTSTVGMKDENKGRLVQKAKIEIVLGKSEKFDSLM  113



>ref|XP_008456222.1| PREDICTED: uncharacterized protein At2g34160 [Cucumis melo]
Length=142

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNG A
Sbjct  13   TETQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILKNNGLA  72

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             EKK+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  73   TEKKVLTSTVGMKDENKGRLVQKAKIEIVLGKSEKFDSLM  112



>ref|XP_010688018.1| PREDICTED: uncharacterized protein At2g34160-like [Beta vulgaris 
subsp. vulgaris]
Length=132

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = +3

Query  69   TMEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
             +E ITEG+NN+++  +     KKNRIQVSNTKK LFFYVNL+KRY+QQ+++VELSALGM
Sbjct  3    AVEQITEGVNNLSVIDSG----KKNRIQVSNTKKPLFFYVNLAKRYMQQHDDVELSALGM  58

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            AI+TVV+VAEILKN G A+EKKI T TVD++D+   RPV KA+IE++L K+E FD+LM
Sbjct  59   AIATVVSVAEILKNGGLAVEKKIMTSTVDIKDDSRGRPVQKAKIEILLEKSEDFDKLM  116



>ref|XP_010549408.1| PREDICTED: uncharacterized protein At2g34160 isoform X2 [Tarenaya 
hassleriana]
Length=118

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 92/105 (88%), Gaps = 3/105 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N++    + QKKNRIQVSNTKK LFFYVNL+KRY+QQY+EVELSALGMA
Sbjct  1    MEEITEGVNNMNLAV---DTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYDEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEV  386
            I+TVVTVAEILKNNGFA+EKKI T TVD++D+   RPV KA++E+
Sbjct  58   IATVVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKMEI  102



>gb|KHG14530.1| hypothetical protein F383_02218 [Gossypium arboreum]
Length=130

 Score =   157 bits (396),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNG AI
Sbjct  17   EAQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILKNNGLAI  76

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  77   EKKVLTSTVGMKDENKGRVVLKAKIEIVLGKSEKFDLLM  115



>ref|NP_001281224.1| LOC100284257 [Zea mays]
 gb|ACG39714.1| hypothetical protein [Zea mays]
Length=146

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 10/127 (8%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNS----------EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYN  221
            +E I EG+ N+ ++   +               NRIQVSNTKK LFFYVNL+KRY+QQ++
Sbjct  3    VEEIAEGVKNLTVTGDAAASGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAKRYMQQHD  62

Query  222  EVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKT  401
            +VELSALGMAI+TVVTVAEILKNNGFA+EKKIRT TV++ DE   RP  KA+IE++LGK+
Sbjct  63   DVELSALGMAIATVVTVAEILKNNGFAVEKKIRTSTVEINDESRGRPFQKAKIEIILGKS  122

Query  402  EKFDELM  422
            +KFDELM
Sbjct  123  DKFDELM  129



>gb|ABK26422.1| unknown [Picea sitchensis]
Length=154

 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 99/123 (80%), Gaps = 6/123 (5%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQ------KKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVEL  233
            +E +TEG+  + +++ N+         KKNRIQVSNTKK LFFYVNL+KRYLQQ++EVEL
Sbjct  15   VEEVTEGMEKLKVAAINNNNAVSNENYKKNRIQVSNTKKPLFFYVNLAKRYLQQHDEVEL  74

Query  234  SALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            SALGMAI+TVVTVAEILKNNG AIEK+I T TV+M+DE   RP+ KA++E++L K +KFD
Sbjct  75   SALGMAIATVVTVAEILKNNGLAIEKRILTSTVEMKDETRERPIQKAKVEIILTKADKFD  134

Query  414  ELM  422
            ELM
Sbjct  135  ELM  137



>ref|XP_006382820.1| hypothetical protein POPTR_0005s05780g [Populus trichocarpa]
 gb|ERP60617.1| hypothetical protein POPTR_0005s05780g [Populus trichocarpa]
Length=148

 Score =   157 bits (396),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  NISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEIL  284
            N ++T    QK NRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMAI+TVVT+AEIL
Sbjct  24   NDTTTTLAQQKNNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMAITTVVTIAEIL  83

Query  285  KNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            KNNG A EKK+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  84   KNNGLATEKKVLTSTVCMKDENKGRQVQKAKIEIVLGKSEKFDSLM  129



>dbj|BAJ87819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEP-----QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELS  236
            ME +TE +NN+ I+   +        KKNRIQVSNTKK LFFYVNL+KRY+Q + EVELS
Sbjct  1    MEEVTEAVNNLTIAEGAAATAGAEGHKKNRIQVSNTKKPLFFYVNLAKRYMQLHEEVELS  60

Query  237  ALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            ALGMAI+TVVTVAEILKNNG A+EKKI T TVD++D+  +RP+ KA+IE+++GKTEKFD
Sbjct  61   ALGMAIATVVTVAEILKNNGLAVEKKIMTSTVDVKDDTRNRPIQKAKIEILIGKTEKFD  119



>ref|NP_001288491.1| uncharacterized protein LOC103649688 [Zea mays]
 gb|ACF79101.1| unknown [Zea mays]
 gb|ACR38281.1| unknown [Zea mays]
 tpg|DAA53231.1| TPA: hypothetical protein ZEAMMB73_528502 [Zea mays]
Length=146

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 10/127 (8%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNS----------EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYN  221
            +E I EG+ N+ ++   +               NRIQVSNTKK LFFYVNL+KRY+QQ+ 
Sbjct  3    VEEIAEGVKNLTVTGDAAASGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAKRYMQQHG  62

Query  222  EVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKT  401
            +VELSALGMAI+TVVTVAEILKNNGFA+EKKIRT TV++ DE   RP  KA+IE++LGK+
Sbjct  63   DVELSALGMAIATVVTVAEILKNNGFAVEKKIRTSTVEINDESRGRPFQKAKIEIILGKS  122

Query  402  EKFDELM  422
            +KFDELM
Sbjct  123  DKFDELM  129



>ref|NP_001141319.1| uncharacterized protein LOC100273410 [Zea mays]
 gb|ACF86067.1| unknown [Zea mays]
 gb|ACG48793.1| hypothetical protein [Zea mays]
 tpg|DAA53234.1| TPA: hypothetical protein ZEAMMB73_180985 [Zea mays]
Length=146

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 10/127 (8%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNS----------EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYN  221
            +E I EG+ N+ ++   +               NRIQVSNTKK LFFYVNL+KRY+QQ+ 
Sbjct  3    VEEIAEGVKNLTVTGDAAASGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAKRYMQQHE  62

Query  222  EVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKT  401
            +VELSALGMAI+TVVTVAEILKNNGFA+EKKIRT TV++ DE   RP  KA+IE++LGK+
Sbjct  63   DVELSALGMAIATVVTVAEILKNNGFAVEKKIRTSTVEINDESRGRPFQKAKIEIILGKS  122

Query  402  EKFDELM  422
            +KFDELM
Sbjct  123  DKFDELM  129



>gb|ACN31274.1| unknown [Zea mays]
 gb|AFW80169.1| hypothetical protein ZEAMMB73_176081 [Zea mays]
Length=146

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 10/126 (8%)
 Frame = +3

Query  75   EAITEGINNVNISSTNSEPQ----------KKNRIQVSNTKKSLFFYVNLSKRYLQQYNE  224
            E ITEG+ N+ ++   +               NRIQVSNTKK LFFYVNL+KRY+QQ+ +
Sbjct  4    EEITEGLKNLTVTGDAAASGGEGQRRGGGISSNRIQVSNTKKPLFFYVNLAKRYMQQHGD  63

Query  225  VELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTE  404
            VELSALGMAI+TVVTVAEILKNNGFA+EKKIRT TVD+ DE   RP  KA+IE++LGK++
Sbjct  64   VELSALGMAIATVVTVAEILKNNGFAVEKKIRTSTVDINDESRGRPFQKAKIEIILGKSD  123

Query  405  KFDELM  422
            +F+ELM
Sbjct  124  RFNELM  129



>ref|XP_003571486.1| PREDICTED: uncharacterized protein At2g34160-like [Brachypodium 
distachyon]
Length=143

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 97/123 (79%), Gaps = 9/123 (7%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEP---------QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNE  224
            ME +TE +NN++I+   +            KKNRIQVSNTKK LFFYVNL+KRY+Q + E
Sbjct  1    MEEVTEAVNNLSIAEGAAGAAAAAPGAEGHKKNRIQVSNTKKPLFFYVNLAKRYMQLHEE  60

Query  225  VELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTE  404
            VELSALGMAI+TVVTVAEILKNNG A+EKKI T TVD++D+  +RP+ KA+IE+++GKTE
Sbjct  61   VELSALGMAIATVVTVAEILKNNGLAVEKKIMTSTVDVKDDARNRPIQKAKIEILIGKTE  120

Query  405  KFD  413
            KFD
Sbjct  121  KFD  123



>ref|XP_002521944.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40348.1| conserved hypothetical protein [Ricinus communis]
Length=153

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  132  QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEK  311
            QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNG A EK
Sbjct  42   QKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILKNNGLATEK  101

Query  312  KIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            K+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  102  KVLTSTVGMKDENKGRLVQKAKIEIVLGKSEKFDSLM  138



>ref|XP_008243713.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Prunus mume]
Length=156

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 100/144 (69%), Gaps = 31/144 (22%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+ I+ +     KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMA
Sbjct  1    MEEITEGVNNIIIADS----HKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMA  56

Query  252  ISTVVTVAEILKNNGFAIEK---------------------------KIRTLTVDMRDEP  350
            I+TVVT+AEILKNNG A+EK                           +I T TVD++D+ 
Sbjct  57   IATVVTIAEILKNNGLAVEKSEASIYFYIFLQSYYHYSIYIFLNINAEIMTSTVDIKDDS  116

Query  351  GSRPVSKARIEVVLGKTEKFDELM  422
              RPV KA+IE++LGK+E FD+LM
Sbjct  117  RGRPVQKAKIEIILGKSENFDDLM  140



>ref|XP_004495605.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Cicer arietinum]
 ref|XP_004495606.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Cicer arietinum]
Length=135

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            ++  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNGFA
Sbjct  19   NDSHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAIATVVTIAEILKNNGFA  78

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             EKK+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  79   TEKKVLTSTVGMKDENKGRLVQKAKIEIVLGKSEKFDNLM  118



>ref|XP_002319085.2| hypothetical protein POPTR_0013s04020g [Populus trichocarpa]
 gb|EEE95008.2| hypothetical protein POPTR_0013s04020g [Populus trichocarpa]
Length=157

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  132  QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEK  311
            QKKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMAI+TVVT+AEILKNNG AIEK
Sbjct  40   QKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMAITTVVTIAEILKNNGLAIEK  99

Query  312  KIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            K+ T TV M+DE   R + KA+IE+VL K+EKFD LM
Sbjct  100  KVLTSTVGMKDENKGRQIQKAKIEIVLEKSEKFDSLM  136



>ref|XP_010675061.1| PREDICTED: uncharacterized protein At2g34160 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  129  PQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIE  308
            P KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNGFA +
Sbjct  14   PTKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILKNNGFAFQ  73

Query  309  KKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            KK+ T T+ M+DE   R V KA+IE+VL KTEKFD LM
Sbjct  74   KKVCTSTIGMKDENKGRTVQKAKIEIVLEKTEKFDSLM  111



>ref|XP_009372174.1| PREDICTED: uncharacterized protein At2g34160 [Pyrus x bretschneideri]
Length=135

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY++QYNEVELS+LGMAI+TV+T+AEILKNNG AI
Sbjct  18   EAPKKNRIQVSNTKKPLFFYVNLAKRYIEQYNEVELSSLGMAITTVITIAEILKNNGLAI  77

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R V KARIE+VLGK+EKFD +M
Sbjct  78   EKKVSTSTVGMKDESKGRLVQKARIEIVLGKSEKFDAIM  116



>ref|XP_011038549.1| PREDICTED: uncharacterized protein At2g34160-like [Populus euphratica]
Length=149

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  132  QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEK  311
            QKKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMAI+TVVT+AEILKNNG AIEK
Sbjct  32   QKKNRIQVSNTKKPLFFYVNLAKRYMQQYNEVELSALGMAITTVVTIAEILKNNGLAIEK  91

Query  312  KIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            K+ T TV M+DE   R + KA+IE+VL K+EKFD LM
Sbjct  92   KVLTSTVGMKDENKGRQIQKAKIEIVLEKSEKFDSLM  128



>gb|KEH43002.1| alba DNA/RNA-binding protein [Medicago truncatula]
Length=130

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  ISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILK  287
            ++ T +E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILK
Sbjct  8    VTETANESHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAIATVVTIAEILK  67

Query  288  NNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            NNG A EKK+ T TV M+DE   R V KA+IE+ LGK+EKFD +M
Sbjct  68   NNGLATEKKVLTSTVGMKDENKGRLVQKAKIEITLGKSEKFDNMM  112



>ref|XP_004291467.1| PREDICTED: uncharacterized protein At2g34160-like [Fragaria vesca 
subsp. vesca]
Length=134

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +3

Query  72   MEAITEGINNVNI--SSTNSEPQK-KNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSAL  242
            ME +TE +N++++  S+ N +  + +NRIQVSNTKK LFFYVNL+K+Y+Q  NEVELS L
Sbjct  1    MEGLTEAVNDMHVTESAANKKNHRLQNRIQVSNTKKPLFFYVNLAKKYMQLNNEVELSGL  60

Query  243  GMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            GMAI+TVVT+AEILKNNG A+EKKI T TVDMR++ G RP+ KA+IE++LGK++KFD
Sbjct  61   GMAIATVVTIAEILKNNGLAVEKKIITKTVDMREDAGGRPIQKAKIEILLGKSDKFD  117



>ref|XP_010519975.1| PREDICTED: uncharacterized protein At2g34160-like [Tarenaya hassleriana]
Length=161

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A
Sbjct  30   AENQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLA  89

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            IEKK+ T TV M+DE   R V KA+IE+VLGK++KFD LM
Sbjct  90   IEKKVLTSTVGMKDENKGRVVQKAKIEIVLGKSDKFDSLM  129



>ref|XP_004230078.2| PREDICTED: uncharacterized protein At2g34160 [Solanum lycopersicum]
Length=160

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +3

Query  120  NSEPQKK-NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNG  296
            N+E QKK NRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVTVAEILKN G
Sbjct  26   NNEAQKKSNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAITTVVTVAEILKNGG  85

Query  297  FAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            FA EKK+ T TV M+DE   R V KARIE+VL K+EKFD+LM
Sbjct  86   FATEKKVLTSTVGMKDEAKGRMVQKARIEIVLTKSEKFDKLM  127



>ref|XP_007206133.1| hypothetical protein PRUPE_ppa013191mg [Prunus persica]
 ref|XP_008218286.1| PREDICTED: uncharacterized protein At2g34160 [Prunus mume]
 gb|EMJ07332.1| hypothetical protein PRUPE_ppa013191mg [Prunus persica]
Length=135

 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  117  TNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNG  296
             N +  KKNRIQVSNTKK LFFYVNL+KRY++Q+NEVELSALGMAI+TVVT+AEILKNNG
Sbjct  17   ANIDAAKKNRIQVSNTKKPLFFYVNLAKRYIEQHNEVELSALGMAITTVVTIAEILKNNG  76

Query  297  FAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             AIEKK+ T TV M+DE   R V KA+IE+VLGK+EKFD +M
Sbjct  77   LAIEKKVSTSTVGMKDENKGRLVQKAKIEIVLGKSEKFDAIM  118



>ref|XP_006410557.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum]
 gb|ESQ52010.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum]
Length=126

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 95/117 (81%), Gaps = 7/117 (6%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME IT G+NN+N++    + QKKNRIQVSNTKK LFFYVNL+K    QYNEVELSALGMA
Sbjct  1    MEEITAGVNNMNLAV---DDQKKNRIQVSNTKKPLFFYVNLAK----QYNEVELSALGMA  53

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             +TVVT+AEILKNNGFA+EKKI T TV+++D+   RPV K +IE+ L K+EKFDELM
Sbjct  54   TATVVTIAEILKNNGFAVEKKIMTSTVEIKDDSRGRPVQKVKIEITLVKSEKFDELM  110



>emb|CAN60466.1| hypothetical protein VITISV_012496 [Vitis vinifera]
Length=161

 Score =   155 bits (391),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 102/148 (69%), Gaps = 35/148 (24%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSK-----------------  200
            ME ITEG+N++NI+ ++    KKNRIQVSNTKK LFFYVNL+K                 
Sbjct  1    MEEITEGVNSMNIADSH----KKNRIQVSNTKKPLFFYVNLAKFSWKPNIGLKIRVRISG  56

Query  201  ---------RYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKK-----IRTLTVDM  338
                     RY+QQ+NEVELSALGMAI+TVVT+AEILKNNG A+EK+     I T TVDM
Sbjct  57   LDVLGSGVQRYMQQHNEVELSALGMAIATVVTIAEILKNNGLAVEKRLHHAEIMTSTVDM  116

Query  339  RDEPGSRPVSKARIEVVLGKTEKFDELM  422
            +DE   RP+ KA+IE++LGKTE FDELM
Sbjct  117  KDESRGRPIQKAKIEILLGKTENFDELM  144



>ref|XP_008370716.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=135

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY++QYNEVELS+LGMAI+TV+T+AEILKNNG AI
Sbjct  18   EAPKKNRIQVSNTKKPLFFYVNLAKRYIEQYNEVELSSLGMAITTVITIAEILKNNGLAI  77

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R V KA+IE+VLGK+EKFD +M
Sbjct  78   EKKVSTSTVGMKDESKGRLVQKAKIEIVLGKSEKFDAIM  116



>ref|XP_002455102.1| hypothetical protein SORBIDRAFT_03g004340 [Sorghum bicolor]
 gb|EES00222.1| hypothetical protein SORBIDRAFT_03g004340 [Sorghum bicolor]
Length=147

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  141  NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIR  320
            NRIQVSNTKK LFFYVNL+KRY+QQ+ +VELSALGMAI+TVVTVAEILKNNGFA+EKKIR
Sbjct  37   NRIQVSNTKKPLFFYVNLAKRYMQQHGDVELSALGMAIATVVTVAEILKNNGFAVEKKIR  96

Query  321  TLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            T TV++ DE   RP  KA+IE++LGK++KFDELM
Sbjct  97   TSTVEINDESRGRPFQKAKIEIILGKSDKFDELM  130



>ref|XP_009151257.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=160

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  VNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEI  281
            V+ ++T  E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EI
Sbjct  22   VSATTTAVETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEI  81

Query  282  LKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            LKNNG A EKK+ T TV M+DE   R V KA+IE+VLGK++KFD LM
Sbjct  82   LKNNGLATEKKVLTSTVGMKDENKGRVVQKAKIEIVLGKSDKFDSLM  128



>ref|XP_010417092.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=158

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  96   NNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVA  275
            N V   +T  E  KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMAI+TVVT++
Sbjct  18   NIVLTPATTVESHKKNRIQVSNTKKPLFFYVNLAKRYIQQYNEVELSALGMAITTVVTIS  77

Query  276  EILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EILKNNG A EKK+ T TV+M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  78   EILKNNGMATEKKVLTSTVEMKDETKGRMVQKAKIEIVLGKSDKFDSLV  126



>ref|XP_010670649.1| PREDICTED: uncharacterized protein At2g34160-like [Beta vulgaris 
subsp. vulgaris]
Length=145

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 98/131 (75%), Gaps = 15/131 (11%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKN--------------RIQVSNTKKSLFFYVNLSKRYL  209
            ME +TEG++N+ ++ ++                     RIQVSNTKK LFFYVNL+KRY+
Sbjct  1    MEQVTEGVSNLTVTDSSDNTNNTTNNNNNNNFNNNKKNRIQVSNTKKPLFFYVNLAKRYM  60

Query  210  QQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVV  389
            QQ+NEVELSALGMAI+TVVT+AEILKNNGFA+EKKI T TVD+ +E G RPV KA+IE+V
Sbjct  61   QQHNEVELSALGMAIATVVTIAEILKNNGFAVEKKITTSTVDI-NESGGRPVQKAKIEIV  119

Query  390  LGKTEKFDELM  422
            L K+E FDELM
Sbjct  120  LEKSENFDELM  130



>gb|KDP23684.1| hypothetical protein JCGZ_23517 [Jatropha curcas]
Length=146

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  114  STNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNN  293
            +T     KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNN
Sbjct  29   TTAQGQHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILKNN  88

Query  294  GFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            G A EKK+ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  89   GLATEKKVLTSTVGMKDENKGRLVQKAKIEIVLGKSEKFDSLM  131



>ref|XP_003535371.1| PREDICTED: uncharacterized protein At2g34160-like [Glycine max]
 gb|KHN14838.1| Hypothetical protein glysoja_021011 [Glycine soja]
Length=132

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  117  TNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNG  296
            T ++  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNG
Sbjct  11   TANDSHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAIATVVTIAEILKNNG  70

Query  297  FAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             A EKK+ T TV M+DE   R V KA+IE+VLGK++KFD LM
Sbjct  71   LATEKKVLTSTVGMKDENKGRLVQKAKIEIVLGKSDKFDNLM  112



>emb|CDP06841.1| unnamed protein product [Coffea canephora]
Length=128

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  132  QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEK  311
            Q+KNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMAI+TVVT+AEILKN G A EK
Sbjct  15   QRKNRIQVSNTKKPLFFYVNLAKRYIQQHDEVELSALGMAITTVVTIAEILKNTGLATEK  74

Query  312  KIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            K+ T TV M+DE   R V KARIE+VLGKTEKFD LM
Sbjct  75   KVLTSTVGMKDESKGRMVQKARIEIVLGKTEKFDALM  111



>ref|XP_006395024.1| hypothetical protein EUTSA_v10005588mg [Eutrema salsugineum]
 gb|ESQ32310.1| hypothetical protein EUTSA_v10005588mg [Eutrema salsugineum]
Length=159

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +3

Query  81   ITEGINNVNISSTNS-EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAIS  257
            +T   +N+ +S+T   E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+
Sbjct  13   VTSPASNILLSATTVVETQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAIT  72

Query  258  TVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            TVVT++EILKNNG A EKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  73   TVVTISEILKNNGLATEKKVLTSTVGMKDENKGRIVQKAKIEIVLGKSDKFDSLI  127



>ref|XP_006487872.1| PREDICTED: uncharacterized protein At2g34160-like [Citrus sinensis]
Length=148

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNG A 
Sbjct  27   ESHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILKNNGLAT  86

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R + KA+IE+VLGK+EKFD LM
Sbjct  87   EKKVLTSTVGMKDENKGRFIQKAKIEIVLGKSEKFDSLM  125



>ref|XP_009630719.1| PREDICTED: uncharacterized protein At2g34160 [Nicotiana tomentosiformis]
Length=164

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +3

Query  120  NSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGF  299
            N  P+K NRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGMAI+TVVTVAEILKN GF
Sbjct  35   NEAPKKSNRIQVSNTKKPLFFYVNLAKRYMQQHTEVELSALGMAITTVVTVAEILKNGGF  94

Query  300  AIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            A EKK+ T TV M+DE   R V KARIE+VL K+EKFD+LM
Sbjct  95   ATEKKVLTSTVGMKDEAKGRMVQKARIEIVLTKSEKFDKLM  135



>ref|XP_009364477.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=134

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY++Q+NEVELSALGMAI+TVVT+AEILKNNG AI
Sbjct  18   EAPKKNRIQVSNTKKPLFFYVNLAKRYIEQHNEVELSALGMAITTVVTIAEILKNNGLAI  77

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R + KA+IE+VLGK+EKFD +M
Sbjct  78   EKKVSTSTVGMKDEIKGRLMQKAKIEIVLGKSEKFDAIM  116



>ref|XP_008350636.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=134

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY++Q+NEVELSALGMAI+TVVT+AEILKNNG AI
Sbjct  18   EAPKKNRIQVSNTKKPLFFYVNLAKRYIEQHNEVELSALGMAITTVVTIAEILKNNGLAI  77

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R + KA+IE+VLGK+EKFD +M
Sbjct  78   EKKVSTSTVGMKDEIKGRLMQKAKIEIVLGKSEKFDAIM  116



>ref|XP_009134767.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=162

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A
Sbjct  31   AESHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAITTVVTISEILKNNGLA  90

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            IEKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  91   IEKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLV  130



>ref|NP_001042157.1| Os01g0173100 [Oryza sativa Japonica Group]
 dbj|BAB62549.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04071.1| Os01g0173100 [Oryza sativa Japonica Group]
 gb|EAZ10729.1| hypothetical protein OsJ_00565 [Oryza sativa Japonica Group]
 dbj|BAH00322.1| unnamed protein product [Oryza sativa Japonica Group]
Length=152

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  141  NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIR  320
            NRIQVSNTKK LFFYVNL+KRY+QQ+ +VELSALGMAI+TVVTVAEILKNNGFA+EKKIR
Sbjct  43   NRIQVSNTKKPLFFYVNLAKRYMQQHGDVELSALGMAIATVVTVAEILKNNGFAVEKKIR  102

Query  321  TLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            T TV++ DE   RP+ KA+IE+VL K+EKFDELM
Sbjct  103  TSTVEINDESRVRPLQKAKIEIVLEKSEKFDELM  136



>ref|XP_010463944.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=158

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  96   NNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVA  275
            N V   +T  E  KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSALGMAI+TVVT++
Sbjct  18   NIVLAPATTVESHKKNRIQVSNTKKPLFFYVNLAKRYIQQYNEVELSALGMAITTVVTIS  77

Query  276  EILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EILKNNG A EKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  78   EILKNNGMATEKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLV  126



>ref|XP_011091961.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
 ref|XP_011091962.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=149

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  ISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILK  287
            +  TN+E  KKNRIQVSNTKK LFFYVNL+KRYLQQ+NE+ELSALGMAI+TVVT+AEILK
Sbjct  8    MKQTNNENLKKNRIQVSNTKKPLFFYVNLAKRYLQQHNEIELSALGMAITTVVTIAEILK  67

Query  288  NNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            NNGF  EK I T TV M+D+   R V KARIE+VL K+EKFD L+
Sbjct  68   NNGFVKEKSITTSTVGMKDQAKGRVVHKARIEIVLEKSEKFDSLV  112



>ref|XP_010550911.1| PREDICTED: uncharacterized protein At2g34160 [Tarenaya hassleriana]
Length=143

 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A
Sbjct  24   AENQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLA  83

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             EKK+ T TV M+DE   R V KA+IE+VLGK++KFD LM
Sbjct  84   TEKKVLTSTVGMKDENKGRIVQKAKIEIVLGKSDKFDSLM  123



>gb|KDO48762.1| hypothetical protein CISIN_1g038360mg [Citrus sinensis]
Length=149

 Score =   152 bits (384),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMAI+TVVT+AEILKNNG A 
Sbjct  28   ESHKKNRIQVSNTKKPLFFYVNLAKRYIQQHDEVELSALGMAITTVVTIAEILKNNGLAT  87

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R + KA+IE+VLGK+EKFD LM
Sbjct  88   EKKVLTSTVGMKDENKGRFIQKAKIEIVLGKSEKFDSLM  126



>gb|AFK44427.1| unknown [Lotus japonicus]
Length=128

 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKNNG A
Sbjct  12   NESPKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAIATVVTIAEILKNNGLA  71

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             EK++ T TV M+DE   R V KA+IE+VLGK+EKFD LM
Sbjct  72   TEKRVLTSTVGMKDENKGRLVQKAKIEIVLGKSEKFDNLM  111



>ref|XP_009124184.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=157

 Score =   152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  99   NVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAE  278
            N+ ++    E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++E
Sbjct  19   NIILAPATVETHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAITTVVTISE  78

Query  279  ILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ILKNNG A EKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  79   ILKNNGLATEKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLV  126



>ref|XP_006299145.1| hypothetical protein CARUB_v10015288mg [Capsella rubella]
 gb|EOA32043.1| hypothetical protein CARUB_v10015288mg [Capsella rubella]
Length=160

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  111  SSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKN  290
            ++ N E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKN
Sbjct  26   TTVNVETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKN  85

Query  291  NGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            NG A EKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  86   NGLATEKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLV  129



>ref|XP_009790071.1| PREDICTED: uncharacterized protein At2g34160 [Nicotiana sylvestris]
Length=164

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +3

Query  120  NSEPQKK-NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNG  296
            N+E QKK NRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGMAI+TVVTVAEILKN G
Sbjct  34   NNEAQKKSNRIQVSNTKKPLFFYVNLAKRYMQQHTEVELSALGMAITTVVTVAEILKNGG  93

Query  297  FAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            FA EKK+ T TV M+DE   R V KARIE+VL K+EKFD LM
Sbjct  94   FATEKKVLTSTVGMKDEAKGRMVQKARIEIVLTKSEKFDRLM  135



>ref|XP_003569410.1| PREDICTED: uncharacterized protein At2g34160-like [Brachypodium 
distachyon]
Length=150

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  141  NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIR  320
            NRIQVSNTKK LFFYVNL+KRY+QQ+ +VELSALGMAI+TVVTVAEILKNNG A+EKKIR
Sbjct  41   NRIQVSNTKKPLFFYVNLAKRYMQQHGDVELSALGMAIATVVTVAEILKNNGLAVEKKIR  100

Query  321  TLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            T TV++ DE   RP  KA+IE+ LGK+EKFDELM
Sbjct  101  TSTVEINDESRGRPFQKAKIEIELGKSEKFDELM  134



>ref|XP_003566493.2| PREDICTED: uncharacterized protein At2g34160-like, partial [Brachypodium 
distachyon]
Length=115

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  141  NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIR  320
            NRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGMAI+TVVTVAEILKNNGFA E KIR
Sbjct  8    NRIQVSNTKKPLFFYVNLAKRYMQQHTEVELSALGMAIATVVTVAEILKNNGFAFETKIR  67

Query  321  TLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            T TV+++DE   RP+ KA+IE+VL K++KFDELM
Sbjct  68   TSTVEIKDEMRGRPIQKAKIEIVLRKSDKFDELM  101



>gb|EYU30530.1| hypothetical protein MIMGU_mgv1a015883mg [Erythranthe guttata]
Length=142

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  120  NSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGF  299
            N+E  KKNRIQVSNTKK LFFYVNL+KRYLQQ+ E+ELSALGMAI+TVVT+AEILKNNGF
Sbjct  12   NNENLKKNRIQVSNTKKPLFFYVNLAKRYLQQHTEIELSALGMAITTVVTIAEILKNNGF  71

Query  300  AIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            A EK I T TV M+D+   R V+KARIE+VL K+EKFD LM
Sbjct  72   AKEKSILTSTVGMKDQDKGRTVNKARIEIVLEKSEKFDSLM  112



>gb|KFK37876.1| hypothetical protein AALP_AA3G040800 [Arabis alpina]
Length=164

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A 
Sbjct  29   ETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLAT  88

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  89   EKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLL  127



>dbj|BAJ86084.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  141  NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIR  320
            NRIQVSNTKK LFFYVNL+KRY+QQ+ +VELSALGMAI+TVVTVAEILKNNG A+EKKIR
Sbjct  46   NRIQVSNTKKPLFFYVNLAKRYMQQHGDVELSALGMAIATVVTVAEILKNNGLAVEKKIR  105

Query  321  TLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            T TV++ DE   RP  KA+IE+ LGK+EKFDELM
Sbjct  106  TSTVEINDESRGRPFQKAKIEIELGKSEKFDELM  139



>emb|CDM81981.1| unnamed protein product [Triticum aestivum]
Length=153

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  141  NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIR  320
            NRIQVSNTKK LFFYVNL+KRY+QQ+ +VELSALGMAI+TVVTVAEILKNNG A+EKKIR
Sbjct  46   NRIQVSNTKKPLFFYVNLAKRYMQQHGDVELSALGMAIATVVTVAEILKNNGLAVEKKIR  105

Query  321  TLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            T TV++ DE   RP  KA+IE+ LGK+EKFDELM
Sbjct  106  TSTVEINDESRGRPFQKAKIEIELGKSEKFDELM  139



>ref|XP_002966653.1| hypothetical protein SELMODRAFT_86023 [Selaginella moellendorffii]
 gb|EFJ32680.1| hypothetical protein SELMODRAFT_86023 [Selaginella moellendorffii]
Length=128

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  VNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEI  281
            V I +   E  KKNRIQVSNTKK LFFYVNL+KR++QQYNEVELSALGMAI+TVVTV EI
Sbjct  4    VAIDANGVESAKKNRIQVSNTKKPLFFYVNLAKRFMQQYNEVELSALGMAIATVVTVVEI  63

Query  282  LKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            LKNNG A+EK+I T T+D+ DE   R V KA++E+VL K+ +FDE+M
Sbjct  64   LKNNGLAVEKRISTSTIDIGDETRGRSVQKAKMEIVLTKSAQFDEIM  110



>ref|XP_002978089.1| hypothetical protein SELMODRAFT_176795 [Selaginella moellendorffii]
 gb|EFJ20746.1| hypothetical protein SELMODRAFT_176795 [Selaginella moellendorffii]
Length=128

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  VNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEI  281
            V I +   E  KKNRIQVSNTKK LFFYVNL+KR++QQYNEVELSALGMAI+TVVTV EI
Sbjct  4    VAIDANGVESAKKNRIQVSNTKKPLFFYVNLAKRFMQQYNEVELSALGMAIATVVTVVEI  63

Query  282  LKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            LKNNG A+EK+I T T+D+ DE   R V KA++E+VL K+ +FDE+M
Sbjct  64   LKNNGLAVEKRISTSTIDIGDETRGRSVQKAKMEIVLTKSAQFDEIM  110



>ref|XP_010102274.1| Uncharacterized protein L484_024556 [Morus notabilis]
 gb|EXB93217.1| Uncharacterized protein L484_024556 [Morus notabilis]
Length=195

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  132  QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEK  311
            QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A EK
Sbjct  15   QKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLATEK  74

Query  312  KIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            K+ T TV M+DE   R V KA+IE+VLGK+EKFD L+
Sbjct  75   KVSTSTVGMKDENKGRLVQKAKIEIVLGKSEKFDSLV  111



>ref|XP_006408171.1| hypothetical protein EUTSA_v10021676mg [Eutrema salsugineum]
 gb|ESQ49624.1| hypothetical protein EUTSA_v10021676mg [Eutrema salsugineum]
Length=161

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A
Sbjct  30   AETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLA  89

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             EKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  90   TEKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLV  129



>ref|XP_009111897.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Brassica rapa]
Length=154

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = +3

Query  81   ITEGINNVNISSTNS-EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAIS  257
            +T   +N+ IS+T + E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+
Sbjct  13   VTSPASNLIISATTAVETQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAIT  72

Query  258  TVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            TVVT++EILKNNG A EK++ T TV M+DE   + V K +IE+VL K++KFD LM
Sbjct  73   TVVTISEILKNNGLATEKRVLTSTVGMKDENKGKIVQKTKIEIVLAKSDKFDSLM  127



>ref|XP_006347728.1| PREDICTED: uncharacterized protein At2g34160-like [Solanum tuberosum]
Length=167

 Score =   150 bits (379),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  126  EPQKK-NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            E QKK NRIQVSNTKK LFFYVNL+KRY+QQ+ EVELSALGMAI+TVVTVAEILKN GFA
Sbjct  35   EAQKKSNRIQVSNTKKPLFFYVNLAKRYMQQHTEVELSALGMAITTVVTVAEILKNGGFA  94

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             EKK+ T TV M+DE   R V KARIE+VL K+EKFD+LM
Sbjct  95   TEKKVLTSTVGMKDEAKGRMVQKARIEIVLTKSEKFDKLM  134



>ref|XP_002884455.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60714.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=164

 Score =   149 bits (377),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A 
Sbjct  33   ETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLAT  92

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  93   EKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLV  131



>ref|XP_002962432.1| hypothetical protein SELMODRAFT_141130 [Selaginella moellendorffii]
 ref|XP_002989386.1| hypothetical protein SELMODRAFT_129805 [Selaginella moellendorffii]
 gb|EFJ09477.1| hypothetical protein SELMODRAFT_129805 [Selaginella moellendorffii]
 gb|EFJ35895.1| hypothetical protein SELMODRAFT_141130 [Selaginella moellendorffii]
Length=137

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  135  KKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKK  314
            +KNRIQVSNTKK LFFYVNLSKR++QQY EVELS LGMAI+TVVTV EILKNNG A+EKK
Sbjct  24   RKNRIQVSNTKKPLFFYVNLSKRFMQQYGEVELSGLGMAIATVVTVVEILKNNGLALEKK  83

Query  315  IRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I T T++++DE   RPV KA+IE+VL K++KFDELM
Sbjct  84   IYTSTIEIQDELRGRPVQKAKIEIVLKKSDKFDELM  119



>ref|XP_011087389.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=127

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  ISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILK  287
            I  TN+E  KKNRIQVSNTKK LFFYVNL+KRYLQQ+ E+ELSALGMAI+TVVT+AEILK
Sbjct  12   IKQTNNENLKKNRIQVSNTKKPLFFYVNLAKRYLQQHKEIELSALGMAITTVVTIAEILK  71

Query  288  NNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            NNGF  EK I T TV M+D    R + KARIE+VL K+EKFD L+
Sbjct  72   NNGFVTEKSIVTSTVGMKDVAKGRVIHKARIEIVLEKSEKFDTLI  116



>ref|XP_010485843.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=158

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +3

Query  117  TNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNG  296
            T  E  KKNRIQVSNTKK LFFYVNL+KRY+QQYNEVELSAL MAI+TVVT++EILKNNG
Sbjct  25   TTVESHKKNRIQVSNTKKPLFFYVNLAKRYIQQYNEVELSALRMAITTVVTISEILKNNG  84

Query  297  FAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             A EKK+ T TV M+DE   R V KA+IE+VLGK++KFD L+
Sbjct  85   MATEKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLV  126



>ref|XP_002440693.1| hypothetical protein SORBIDRAFT_09g005260 [Sorghum bicolor]
 gb|EES19123.1| hypothetical protein SORBIDRAFT_09g005260 [Sorghum bicolor]
Length=134

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  141  NRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIR  320
            NRIQVS++KK LFFYVNL+K+Y+QQ+ +VELSALG+AISTVVT+AEILKNNG A+EKKIR
Sbjct  25   NRIQVSSSKKPLFFYVNLAKKYMQQHGDVELSALGLAISTVVTIAEILKNNGLAVEKKIR  84

Query  321  TLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            T TV++ DE  +RP+ KA+IE+VLGKT+KF+ELM
Sbjct  85   TSTVEIIDETKARPIQKAKIEIVLGKTDKFEELM  118



>gb|KGN60668.1| hypothetical protein Csa_2G006140 [Cucumis sativus]
Length=100

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 88/103 (85%), Gaps = 3/103 (3%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME I EG+N++N+SS   +  KKNRIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMA
Sbjct  1    MEEIVEGVNSINLSS---DSFKKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMA  57

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARI  380
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA++
Sbjct  58   IATVVTVAEILKNNGLALEKKIATSTVDIKDDSRGRPVQKAKL  100



>ref|XP_009124986.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=161

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A 
Sbjct  32   ETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLAT  91

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   + V KA+IE+VLGK+ KFD L+
Sbjct  92   EKKVLTSTVGMKDETKGKMVQKAKIEIVLGKSAKFDSLV  130



>ref|NP_187113.1| DUO1-activated nucleic acid binding protein [Arabidopsis thaliana]
 gb|AAF04892.1|AC011437_7 unknown protein [Arabidopsis thaliana]
 gb|AAR20712.1| At3g04620 [Arabidopsis thaliana]
 gb|AAR24749.1| At3g04620 [Arabidopsis thaliana]
 gb|AEE74107.1| DUO1-activated nucleic acid binding protein [Arabidopsis thaliana]
Length=164

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A 
Sbjct  33   ETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLAT  92

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   + V KA+IE+VLGK++KFD L+
Sbjct  93   EKKVLTSTVGMKDETKGKMVQKAKIEIVLGKSDKFDSLV  131



>ref|XP_004960818.1| PREDICTED: uncharacterized protein At2g34160-like [Setaria italica]
Length=134

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  129  PQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIE  308
            P   NRIQVS++KK LFFYVNL+K+Y+QQ+ +VELSALG+AISTVVT+AEILKNNG A+E
Sbjct  21   PGAGNRIQVSSSKKPLFFYVNLAKKYMQQHGDVELSALGLAISTVVTIAEILKNNGLAVE  80

Query  309  KKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            KKIRT TV++ DE     + KA+IE+VLGKTE FDELM
Sbjct  81   KKIRTSTVEISDEMRGHSIQKAKIEIVLGKTENFDELM  118



>emb|CDX74179.1| BnaA03g28680D [Brassica napus]
Length=164

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A
Sbjct  31   AESHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAITTVVTISEILKNNGLA  90

Query  303  IEKKIRTLTVDMRDEPGSRPVSKAR--IEVVLGKTEKFDELM  422
            IEKK+ T TV M+DE   R V KA+  IE+VLGK++KFD L+
Sbjct  91   IEKKVLTSTVGMKDETKGRMVQKAKASIEIVLGKSDKFDSLV  132



>emb|CDY40664.1| BnaC03g33800D [Brassica napus]
Length=161

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A
Sbjct  27   AESHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAITTVVTISEILKNNGLA  86

Query  303  IEKKIRTLTVDMRDEPGSRPVSKAR--IEVVLGKTEKFDELM  422
            IEKK+ T TV M+DE   R V KA+  IE+VLGK++KFD L+
Sbjct  87   IEKKVLTSTVGMKDETKGRMVQKAKASIEIVLGKSDKFDSLV  128



>ref|XP_003555573.1| PREDICTED: uncharacterized protein At2g34160-like [Glycine max]
 gb|KHN14706.1| Hypothetical protein glysoja_038115 [Glycine soja]
Length=132

 Score =   146 bits (368),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  117  TNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNG  296
            T ++  KK RIQVSNTKK LFFYVNL+KRY+QQ++EVELSALGMAI+TVVT++EILKNNG
Sbjct  11   TANDSHKKYRIQVSNTKKPLFFYVNLAKRYIQQHDEVELSALGMAIATVVTISEILKNNG  70

Query  297  FAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
             A EKK+ T TV M+DE   R V KA+IE+VLGK++KFD LM
Sbjct  71   LATEKKVLTSTVGMKDENKGRLVQKAKIEIVLGKSDKFDNLM  112



>gb|AFW87068.1| hypothetical protein ZEAMMB73_637233 [Zea mays]
Length=122

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME +TEG+NN+ I+    EPQ KN+IQVSNTKK LFFYVNL+KRY+QQ+ EVELS LGM 
Sbjct  14   MEELTEGVNNLAIT----EPQMKNKIQVSNTKKPLFFYVNLAKRYMQQHEEVELSTLGMT  69

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGK  398
            I+T+VTVAEILKNN   +EKKI T T D++D+  + P+ KA+IE+VLGK
Sbjct  70   IATMVTVAEILKNNRLVVEKKIMTSTADVKDDSRAHPIQKAKIEIVLGK  118



>ref|XP_004486681.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Cicer arietinum]
Length=136

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+NN+N  + NS+  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMA
Sbjct  1    MEGITEGLNNIN-INNNSDSYKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMA  59

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEV  386
            I+TVVTVAEILKNNG A+EKKI T TVD++D+   RPV KA++ V
Sbjct  60   IATVVTVAEILKNNGLAVEKKIMTSTVDIKDDSRGRPVQKAKVRV  104



>ref|XP_003520842.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Glycine max]
Length=138

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKN+IQVSNTKK LFFYVNL+KRY+QQ NEV LSALGM I+TVVT+AEILKNNG AI
Sbjct  20   ESPKKNKIQVSNTKKPLFFYVNLAKRYIQQRNEVVLSALGMGITTVVTIAEILKNNGLAI  79

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDEL  419
            EKK+ T +V M+DE   R V KA+IE+VL KTEKFD L
Sbjct  80   EKKVSTSSVTMKDETKGRLVQKAKIEIVLEKTEKFDSL  117



>gb|KHN31472.1| Hypothetical protein glysoja_035579 [Glycine soja]
Length=138

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKN+IQVSNTKK LFFYVNL+KRY+QQ NEV LSALGM I+TVVT+AEILKNNG AI
Sbjct  20   ESPKKNKIQVSNTKKPLFFYVNLAKRYIQQRNEVVLSALGMGITTVVTIAEILKNNGLAI  79

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDEL  419
            EKK+ T +V M+DE   R V KA+IE+VL KTEKFD L
Sbjct  80   EKKVSTSSVTMKDETKGRLVQKAKIEIVLEKTEKFDSL  117



>emb|CDX86203.1| BnaA06g29200D [Brassica napus]
Length=155

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 7/108 (6%)
 Frame = +3

Query  102  VNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEI  281
            V+ ++T  E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EI
Sbjct  22   VSATTTAVETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEI  81

Query  282  LKNNGFAIEKKIRTLTVDMRDEPGSRPVSKAR-IEVVLGKTEKFDELM  422
            LKNNG A EKK+ T TV M+DE      +K R IE+VLGK++KFD LM
Sbjct  82   LKNNGLATEKKVLTSTVGMKDE------NKGRVIEIVLGKSDKFDSLM  123



>emb|CDY41887.1| BnaC05g47170D [Brassica napus]
Length=152

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = +3

Query  81   ITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAIST  260
            IT    N+ ++    E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+T
Sbjct  13   ITAPERNIILAPATVETHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAITT  72

Query  261  VVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            VVT++EILKNNG A EKK+ T TV M+DE   R      IE+VLGK++KFD L+
Sbjct  73   VVTISEILKNNGLATEKKVLTSTVGMKDETKGR-----MIEIVLGKSDKFDSLV  121



>ref|XP_008656129.1| PREDICTED: uncharacterized protein At2g34160-like [Zea mays]
 gb|AFW81392.1| hypothetical protein ZEAMMB73_168635 [Zea mays]
Length=174

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = +3

Query  138  KNRIQVSNTKKSLFFYVNLSKRYLQQYNE-VELSALGMAISTVVTVAEILKNNGFAIEKK  314
            +NRIQVS++KK LFFYVNL+KRY+Q +++ VELSALG+AIST VTVAEILKNNG A+EKK
Sbjct  21   RNRIQVSSSKKPLFFYVNLAKRYMQHHDDDVELSALGLAISTAVTVAEILKNNGLAVEKK  80

Query  315  IRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            +RT TVD+++E  +R + KA+IE+VLGKT KFDELM
Sbjct  81   VRTSTVDIKNEISTRSIQKAKIEIVLGKTNKFDELM  116



>emb|CDY50744.1| BnaAnng10510D [Brassica napus]
Length=152

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 5/108 (5%)
 Frame = +3

Query  99   NVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAE  278
            N+ ++    E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++E
Sbjct  19   NIILAPATVETHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAITTVVTISE  78

Query  279  ILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            ILKNNG A EKK+ T TV M+DE   R      IE+VLGK++KFD L+
Sbjct  79   ILKNNGLATEKKVLTSTVGMKDETKGR-----MIEIVLGKSDKFDSLV  121



>ref|XP_009396606.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=148

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  135  KKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKK  314
            K+NRIQVS  KK LFFYVNL+KRY+QQ+NE+ELSALGMAI TVVTVAEILKNNG A EKK
Sbjct  39   KRNRIQVSTNKKPLFFYVNLAKRYMQQHNEIELSALGMAIGTVVTVAEILKNNGLATEKK  98

Query  315  IRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+T TV  +DE   R V KA+IE++LGKTE F+ L+
Sbjct  99   IQTSTVGTKDEAKGRLVRKAKIEILLGKTENFNHLV  134



>gb|EMT17314.1| hypothetical protein F775_31902 [Aegilops tauschii]
Length=164

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 95/144 (66%), Gaps = 30/144 (21%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEP-----QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELS  236
            ME +TE +NN+ I+   +        KKNRIQVSNTKK LFFYVNL+KRY+Q + EVELS
Sbjct  1    MEEVTEAVNNLTIAEGAAATAGAEGHKKNRIQVSNTKKPLFFYVNLAKRYMQLHEEVELS  60

Query  237  ALGMA-------------------------ISTVVTVAEILKNNGFAIEKKIRTLTVDMR  341
            ALGM                          I+TVVTVAEILKNNG A+EKKI T TVD++
Sbjct  61   ALGMGKSSLAEAYFCISLGLCYVTLAMICPIATVVTVAEILKNNGLAVEKKIMTSTVDVK  120

Query  342  DEPGSRPVSKARIEVVLGKTEKFD  413
            D+  +RP+ KA+IE+++GKTEKFD
Sbjct  121  DDTRNRPIQKAKIEILIGKTEKFD  144



>ref|XP_009111898.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Brassica rapa]
Length=152

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = +3

Query  81   ITEGINNVNISSTNS-EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAIS  257
            +T   +N+ IS+T + E QKKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSAL  AI+
Sbjct  13   VTSPASNLIISATTAVETQKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSAL--AIT  70

Query  258  TVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            TVVT++EILKNNG A EK++ T TV M+DE   + V K +IE+VL K++KFD LM
Sbjct  71   TVVTISEILKNNGLATEKRVLTSTVGMKDENKGKIVQKTKIEIVLAKSDKFDSLM  125



>ref|XP_010027179.1| PREDICTED: uncharacterized protein At2g34160 [Eucalyptus grandis]
 gb|KCW61578.1| hypothetical protein EUGRSUZ_H04315 [Eucalyptus grandis]
Length=149

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +3

Query  111  SSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKN  290
            SS N+   KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT+AEILKN
Sbjct  9    SSENALAPKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIAEILKN  68

Query  291  NGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
            NG A EKK+ T +V M+DE   R + KA+IE+VL K++K +
Sbjct  69   NGIATEKKVLTSSVGMKDENRGRMIQKAKIEIVLEKSDKAE  109



>ref|XP_007147186.1| hypothetical protein PHAVU_006G103000g [Phaseolus vulgaris]
 gb|ESW19180.1| hypothetical protein PHAVU_006G103000g [Phaseolus vulgaris]
Length=218

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ +EV LSALGMAI+TVVT+AEILKNNG A 
Sbjct  103  ESPKKNRIQVSNTKKPLFFYVNLAKRYIQQRDEVVLSALGMAITTVVTIAEILKNNGLAT  162

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T ++ M+DE   R V KA+IE+VL K+EKFD LM
Sbjct  163  EKKVSTSSISMKDESKGRLVQKAKIEIVLEKSEKFDNLM  201



>gb|KHG08649.1| hypothetical protein F383_35638 [Gossypium arboreum]
Length=113

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 19/117 (16%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMA  251
            ME ITEG+N++NI+  +S P  K                   + Y+QQYNEVELSALGMA
Sbjct  1    MEGITEGVNSLNIA--DSSPSNKQE-----------------EPYMQQYNEVELSALGMA  41

Query  252  ISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+TVVT+AEILKNNG A+EKKI T TVDMR+E G RPV KA+IE++LGK+EKFDELM
Sbjct  42   IATVVTIAEILKNNGLAVEKKIMTSTVDMREESGGRPVQKAKIEILLGKSEKFDELM  98



>ref|XP_009396723.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=158

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +3

Query  111  SSTNSEP--QKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEIL  284
            SST S P   KKNRIQVS  KK LFFYVNL+KRY+QQYNE+ELSALGMAI TVVTVAEIL
Sbjct  37   SSTTSTPKTHKKNRIQVSTNKKPLFFYVNLAKRYMQQYNEIELSALGMAIGTVVTVAEIL  96

Query  285  KNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDE  416
            KNNG A EKKI T TV  +DE   R V KA+IE+++GK    D 
Sbjct  97   KNNGLATEKKILTSTVGTKDEAKGRLVRKAKIEILMGKKNSDDH  140



>emb|CDY21118.1| BnaA01g33490D [Brassica napus]
Length=156

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 5/99 (5%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A 
Sbjct  32   ETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLAT  91

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV M+DE   +      IE+VLGK+ KFD L+
Sbjct  92   EKKVLTSTVGMKDETKGK-----MIEIVLGKSAKFDSLV  125



>emb|CBI26374.3| unnamed protein product [Vitis vinifera]
Length=131

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E QKKNRIQVSN+KK LFFY+NL+KRY++QYN+VELSALGMAI +VVT+AEILK NG A
Sbjct  10   TETQKKNRIQVSNSKKPLFFYINLAKRYIKQYNDVELSALGMAIPSVVTIAEILKKNGVA  69

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
             +KKI T TVDM+ E   R V KA+IE+VLGK E  D
Sbjct  70   TQKKILTSTVDMKWETNGRTVQKAKIEIVLGKPEDSD  106



>ref|XP_002280347.1| PREDICTED: uncharacterized protein At2g34160-like [Vitis vinifera]
Length=144

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            +E QKKNRIQVSN+KK LFFY+NL+KRY++QYN+VELSALGMAI +VVT+AEILK NG A
Sbjct  23   TETQKKNRIQVSNSKKPLFFYINLAKRYIKQYNDVELSALGMAIPSVVTIAEILKKNGVA  82

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFD  413
             +KKI T TVDM+ E   R V KA+IE+VLGK E  D
Sbjct  83   TQKKILTSTVDMKWETNGRTVQKAKIEIVLGKPEDSD  119



>ref|XP_006577294.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Glycine max]
Length=137

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKN+IQVSNTKK LFFYVNL+KRY+QQ NEV LSALGM I+TVVT+AEILKNNG AI
Sbjct  20   ESPKKNKIQVSNTKKPLFFYVNLAKRYIQQRNEVVLSALGMGITTVVTIAEILKNNGLAI  79

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDEL  419
            E KI T +V M+DE   R V KA+IE+VL KTEKFD L
Sbjct  80   E-KISTSSVTMKDETKGRLVQKAKIEIVLEKTEKFDSL  116



>ref|XP_010274159.1| PREDICTED: uncharacterized protein At2g34160-like [Nelumbo nucifera]
Length=138

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  123  SEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFA  302
            S   +K RIQVSNTKK LFFYVNL+K+Y+QQ++EVELSALGMAI+TVVT+AEILKNN  A
Sbjct  21   SASPRKYRIQVSNTKKPLFFYVNLAKKYIQQHDEVELSALGMAITTVVTIAEILKNNRMA  80

Query  303  IEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            I+KKI T TVDM+DE   R V KA+IE++L K   FD LM
Sbjct  81   IQKKILTSTVDMKDETKGRMVPKAKIEILLVKATSFDNLM  120



>ref|XP_010905447.1| PREDICTED: uncharacterized protein At2g34160-like [Elaeis guineensis]
Length=163

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  111  SSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKN  290
            ++  + P KKNRIQVS  KK L+FYVNL+KRY+QQ+NE+ELSALGMAI TVVTVAEILKN
Sbjct  15   AAVAAAPGKKNRIQVSTNKKPLYFYVNLAKRYMQQHNEIELSALGMAIGTVVTVAEILKN  74

Query  291  NGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTE  404
            NG A EKKI T TV  +DE   R V KA+IE++LGKTE
Sbjct  75   NGLATEKKILTSTVGTKDETRGRLVRKAKIEILLGKTE  112



>emb|CDY30010.1| BnaC01g39980D [Brassica napus]
Length=159

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 5/99 (5%)
 Frame = +3

Query  126  EPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAI  305
            E  KKNRIQVSNTKK LFFYVNL+KRY+QQ+NEVELSALGMAI+TVVT++EILKNNG A 
Sbjct  35   ETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTISEILKNNGLAT  94

Query  306  EKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            EKK+ T TV +RDE   +      IE+VLGK+ KFD L+
Sbjct  95   EKKVLTSTVGLRDETKGK-----MIEIVLGKSAKFDSLV  128



>ref|XP_010672114.1| PREDICTED: uncharacterized protein At2g34160-like [Beta vulgaris 
subsp. vulgaris]
Length=174

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = +3

Query  69   TMEAITEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALGM  248
            +M+ + E + +V I   N +  KKNRIQVSNTKK LFFY+NL+KRY++Q+N+VELSALGM
Sbjct  24   SMDMVAESLASVKI---NEDVHKKNRIQVSNTKKPLFFYLNLAKRYIKQHNDVELSALGM  80

Query  249  AISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEK  407
            AI TVVT+AEILK+NGFA+EKK+ T TV  +DE   R V KA++E+VL K +K
Sbjct  81   AIPTVVTIAEILKSNGFAVEKKVLTSTVGSKDENKGRFVQKAKLEIVLEKNDK  133



>ref|XP_006583129.1| PREDICTED: uncharacterized protein At2g34160-like [Glycine max]
Length=114

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  165  KKSLFFYVNLSKRYLQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRD  344
            +K+   YVNL+KRY+QQ+NEVELSALGMAI+TVVTVAEILKNN  A+EKKI T TVD++D
Sbjct  8    QKAPLLYVNLAKRYMQQHNEVELSALGMAIATVVTVAEILKNNELAVEKKITTSTVDIKD  67

Query  345  EPGSRPVSKARIEVVLGKTEKFDELM  422
            +   RPV KA+IE++LGKTEKFDELM
Sbjct  68   DSRGRPVQKAKIEILLGKTEKFDELM  93



>gb|AFW81391.1| hypothetical protein ZEAMMB73_168635 [Zea mays]
Length=184

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 85/106 (80%), Gaps = 11/106 (10%)
 Frame = +3

Query  138  KNRIQVSNTKKSLFFYVNLSKRYLQQYNE-VELSALGM----------AISTVVTVAEIL  284
            +NRIQVS++KK LFFYVNL+KRY+Q +++ VELSALG+          AIST VTVAEIL
Sbjct  21   RNRIQVSSSKKPLFFYVNLAKRYMQHHDDDVELSALGLGPKSLSNLLAAISTAVTVAEIL  80

Query  285  KNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTEKFDELM  422
            KNNG A+EKK+RT TVD+++E  +R + KA+IE+VLGKT KFDELM
Sbjct  81   KNNGLAVEKKVRTSTVDIKNEISTRSIQKAKIEIVLGKTNKFDELM  126



>ref|XP_010932895.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Elaeis guineensis]
Length=144

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = +3

Query  72   MEAI--TEGINNVNISSTNSEPQKKNRIQVSNTKKSLFFYVNLSKRYLQQYNEVELSALG  245
            MEA+   E + +  ++     P KKNRIQVS  KK L+FYVNL+KRY+QQ NE+ELSALG
Sbjct  1    MEAVMVAEAVKDPTVAVGVVAPGKKNRIQVSTHKKPLYFYVNLAKRYMQQNNEIELSALG  60

Query  246  MAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEVVLGKTE  404
            MAI TVVTVAEILKN+G A +KKI T TV  +DE   R V KA+IE++LGKTE
Sbjct  61   MAIGTVVTVAEILKNSGLATQKKILTSTVGTKDETKGRLVRKAKIEILLGKTE  113



>ref|XP_004968372.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Setaria italica]
Length=138

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 15/120 (13%)
 Frame = +3

Query  72   MEAITEGINNVNISSTNSEP--------QKK-------NRIQVSNTKKSLFFYVNLSKRY  206
            +E ITEG+ N++++   +          QK+       NRIQVSNTKK LFFYVNL+KRY
Sbjct  3    VEEITEGVKNLSVAGDAAASGAGNGGEGQKRGGSGGSSNRIQVSNTKKPLFFYVNLAKRY  62

Query  207  LQQYNEVELSALGMAISTVVTVAEILKNNGFAIEKKIRTLTVDMRDEPGSRPVSKARIEV  386
            +QQ+ +VELSALGMAI+TVVTVAEILKNNGFAIEKKIRT TV++ DE   RP  KA++ V
Sbjct  63   MQQHGDVELSALGMAIATVVTVAEILKNNGFAIEKKIRTSTVEINDESRGRPFQKAKVSV  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561306781368