BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16047_g1_i1 len=1411 path=[1391:0-139 @1531@!:140-515 1907:516-518
1910:519-1410]

Length=1411
                                                                      Score     E

ref|XP_010278970.1|  PREDICTED: nuclear transcription factor Y su...    154   1e-38   
ref|XP_009394404.1|  PREDICTED: nuclear transcription factor Y su...    152   3e-38   
emb|CBI29866.3|  unnamed protein product                                152   4e-38   
ref|XP_010257210.1|  PREDICTED: nuclear transcription factor Y su...    152   5e-38   
gb|KDO53707.1|  hypothetical protein CISIN_1g017825mg                   152   9e-38   
ref|XP_009394400.1|  PREDICTED: nuclear transcription factor Y su...    151   9e-38   
ref|XP_006489920.1|  PREDICTED: nuclear transcription factor Y su...    151   1e-37   
ref|XP_006421429.1|  hypothetical protein CICLE_v10005144mg             150   4e-37   
gb|ACN40089.1|  unknown                                                 150   5e-37   Picea sitchensis
ref|XP_007028810.1|  Nuclear factor Y, putative                         148   2e-36   
emb|CDP07786.1|  unnamed protein product                                146   2e-36   
ref|XP_009396056.1|  PREDICTED: nuclear transcription factor Y su...    147   2e-36   
emb|CAM12541.1|  YA3                                                    145   3e-36   Antirrhinum majus [garden snapdragon]
gb|AHX56181.1|  NFYA1                                                   148   3e-36   
ref|XP_009394733.1|  PREDICTED: nuclear transcription factor Y su...    142   6e-35   
ref|XP_010910379.1|  PREDICTED: nuclear transcription factor Y su...    142   8e-35   
ref|XP_010909045.1|  PREDICTED: nuclear transcription factor Y su...    142   2e-34   
ref|XP_010910375.1|  PREDICTED: nuclear transcription factor Y su...    142   2e-34   
ref|XP_010909039.1|  PREDICTED: nuclear transcription factor Y su...    142   2e-34   
ref|XP_011093323.1|  PREDICTED: nuclear transcription factor Y su...    140   3e-34   
ref|XP_006838331.1|  hypothetical protein AMTR_s00103p00144230          141   5e-34   
tpg|DAA50808.1|  TPA: hypothetical protein ZEAMMB73_727067              138   6e-34   
ref|XP_008790800.1|  PREDICTED: nuclear transcription factor Y su...    140   6e-34   
ref|XP_002278849.1|  PREDICTED: nuclear transcription factor Y su...    140   8e-34   Vitis vinifera
ref|XP_008790783.1|  PREDICTED: nuclear transcription factor Y su...    140   9e-34   
ref|NP_001149098.1|  LOC100282719                                       138   1e-33   Zea mays [maize]
ref|XP_010936981.1|  PREDICTED: nuclear transcription factor Y su...    140   1e-33   
ref|XP_008676720.1|  PREDICTED: LOC100282719 isoform X1                 137   1e-33   
gb|KHG24923.1|  Nuclear transcription factor Y subunit A-1 -like ...    138   1e-33   
ref|XP_007052521.1|  Nuclear transcription factor Y subunit A-1, ...    139   2e-33   
emb|CDP19036.1|  unnamed protein product                                138   2e-33   
emb|CBI24892.3|  unnamed protein product                                140   2e-33   
ref|XP_010557797.1|  PREDICTED: nuclear transcription factor Y su...    136   2e-33   
ref|XP_007052520.1|  Nuclear transcription factor Y subunit A-1, ...    138   4e-33   
gb|AHX56184.1|  NFYA4                                                   139   4e-33   
ref|XP_001760371.1|  predicted protein                                  140   5e-33   
ref|XP_004982099.1|  PREDICTED: nuclear transcription factor Y su...    135   6e-33   
ref|XP_011090024.1|  PREDICTED: nuclear transcription factor Y su...    137   6e-33   
ref|XP_004982097.1|  PREDICTED: nuclear transcription factor Y su...    135   6e-33   
ref|XP_006379095.1|  hypothetical protein POPTR_0009s06540g             136   9e-33   
gb|AEL95437.1|  CCAAT-binding transcription factor subunit B            137   2e-32   
emb|CBI16364.3|  unnamed protein product                                135   2e-32   
dbj|BAJ85335.1|  predicted protein                                      134   2e-32   
ref|XP_002282778.2|  PREDICTED: nuclear transcription factor Y su...    135   3e-32   Vitis vinifera
ref|XP_010939931.1|  PREDICTED: nuclear transcription factor Y su...    136   3e-32   
ref|XP_009767409.1|  PREDICTED: nuclear transcription factor Y su...    134   3e-32   
ref|XP_002313307.2|  hypothetical protein POPTR_0009s06540g             136   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011090023.1|  PREDICTED: nuclear transcription factor Y su...    136   4e-32   
ref|XP_004158189.1|  PREDICTED: nuclear transcription factor Y su...    135   4e-32   
ref|XP_004135933.1|  PREDICTED: nuclear transcription factor Y su...    135   4e-32   
gb|KDO83424.1|  hypothetical protein CISIN_1g019764mg                   133   4e-32   
ref|XP_008449707.1|  PREDICTED: nuclear transcription factor Y su...    135   5e-32   
ref|XP_004143236.1|  PREDICTED: nuclear transcription factor Y su...    135   5e-32   
ref|XP_010695208.1|  PREDICTED: nuclear transcription factor Y su...    135   5e-32   
ref|XP_002965605.1|  hypothetical protein SELMODRAFT_38090              129   5e-32   
ref|XP_008346932.1|  PREDICTED: nuclear transcription factor Y su...    134   5e-32   
ref|XP_008461297.1|  PREDICTED: nuclear transcription factor Y su...    134   5e-32   
ref|XP_009354754.1|  PREDICTED: nuclear transcription factor Y su...    134   6e-32   
gb|EMS57870.1|  Nuclear transcription factor Y subunit A-1              132   6e-32   
ref|XP_009632036.1|  PREDICTED: nuclear transcription factor Y su...    132   7e-32   
gb|KDO83422.1|  hypothetical protein CISIN_1g019764mg                   134   8e-32   
ref|XP_003560983.1|  PREDICTED: nuclear transcription factor Y su...    132   1e-31   
emb|CDX85686.1|  BnaA02g01270D                                          131   2e-31   
ref|XP_004291783.1|  PREDICTED: nuclear transcription factor Y su...    134   2e-31   
ref|XP_006649488.1|  PREDICTED: nuclear transcription factor Y su...    131   2e-31   
gb|ABF94257.1|  CCAAT-binding transcription factor subunit B fami...    129   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAO19379.1|  putative CCAAT-binding transcription factor             131   2e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CAA71844.1|  RAPB protein                                           130   2e-31   Oryza sativa [red rice]
gb|ABF94256.1|  CCAAT-binding transcription factor subunit B fami...    130   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049132.1|  Os03g0174900                                       130   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008787861.1|  PREDICTED: nuclear transcription factor Y su...    133   2e-31   
ref|XP_010261977.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-31   
ref|XP_008798898.1|  PREDICTED: nuclear transcription factor Y su...    133   2e-31   
ref|XP_002299939.2|  hypothetical protein POPTR_0001s27300g             132   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006288441.1|  hypothetical protein CARUB_v10001701mg             131   3e-31   
ref|NP_568282.1|  nuclear transcription factor Y subunit A-1            131   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873581.1|  predicted protein                                  131   3e-31   
ref|XP_006288440.1|  hypothetical protein CARUB_v10001701mg             131   3e-31   
ref|XP_003570525.1|  PREDICTED: nuclear transcription factor Y su...    130   4e-31   
ref|XP_010453330.1|  PREDICTED: nuclear transcription factor Y su...    131   4e-31   
ref|XP_006439109.1|  hypothetical protein CICLE_v10032207mg             132   4e-31   
ref|XP_010324494.1|  PREDICTED: nuclear transcription factor Y su...    131   4e-31   
ref|XP_004500195.1|  PREDICTED: nuclear transcription factor Y su...    132   4e-31   
ref|XP_008363319.1|  PREDICTED: nuclear transcription factor Y su...    132   4e-31   
ref|XP_003540525.1|  PREDICTED: nuclear transcription factor Y su...    131   5e-31   
ref|NP_850811.1|  nuclear transcription factor Y subunit A-1            130   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345445.1|  PREDICTED: nuclear transcription factor Y su...    130   5e-31   
ref|XP_002962387.1|  hypothetical protein SELMODRAFT_438143             130   5e-31   
ref|XP_006345444.1|  PREDICTED: nuclear transcription factor Y su...    131   6e-31   
ref|XP_009364962.1|  PREDICTED: nuclear transcription factor Y su...    132   6e-31   
ref|XP_010917240.1|  PREDICTED: nuclear transcription factor Y su...    132   7e-31   
ref|NP_001050979.1|  Os03g0696300                                       130   7e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76000.1|  hypothetical protein OsI_13136                          129   7e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_009767410.1|  PREDICTED: nuclear transcription factor Y su...    129   7e-31   
gb|KEH19086.1|  CCAAT-binding transcription factor                      130   8e-31   
gb|KDP43479.1|  hypothetical protein JCGZ_16766                         131   9e-31   
gb|KDO53706.1|  hypothetical protein CISIN_1g017825mg                   131   1e-30   
gb|AFK49649.1|  nuclear transcription factor Y subunit A7               130   1e-30   
gb|KHG20723.1|  Nuclear transcription factor Y subunit A-1 -like ...    130   1e-30   
ref|XP_003558692.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-30   
gb|EYU31369.1|  hypothetical protein MIMGU_mgv1a013110mg                128   1e-30   
ref|XP_010419841.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-30   
ref|XP_008791883.1|  PREDICTED: nuclear transcription factor Y su...    131   1e-30   
ref|XP_009778037.1|  PREDICTED: nuclear transcription factor Y su...    128   1e-30   
emb|CDX78492.1|  BnaA03g04040D                                          127   1e-30   
ref|XP_007015064.1|  Nuclear transcription factor Y subunit A-9, ...    130   1e-30   
ref|XP_010492016.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-30   
ref|XP_010419840.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-30   
gb|KHG16591.1|  Nuclear transcription factor Y subunit A-1 -like ...    130   1e-30   
ref|XP_003551355.1|  PREDICTED: nuclear transcription factor Y su...    130   1e-30   
emb|CAN70549.1|  hypothetical protein VITISV_002755                     132   1e-30   Vitis vinifera
ref|XP_010492015.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-30   
ref|XP_010453331.1|  PREDICTED: nuclear transcription factor Y su...    129   1e-30   
gb|KHN31720.1|  Nuclear transcription factor Y subunit A-1              130   1e-30   
ref|XP_010261975.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-30   
ref|XP_006650437.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-30   
ref|XP_010673645.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-30   
gb|EYU29033.1|  hypothetical protein MIMGU_mgv1a012967mg                128   2e-30   
ref|XP_003532204.1|  PREDICTED: nuclear transcription factor Y su...    130   2e-30   
ref|XP_004985516.1|  PREDICTED: nuclear transcription factor Y su...    128   2e-30   
ref|XP_006446125.1|  hypothetical protein CICLE_v10015808mg             130   2e-30   
ref|XP_007146701.1|  hypothetical protein PHAVU_006G062200g             130   2e-30   
gb|KDO61245.1|  hypothetical protein CISIN_1g019036mg                   129   2e-30   
ref|XP_004985518.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-30   
gb|AAF37266.1|AF220405_1  transcription factor                          127   2e-30   Vitis riparia [frost grape]
ref|XP_008778422.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-30   
ref|XP_002517826.1|  Nuclear transcription factor Y subunit A-1, ...    130   3e-30   Ricinus communis
ref|XP_004291784.1|  PREDICTED: nuclear transcription factor Y su...    130   3e-30   
ref|XP_010241195.1|  PREDICTED: nuclear transcription factor Y su...    126   3e-30   
ref|XP_010105454.1|  Nuclear transcription factor Y subunit A-9         130   3e-30   
ref|XP_009131295.1|  PREDICTED: nuclear transcription factor Y su...    127   3e-30   
ref|XP_010241197.1|  PREDICTED: nuclear transcription factor Y su...    125   4e-30   
ref|XP_009131291.1|  PREDICTED: nuclear transcription factor Y su...    127   4e-30   
ref|XP_009626582.1|  PREDICTED: nuclear transcription factor Y su...    128   4e-30   
ref|XP_010247690.1|  PREDICTED: nuclear transcription factor Y su...    129   4e-30   
ref|XP_010923675.1|  PREDICTED: nuclear transcription factor Y su...    126   4e-30   
ref|XP_010241198.1|  PREDICTED: nuclear transcription factor Y su...    125   5e-30   
gb|KDP34934.1|  hypothetical protein JCGZ_09222                         126   5e-30   
ref|XP_002465770.1|  hypothetical protein SORBIDRAFT_01g045500          127   5e-30   Sorghum bicolor [broomcorn]
ref|XP_008664545.1|  PREDICTED: uncharacterized protein LOC100194...    126   6e-30   
ref|XP_009626581.1|  PREDICTED: nuclear transcription factor Y su...    128   6e-30   
gb|KDP22098.1|  hypothetical protein JCGZ_25929                         128   6e-30   
ref|XP_010241196.1|  PREDICTED: nuclear transcription factor Y su...    125   6e-30   
ref|XP_004985515.1|  PREDICTED: nuclear transcription factor Y su...    126   6e-30   
ref|XP_009626580.1|  PREDICTED: nuclear transcription factor Y su...    128   7e-30   
ref|XP_004985517.1|  PREDICTED: nuclear transcription factor Y su...    126   7e-30   
ref|XP_008664533.1|  PREDICTED: uncharacterized protein LOC100194...    127   7e-30   
ref|XP_010247679.1|  PREDICTED: nuclear transcription factor Y su...    129   7e-30   
ref|XP_009396059.1|  PREDICTED: nuclear transcription factor Y su...    127   7e-30   
ref|XP_009366099.1|  PREDICTED: nuclear transcription factor Y su...    129   7e-30   
ref|XP_008664541.1|  PREDICTED: uncharacterized protein LOC100194...    126   8e-30   
ref|XP_010923674.1|  PREDICTED: nuclear transcription factor Y su...    126   8e-30   
ref|XP_010241193.1|  PREDICTED: nuclear transcription factor Y su...    125   8e-30   
ref|XP_003600468.1|  Nuclear transcription factor Y subunit             127   9e-30   
ref|XP_009408550.1|  PREDICTED: nuclear transcription factor Y su...    126   9e-30   
ref|XP_002454647.1|  hypothetical protein SORBIDRAFT_04g034760          127   9e-30   Sorghum bicolor [broomcorn]
ref|XP_008227314.1|  PREDICTED: nuclear transcription factor Y su...    128   1e-29   
emb|CDX70480.1|  BnaC03g05640D                                          126   1e-29   
ref|XP_008344681.1|  PREDICTED: nuclear transcription factor Y su...    128   1e-29   
gb|AIZ68346.1|  CCAAT-binding transcription factor B                    126   1e-29   
ref|XP_007212260.1|  hypothetical protein PRUPE_ppa006634mg             129   2e-29   
ref|XP_010520178.1|  PREDICTED: nuclear transcription factor Y su...    126   2e-29   
ref|XP_007133814.1|  hypothetical protein PHAVU_011G211300g             126   2e-29   
ref|XP_009343714.1|  PREDICTED: nuclear transcription factor Y su...    128   2e-29   
emb|CDP18655.1|  unnamed protein product                                122   2e-29   
ref|XP_009131289.1|  PREDICTED: nuclear transcription factor Y su...    125   2e-29   
ref|XP_004306538.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-29   
gb|ADY38377.1|  nuclear transcription factor Y subunit A7               125   2e-29   
ref|XP_009131294.1|  PREDICTED: nuclear transcription factor Y su...    125   2e-29   
gb|AFK49647.1|  nuclear transcription factor Y subunit A5               127   2e-29   
gb|AGH62008.1|  nuclear transcription factor Y subunit A-3              124   2e-29   
ref|XP_006399769.1|  hypothetical protein EUTSA_v10014364mg             126   2e-29   
ref|XP_006399770.1|  hypothetical protein EUTSA_v10014364mg             126   2e-29   
ref|XP_010102352.1|  Nuclear transcription factor Y subunit A-1         127   2e-29   
ref|XP_009343707.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-29   
ref|XP_010278974.1|  PREDICTED: nuclear transcription factor Y su...    127   2e-29   
ref|XP_009374949.1|  PREDICTED: nuclear transcription factor Y su...    127   3e-29   
ref|XP_009374946.1|  PREDICTED: nuclear transcription factor Y su...    127   3e-29   
ref|XP_010088228.1|  Nuclear transcription factor Y subunit A-9         126   3e-29   
gb|AIZ68348.1|  CCAAT-binding transcription factor B                    124   3e-29   
emb|CAM12542.1|  YA4                                                    126   3e-29   Antirrhinum majus [garden snapdragon]
gb|AES70718.2|  CCAAT-binding transcription factor                      127   3e-29   
ref|XP_010520177.1|  PREDICTED: nuclear transcription factor Y su...    126   3e-29   
ref|XP_009414802.1|  PREDICTED: nuclear transcription factor Y su...    127   3e-29   
gb|AAS78480.1|  CCAAT-box transcription factor complex WHAP6            124   3e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003600467.1|  Nuclear transcription factor Y subunit             127   3e-29   
gb|AAS78482.1|  CCAAT-box transcription factor complex WHAP8            124   3e-29   Triticum aestivum [Canadian hard winter wheat]
gb|KHG16925.1|  Nuclear transcription factor Y subunit A-5 -like ...    126   3e-29   
gb|AGT16982.1|  nuclear transcription factor                            125   4e-29   
gb|AGT16671.1|  nuclear transcription factor                            125   4e-29   
ref|XP_006448911.1|  hypothetical protein CICLE_v10016491mg             123   4e-29   
ref|XP_008778424.1|  PREDICTED: nuclear transcription factor Y su...    122   4e-29   
ref|XP_006468306.1|  PREDICTED: nuclear transcription factor Y su...    123   4e-29   
gb|AGT15964.1|  nuclear transcription factor                            125   4e-29   
ref|XP_010273959.1|  PREDICTED: nuclear transcription factor Y su...    125   4e-29   
emb|CDX97206.1|  BnaC09g44190D                                          125   4e-29   
ref|XP_011012079.1|  PREDICTED: nuclear transcription factor Y su...    123   4e-29   
ref|XP_006468307.1|  PREDICTED: nuclear transcription factor Y su...    122   4e-29   
gb|AGT16714.1|  nuclear transcription factor                            124   5e-29   
ref|XP_008794455.1|  PREDICTED: nuclear transcription factor Y su...    122   5e-29   
gb|AGT16937.1|  nuclear transcription factor                            124   5e-29   
ref|XP_010031785.1|  PREDICTED: nuclear transcription factor Y su...    123   5e-29   
dbj|BAJ86591.1|  predicted protein                                      124   5e-29   
gb|AAS78479.1|  CCAAT-box transcription factor complex WHAP5            124   5e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006448912.1|  hypothetical protein CICLE_v10016491mg             123   5e-29   
gb|AAS78478.1|  CCAAT-box transcription factor complex WHAP4            124   5e-29   Triticum aestivum [Canadian hard winter wheat]
gb|AAS78477.1|  CCAAT-box transcription factor complex WHAP3            124   5e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006468305.1|  PREDICTED: nuclear transcription factor Y su...    123   6e-29   
ref|XP_006826447.1|  hypothetical protein AMTR_s00004p00174960          124   6e-29   
gb|AAS78487.1|  CCAAT-box transcription factor complex WHAP13           124   6e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006448913.1|  hypothetical protein CICLE_v10016491mg             124   6e-29   
ref|XP_007212071.1|  hypothetical protein PRUPE_ppa011627mg             122   6e-29   
emb|CDY53967.1|  BnaA10g29990D                                          125   6e-29   
ref|XP_006468304.1|  PREDICTED: nuclear transcription factor Y su...    124   6e-29   
ref|XP_011020342.1|  PREDICTED: nuclear transcription factor Y su...    125   7e-29   
ref|XP_010247683.1|  PREDICTED: nuclear transcription factor Y su...    126   7e-29   
emb|CAN68910.1|  hypothetical protein VITISV_000211                     125   7e-29   Vitis vinifera
gb|KHF97628.1|  Nuclear transcription factor Y subunit A-7              122   7e-29   
ref|XP_008794453.1|  PREDICTED: nuclear transcription factor Y su...    123   7e-29   
gb|AHI94929.1|  transcription factor subunit NF-YA1A                    124   8e-29   
ref|XP_009769785.1|  PREDICTED: nuclear transcription factor Y su...    125   9e-29   
ref|XP_002282043.1|  PREDICTED: nuclear transcription factor Y su...    122   9e-29   Vitis vinifera
ref|XP_006580212.1|  PREDICTED: nuclear transcription factor Y su...    122   1e-28   
ref|XP_010555019.1|  PREDICTED: nuclear transcription factor Y su...    123   1e-28   
ref|XP_004293988.1|  PREDICTED: nuclear transcription factor Y su...    122   1e-28   
ref|XP_010555018.1|  PREDICTED: nuclear transcription factor Y su...    123   1e-28   
ref|XP_008231270.1|  PREDICTED: nuclear transcription factor Y su...    125   1e-28   
ref|XP_002523193.1|  Nuclear transcription factor Y subunit A-4, ...    122   1e-28   Ricinus communis
ref|XP_006854167.1|  hypothetical protein AMTR_s00048p00192930          124   1e-28   
ref|XP_002513499.1|  Nuclear transcription factor Y subunit A-1, ...    125   1e-28   Ricinus communis
ref|XP_009131293.1|  PREDICTED: nuclear transcription factor Y su...    123   1e-28   
gb|KCW51172.1|  hypothetical protein EUGRSUZ_J00764                     124   1e-28   
ref|XP_004245059.1|  PREDICTED: nuclear transcription factor Y su...    124   2e-28   
gb|AHI94930.1|  transcription factor subunit NF-YA1B                    123   2e-28   
gb|KHF97629.1|  Nuclear transcription factor Y subunit A-7              121   2e-28   
ref|XP_004513462.1|  PREDICTED: nuclear transcription factor Y su...    122   2e-28   
gb|KDP26024.1|  hypothetical protein JCGZ_21057                         124   2e-28   
ref|XP_011075221.1|  PREDICTED: nuclear transcription factor Y su...    124   2e-28   
ref|XP_007022876.1|  Nuclear transcription factor Y subunit A-7         121   2e-28   
ref|XP_008449710.1|  PREDICTED: nuclear transcription factor Y su...    124   2e-28   
ref|YP_009049690.1|  hypothetical protein                               124   2e-28   
gb|KHN48069.1|  Nuclear transcription factor Y subunit A-7              121   2e-28   
gb|ACU19519.1|  unknown                                                 121   2e-28   Glycine max [soybeans]
ref|XP_010536085.1|  PREDICTED: nuclear transcription factor Y su...    122   2e-28   
ref|XP_009631356.1|  PREDICTED: nuclear transcription factor Y su...    124   2e-28   
ref|XP_003524992.1|  PREDICTED: nuclear transcription factor Y su...    121   2e-28   
gb|KHG15597.1|  Nuclear transcription factor Y subunit A-7 -like ...    121   3e-28   
ref|XP_011080345.1|  PREDICTED: nuclear transcription factor Y su...    124   3e-28   
gb|AAS78481.1|  CCAAT-box transcription factor complex WHAP7            122   3e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009793851.1|  PREDICTED: nuclear transcription factor Y su...    124   3e-28   
gb|KHG04177.1|  Nuclear transcription factor Y subunit A-3 -like ...    124   3e-28   
ref|XP_009631340.1|  PREDICTED: nuclear transcription factor Y su...    124   3e-28   
ref|XP_009801470.1|  PREDICTED: nuclear transcription factor Y su...    123   3e-28   
ref|XP_009121834.1|  PREDICTED: nuclear transcription factor Y su...    122   4e-28   
ref|XP_006377668.1|  CCAAT-binding transcription factor family pr...    120   4e-28   
gb|AAR26000.1|  CCAAT-box transcription factor complex WHAP2            121   4e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004154628.1|  PREDICTED: nuclear transcription factor Y su...    122   4e-28   
gb|AAS78476.1|  CCAAT-box transcription factor complex WHAP1            119   4e-28   Triticum aestivum [Canadian hard winter wheat]
gb|EMS54154.1|  Nuclear transcription factor Y subunit A-9              124   4e-28   
ref|XP_004139033.1|  PREDICTED: nuclear transcription factor Y su...    122   4e-28   
ref|XP_002308961.2|  hypothetical protein POPTR_0006s05210g             122   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010237027.1|  PREDICTED: nuclear transcription factor Y su...    120   4e-28   
gb|AAS78486.1|  CCAAT-box transcription factor complex WHAP12           121   5e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008450423.1|  PREDICTED: nuclear transcription factor Y su...    122   5e-28   
ref|XP_009624416.1|  PREDICTED: nuclear transcription factor Y su...    122   5e-28   
ref|XP_011080343.1|  PREDICTED: nuclear transcription factor Y su...    123   6e-28   
gb|AIZ03442.1|  NF-YA10-1                                               121   6e-28   
ref|XP_009608945.1|  PREDICTED: nuclear transcription factor Y su...    122   6e-28   
ref|XP_010067868.1|  PREDICTED: nuclear transcription factor Y su...    121   6e-28   
ref|XP_004954092.1|  PREDICTED: nuclear transcription factor Y su...    121   6e-28   
gb|AIZ68345.1|  CCAAT-binding transcription factor B                    121   7e-28   
gb|KHN06472.1|  Nuclear transcription factor Y subunit A-7              119   8e-28   
ref|XP_006657945.1|  PREDICTED: nuclear transcription factor Y su...    122   8e-28   
ref|XP_006650188.1|  PREDICTED: nuclear transcription factor Y su...    122   8e-28   
ref|XP_008450422.1|  PREDICTED: nuclear transcription factor Y su...    122   8e-28   
ref|XP_009362237.1|  PREDICTED: nuclear transcription factor Y su...    119   9e-28   
ref|XP_009767513.1|  PREDICTED: nuclear transcription factor Y su...    122   9e-28   
ref|XP_008372229.1|  PREDICTED: nuclear transcription factor Y su...    119   9e-28   
ref|XP_006351613.1|  PREDICTED: nuclear transcription factor Y su...    122   1e-27   
ref|XP_006580213.1|  PREDICTED: nuclear transcription factor Y su...    119   1e-27   
ref|XP_008344031.1|  PREDICTED: nuclear transcription factor Y su...    122   1e-27   
ref|XP_004250937.1|  PREDICTED: nuclear transcription factor Y su...    121   1e-27   
ref|XP_009125865.1|  PREDICTED: nuclear transcription factor Y su...    120   1e-27   
gb|EYU46255.1|  hypothetical protein MIMGU_mgv1a021648mg                120   1e-27   
ref|XP_006361756.1|  PREDICTED: nuclear transcription factor Y su...    121   1e-27   
ref|XP_010666451.1|  PREDICTED: nuclear transcription factor Y su...    122   1e-27   
ref|XP_008383405.1|  PREDICTED: nuclear transcription factor Y su...    119   1e-27   
ref|XP_009617199.1|  PREDICTED: nuclear transcription factor Y su...    118   1e-27   
ref|XP_010666452.1|  PREDICTED: nuclear transcription factor Y su...    121   1e-27   
ref|XP_009397392.1|  PREDICTED: nuclear transcription factor Y su...    119   1e-27   
ref|XP_006366543.1|  PREDICTED: nuclear transcription factor Y su...    121   2e-27   
ref|XP_002299906.1|  hypothetical protein POPTR_0001s26480g             122   2e-27   
ref|XP_003533780.1|  PREDICTED: nuclear transcription factor Y su...    119   2e-27   
ref|XP_009125864.1|  PREDICTED: nuclear transcription factor Y su...    119   2e-27   
ref|XP_009361673.1|  PREDICTED: nuclear transcription factor Y su...    121   2e-27   
gb|ACU24533.1|  unknown                                                 119   2e-27   
gb|KHN12271.1|  Nuclear transcription factor Y subunit A-3              120   2e-27   
ref|XP_010906032.1|  PREDICTED: nuclear transcription factor Y su...    122   2e-27   
gb|ADY38378.1|  nuclear transcription factor Y subunit A9               120   2e-27   
ref|XP_004510989.1|  PREDICTED: nuclear transcription factor Y su...    121   2e-27   
emb|CDX91161.1|  BnaC02g04360D                                          119   2e-27   
ref|XP_007202894.1|  hypothetical protein PRUPE_ppa016008mg             121   2e-27   
gb|AFK49645.1|  nuclear transcription factor Y subunit A3               119   2e-27   
ref|NP_001235566.1|  uncharacterized protein LOC100499754               118   3e-27   
gb|AAS78484.1|  CCAAT-box transcription factor complex WHAP10           119   3e-27   
dbj|BAC84851.1|  putative transcription factor                          120   3e-27   
ref|XP_008242196.1|  PREDICTED: nuclear transcription factor Y su...    120   3e-27   
ref|XP_009387069.1|  PREDICTED: nuclear transcription factor Y su...    120   3e-27   
ref|XP_008643683.1|  PREDICTED: nuclear transcription factor Y su...    119   3e-27   
ref|XP_009617196.1|  PREDICTED: nuclear transcription factor Y su...    119   3e-27   
gb|EEC82423.1|  hypothetical protein OsI_26817                          120   3e-27   
ref|XP_004510988.1|  PREDICTED: nuclear transcription factor Y su...    121   3e-27   
ref|XP_008643680.1|  PREDICTED: nuclear transcription factor Y su...    119   4e-27   
ref|NP_001060240.1|  Os07g0608200                                       120   4e-27   
ref|XP_009793846.1|  PREDICTED: nuclear transcription factor Y su...    120   4e-27   
ref|XP_004228516.1|  PREDICTED: nuclear transcription factor Y su...    120   4e-27   
ref|XP_006370020.1|  hypothetical protein POPTR_0001s38100g             118   4e-27   
gb|AGT16110.1|  nuclear transcription factor                            119   4e-27   
ref|XP_010519750.1|  PREDICTED: nuclear transcription factor Y su...    119   4e-27   
ref|XP_010263046.1|  PREDICTED: nuclear transcription factor Y su...    120   5e-27   
ref|XP_008228231.1|  PREDICTED: nuclear transcription factor Y su...    120   5e-27   
ref|XP_011012082.1|  PREDICTED: nuclear transcription factor Y su...    116   5e-27   
gb|ACF83958.1|  unknown                                                 115   5e-27   
dbj|BAJ99575.1|  predicted protein                                      116   5e-27   
ref|XP_007159545.1|  hypothetical protein PHAVU_002G246600g             117   5e-27   
ref|XP_008643682.1|  PREDICTED: nuclear transcription factor Y su...    119   5e-27   
ref|XP_010263040.1|  PREDICTED: nuclear transcription factor Y su...    120   5e-27   
ref|XP_002298891.1|  CCAAT-binding transcription factor family pr...    117   5e-27   
ref|XP_010905423.1|  PREDICTED: nuclear transcription factor Y su...    117   6e-27   
ref|XP_010098569.1|  Nuclear transcription factor Y subunit A-7         120   6e-27   
ref|XP_008228232.1|  PREDICTED: nuclear transcription factor Y su...    119   6e-27   
ref|XP_004963231.1|  PREDICTED: nuclear transcription factor Y su...    117   6e-27   
ref|NP_001149075.1|  nuclear transcription factor Y subunit A-3         119   6e-27   
ref|XP_007024572.1|  Nuclear transcription factor Y subunit A-3, ...    120   7e-27   
ref|XP_010905422.1|  PREDICTED: nuclear transcription factor Y su...    117   7e-27   
ref|XP_009344406.1|  PREDICTED: nuclear transcription factor Y su...    117   8e-27   
tpg|DAA43656.1|  TPA: hypothetical protein ZEAMMB73_480714              117   8e-27   
gb|EEC75456.1|  hypothetical protein OsI_12014                          119   8e-27   
ref|XP_008664550.1|  PREDICTED: uncharacterized protein LOC100194...    117   8e-27   
gb|KCW66104.1|  hypothetical protein EUGRSUZ_G03377                     115   9e-27   
gb|AAW39026.1|  putative CCAAT-binding transcription factor             119   9e-27   
gb|AFK41890.1|  unknown                                                 117   9e-27   
ref|XP_006575727.1|  PREDICTED: nuclear transcription factor Y su...    118   1e-26   
emb|CAM12543.1|  YA5                                                    118   1e-26   
ref|XP_008643684.1|  PREDICTED: nuclear transcription factor Y su...    118   1e-26   
ref|XP_006846016.1|  hypothetical protein AMTR_s00155p00071520          115   1e-26   
ref|NP_001050347.1|  Os03g0411100                                       119   1e-26   
dbj|BAK01769.1|  predicted protein                                      118   1e-26   
ref|XP_007216878.1|  hypothetical protein PRUPE_ppa020977mg             119   1e-26   
gb|EMT27317.1|  Nuclear transcription factor Y subunit A-5              118   1e-26   
ref|XP_008360450.1|  PREDICTED: nuclear transcription factor Y su...    118   1e-26   
ref|XP_011038883.1|  PREDICTED: nuclear transcription factor Y su...    118   1e-26   
ref|XP_011038881.1|  PREDICTED: nuclear transcription factor Y su...    118   1e-26   
ref|XP_010062679.1|  PREDICTED: nuclear transcription factor Y su...    118   1e-26   
ref|XP_010312081.1|  PREDICTED: nuclear transcription factor Y su...    117   1e-26   
gb|AHX56183.1|  NFYA3                                                   118   1e-26   
ref|XP_011025538.1|  PREDICTED: nuclear transcription factor Y su...    119   1e-26   
gb|KDO75265.1|  hypothetical protein CISIN_1g0264741mg                  116   1e-26   
ref|XP_008360451.1|  PREDICTED: nuclear transcription factor Y su...    117   2e-26   
ref|XP_009407723.1|  PREDICTED: nuclear transcription factor Y su...    118   2e-26   
ref|XP_008643681.1|  PREDICTED: nuclear transcription factor Y su...    117   2e-26   
gb|EMT02956.1|  Nuclear transcription factor Y subunit A-5              119   2e-26   
ref|XP_002463167.1|  hypothetical protein SORBIDRAFT_02g038960          118   2e-26   
ref|XP_008360449.1|  PREDICTED: nuclear transcription factor Y su...    119   2e-26   
ref|XP_010939934.1|  PREDICTED: nuclear transcription factor Y su...    118   2e-26   
ref|XP_008337747.1|  PREDICTED: nuclear transcription factor Y su...    118   2e-26   
ref|XP_010062677.1|  PREDICTED: nuclear transcription factor Y su...    118   2e-26   
ref|XP_010656147.1|  PREDICTED: nuclear transcription factor Y su...    118   3e-26   
emb|CBI27842.3|  unnamed protein product                                117   3e-26   
ref|XP_009592751.1|  PREDICTED: nuclear transcription factor Y su...    116   3e-26   
ref|XP_010312079.1|  PREDICTED: nuclear transcription factor Y su...    116   3e-26   
ref|XP_007142467.1|  hypothetical protein PHAVU_008G283100g             117   3e-26   
gb|KHN23811.1|  Nuclear transcription factor Y subunit A-9              117   3e-26   
gb|ADE77824.1|  unknown                                                 117   3e-26   
ref|XP_009592750.1|  PREDICTED: nuclear transcription factor Y su...    116   3e-26   
ref|XP_009761217.1|  PREDICTED: nuclear transcription factor Y su...    116   3e-26   
ref|XP_002443549.1|  hypothetical protein SORBIDRAFT_08g021370          115   4e-26   
gb|AAS78485.1|  CCAAT-box transcription factor complex WHAP11           115   4e-26   
ref|XP_003535082.1|  PREDICTED: nuclear transcription factor Y su...    115   4e-26   
ref|XP_009372380.1|  PREDICTED: nuclear transcription factor Y su...    117   4e-26   
ref|XP_010036606.1|  PREDICTED: nuclear transcription factor Y su...    114   4e-26   
ref|XP_002278441.2|  PREDICTED: nuclear transcription factor Y su...    118   4e-26   
ref|XP_009413487.1|  PREDICTED: nuclear transcription factor Y su...    117   4e-26   
ref|XP_010656146.1|  PREDICTED: nuclear transcription factor Y su...    118   4e-26   
gb|EMS62064.1|  Nuclear transcription factor Y subunit A-5              116   4e-26   
ref|XP_006342951.1|  PREDICTED: nuclear transcription factor Y su...    117   4e-26   
ref|XP_010057360.1|  PREDICTED: nuclear transcription factor Y su...    117   4e-26   
ref|XP_003544525.1|  PREDICTED: nuclear transcription factor Y su...    117   4e-26   
ref|XP_004958253.1|  PREDICTED: nuclear transcription factor Y su...    116   4e-26   
ref|XP_010087689.1|  Nuclear transcription factor Y subunit A-3         119   5e-26   
ref|XP_007218494.1|  hypothetical protein PRUPE_ppa012173mg             114   5e-26   
ref|XP_009372379.1|  PREDICTED: nuclear transcription factor Y su...    117   5e-26   
emb|CBI39143.3|  unnamed protein product                                117   5e-26   
ref|XP_006465957.1|  PREDICTED: nuclear transcription factor Y su...    117   5e-26   
gb|KDO65101.1|  hypothetical protein CISIN_1g019782mg                   117   5e-26   
ref|XP_010492017.1|  PREDICTED: nuclear transcription factor Y su...    112   5e-26   
ref|XP_003546473.1|  PREDICTED: nuclear transcription factor Y su...    115   6e-26   
ref|XP_008242197.1|  PREDICTED: nuclear transcription factor Y su...    117   6e-26   
ref|XP_002263793.1|  PREDICTED: nuclear transcription factor Y su...    117   6e-26   
gb|KDO65102.1|  hypothetical protein CISIN_1g019782mg                   117   6e-26   
ref|XP_004958251.1|  PREDICTED: nuclear transcription factor Y su...    116   6e-26   
ref|NP_001169378.1|  hypothetical protein                               114   6e-26   
ref|XP_003546258.1|  PREDICTED: nuclear transcription factor Y su...    114   6e-26   
gb|EYU25884.1|  hypothetical protein MIMGU_mgv1a014546mg                114   6e-26   
ref|NP_001151224.1|  LOC100284857                                       114   7e-26   
gb|AGV54765.1|  nuclear transcription factor Y subunit A-3-like i...    115   7e-26   
ref|XP_007154608.1|  hypothetical protein PHAVU_003G133100g             115   7e-26   
ref|XP_010544192.1|  PREDICTED: nuclear transcription factor Y su...    116   7e-26   
ref|XP_003535083.1|  PREDICTED: nuclear transcription factor Y su...    114   8e-26   
emb|CDO97867.1|  unnamed protein product                                117   8e-26   
ref|XP_006586834.1|  PREDICTED: nuclear transcription factor Y su...    113   8e-26   
ref|XP_006597658.1|  PREDICTED: nuclear transcription factor Y su...    113   8e-26   
ref|XP_010544188.1|  PREDICTED: nuclear transcription factor Y su...    116   8e-26   
ref|XP_006426613.1|  hypothetical protein CICLE_v10026020mg             117   8e-26   
dbj|BAF64439.1|  HAP2 subunit of HAP complex                            116   9e-26   
emb|CDY06393.1|  BnaC05g31370D                                          116   9e-26   
gb|ACG26734.1|  nuclear transcription factor Y subunit A-3              116   9e-26   
ref|XP_006426612.1|  hypothetical protein CICLE_v10026020mg             116   9e-26   
ref|XP_006664197.1|  PREDICTED: nuclear transcription factor Y su...    114   1e-25   
ref|XP_011093786.1|  PREDICTED: nuclear transcription factor Y su...    115   1e-25   
ref|XP_008643685.1|  PREDICTED: nuclear transcription factor Y su...    114   1e-25   
ref|XP_009145532.1|  PREDICTED: nuclear transcription factor Y su...    115   1e-25   
ref|XP_003562711.1|  PREDICTED: nuclear transcription factor Y su...    115   1e-25   
gb|KDP40721.1|  hypothetical protein JCGZ_24720                         115   1e-25   
gb|EYU19122.1|  hypothetical protein MIMGU_mgv1a013834mg                113   1e-25   
ref|XP_011045960.1|  PREDICTED: nuclear transcription factor Y su...    116   1e-25   
ref|XP_010544186.1|  PREDICTED: nuclear transcription factor Y su...    116   2e-25   
ref|XP_008651393.1|  PREDICTED: nuclear transcription factor Y su...    115   2e-25   
ref|XP_006298228.1|  hypothetical protein CARUB_v10014289mg             115   2e-25   
ref|XP_004510428.1|  PREDICTED: nuclear transcription factor Y su...    115   2e-25   
ref|XP_004510429.1|  PREDICTED: nuclear transcription factor Y su...    115   2e-25   
ref|XP_009145531.1|  PREDICTED: nuclear transcription factor Y su...    115   2e-25   
ref|XP_009145533.1|  PREDICTED: nuclear transcription factor Y su...    115   2e-25   
ref|XP_009145530.1|  PREDICTED: nuclear transcription factor Y su...    115   2e-25   
ref|XP_010090113.1|  Nuclear transcription factor Y subunit A-8         114   2e-25   
ref|XP_010906030.1|  PREDICTED: nuclear transcription factor Y su...    115   2e-25   
ref|XP_007012707.1|  Nuclear transcription factor Y subunit A-3, ...    113   2e-25   
ref|XP_010672780.1|  PREDICTED: nuclear transcription factor Y su...    112   2e-25   
ref|XP_002308270.1|  CCAAT-binding transcription factor family pr...    115   2e-25   
ref|XP_010036604.1|  PREDICTED: nuclear transcription factor Y su...    113   2e-25   
ref|NP_001276187.1|  uncharacterized protein LOC102664020               115   2e-25   
ref|XP_004984044.1|  PREDICTED: nuclear transcription factor Y su...    115   2e-25   
dbj|BAG50055.1|  transcription factor CCAAT                             115   3e-25   
ref|NP_001067261.1|  Os12g0613000                                       112   3e-25   
ref|XP_007024571.1|  Nuclear transcription factor Y subunit A-3, ...    115   3e-25   
ref|XP_003542351.1|  PREDICTED: nuclear transcription factor Y su...    113   3e-25   
ref|XP_004984046.1|  PREDICTED: nuclear transcription factor Y su...    114   3e-25   
gb|AFK37452.1|  unknown                                                 115   3e-25   
ref|XP_009340453.1|  PREDICTED: nuclear transcription factor Y su...    114   3e-25   
ref|XP_010907709.1|  PREDICTED: nuclear transcription factor Y su...    115   3e-25   
ref|XP_004303671.1|  PREDICTED: nuclear transcription factor Y su...    114   3e-25   
ref|XP_006406333.1|  hypothetical protein EUTSA_v10021240mg             114   3e-25   
dbj|BAB01900.1|  CCAAT-binding transcription factor B subunit           114   3e-25   
gb|KDO61246.1|  hypothetical protein CISIN_1g019036mg                   112   3e-25   
ref|XP_008643686.1|  PREDICTED: nuclear transcription factor Y su...    113   3e-25   
emb|CDP17312.1|  unnamed protein product                                112   3e-25   
ref|XP_006664196.1|  PREDICTED: nuclear transcription factor Y su...    112   4e-25   
ref|XP_008391985.1|  PREDICTED: nuclear transcription factor Y su...    114   4e-25   
ref|NP_001132701.1|  nuclear transcription factor Y subunit A-3 i...    114   4e-25   
emb|CDP20541.1|  unnamed protein product                                114   4e-25   
gb|KDP33884.1|  hypothetical protein JCGZ_07455                         112   4e-25   
ref|NP_566670.1|  nuclear transcription factor Y subunit A-9            114   4e-25   
ref|XP_007012708.1|  Nuclear transcription factor Y subunit A-3, ...    113   4e-25   
ref|XP_009417055.1|  PREDICTED: nuclear transcription factor Y su...    112   4e-25   
ref|XP_006351229.1|  PREDICTED: nuclear transcription factor Y su...    112   5e-25   
ref|XP_009397416.1|  PREDICTED: nuclear transcription factor Y su...    114   5e-25   
gb|KHN37624.1|  Nuclear transcription factor Y subunit A-9              114   5e-25   
ref|XP_002521352.1|  Nuclear transcription factor Y subunit A-3, ...    114   5e-25   
gb|ACN27184.1|  unknown                                                 110   5e-25   
gb|EYU19123.1|  hypothetical protein MIMGU_mgv1a013834mg                111   6e-25   
emb|CDX82223.1|  BnaA03g35980D                                          113   6e-25   
ref|XP_006353551.1|  PREDICTED: nuclear transcription factor Y su...    112   6e-25   
ref|XP_007024573.1|  Nuclear transcription factor Y subunit A-3, ...    113   6e-25   
ref|XP_011038885.1|  PREDICTED: nuclear transcription factor Y su...    112   6e-25   
ref|XP_004136716.1|  PREDICTED: nuclear transcription factor Y su...    114   6e-25   
ref|XP_004235574.1|  PREDICTED: nuclear transcription factor Y su...    113   6e-25   
ref|XP_006298229.1|  hypothetical protein CARUB_v10014289mg             113   7e-25   
ref|XP_003521500.1|  PREDICTED: nuclear transcription factor Y su...    114   7e-25   
ref|XP_008228230.1|  PREDICTED: nuclear transcription factor Y su...    114   7e-25   
gb|ACG36823.1|  nuclear transcription factor Y subunit A-3              113   7e-25   
gb|KHG00611.1|  Nuclear transcription factor Y subunit A-7 -like ...    114   7e-25   
ref|XP_004150466.1|  PREDICTED: nuclear transcription factor Y su...    112   7e-25   
ref|XP_007012706.1|  Nuclear transcription factor Y subunit A-3, ...    114   8e-25   
gb|AIZ68353.1|  CCAAT-binding transcription factor B                    111   8e-25   
gb|KHG01512.1|  Nuclear transcription factor Y subunit A-3 -like ...    114   8e-25   
ref|NP_001242813.1|  uncharacterized protein LOC100789738               113   8e-25   
dbj|BAJ95137.1|  predicted protein                                      111   8e-25   
gb|ACN33300.1|  unknown                                                 113   9e-25   
ref|XP_008442935.1|  PREDICTED: nuclear transcription factor Y su...    114   9e-25   
ref|XP_010907711.1|  PREDICTED: uncharacterized protein LOC105034...    113   9e-25   
gb|ABA99388.2|  CCAAT-box transcription factor complex WHAP5, put...    111   9e-25   
ref|NP_001147311.1|  nuclear transcription factor Y subunit A-3         113   9e-25   
ref|XP_006351227.1|  PREDICTED: nuclear transcription factor Y su...    112   9e-25   
gb|ABF96566.1|  CCAAT-box transcription factor complex WHAP3, put...    113   1e-24   
gb|AHI94938.1|  transcription factor subunit NF-YA9A                    113   1e-24   
gb|AFK49650.1|  nuclear transcription factor Y subunit A8               113   1e-24   
gb|KCW69810.1|  hypothetical protein EUGRSUZ_F03169                     110   1e-24   
ref|XP_011094246.1|  PREDICTED: nuclear transcription factor Y su...    113   1e-24   
ref|XP_011038884.1|  PREDICTED: nuclear transcription factor Y su...    112   1e-24   
ref|XP_007012703.1|  Nuclear transcription factor Y subunit A-3, ...    113   1e-24   



>ref|XP_010278970.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010278972.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010278973.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Nelumbo nucifera]
Length=353

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 93/119 (78%), Gaps = 7/119 (6%)
 Frame = +1

Query  481  PATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEP  642
            P T+ +L+GHSI CAPYPY++P + G   A G +++ H    G+   RM LPLE+T EEP
Sbjct  120  PHTQLELIGHSIACAPYPYSDPYYGGIMAAYGNQAMAHPHLLGMHHTRMPLPLEMT-EEP  178

Query  643  VYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  179  VYVNAKQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHAMRRARGCGGRFLNTKK  237



>ref|XP_009394404.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=320

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 103/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  367  GGMHHTAPEPKGFTEL-HTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTE  543
            GGMH T    K        SD N +  S   +M   +  P T+ +L G SI CA YP+T+
Sbjct  56   GGMHGTGDVSKETQSADRKSDGNLQPTSAATSMMHEYLAPHTQLEL-GQSIACAMYPFTD  114

Query  544  PAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKA  705
            P F G     G +++VH    G+   RM+LPLE+T EEPVYVN KQYHGI+RRRQLRAKA
Sbjct  115  PYFAGVVAPYGTQAMVHPQIIGMPQSRMLLPLEMT-EEPVYVNPKQYHGIIRRRQLRAKA  173

Query  706  ELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            ELE K +K RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  174  ELERKALKVRKPYLHESRHLHAMRRARGCGGRFLNTKK  211



>emb|CBI29866.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 95/128 (74%), Gaps = 7/128 (5%)
 Frame = +1

Query  454  VAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVL  615
            + M+ +H  P ++ +L+GHSI CA YPY+EP + G   A G + +V     GV   RM L
Sbjct  110  MTMAEYHLAPPSQLELVGHSIACASYPYSEPYYTGVIPAYGPQGLVQSQFLGVNVARMAL  169

Query  616  PLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGG  795
            P+E+  EEPVYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  G
Sbjct  170  PIEMA-EEPVYVNAKQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHAMRRARGCG  228

Query  796  GRFVNKKK  819
            GRF+N KK
Sbjct  229  GRFLNTKK  236



>ref|XP_010257210.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Nelumbo nucifera]
Length=353

 Score =   152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 102/147 (69%), Gaps = 15/147 (10%)
 Frame = +1

Query  421  SDKNCKVESENV----AMSPHHSR----PATEHDLMGHSIQCAPYPYTEPAFLG---AAG  567
            S+ NC  ES ++       PH +     P T+ +L+GHSI CAPYPY++P + G   A G
Sbjct  91   SNGNCGQESPHMQHGSTTVPHTTSEPLVPTTQLELVGHSIACAPYPYSDPYYGGMMAAYG  150

Query  568  GESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRK  738
             +++ H    G+   RM LPLE+  EEPVYVNAKQYHGILRRRQ RAKAELE K++K RK
Sbjct  151  TQALAHPHLLGMHHPRMPLPLEMA-EEPVYVNAKQYHGILRRRQSRAKAELEKKLIKVRK  209

Query  739  PYLHESRHKHAMRRARDGGGRFVNKKK  819
            PYLHESRH HAMRRAR  GGRF+N KK
Sbjct  210  PYLHESRHLHAMRRARGCGGRFLNTKK  236



>gb|KDO53707.1| hypothetical protein CISIN_1g017825mg [Citrus sinensis]
Length=365

 Score =   152 bits (383),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 7/117 (6%)
 Frame = +1

Query  487  TEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEPVY  648
            ++ +L+GHSI CA YPY++  + GA    G +++VH  + GV   RM LPLE+  EEPVY
Sbjct  123  SQLELVGHSIACASYPYSDSYYGGAVPAYGQQALVHPQSMGVHSARMALPLEMA-EEPVY  181

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQYHGILRRRQLRAKAELE K++K RKPYLHESRH HAMRRAR  GGRFVN KK
Sbjct  182  VNAKQYHGILRRRQLRAKAELERKLIKVRKPYLHESRHLHAMRRARGCGGRFVNTKK  238



>ref|XP_009394400.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009394401.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009394402.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009394403.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=324

 Score =   151 bits (381),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 103/162 (64%), Gaps = 13/162 (8%)
 Frame = +1

Query  367  GGMHHTAPEPKGFTELH-----TSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPY  531
            GGMH T    K            SD N +  S   +M   +  P T+ +L G SI CA Y
Sbjct  56   GGMHGTGDVSKETQSADRKSDLVSDGNLQPTSAATSMMHEYLAPHTQLEL-GQSIACAMY  114

Query  532  PYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQL  693
            P+T+P F G     G +++VH    G+   RM+LPLE+T EEPVYVN KQYHGI+RRRQL
Sbjct  115  PFTDPYFAGVVAPYGTQAMVHPQIIGMPQSRMLLPLEMT-EEPVYVNPKQYHGIIRRRQL  173

Query  694  RAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RAKAELE K +K RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  174  RAKAELERKALKVRKPYLHESRHLHAMRRARGCGGRFLNTKK  215



>ref|XP_006489920.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006489921.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Citrus sinensis]
 ref|XP_006489922.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X3 [Citrus sinensis]
Length=365

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 7/117 (6%)
 Frame = +1

Query  487  TEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEPVY  648
            ++ +L+GHSI CA YPY++  + GA    G +++VH  + GV   RM LPLE+  EEPVY
Sbjct  123  SQLELVGHSIACASYPYSDSYYGGAVPAYGQQALVHPQSMGVHSARMALPLEMA-EEPVY  181

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQYHGILRRRQLRAKAELE K++K RKPYLHESRH HAMRRAR  GGRFVN KK
Sbjct  182  VNAKQYHGILRRRQLRAKAELERKLIKVRKPYLHESRHLHAMRRARGCGGRFVNTKK  238



>ref|XP_006421429.1| hypothetical protein CICLE_v10005144mg [Citrus clementina]
 gb|ESR34669.1| hypothetical protein CICLE_v10005144mg [Citrus clementina]
Length=388

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 7/117 (6%)
 Frame = +1

Query  487  TEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEPVY  648
            ++ +L+GHSI CA YPY++  + GA    G +++VH  + GV   RM LPLE+  EEPVY
Sbjct  119  SQLELVGHSIACASYPYSDSYYGGAVPAYGQQALVHPQSIGVHSARMALPLEMA-EEPVY  177

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQYHGILRRRQLRAKAELE K++K RKPYLHESRH HAMRRAR  GGRFVN KK
Sbjct  178  VNAKQYHGILRRRQLRAKAELERKLIKVRKPYLHESRHLHAMRRARGCGGRFVNTKK  234



>gb|ACN40089.1| unknown [Picea sitchensis]
Length=369

 Score =   150 bits (378),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYH  669
            HSI CA YPY EP F   L A   ++++H +  GV   RM LPL++T EEPVYVNAKQYH
Sbjct  139  HSIACAAYPYAEPYFGGILAAYPAQAMIHPNMLGVQQARMPLPLDMTEEEPVYVNAKQYH  198

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            GILRRRQLRAKAE ENK++K RKPYLHESRH HAM+RAR  GGRF+N KK
Sbjct  199  GILRRRQLRAKAESENKLIKTRKPYLHESRHLHAMKRARGCGGRFLNTKK  248



>ref|XP_007028810.1| Nuclear factor Y, putative [Theobroma cacao]
 gb|EOY09312.1| Nuclear factor Y, putative [Theobroma cacao]
Length=361

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 7/119 (6%)
 Frame = +1

Query  481  PATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEP  642
            P T  +L+GHSI C  YPY +P + GA    G +S+VH    GV   RM LPLE+  EEP
Sbjct  118  PRTRLELVGHSIACPSYPYADPYYGGAMPPYGPQSLVHPHCLGVHPARMALPLEMA-EEP  176

Query  643  VYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  177  VYVNAKQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHLHAMRRARGCGGRFLNTKK  235



>emb|CDP07786.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 91/125 (73%), Gaps = 5/125 (4%)
 Frame = +1

Query  454  VAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGV---RMVLPLE  624
            + MS H   P ++ +L+GHSI   PYPY +PA+ G     + VH    G+   RM LPL+
Sbjct  85   IPMSGHLDSP-SQMELVGHSIMLTPYPYPDPAYGGVITYGAPVHPQYFGIHQTRMPLPLQ  143

Query  625  VTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            +  EEPVYVNAKQYHGILRRRQ RAKAE+E K++K RKPYLHESRH+HAMRRAR  GGRF
Sbjct  144  ME-EEPVYVNAKQYHGILRRRQSRAKAEMEKKIMKGRKPYLHESRHQHAMRRARGSGGRF  202

Query  805  VNKKK  819
            +N KK
Sbjct  203  LNTKK  207



>ref|XP_009396056.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009396057.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009396058.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=316

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 91/128 (71%), Gaps = 8/128 (6%)
 Frame = +1

Query  454  VAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVL  615
             +M P    P T+ +L G SI CA YP+ +P F G     G +++VH    G+   RM L
Sbjct  94   TSMMPEILSPHTQLEL-GQSITCATYPFADPYFAGLVAPYGTQALVHPQIIGMPHPRMPL  152

Query  616  PLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGG  795
            PLE+T EEPVYVNAKQYHGILRRRQ RAKAELE KV+K RKPYLHESRH HAMRRAR  G
Sbjct  153  PLEMT-EEPVYVNAKQYHGILRRRQSRAKAELEKKVIKVRKPYLHESRHLHAMRRARGCG  211

Query  796  GRFVNKKK  819
            GRF+N KK
Sbjct  212  GRFLNTKK  219



>emb|CAM12541.1| YA3 [Antirrhinum majus]
Length=257

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQG---VRMVLPLEVTTEEPVYVNAKQY  666
            DL+ HSI  A YPY++P + G     + VH    G    RM LPLE+  EEPVYVNAKQY
Sbjct  52   DLVSHSIMLASYPYSDPQYGGIMTYGAPVHPHLFGYNQARMPLPLEME-EEPVYVNAKQY  110

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            HGILRRRQ+RAKAELE K++KNRKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  111  HGILRRRQVRAKAELEKKMIKNRKPYLHESRHQHAMRRARGSGGRFLNTKK  161



>gb|AHX56181.1| NFYA1 [Larix kaempferi]
Length=368

 Score =   148 bits (373),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYH  669
            HSI C  YPY +P F   L A   ++++H +  GV   RM LPL++T EEPVYVNAKQYH
Sbjct  139  HSIACGAYPYADPYFGGILTAYPAQAMIHPNMLGVQQARMALPLDMTEEEPVYVNAKQYH  198

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            GILRRRQLRAKAE ENK++K RKPYLHESRH HAM+RAR  GGRF+N KK
Sbjct  199  GILRRRQLRAKAESENKLIKTRKPYLHESRHLHAMKRARGCGGRFLNTKK  248



>ref|XP_009394733.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Musa 
acuminata subsp. malaccensis]
Length=271

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 7/112 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQ  663
            +G SI CA YP+T+P F G     G ++++H     +   RM LPLE+T EEPVYVNAKQ
Sbjct  111  LGQSIACATYPFTDPYFAGVVASYGTQALMHPQLLRIPYSRMPLPLEMT-EEPVYVNAKQ  169

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            YHGILRRRQ RAKAELE  V+K RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  170  YHGILRRRQSRAKAELEKNVIKVRKPYLHESRHLHALRRARGCGGRFLNTKK  221



>ref|XP_010910379.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
X3 [Elaeis guineensis]
Length=284

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = +1

Query  460  MSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPL  621
            M P +  P T+ +L G S+ CA Y Y++P F G     G +++VH    G+   RM LPL
Sbjct  45   MMPEYFAPHTQLEL-GQSLACATYSYSDPYFAGFMAPYGTQALVHPQMLGMPHTRMPLPL  103

Query  622  EVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGR  801
            E+T EEPVYVNAKQYHGILRRRQ RAKAELE K +K RKPYLHESRH+HA+RRAR  GGR
Sbjct  104  EMT-EEPVYVNAKQYHGILRRRQSRAKAELEKKAIKVRKPYLHESRHQHALRRARGCGGR  162

Query  802  FVNKKK  819
            F+N KK
Sbjct  163  FLNTKK  168



>ref|XP_010909045.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010909046.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X2 [Elaeis guineensis]
Length=330

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV--  603
            V S    M P +  P T+ +L G SI CA Y Y++P     +   G +++VH    G+  
Sbjct  89   VSSTMPPMMPEYLAPHTQLEL-GQSIACATYSYSDPYLSRVMAPYGTQALVHPQLLGMPY  147

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LPLE+T EEPVYVNAKQYHGILRRRQ RAKAELE KV+K RKPYLHESRH HAMRR
Sbjct  148  TRMPLPLEMT-EEPVYVNAKQYHGILRRRQSRAKAELEKKVIKVRKPYLHESRHLHAMRR  206

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  207  ARGCGGRFLNTKK  219



>ref|XP_010910375.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010910376.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010910377.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
Length=349

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = +1

Query  460  MSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPL  621
            M P +  P T+ +L G S+ CA Y Y++P F G     G +++VH    G+   RM LPL
Sbjct  110  MMPEYFAPHTQLEL-GQSLACATYSYSDPYFAGFMAPYGTQALVHPQMLGMPHTRMPLPL  168

Query  622  EVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGR  801
            E+T EEPVYVNAKQYHGILRRRQ RAKAELE K +K RKPYLHESRH+HA+RRAR  GGR
Sbjct  169  EMT-EEPVYVNAKQYHGILRRRQSRAKAELEKKAIKVRKPYLHESRHQHALRRARGCGGR  227

Query  802  FVNKKK  819
            F+N KK
Sbjct  228  FLNTKK  233



>ref|XP_010909039.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010909040.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010909041.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010909042.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010909043.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010909044.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
Length=344

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV--  603
            V S    M P +  P T+ +L G SI CA Y Y++P     +   G +++VH    G+  
Sbjct  103  VSSTMPPMMPEYLAPHTQLEL-GQSIACATYSYSDPYLSRVMAPYGTQALVHPQLLGMPY  161

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LPLE+T EEPVYVNAKQYHGILRRRQ RAKAELE KV+K RKPYLHESRH HAMRR
Sbjct  162  TRMPLPLEMT-EEPVYVNAKQYHGILRRRQSRAKAELEKKVIKVRKPYLHESRHLHAMRR  220

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  221  ARGCGGRFLNTKK  233



>ref|XP_011093323.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Sesamum 
indicum]
 ref|XP_011093324.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Sesamum 
indicum]
Length=310

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQ--SAQGVRMV  612
            +   N      H    ++ +L+GHSI   PYPY +P + G     + VH        RM 
Sbjct  77   LNGSNNGQEKQHLDANSQMELVGHSIMLTPYPYEDPQYGGRLTYGATVHHLLGYHPARMP  136

Query  613  LPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDG  792
            LPLE+  EEPVYVNAKQY GILRRRQ+RA+AEL+ K+VKNRKPYLHESRH+HA+RRAR  
Sbjct  137  LPLEME-EEPVYVNAKQYRGILRRRQMRARAELDKKLVKNRKPYLHESRHQHAIRRARGS  195

Query  793  GGRFVNKKK  819
            GGRF+N KK
Sbjct  196  GGRFLNTKK  204



>ref|XP_006838331.1| hypothetical protein AMTR_s00103p00144230 [Amborella trichopoda]
 gb|ERN00900.1| hypothetical protein AMTR_s00103p00144230 [Amborella trichopoda]
Length=350

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 7/112 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQ  663
            +G SI  APYPY++P + G   A G +++VH    G+   RM LPLE+T EEPVYVNAKQ
Sbjct  130  LGPSIARAPYPYSDPYYGGIMTAYGTQALVHPHLLGLHQSRMPLPLEMT-EEPVYVNAKQ  188

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            YHGILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  189  YHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHAMRRARGCGGRFLNTKK  240



>tpg|DAA50808.1| TPA: hypothetical protein ZEAMMB73_727067 [Zea mays]
Length=255

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  445  SENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---R  606
            S+  A++P +  P ++ +L   SI  A Y Y +P + G     G  +V H    G+   R
Sbjct  107  SQIPALAPEYLAPYSQLEL-NQSIASAAYQYPDPYYAGMVAPYGSHAVAHFQLPGLTQSR  165

Query  607  MVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRAR  786
            M LPLEV+ EEPVYVNAKQYHGILRRRQ RAKAELE KVVK RKPYLHESRH+HAMRRAR
Sbjct  166  MPLPLEVS-EEPVYVNAKQYHGILRRRQSRAKAELEKKVVKARKPYLHESRHQHAMRRAR  224

Query  787  DGGGRFVNKKK  819
              GGRF+N KK
Sbjct  225  GNGGRFLNTKK  235



>ref|XP_008790800.1| PREDICTED: nuclear transcription factor Y subunit A-1 isoform 
X2 [Phoenix dactylifera]
Length=314

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV--  603
            V S    M P +  P T+ +L G SI C  Y Y++P F   +   G +++VH    G+  
Sbjct  103  VSSAMPPMMPEYLAPHTQLEL-GQSIACPTYSYSDPYFSRIMAPYGTQALVHPQLLGMPY  161

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LPLE+  EEPVYVNAKQYHGILRRRQ RAKAELE KV+K RKPYLHESRH HAMRR
Sbjct  162  TRMPLPLEMA-EEPVYVNAKQYHGILRRRQSRAKAELEKKVIKVRKPYLHESRHLHAMRR  220

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  221  ARGCGGRFLNTKK  233



>ref|XP_002278849.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Vitis 
vinifera]
 ref|XP_010659347.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Vitis 
vinifera]
Length=346

 Score =   140 bits (353),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 89/122 (73%), Gaps = 7/122 (6%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P ++ +L+GHSI    YPY +P  +G   + G +++VH    G+   RM LPLE+  
Sbjct  116  HLEPNSQMELVGHSIVLTSYPYQDPHNVGIMTSYGPQAMVHPHLFGMHQPRMPLPLEME-  174

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N 
Sbjct  175  EEPVYVNAKQYHGILRRRQSRAKAELEKKAIKVRKPYLHESRHQHAMRRARGCGGRFLNT  234

Query  814  KK  819
            KK
Sbjct  235  KK  236



>ref|XP_008790783.1| PREDICTED: nuclear transcription factor Y subunit A-1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008790792.1| PREDICTED: nuclear transcription factor Y subunit A-1 isoform 
X1 [Phoenix dactylifera]
Length=343

 Score =   140 bits (352),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV--  603
            V S    M P +  P T+ +L G SI C  Y Y++P F   +   G +++VH    G+  
Sbjct  103  VSSAMPPMMPEYLAPHTQLEL-GQSIACPTYSYSDPYFSRIMAPYGTQALVHPQLLGMPY  161

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LPLE+  EEPVYVNAKQYHGILRRRQ RAKAELE KV+K RKPYLHESRH HAMRR
Sbjct  162  TRMPLPLEMA-EEPVYVNAKQYHGILRRRQSRAKAELEKKVIKVRKPYLHESRHLHAMRR  220

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  221  ARGCGGRFLNTKK  233



>ref|NP_001149098.1| LOC100282719 [Zea mays]
 gb|ACG34194.1| nuclear transcription factor Y subunit A-1 [Zea mays]
 gb|ACN28500.1| unknown [Zea mays]
 tpg|DAA50806.1| TPA: nuclear transcription factor Y subunit A-1 [Zea mays]
 gb|AIB05784.1| CCAAT-HAP2 transcription factor, partial [Zea mays]
Length=264

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  445  SENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---R  606
            S+  A++P +  P ++ +L   SI  A Y Y +P + G     G  +V H    G+   R
Sbjct  107  SQIPALAPEYLAPYSQLEL-NQSIASAAYQYPDPYYAGMVAPYGSHAVAHFQLPGLTQSR  165

Query  607  MVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRAR  786
            M LPLEV+ EEPVYVNAKQYHGILRRRQ RAKAELE KVVK RKPYLHESRH+HAMRRAR
Sbjct  166  MPLPLEVS-EEPVYVNAKQYHGILRRRQSRAKAELEKKVVKARKPYLHESRHQHAMRRAR  224

Query  787  DGGGRFVNKKK  819
              GGRF+N KK
Sbjct  225  GNGGRFLNTKK  235



>ref|XP_010936981.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Elaeis 
guineensis]
 ref|XP_010936983.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Elaeis 
guineensis]
Length=346

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQY  666
             S  C PYPY +P+F+G   A G  +++H    G+    R+ LPLE   EEP+YVNAKQY
Sbjct  146  QSFACVPYPYADPSFVGMLAAYGPHAIIHPQMMGIAPSSRVPLPLEPAAEEPIYVNAKQY  205

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
              ILRRRQLRAK E +NK+VK RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  206  RAILRRRQLRAKMEAQNKLVKGRKPYLHESRHRHAMKRARGSGGRFLNTKQ  256



>ref|XP_008676720.1| PREDICTED: LOC100282719 isoform X1 [Zea mays]
 tpg|DAA50807.1| TPA: hypothetical protein ZEAMMB73_727067 [Zea mays]
Length=263

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  445  SENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---R  606
            S+  A++P +  P ++ +L   SI  A Y Y +P + G     G  +V H    G+   R
Sbjct  107  SQIPALAPEYLAPYSQLEL-NQSIASAAYQYPDPYYAGMVAPYGSHAVAHFQLPGLTQSR  165

Query  607  MVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRAR  786
            M LPLEV+ EEPVYVNAKQYHGILRRRQ RAKAELE KVVK RKPYLHESRH+HAMRRAR
Sbjct  166  MPLPLEVS-EEPVYVNAKQYHGILRRRQSRAKAELEKKVVKARKPYLHESRHQHAMRRAR  224

Query  787  DGGGRFVNKKK  819
              GGRF+N KK
Sbjct  225  GNGGRFLNTKK  235



>gb|KHG24923.1| Nuclear transcription factor Y subunit A-1 -like protein [Gossypium 
arboreum]
Length=294

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 88/122 (72%), Gaps = 7/122 (6%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P ++ +L+GHSI    YPY++P +   L + G + +V     G+   RM LPL++  
Sbjct  96   HHEPNSQMELVGHSIVLTSYPYSDPQYGGMLTSYGPQMMVSPHLYGMHHARMPLPLQME-  154

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ+RAKAELE K +K RKPYLHESRH HAMRRAR  GGRF+N 
Sbjct  155  EEPVYVNAKQYHGILRRRQIRAKAELEKKAIKVRKPYLHESRHLHAMRRARGCGGRFLNT  214

Query  814  KK  819
            KK
Sbjct  215  KK  216



>ref|XP_007052521.1| Nuclear transcription factor Y subunit A-1, putative isoform 
2 [Theobroma cacao]
 ref|XP_007052522.1| Nuclear transcription factor Y subunit A-1, putative isoform 
2 [Theobroma cacao]
 gb|EOX96678.1| Nuclear transcription factor Y subunit A-1, putative isoform 
2 [Theobroma cacao]
 gb|EOX96679.1| Nuclear transcription factor Y subunit A-1, putative isoform 
2 [Theobroma cacao]
Length=323

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 88/122 (72%), Gaps = 7/122 (6%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P ++ +L+GHSI    YPY++P + G   + G +++V     G+   RM LPL++  
Sbjct  96   HLEPNSQMELVGHSIVLTAYPYSDPQYSGIMTSYGPQTMVSPHLYGMHHARMPLPLQME-  154

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ+RAKAELE K  K RKPYLHESRH HAMRRAR  GGRF+N 
Sbjct  155  EEPVYVNAKQYHGILRRRQIRAKAELEKKAFKARKPYLHESRHLHAMRRARGCGGRFLNT  214

Query  814  KK  819
            KK
Sbjct  215  KK  216



>emb|CDP19036.1| unnamed protein product [Coffea canephora]
Length=286

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 84/113 (74%), Gaps = 6/113 (5%)
 Frame = +1

Query  490  EHDLMGHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVN  654
            + +L+GHSI CA  PY +P F G  A  G+ +VH     +   RM LPLE+T +EPVYVN
Sbjct  116  QFELVGHSIACASNPYADPYFAGMVATYGQPLVHPPLIDMHHARMPLPLEMT-QEPVYVN  174

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            AKQYHGILRRR+ RAKAELE K++K RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  175  AKQYHGILRRRESRAKAELEKKLIKARKPYLHESRHQHALRRARGSGGRFAKK  227



>emb|CBI24892.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 7/131 (5%)
 Frame = +1

Query  445  SENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---R  606
            S  + +   H  P ++ +L+GHSI    YPY +P  +G   + G +++VH    G+   R
Sbjct  166  SSTLPIMSEHLEPNSQMELVGHSIVLTSYPYQDPHNVGIMTSYGPQAMVHPHLFGMHQPR  225

Query  607  MVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRAR  786
            M LPLE+  EEPVYVNAKQYHGILRRRQ RAKAELE K +K RKPYLHESRH+HAMRRAR
Sbjct  226  MPLPLEME-EEPVYVNAKQYHGILRRRQSRAKAELEKKAIKVRKPYLHESRHQHAMRRAR  284

Query  787  DGGGRFVNKKK  819
              GGRF+N KK
Sbjct  285  GCGGRFLNTKK  295



>ref|XP_010557797.1| PREDICTED: nuclear transcription factor Y subunit A-7-like [Tarenaya 
hassleriana]
Length=247

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 85/117 (73%), Gaps = 7/117 (6%)
 Frame = +1

Query  487  TEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVY  648
            ++ +L+GHSI    YPY++P +   L + G   +V     GV   RM LPLE+  EEPVY
Sbjct  96   SQMELVGHSIVMMSYPYSDPQYGTMLASYGPHGLVSPQMYGVHQTRMPLPLEME-EEPVY  154

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQYHGILRRRQ RA+AELE KV+K RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  155  VNAKQYHGILRRRQSRARAELEKKVIKVRKPYLHESRHLHAMRRARGSGGRFLNTKK  211



>ref|XP_007052520.1| Nuclear transcription factor Y subunit A-1, putative isoform 
1 [Theobroma cacao]
 gb|EOX96677.1| Nuclear transcription factor Y subunit A-1, putative isoform 
1 [Theobroma cacao]
Length=343

 Score =   138 bits (348),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 88/122 (72%), Gaps = 7/122 (6%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P ++ +L+GHSI    YPY++P + G   + G +++V     G+   RM LPL++  
Sbjct  96   HLEPNSQMELVGHSIVLTAYPYSDPQYSGIMTSYGPQTMVSPHLYGMHHARMPLPLQME-  154

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ+RAKAELE K  K RKPYLHESRH HAMRRAR  GGRF+N 
Sbjct  155  EEPVYVNAKQYHGILRRRQIRAKAELEKKAFKARKPYLHESRHLHAMRRARGCGGRFLNT  214

Query  814  KK  819
            KK
Sbjct  215  KK  216



>gb|AHX56184.1| NFYA4 [Larix kaempferi]
Length=354

 Score =   139 bits (349),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 91/135 (67%), Gaps = 13/135 (10%)
 Frame = +1

Query  430  NCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQG  600
            NC   SE          P  + +L  HSI  A YPYTEP F G   A G ++++H    G
Sbjct  106  NCSAPSECFV-------PQNQQEL-DHSIARANYPYTEPYFGGIFAAYGAQTMIHPHVLG  157

Query  601  VRMV-LPLEVTTEE-PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAM  774
            V+   +PL++ TEE PVYVNAKQY+GILRRRQLRAKAE E KV+K RKPYLHESRH HAM
Sbjct  158  VQQARMPLQIETEEEPVYVNAKQYYGILRRRQLRAKAESEKKVIKVRKPYLHESRHLHAM  217

Query  775  RRARDGGGRFVNKKK  819
            RRAR  GGRF+N KK
Sbjct  218  RRARGCGGRFLNTKK  232



>ref|XP_001760371.1| predicted protein [Physcomitrella patens]
 gb|EDQ74762.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = +1

Query  481  PATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEP  642
            P T+ +L GHS+  A YP+ +P F G   A G ++V+H    GV   RM LP E+  EEP
Sbjct  132  PHTQLEL-GHSMARAAYPFADPYFGGIVAAYGAQAVIHPHMLGVQQARMPLPSEMMEEEP  190

Query  643  VYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            VYVNAKQYHGILRRRQ RAKAE ENK++K+RKPYLHESRH+HA+RRAR  GGRF+N K
Sbjct  191  VYVNAKQYHGILRRRQSRAKAESENKLIKSRKPYLHESRHQHALRRARGNGGRFLNTK  248



>ref|XP_004982099.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
X3 [Setaria italica]
Length=259

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQ  663
            +  SI  A Y Y +P + G     G ++V H    G+   RM LPLEV+ EEPVYVNAKQ
Sbjct  120  LNQSIASAAYQYPDPYYTGMVPPYGTQAVAHFQLPGLAHSRMPLPLEVS-EEPVYVNAKQ  178

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            YHGILRRRQ RAKAELE KVVK RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  179  YHGILRRRQSRAKAELEKKVVKTRKPYLHESRHQHAMRRARGNGGRFLNTKK  230



>ref|XP_011090024.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011090025.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
Length=316

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 97/143 (68%), Gaps = 14/143 (10%)
 Frame = +1

Query  421  SDKNCKVESENV--AMSPHHSRP------ATEHDLMGHSIQCAPYPYTEPAFLG--AAGG  570
            SD+N + E+ N+   +   H RP        + +L+GHSI CA  PY +P F G  AA G
Sbjct  85   SDRNHRPENTNLEKGVPTLHPRPDGSLSQPPQLELVGHSIACAANPY-DPYFGGVVAAYG  143

Query  571  ESVVHQ--SAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPY  744
            + +V        +RM LPLE+  +EPVYVNAKQYHGILRRRQ+RAKAELE K++K RKPY
Sbjct  144  QPMVPHLYDMNQMRMPLPLEMA-QEPVYVNAKQYHGILRRRQIRAKAELEKKLIKARKPY  202

Query  745  LHESRHKHAMRRARDGGGRFVNK  813
            LHESRH+HAMRRAR  GGRF  K
Sbjct  203  LHESRHQHAMRRARGSGGRFAKK  225



>ref|XP_004982097.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
X1 [Setaria italica]
 ref|XP_004982098.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
X2 [Setaria italica]
Length=266

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQ  663
            +  SI  A Y Y +P + G     G ++V H    G+   RM LPLEV+ EEPVYVNAKQ
Sbjct  120  LNQSIASAAYQYPDPYYTGMVPPYGTQAVAHFQLPGLAHSRMPLPLEVS-EEPVYVNAKQ  178

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            YHGILRRRQ RAKAELE KVVK RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  179  YHGILRRRQSRAKAELEKKVVKTRKPYLHESRHQHAMRRARGNGGRFLNTKK  230



>ref|XP_006379095.1| hypothetical protein POPTR_0009s06540g [Populus trichocarpa]
 gb|ERP56892.1| hypothetical protein POPTR_0009s06540g [Populus trichocarpa]
Length=307

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQ--SAQGVRMVLPLEVTTE  636
            H  P ++ +L+GHSI    +PYT+P + G   + G +++V Q       RM LPLE+  E
Sbjct  112  HLEPNSQMELVGHSIVLTSHPYTDPQYGGMFASYGAQAMVPQLYGMPHARMPLPLEME-E  170

Query  637  EPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            EPVYVNAKQ+HGI+RRRQ RAKAELE K VK RKPYLHESRH+HA+RRAR  GGRF+N K
Sbjct  171  EPVYVNAKQFHGIMRRRQARAKAELEKKAVKVRKPYLHESRHQHALRRARGCGGRFLNTK  230

Query  817  K  819
            K
Sbjct  231  K  231



>gb|AEL95437.1| CCAAT-binding transcription factor subunit B [Populus euphratica]
Length=377

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 6/121 (5%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEP---AFLGAAGGESVVHQ--SAQGVRMVLPLEVTTE  636
            H  P ++ +L+GHSI    +PYT+P       + G +++V Q       RM LPLE+  E
Sbjct  111  HLEPNSQMELVGHSIVLTSHPYTDPQHGGMFASYGAQAMVPQLYGMPQARMPLPLEME-E  169

Query  637  EPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            EPVYVNAKQ+HGI+RRRQ RAKAELE K VK RKPYLHESRH+HAMRRAR  GGRF+N K
Sbjct  170  EPVYVNAKQFHGIMRRRQARAKAELEKKAVKVRKPYLHESRHQHAMRRARGCGGRFLNTK  229

Query  817  K  819
            K
Sbjct  230  K  230



>emb|CBI16364.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + +VH    G+   RM LPLE+T ++PVYVN 
Sbjct  84   ELVGHSIACASNPYQDPYYGGMMTAYGPQPLVHPHLLGMHEARMPLPLEMT-QDPVYVNP  142

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQYHGILRRRQ RAKAELE K++K RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  143  KQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHALRRARSSGGRFAKK  194



>dbj|BAJ85335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=273

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQ  663
            +   +  APYPY +  +   +G  G ++V H    G+   RM LPLEV+ EEPVYVNAKQ
Sbjct  130  LSQPMASAPYPYPDAYYAGMVGPYGAQAVAHFQLPGLTHSRMPLPLEVS-EEPVYVNAKQ  188

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            YHGILRRRQ RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  189  YHGILRRRQSRAKAELERKAIKARKPYLHESRHQHAMRRARGTGGRFLNTKK  240



>ref|XP_002282778.2| PREDICTED: nuclear transcription factor Y subunit A-1 [Vitis 
vinifera]
Length=345

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + +VH    G+   RM LPLE+T ++PVYVN 
Sbjct  123  ELVGHSIACASNPYQDPYYGGMMTAYGPQPLVHPHLLGMHEARMPLPLEMT-QDPVYVNP  181

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQYHGILRRRQ RAKAELE K++K RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  182  KQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHALRRARSSGGRFAKK  233



>ref|XP_010939931.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010939932.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010939933.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X1 [Elaeis guineensis]
Length=352

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 78/112 (70%), Gaps = 7/112 (6%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQ  663
            G S  C PY Y +P+F   L A G  +++H    GV    R+ LPLE   EEP+YVNAKQ
Sbjct  148  GQSFACVPYTYADPSFGGVLAAYGSPAIIHPQMVGVPPSSRVPLPLEPAAEEPIYVNAKQ  207

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            Y  ILRRRQLRAK E +NK++K RKPYLHESRH HAM+RAR  GGRF+N K+
Sbjct  208  YRAILRRRQLRAKLEAQNKLIKARKPYLHESRHLHAMKRARGSGGRFLNTKQ  259



>ref|XP_009767409.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Nicotiana sylvestris]
Length=270

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 103/145 (71%), Gaps = 14/145 (10%)
 Frame = +1

Query  424  DKNCKVESENVAMSP----HHSRPATEHDLMGHSIQCAPYPYTE-PAFLG----AAGGES  576
            D +CK E ++V   P     + + A + +LM  SI    YPY+E P + G    AA GES
Sbjct  32   DSDCKREGKHVEFMPPIMGENLKAANQFELMAPSIAFKSYPYSEVPQYSGGNVAAACGES  91

Query  577  VVHQ----SAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPY  744
            +VHQ    S    RM+LP+EV  EEP+YVNAKQYHGILRRRQLRAKA LE KVVK+RKPY
Sbjct  92   LVHQNIERSVHNGRMILPIEVK-EEPMYVNAKQYHGILRRRQLRAKAVLEQKVVKSRKPY  150

Query  745  LHESRHKHAMRRARDGGGRFVNKKK  819
            LHESRH+HAMRRARDGGGRF+N KK
Sbjct  151  LHESRHRHAMRRARDGGGRFLNTKK  175



>ref|XP_002313307.2| hypothetical protein POPTR_0009s06540g [Populus trichocarpa]
 gb|EEE87262.2| hypothetical protein POPTR_0009s06540g [Populus trichocarpa]
Length=377

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQ--SAQGVRMVLPLEVTTE  636
            H  P ++ +L+GHSI    +PYT+P + G   + G +++V Q       RM LPLE+  E
Sbjct  112  HLEPNSQMELVGHSIVLTSHPYTDPQYGGMFASYGAQAMVPQLYGMPHARMPLPLEME-E  170

Query  637  EPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            EPVYVNAKQ+HGI+RRRQ RAKAELE K VK RKPYLHESRH+HA+RRAR  GGRF+N K
Sbjct  171  EPVYVNAKQFHGIMRRRQARAKAELEKKAVKVRKPYLHESRHQHALRRARGCGGRFLNTK  230

Query  817  K  819
            K
Sbjct  231  K  231



>ref|XP_011090023.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Sesamum indicum]
Length=365

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 97/143 (68%), Gaps = 14/143 (10%)
 Frame = +1

Query  421  SDKNCKVESENV--AMSPHHSRP------ATEHDLMGHSIQCAPYPYTEPAFLG--AAGG  570
            SD+N + E+ N+   +   H RP        + +L+GHSI CA  PY +P F G  AA G
Sbjct  134  SDRNHRPENTNLEKGVPTLHPRPDGSLSQPPQLELVGHSIACAANPY-DPYFGGVVAAYG  192

Query  571  ESVVHQ--SAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPY  744
            + +V        +RM LPLE+  +EPVYVNAKQYHGILRRRQ+RAKAELE K++K RKPY
Sbjct  193  QPMVPHLYDMNQMRMPLPLEMA-QEPVYVNAKQYHGILRRRQIRAKAELEKKLIKARKPY  251

Query  745  LHESRHKHAMRRARDGGGRFVNK  813
            LHESRH+HAMRRAR  GGRF  K
Sbjct  252  LHESRHQHAMRRARGSGGRFAKK  274



>ref|XP_004158189.1| PREDICTED: nuclear transcription factor Y subunit A-9-like [Cucumis 
sativus]
Length=318

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 99/153 (65%), Gaps = 14/153 (9%)
 Frame = +1

Query  400  GFTELHTSDKNCKVESENVAMSPHH-SRPATEH-------DLMGHSIQCAPYPYTEPAF-  552
            G T+   +D+N   E +++   P   S P  EH       +L+GHSI    YP+++  + 
Sbjct  60   GATQPQANDENIGKEVQHLKYIPFSTSPPVGEHLDLNSQMELVGHSIVLTSYPFSDAQYC  119

Query  553  --LGAAGGESVVHQ--SAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENK  720
              L + G ++ + +       RM LPLE+  EEPVYVNAKQYHGILRRRQ RAKAELE K
Sbjct  120  QMLTSYGPQATLPRIYGLHHARMPLPLEME-EEPVYVNAKQYHGILRRRQSRAKAELEKK  178

Query  721  VVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            V+K+RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  179  VIKSRKPYLHESRHLHAMRRARGSGGRFLNTKK  211



>ref|XP_004135933.1| PREDICTED: nuclear transcription factor Y subunit A-9-like [Cucumis 
sativus]
 gb|KGN45125.1| hypothetical protein Csa_7G428130 [Cucumis sativus]
Length=318

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 99/153 (65%), Gaps = 14/153 (9%)
 Frame = +1

Query  400  GFTELHTSDKNCKVESENVAMSPHH-SRPATEH-------DLMGHSIQCAPYPYTEPAF-  552
            G T+   +D+N   E +++   P   S P  EH       +L+GHSI    YP+++  + 
Sbjct  60   GATQPQANDENIGKEVQHLKYIPFSTSPPVGEHLDLNSQMELVGHSIVLTSYPFSDAQYC  119

Query  553  --LGAAGGESVVHQ--SAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENK  720
              L + G ++ + +       RM LPLE+  EEPVYVNAKQYHGILRRRQ RAKAELE K
Sbjct  120  QMLTSYGPQATLPRIYGLHHARMPLPLEME-EEPVYVNAKQYHGILRRRQSRAKAELEKK  178

Query  721  VVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            V+K+RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  179  VIKSRKPYLHESRHLHAMRRARGSGGRFLNTKK  211



>gb|KDO83424.1| hypothetical protein CISIN_1g019764mg [Citrus sinensis]
Length=255

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 7/117 (6%)
 Frame = +1

Query  487  TEHDLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQSAQGV---RMVLPLEVTTEEPVY  648
            ++ +L+GHSI    YPYT+P  +G       ++++     G+   RM LPLE+  EEPVY
Sbjct  43   SQMELVGHSIVLTSYPYTDPQHVGVITPYVPQAMIPPQLYGMHQARMPLPLEME-EEPVY  101

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQY GILRRRQ RAKAELE KV+K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  102  VNAKQYRGILRRRQSRAKAELEKKVIKARKPYLHESRHQHAMRRARGCGGRFLNTKK  158



>ref|XP_008449707.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Cucumis melo]
 ref|XP_008449708.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Cucumis melo]
 ref|XP_008449709.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Cucumis melo]
Length=341

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 6/113 (5%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAK  660
            +L+GHSI CA  PY +P + G  AA G    +    G+   RM LPLEVT +EPV+VNAK
Sbjct  117  ELVGHSIACASNPYQDPYYAGVMAAYGHQPGYPPFLGMPHARMALPLEVT-QEPVFVNAK  175

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QY GILRRRQ RAKAE+ENK++K RKPYLHESRH+HAMRRAR  GGRF  K +
Sbjct  176  QYQGILRRRQARAKAEVENKLIKVRKPYLHESRHQHAMRRARGSGGRFAKKNE  228



>ref|XP_004143236.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Cucumis 
sativus]
 ref|XP_004156306.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Cucumis 
sativus]
 gb|KGN48130.1| hypothetical protein Csa_6G439960 [Cucumis sativus]
Length=341

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 6/113 (5%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAK  660
            +L+GHSI CA  PY +P + G  AA G    +    G+   RM LPLEVT +EPV+VNAK
Sbjct  117  ELVGHSIACASNPYQDPYYAGVMAAYGHQPGYPPFLGMPHARMALPLEVT-QEPVFVNAK  175

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QY GILRRRQ RAKAE+ENK++K RKPYLHESRH+HAMRRAR  GGRF  K +
Sbjct  176  QYQGILRRRQARAKAEVENKLIKVRKPYLHESRHQHAMRRARGSGGRFAKKNE  228



>ref|XP_010695208.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Beta 
vulgaris subsp. vulgaris]
Length=338

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 83/121 (69%), Gaps = 16/121 (13%)
 Frame = +1

Query  490  EHDLMGHSIQCAPYPYTEPAFLGAAGGESV-----------VHQSAQGVRMVLPLEVTTE  636
            + +L+GHSI    YP+ +P + GA     V           +HQS    RM LPL +  E
Sbjct  119  QMELVGHSIVMTSYPFQDPTYGGAMAYAQVQQVNPQMYGFQLHQS----RMPLPLAME-E  173

Query  637  EPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            EPVYVNAKQYHGILRRRQ RAKAELE KV+K+RKPYLHESRH HA+RRAR  GGRF+N K
Sbjct  174  EPVYVNAKQYHGILRRRQSRAKAELEKKVIKSRKPYLHESRHLHALRRARGSGGRFLNAK  233

Query  817  K  819
            K
Sbjct  234  K  234



>ref|XP_002965605.1| hypothetical protein SELMODRAFT_38090, partial [Selaginella moellendorffii]
 gb|EFJ33025.1| hypothetical protein SELMODRAFT_38090, partial [Selaginella moellendorffii]
Length=121

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 76/103 (74%), Gaps = 7/103 (7%)
 Frame = +1

Query  529  YPYTEPAFLG----AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY++P F G    A  G+ +V     G+   RM LP E+  EEPVYVNAKQYHGILRRR
Sbjct  2    YPYSDPFFGGMMAAAYAGQGLVQPHVLGLQQARMPLPTEILEEEPVYVNAKQYHGILRRR  61

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            Q RAKAE EN+++K RKPYLHESRH HA+RRAR  GGRF+NKK
Sbjct  62   QSRAKAESENRLIKTRKPYLHESRHLHALRRARGCGGRFLNKK  104



>ref|XP_008346932.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Malus 
domestica]
Length=309

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 7/133 (5%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV--  603
            V S  V     H  P ++ +L+GHSI  + YPY++P + G     G ++++     G+  
Sbjct  95   VSSSVVPALGEHVDPNSQMELVGHSIVMSSYPYSDPQYGGMLTPYGPQAMLPPHFYGMHP  154

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LPL++  EEPVYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH HA+RR
Sbjct  155  GRMPLPLDME-EEPVYVNAKQYHGILRRRQSRAKAELEKKLIKARKPYLHESRHLHALRR  213

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  214  ARGCGGRFLNTKK  226



>ref|XP_008461297.1| PREDICTED: nuclear transcription factor Y subunit A-9-like [Cucumis 
melo]
 ref|XP_008461299.1| PREDICTED: nuclear transcription factor Y subunit A-9-like [Cucumis 
melo]
Length=318

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 99/153 (65%), Gaps = 14/153 (9%)
 Frame = +1

Query  400  GFTELHTSDKNCKVESENVAMSPHH-SRPATEH-------DLMGHSIQCAPYPYTEPAF-  552
            G T+   +D+N   E +++   P   S P  EH       +L+GHSI    YP+++  + 
Sbjct  60   GATQPQANDENIGKEVQHLKYIPFSTSPPVGEHLDLNSQMELVGHSIVLTSYPFSDAQYC  119

Query  553  --LGAAGGESVVHQ--SAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENK  720
              L + G ++ + +       RM LPLE+  EEPVYVNAKQYHGILRRRQ RAKAELE K
Sbjct  120  QMLTSYGPQATLPRIYGLHHARMPLPLEME-EEPVYVNAKQYHGILRRRQSRAKAELEKK  178

Query  721  VVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            V+K+RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  179  VIKSRKPYLHESRHLHAMRRARGSGGRFLNTKK  211



>ref|XP_009354754.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Pyrus 
x bretschneideri]
Length=326

 Score =   134 bits (338),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 7/133 (5%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV--  603
            V S  V     H  P ++ +L+GHSI  + YPY++P + G     G ++++     G+  
Sbjct  95   VSSSVVPALGEHVDPNSQMELVGHSIVMSSYPYSDPQYGGILTPYGPQAMLPPHFYGMHP  154

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LPL++  EEPVYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH HA+RR
Sbjct  155  GRMPLPLDME-EEPVYVNAKQYHGILRRRQSRAKAELEKKLIKARKPYLHESRHLHALRR  213

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  214  ARGCGGRFLNTKK  226



>gb|EMS57870.1| Nuclear transcription factor Y subunit A-1 [Triticum urartu]
Length=231

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 92/138 (67%), Gaps = 8/138 (6%)
 Frame = +1

Query  424  DKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSA  594
            ++N +  S   A++  +  P + H  +   +  A YPY +  +   +G  G ++V H   
Sbjct  78   EENQRATSRMPALATDYLAPYS-HLELNQPMASATYPYPDAYYTGMVGPYGAQAVAHFQL  136

Query  595  QGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHK  765
             G+   RM LPLEV+ EEPVYVNAKQYHGILRRRQ RAKAELE K +K RKPYLHESRH+
Sbjct  137  PGLTHPRMPLPLEVS-EEPVYVNAKQYHGILRRRQSRAKAELERKAIKARKPYLHESRHQ  195

Query  766  HAMRRARDGGGRFVNKKK  819
            HAMRRAR  GGRF+N KK
Sbjct  196  HAMRRARGTGGRFLNTKK  213



>ref|XP_009632036.1| PREDICTED: nuclear transcription factor Y subunit A-7-like [Nicotiana 
tomentosiformis]
Length=243

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 102/146 (70%), Gaps = 14/146 (10%)
 Frame = +1

Query  421  SDKNCKVESENVAMSP----HHSRPATEHDLMGHSIQCAPYPYTE-PAFLG----AAGGE  573
            +D +CK + + V   P     + R A + +LM  SI    YPY+E P + G    AA GE
Sbjct  7    ADSDCKRDGKRVEFMPPIMGENLRAANQFELMPPSIAFRSYPYSEVPQYSGGNVAAAFGE  66

Query  574  SVVHQ----SAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKP  741
            S VHQ    S    RM+LPLEV  EEP+YVNAKQYHGILRRRQLRAKA LE KVVK+RKP
Sbjct  67   STVHQNIERSVHNGRMILPLEVK-EEPMYVNAKQYHGILRRRQLRAKAVLEQKVVKSRKP  125

Query  742  YLHESRHKHAMRRARDGGGRFVNKKK  819
            YLHESRH+HAMRRARDGGGRF+N KK
Sbjct  126  YLHESRHRHAMRRARDGGGRFLNTKK  151



>gb|KDO83422.1| hypothetical protein CISIN_1g019764mg [Citrus sinensis]
 gb|KDO83423.1| hypothetical protein CISIN_1g019764mg [Citrus sinensis]
Length=307

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 7/117 (6%)
 Frame = +1

Query  487  TEHDLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQSAQGV---RMVLPLEVTTEEPVY  648
            ++ +L+GHSI    YPYT+P  +G       ++++     G+   RM LPLE+  EEPVY
Sbjct  95   SQMELVGHSIVLTSYPYTDPQHVGVITPYVPQAMIPPQLYGMHQARMPLPLEME-EEPVY  153

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQY GILRRRQ RAKAELE KV+K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  154  VNAKQYRGILRRRQSRAKAELEKKVIKARKPYLHESRHQHAMRRARGCGGRFLNTKK  210



>ref|XP_003560983.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Brachypodium 
distachyon]
 ref|XP_010231277.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Brachypodium 
distachyon]
 ref|XP_010231280.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Brachypodium 
distachyon]
Length=262

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQ  663
            +   I  A YPY +  +   +G  G ++V H    G+   RM LPLE++ EEPVYVNAKQ
Sbjct  119  LNQPIASATYPYPDAYYTGMVGPYGAQAVTHFQLPGLTQSRMPLPLEIS-EEPVYVNAKQ  177

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            YHGILRRRQ RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  178  YHGILRRRQSRAKAELERKAIKARKPYLHESRHQHAMRRARGTGGRFLNTKK  229



>emb|CDX85686.1| BnaA02g01270D [Brassica napus]
Length=236

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 108/204 (53%), Gaps = 40/204 (20%)
 Frame = +1

Query  265  MVSRNPW--NNTL-----YENSSAVDPGNNATSAHMLWEDNGG-----MHHTAPEPKGFT  408
            M+  +PW  NN+       E  SA    + +   H   ED+GG        T+P P GF 
Sbjct  21   MMYPDPWWKNNSFGGVLPQERPSA----SESNDVHSPSEDDGGPCKDSQAATSPPPPGF-  75

Query  409  ELHTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQ  588
             L   D+   ++ E V   P         +L+GH I C P PY +  + G  G  +  H 
Sbjct  76   -LEGKDQTASMDDEQVVQPP---------ELVGHYIACVPNPYQDAYYGGMMG--AYGHH  123

Query  589  SAQGVR---------MVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKP  741
               G R           LPL+ TT+EPVYVNAKQY GILRRR+ RAKAELE KV+ NRKP
Sbjct  124  QPLGFRPYPGMARERTALPLD-TTQEPVYVNAKQYEGILRRRKARAKAELERKVI-NRKP  181

Query  742  YLHESRHKHAMRRARDGGGRFVNK  813
            YLHESRHKHAM+R R  GGRF  K
Sbjct  182  YLHESRHKHAMKRVRASGGRFAKK  205



>ref|XP_004291783.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=346

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 113/215 (53%), Gaps = 32/215 (15%)
 Frame = +1

Query  262  AMVSRNPWNNTLYENSSAVDPGNNATSAHMLW----------------------EDNGGM  375
            + VS  PW  T Y  +S    G N +++                          +DN   
Sbjct  21   STVSSQPWWRTGYNPTSPTVTGRNVSTSSSFEPPKSHSESSDDKSVSDDGSNEDDDNAKE  80

Query  376  HHTAPEPKGFTELHTSDKNCKVESENVAMSPHHSRPAT---EHDLMGHSIQCAPYPYTEP  546
             H      G T +   +KN  ++ ++  +   H    T   + +L+GHSI CA  PY +P
Sbjct  81   SHLTSPLSGSTLIDFGNKNQDLQLDSSTVPTVHDEGVTHPPQLELIGHSIACASNPYQDP  140

Query  547  AFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAE  708
             + G   A G + + +    G+   RM LPLE+  +EPVYVNAKQY GILRRRQ RAKAE
Sbjct  141  YYAGMMAAYGHQPLGYPPFVGMPHARMPLPLEMA-QEPVYVNAKQYQGILRRRQARAKAE  199

Query  709  LENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            LE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  200  LEKKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  234



>ref|XP_006649488.1| PREDICTED: nuclear transcription factor Y subunit A-6-like [Oryza 
brachyantha]
Length=249

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY +  + G     G  +++H    G+    R+ LP+E TTEEP+YVNAKQYH ILRRR
Sbjct  95   YPYADSYYAGTVATYGAHAIMHPQIVGMMSSSRVPLPIEPTTEEPIYVNAKQYHAILRRR  154

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QLRAK E ENK+VKNRKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  155  QLRAKLEAENKLVKNRKPYLHESRHQHAMKRARGTGGRFLNTKQ  198



>gb|ABF94257.1| CCAAT-binding transcription factor subunit B family protein, 
expressed [Oryza sativa Japonica Group]
Length=166

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY +  + GA    G  +++H    GV    R+ LP+E  TEEP+YVNAKQYH ILRRR
Sbjct  22   YPYADSFYGGAVATYGTHAIMHPQIVGVMSSSRVPLPIEPATEEPIYVNAKQYHAILRRR  81

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QLRAK E ENK+VKNRKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  82   QLRAKLEAENKLVKNRKPYLHESRHQHAMKRARGTGGRFLNTKQ  125



>gb|AAO19379.1| putative CCAAT-binding transcription factor [Oryza sativa Japonica 
Group]
Length=255

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  445  SENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQSAQGV---R  606
            S+  A++  +  P ++ +L    I  A Y Y +  ++G  G    +++ H    G+   R
Sbjct  92   SQMTALASDYLTPFSQLEL-NQPIASAAYQYPDSYYMGMVGPYGPQAMTHFQLPGLTHSR  150

Query  607  MVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRAR  786
            M LPLE++ EEPVYVNAKQYHGILRRRQ RAKAELE KVVK+RKPYLHESRH+HAMRRAR
Sbjct  151  MPLPLEIS-EEPVYVNAKQYHGILRRRQSRAKAELEKKVVKSRKPYLHESRHQHAMRRAR  209

Query  787  DGGGRFVNKKK  819
              GGRF+N KK
Sbjct  210  GTGGRFLNTKK  220



>emb|CAA71844.1| RAPB protein [Oryza sativa Indica Group]
Length=238

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY +  + GA    G  +++H    GV    R+ LP+E  TEEP+YVNAKQYH ILRRR
Sbjct  95   YPYADSFYGGAVATYGTHAIMHPQIVGVMSSSRVPLPIEPATEEPIYVNAKQYHAILRRR  154

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QLRAK E ENK+VKNRKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  155  QLRAKLEAENKLVKNRKPYLHESRHQHAMKRARGTGGRFLNTKQ  198



>gb|ABF94256.1| CCAAT-binding transcription factor subunit B family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF64437.1| HAP2 subunit of HAP complex [Oryza sativa Japonica Group]
 dbj|BAG91394.1| unnamed protein product [Oryza sativa Japonica Group]
Length=209

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY +  + GA    G  +++H    GV    R+ LP+E  TEEP+YVNAKQYH ILRRR
Sbjct  65   YPYADSFYGGAVATYGTHAIMHPQIVGVMSSSRVPLPIEPATEEPIYVNAKQYHAILRRR  124

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QLRAK E ENK+VKNRKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  125  QLRAKLEAENKLVKNRKPYLHESRHQHAMKRARGTGGRFLNTKQ  168



>ref|NP_001049132.1| Os03g0174900 [Oryza sativa Japonica Group]
 gb|ABF94255.1| CCAAT-binding transcription factor subunit B family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11046.1| Os03g0174900 [Oryza sativa Japonica Group]
 gb|EAY88749.1| hypothetical protein OsI_10223 [Oryza sativa Indica Group]
 gb|EAZ25777.1| hypothetical protein OsJ_09616 [Oryza sativa Japonica Group]
 gb|ACJ54909.1| CCAAT-binding transcription factor [Oryza sativa Japonica Group]
Length=239

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY +  + GA    G  +++H    GV    R+ LP+E  TEEP+YVNAKQYH ILRRR
Sbjct  95   YPYADSFYGGAVATYGTHAIMHPQIVGVMSSSRVPLPIEPATEEPIYVNAKQYHAILRRR  154

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QLRAK E ENK+VKNRKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  155  QLRAKLEAENKLVKNRKPYLHESRHQHAMKRARGTGGRFLNTKQ  198



>ref|XP_008787861.1| PREDICTED: nuclear transcription factor Y subunit A-6-like [Phoenix 
dactylifera]
Length=351

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 77/111 (69%), Gaps = 7/111 (6%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQ  663
            G S  C PY Y +P+F   L A G  +++H    G+    R+ LPLE   EEP+YVNAKQ
Sbjct  148  GQSFACVPYTYADPSFGGVLAAYGSPAIIHPQMVGMAPCSRVPLPLEPAAEEPIYVNAKQ  207

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            Y  ILRRRQLRAK E +NK++K RKPYLHESRH HAM+RAR  GGRF+N K
Sbjct  208  YRAILRRRQLRAKLEAQNKLIKVRKPYLHESRHLHAMKRARGSGGRFLNTK  258



>ref|XP_010261977.1| PREDICTED: nuclear transcription factor Y subunit A-4-like isoform 
X2 [Nelumbo nucifera]
Length=244

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = +1

Query  508  HSIQCAPYPYTEP---AFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYH  669
             S+   PYPY EP    +L A G ++V+H    G+   R+ LPL+VT +EP+YVNAKQY 
Sbjct  40   QSMARIPYPYAEPYMNGYLAAYGPQAVIHPQMIGMVPARVPLPLDVTDDEPIYVNAKQYR  99

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            GILRRRQ RAK E +NK+ K RKPYLHESRH HA+RRAR  GGRF++ KK
Sbjct  100  GILRRRQSRAKLEAQNKLAKGRKPYLHESRHLHALRRARGSGGRFLDTKK  149



>ref|XP_008798898.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Phoenix 
dactylifera]
Length=338

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 77/107 (72%), Gaps = 7/107 (7%)
 Frame = +1

Query  511  SIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYH  669
            +  C PYPY +P+F+G   A G  +++H    G+    R+ LPLE   EEP+YVNAKQY 
Sbjct  136  AFACVPYPYADPSFVGMLAAYGSHAIIHPQMMGMAPSSRVPLPLEPAAEEPIYVNAKQYR  195

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVN  810
             ILRRRQLRAK E +NK+VK RKPYLHESRH HAM+RAR  GGRF+N
Sbjct  196  AILRRRQLRAKLEAQNKLVKVRKPYLHESRHLHAMKRARGSGGRFLN  242



>ref|XP_002299939.2| hypothetical protein POPTR_0001s27300g [Populus trichocarpa]
 gb|EEE84744.2| hypothetical protein POPTR_0001s27300g [Populus trichocarpa]
Length=313

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 6/121 (5%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQ--SAQGVRMVLPLEVTTE  636
            H  P ++ +L+GHSI    +PYT+P + G       +++V Q       RM LPLE+  E
Sbjct  111  HLEPNSQMELVGHSIVLTSHPYTDPQYGGIFASYRPQAMVPQFYGMTHARMPLPLEME-E  169

Query  637  EPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            EPVYVNAKQ++GI+RRRQ RAKAELE K VK RKPYLHESRH+HAMRRAR  GGRF+N K
Sbjct  170  EPVYVNAKQFNGIMRRRQARAKAELEKKAVKVRKPYLHESRHQHAMRRARGCGGRFLNTK  229

Query  817  K  819
            K
Sbjct  230  K  230



>ref|XP_006288441.1| hypothetical protein CARUB_v10001701mg [Capsella rubella]
 gb|EOA21339.1| hypothetical protein CARUB_v10001701mg [Capsella rubella]
Length=272

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 120/213 (56%), Gaps = 30/213 (14%)
 Frame = +1

Query  259  QAMVSRNPW--NNT-----------LYENSSAVD---PGNNATSAHMLWED---NGGMHH  381
            Q M+   PW  NN+           +  NSS++D    G+ +   H   ED   NG    
Sbjct  20   QPMMYPEPWWKNNSFGVSPHARPSGIPSNSSSLDCPNGGSESNDVHSASEDGALNGENDA  79

Query  382  TAPEPKGFTELHTSDKNCKVESENVAMS---PHHSRPATEHDLMGHSIQCAPYPYTEPAF  552
            T  + +  T   + D N  +E  + A+S    H  +     +L+GH I C P PY +P +
Sbjct  80   TWKDSQAATSSRSVD-NHGMEGNDPALSMRNLHDQQLVQPPELVGHYIACVPNPYQDPYY  138

Query  553  ---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELE  714
               +GA G + +  +   G+   R  LPL++T +EPVYVNAKQY GILRRR+ RAKAELE
Sbjct  139  GGMMGAYGHQPLGFRPYLGMPRERTALPLDMT-QEPVYVNAKQYEGILRRRKARAKAELE  197

Query  715  NKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
             KV+++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  198  RKVIRDRKPYLHESRHKHAMRRARASGGRFAKK  230



>ref|NP_568282.1| nuclear transcription factor Y subunit A-1 [Arabidopsis thaliana]
 ref|NP_974773.1| nuclear transcription factor Y subunit A-1 [Arabidopsis thaliana]
 sp|Q9LXV5.1|NFYA1_ARATH RecName: Full=Nuclear transcription factor Y subunit A-1; Short=AtNF-YA-1; 
AltName: Full=Protein EMBRYO DEFECTIVE 2220; AltName: 
Full=Transcriptional activator HAP2A [Arabidopsis thaliana]
 emb|CAB88248.1| CCAAT box binding factor/ transcription factor Hap2a [Arabidopsis 
thaliana]
 gb|ABF83691.1| At5g12840 [Arabidopsis thaliana]
 gb|AED91817.1| nuclear transcription factor Y subunit A-1 [Arabidopsis thaliana]
 gb|AED91820.1| nuclear transcription factor Y subunit A-1 [Arabidopsis thaliana]
Length=272

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 121/212 (57%), Gaps = 29/212 (14%)
 Frame = +1

Query  259  QAMVSRNPW--NNT-----------LYENSSAVD--PGNNATSAHMLWED---NGGMHHT  384
            Q M+   PW  NN+           +  NSS++D   G+ +   H   ED   NG    T
Sbjct  21   QPMMYAEPWWKNNSFGVVPQARPSGIPSNSSSLDCPNGSESNDVHSASEDGALNGENDGT  80

Query  385  APEPKGFTELHTSDKNCKVESENVAMSPH--HSRPATEH-DLMGHSIQCAPYPYTEPAF-  552
              + +  T   + D N  +E  + A+S    H +P  +  +L+GH I C P PY +P + 
Sbjct  81   WKDSQAATSSRSVD-NHGMEGNDPALSIRNMHDQPLVQPPELVGHYIACVPNPYQDPYYG  139

Query  553  --LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELEN  717
              +GA G + +  +   G+   R  LPL++  +EPVYVNAKQY GILRRR+ RAKAELE 
Sbjct  140  GLMGAYGHQQLGFRPYLGMPRERTALPLDMA-QEPVYVNAKQYEGILRRRKARAKAELER  198

Query  718  KVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KV+++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  199  KVIRDRKPYLHESRHKHAMRRARASGGRFAKK  230



>ref|XP_002873581.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49840.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=270

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 111/184 (60%), Gaps = 16/184 (9%)
 Frame = +1

Query  304  NSSAVD--PGNNATSAHMLWED---NGGMHHTAPEPKGFTELHTSDKNCKVESENVAMSP  468
            NSS++D   G+ +   H   ED   NG    T  + +  T   + D N  +E  + A+S 
Sbjct  49   NSSSLDCPNGSESNDVHSASEDGALNGENDGTWKDSQAATSSRSVD-NHGMEGNDPALSI  107

Query  469  ---HHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPL  621
               H  +     +L+GH I C P PY +P +   +GA G + +  +   G+   R  LPL
Sbjct  108  RNMHDQQLVQPPELVGHYIACVPNPYQDPYYGGMMGAYGHQPLGFRPYLGMPRERTALPL  167

Query  622  EVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGR  801
            ++T +EPVYVNAKQY GILRRR+ RAKAELE KV+++RKPYLHESRHKHAMRRAR  GGR
Sbjct  168  DMT-QEPVYVNAKQYEGILRRRKARAKAELERKVIRDRKPYLHESRHKHAMRRARASGGR  226

Query  802  FVNK  813
            F  K
Sbjct  227  FAKK  230



>ref|XP_006288440.1| hypothetical protein CARUB_v10001701mg [Capsella rubella]
 gb|EOA21338.1| hypothetical protein CARUB_v10001701mg [Capsella rubella]
Length=271

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 82/112 (73%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GH I C P PY +P +   +GA G + +  +   G+   R  LPL++T +EPVYVNA
Sbjct  119  ELVGHYIACVPNPYQDPYYGGMMGAYGHQPLGFRPYLGMPRERTALPLDMT-QEPVYVNA  177

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRR+ RAKAELE KV+++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  178  KQYEGILRRRKARAKAELERKVIRDRKPYLHESRHKHAMRRARASGGRFAKK  229



>ref|XP_003570525.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Brachypodium 
distachyon]
Length=256

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 82/120 (68%), Gaps = 8/120 (7%)
 Frame = +1

Query  484  ATEHDLMGHSIQCAPYPYTE--PAFLGAAGGESVVHQSAQG------VRMVLPLEVTTEE  639
            A+++   GH I    YPY++  P    A G  ++ H    G       R+ LPLE+  +E
Sbjct  40   ASQNIDYGHPITRISYPYSDSNPGLWAAYGSRAMFHTQIAGGGTSTNTRVPLPLELAEDE  99

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            P++VN KQYHGILRRRQLRAK E +NK++KN+KPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  100  PIFVNPKQYHGILRRRQLRAKLEAQNKLIKNKKPYLHESRHRHAMKRARGSGGRFLNSKE  159



>ref|XP_010453330.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Camelina sativa]
Length=273

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 118/212 (56%), Gaps = 29/212 (14%)
 Frame = +1

Query  259  QAMVSRNPW--NNTLY-----------ENSSAVDPGNNATS--AHMLWED---NGGMHHT  384
            Q M+   PW  NN+              NSS++D  N + S   H   ED   NG    T
Sbjct  21   QPMMYPEPWWKNNSFNVVPQARPSIVPSNSSSLDCANGSESNDVHSASEDGALNGENDGT  80

Query  385  APEPKGFTELHTSDKNCKVESENVAMSP---HHSRPATEHDLMGHSIQCAPYPYTEPAF-  552
              + +  T   + D N  +E  + A+S    H  +     +L+GH I C P PY +P + 
Sbjct  81   WKDSQAATSSRSVDNNG-MEGNDPALSMRNMHDQQLVQPPELVGHYIACVPNPYQDPYYG  139

Query  553  --LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELEN  717
              +GA G + +  +   G+   R  LPL++  +EPVYVNAKQY GILRRR+ RAKAELE 
Sbjct  140  GMMGAYGHQPMGFRPYLGMPRERTALPLDMA-QEPVYVNAKQYEGILRRRKARAKAELER  198

Query  718  KVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KV+++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  199  KVIRDRKPYLHESRHKHAMRRARASGGRFAKK  230



>ref|XP_006439109.1| hypothetical protein CICLE_v10032207mg [Citrus clementina]
 ref|XP_006439110.1| hypothetical protein CICLE_v10032207mg [Citrus clementina]
 ref|XP_006482871.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Citrus 
sinensis]
 gb|ESR52349.1| hypothetical protein CICLE_v10032207mg [Citrus clementina]
 gb|ESR52350.1| hypothetical protein CICLE_v10032207mg [Citrus clementina]
Length=307

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 7/117 (6%)
 Frame = +1

Query  487  TEHDLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQSAQGV---RMVLPLEVTTEEPVY  648
            ++ +L+GHSI    YPYT+P  +G       + ++     G+   RM LPLE+  EEPVY
Sbjct  95   SQMELVGHSIVLTSYPYTDPQHVGVITPYVPQVMIPPQLYGMHQARMPLPLEME-EEPVY  153

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQY GILRRRQ RAKAELE KV+K RKPYLHESRH+HAMRRAR  GGRF+N K+
Sbjct  154  VNAKQYRGILRRRQSRAKAELEKKVIKARKPYLHESRHQHAMRRARGCGGRFLNTKQ  210



>ref|XP_010324494.1| PREDICTED: nuclear transcription factor Y subunit A-7 [Solanum 
lycopersicum]
Length=278

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQY  666
            +L GHS   A YPY +  + G     + VH     +   RM LPL++  EEPVYVNAKQY
Sbjct  72   ELTGHSAMLASYPYPDMQYGGMMTYGAPVHPHLFEIHHARMPLPLDME-EEPVYVNAKQY  130

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            HGILRRRQ+RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  131  HGILRRRQIRAKAELERKAIKARKPYLHESRHQHAMRRARGTGGRFLNTKK  181



>ref|XP_004500195.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004500196.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004500197.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X3 [Cicer arietinum]
Length=337

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 91/139 (65%), Gaps = 14/139 (10%)
 Frame = +1

Query  415  HTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVH  585
            HT+     V  E +  +P       + +L+GHSI CA  PY +P + G   A G + + +
Sbjct  101  HTASSAPSVREEGLTQTP-------QLELVGHSIACATNPYQDPYYGGMMAAYGHQPLGY  153

Query  586  QSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHES  756
                G+   RM LPLE+  +EPVYVNAKQY GILRRRQ RAKAELE K++K+RKPYLHES
Sbjct  154  PPFIGMPHARMPLPLEMA-QEPVYVNAKQYQGILRRRQARAKAELERKLIKSRKPYLHES  212

Query  757  RHKHAMRRARDGGGRFVNK  813
            RH+HAMRRAR  GGRF  K
Sbjct  213  RHQHAMRRARGTGGRFAKK  231



>ref|XP_008363319.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Malus 
domestica]
Length=333

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV--  603
            V S  V     H  P ++ +L+GHSI  + YPY +P +   L   G ++++     G+  
Sbjct  93   VSSSVVPAMGQHVDPNSQMELVGHSIVMSSYPYADPQYGGMLTPYGPQTMLXPHFYGMHP  152

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LP ++  EEPVYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH HA+RR
Sbjct  153  GRMPLPPDME-EEPVYVNAKQYHGILRRRQSRAKAELEKKLIKARKPYLHESRHLHALRR  211

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  212  ARGCGGRFLNXKK  224



>ref|XP_003540525.1| PREDICTED: nuclear transcription factor Y subunit A-9 [Glycine 
max]
 gb|KHN19456.1| Nuclear transcription factor Y subunit A-9 [Glycine soja]
Length=303

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P  + +L+GHS+     PY++  +   L   G + +++    G+   RM LPLE+  
Sbjct  90   HLAPNPQMELVGHSVVLTS-PYSDAQYGQILTTYGQQVMINPQLYGMHHARMPLPLEME-  147

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ RAKAE+E KV+KNRKPYLHESRH HAMRRAR  GGRF+N 
Sbjct  148  EEPVYVNAKQYHGILRRRQSRAKAEIEKKVIKNRKPYLHESRHLHAMRRARGNGGRFLNT  207

Query  814  KK  819
            KK
Sbjct  208  KK  209



>ref|NP_850811.1| nuclear transcription factor Y subunit A-1 [Arabidopsis thaliana]
 ref|NP_974774.1| nuclear transcription factor Y subunit A-1 [Arabidopsis thaliana]
 emb|CAA74048.1| transcription factor [Arabidopsis thaliana]
 dbj|BAH19975.1| AT5G12840 [Arabidopsis thaliana]
 gb|AED91818.1| nuclear transcription factor Y subunit A-1 [Arabidopsis thaliana]
 gb|AED91819.1| nuclear transcription factor Y subunit A-1 [Arabidopsis thaliana]
Length=271

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 118/210 (56%), Gaps = 26/210 (12%)
 Frame = +1

Query  259  QAMVSRNPW--NNT-----------LYENSSAVD--PGNNATSAHMLWED---NGGMHHT  384
            Q M+   PW  NN+           +  NSS++D   G+ +   H   ED   NG    T
Sbjct  21   QPMMYAEPWWKNNSFGVVPQARPSGIPSNSSSLDCPNGSESNDVHSASEDGALNGENDGT  80

Query  385  APEPKGFTELHTSDKNCKVESENVAMSPHHSRPATEH-DLMGHSIQCAPYPYTEPAF---  552
              + +  T   + +   +     +++   H +P  +  +L+GH I C P PY +P +   
Sbjct  81   WKDSQAATSSRSDNHGMEGNDPALSIRNMHDQPLVQPPELVGHYIACVPNPYQDPYYGGL  140

Query  553  LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKV  723
            +GA G + +  +   G+   R  LPL++  +EPVYVNAKQY GILRRR+ RAKAELE KV
Sbjct  141  MGAYGHQQLGFRPYLGMPRERTALPLDMA-QEPVYVNAKQYEGILRRRKARAKAELERKV  199

Query  724  VKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            +++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  200  IRDRKPYLHESRHKHAMRRARASGGRFAKK  229



>ref|XP_006345445.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
X2 [Solanum tuberosum]
Length=278

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQY  666
            +L GHS   A YPY +  + G     + VH     +   RM LPL++  EEPVYVNAKQY
Sbjct  72   ELTGHSAMLASYPYPDMQYGGMMTYGAPVHPHLFEIHHARMPLPLDME-EEPVYVNAKQY  130

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            HGILRRRQ+RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  131  HGILRRRQIRAKAELERKAIKARKPYLHESRHQHAMRRARGSGGRFLNTKK  181



>ref|XP_002962387.1| hypothetical protein SELMODRAFT_438143 [Selaginella moellendorffii]
 gb|EFJ35850.1| hypothetical protein SELMODRAFT_438143 [Selaginella moellendorffii]
Length=289

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = +1

Query  523  APYPYTEPAFLG----AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILR  681
            A YPY++P F G    A  G+ +V     G+   RM LP E+  EEPVYVNAKQYHGILR
Sbjct  93   AAYPYSDPFFGGMMAAAYAGQGLVQPHVLGLQQARMPLPTEILEEEPVYVNAKQYHGILR  152

Query  682  RRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            RRQ RAKAE EN+++K RKPYLHESRH HA+RRAR  GGRF+NKK
Sbjct  153  RRQSRAKAESENRLIKTRKPYLHESRHLHALRRARGCGGRFLNKK  197



>ref|XP_006345444.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
X1 [Solanum tuberosum]
Length=303

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQY  666
            +L GHS   A YPY +  + G     + VH     +   RM LPL++  EEPVYVNAKQY
Sbjct  97   ELTGHSAMLASYPYPDMQYGGMMTYGAPVHPHLFEIHHARMPLPLDME-EEPVYVNAKQY  155

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            HGILRRRQ+RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  156  HGILRRRQIRAKAELERKAIKARKPYLHESRHQHAMRRARGSGGRFLNTKK  206



>ref|XP_009364962.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Pyrus 
x bretschneideri]
Length=329

 Score =   132 bits (331),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV--  603
            V S  V     H  P ++ +L+GHSI  + YPY +P +   L   G ++++     G+  
Sbjct  93   VSSSVVPAMGEHVDPNSQMELVGHSIVMSSYPYADPQYGGMLTPYGPQTMLPPHFYGMHP  152

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LP ++  EEPVYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH HA+RR
Sbjct  153  GRMPLPPDME-EEPVYVNAKQYHGILRRRQSRAKAELEKKLIKARKPYLHESRHLHALRR  211

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  212  ARGCGGRFLNTKK  224



>ref|XP_010917240.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Elaeis 
guineensis]
 ref|XP_010917241.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Elaeis 
guineensis]
 ref|XP_010917242.1| PREDICTED: nuclear transcription factor Y subunit A-4-like [Elaeis 
guineensis]
Length=341

 Score =   132 bits (331),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 78/113 (69%), Gaps = 8/113 (7%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAK  660
               SI C PYPY +P F G     G  +V+H    G+    R+ LP  V  +EP+YVNAK
Sbjct  134  FSQSIACIPYPYADPYFGGIVATYGSHAVIHPQLAGMAPSARVPLPQPVE-DEPIYVNAK  192

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QYHGILRRRQLRAK E +NKV++ RKPYLHESRH HAM+RAR  GGRF+N K+
Sbjct  193  QYHGILRRRQLRAKLEAQNKVIRGRKPYLHESRHIHAMKRARGSGGRFLNTKQ  245



>ref|NP_001050979.1| Os03g0696300 [Oryza sativa Japonica Group]
 gb|ABF98349.1| CCAAT-binding transcription factor subunit B family protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98350.1| CCAAT-binding transcription factor subunit B family protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98351.1| CCAAT-binding transcription factor subunit B family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12893.1| Os03g0696300 [Oryza sativa Japonica Group]
 dbj|BAF64438.1| HAP2 subunit of HAP complex [Oryza sativa Japonica Group]
 gb|ACJ54915.1| CCAAT-binding transcription factor [Oryza sativa Japonica Group]
 dbj|BAG91638.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59745.1| hypothetical protein OsJ_12212 [Oryza sativa Japonica Group]
Length=258

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 90/134 (67%), Gaps = 11/134 (8%)
 Frame = +1

Query  445  SENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQ------GV-  603
            S+  A++  +  P ++ +L    I  A Y Y +  ++G  G       SAQ      G+ 
Sbjct  92   SQMTALASDYLTPFSQLEL-NQPIASAAYQYPDSYYMGMVGPYGPQAMSAQTHFQLPGLT  150

Query  604  --RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMR  777
              RM LPLE++ EEPVYVNAKQYHGILRRRQ RAKAELE KVVK+RKPYLHESRH+HAMR
Sbjct  151  HSRMPLPLEIS-EEPVYVNAKQYHGILRRRQSRAKAELEKKVVKSRKPYLHESRHQHAMR  209

Query  778  RARDGGGRFVNKKK  819
            RAR  GGRF+N KK
Sbjct  210  RARGTGGRFLNTKK  223



>gb|EEC76000.1| hypothetical protein OsI_13136 [Oryza sativa Indica Group]
Length=258

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 90/134 (67%), Gaps = 11/134 (8%)
 Frame = +1

Query  445  SENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQ------GV-  603
            S+  A++  +  P ++ +L    I  A Y Y +  ++G  G       SAQ      G+ 
Sbjct  92   SQMTALASDYLTPFSQLEL-NQPIASAAYQYPDSYYMGMVGPYGPQAMSAQTHFQLPGLT  150

Query  604  --RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMR  777
              RM LPLE++ EEPVYVNAKQYHGILRRRQ RAKAELE KVVK+RKPYLHESRH+HAMR
Sbjct  151  HSRMPLPLEIS-EEPVYVNAKQYHGILRRRQSRAKAELEKKVVKSRKPYLHESRHQHAMR  209

Query  778  RARDGGGRFVNKKK  819
            RAR  GGRF+N KK
Sbjct  210  RARGTGGRFLNTKK  223



>ref|XP_009767410.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009767411.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009767412.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Nicotiana sylvestris]
Length=226

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 93/123 (76%), Gaps = 10/123 (8%)
 Frame = +1

Query  478  RPATEHDLMGHSIQCAPYPYTE-PAFLG----AAGGESVVHQ----SAQGVRMVLPLEVT  630
            + A + +LM  SI    YPY+E P + G    AA GES+VHQ    S    RM+LP+EV 
Sbjct  10   KAANQFELMAPSIAFKSYPYSEVPQYSGGNVAAACGESLVHQNIERSVHNGRMILPIEVK  69

Query  631  TEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVN  810
             EEP+YVNAKQYHGILRRRQLRAKA LE KVVK+RKPYLHESRH+HAMRRARDGGGRF+N
Sbjct  70   -EEPMYVNAKQYHGILRRRQLRAKAVLEQKVVKSRKPYLHESRHRHAMRRARDGGGRFLN  128

Query  811  KKK  819
             KK
Sbjct  129  TKK  131



>gb|KEH19086.1| CCAAT-binding transcription factor [Medicago truncatula]
Length=294

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P ++ +L+GHSI     PY+   F   L A G +++++     +   RM+LPL++  
Sbjct  95   HLYPNSQRELVGHSIVLTS-PYSNAQFGQILNAYGQQAMMNPQLYQMHHARMLLPLKME-  152

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ RAKAELE KV+K RKPYLHESRH+HA+RRAR  GGRF+N 
Sbjct  153  EEPVYVNAKQYHGILRRRQSRAKAELEKKVIKVRKPYLHESRHQHALRRARGNGGRFLNT  212

Query  814  KK  819
            KK
Sbjct  213  KK  214



>gb|KDP43479.1| hypothetical protein JCGZ_16766 [Jatropha curcas]
Length=339

 Score =   131 bits (330),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 88/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  436  KVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV-  603
            +V S   A    H  P ++ +L+GHSI    YPY++P +   L +   + VV     G+ 
Sbjct  99   QVASSTPASMDTHLEPNSQMELVGHSIVLTSYPYSDPQYGGMLASYAPQVVVPSQLYGMH  158

Query  604  --RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMR  777
              R+ LPLE+  EEPV+VNAKQ+HGILRRRQ RAKAELE K +K RKPYLHESRH+HAMR
Sbjct  159  HARIPLPLEME-EEPVFVNAKQFHGILRRRQARAKAELEKKAIKVRKPYLHESRHQHAMR  217

Query  778  RARDGGGRFV  807
            RAR  GGRF+
Sbjct  218  RARGCGGRFL  227



>gb|KDO53706.1| hypothetical protein CISIN_1g017825mg [Citrus sinensis]
Length=341

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = +1

Query  538  TEPAFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAE  708
            T+P+ L   G  S+VH  + GV   RM LPLE+  EEPVYVNAKQYHGILRRRQLRAKAE
Sbjct  120  TQPSQLELVG-HSIVHPQSMGVHSARMALPLEMA-EEPVYVNAKQYHGILRRRQLRAKAE  177

Query  709  LENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            LE K++K RKPYLHESRH HAMRRAR  GGRFVN KK
Sbjct  178  LERKLIKVRKPYLHESRHLHAMRRARGCGGRFVNTKK  214



>gb|AFK49649.1| nuclear transcription factor Y subunit A7 [Medicago truncatula]
Length=304

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P ++ +L+GHSI     PY+   F   L A G +++++     +   RM+LPL++  
Sbjct  95   HLYPNSQRELVGHSIVLTS-PYSNAQFGQILNAYGQQAMMNPQLYQMHHARMLLPLKME-  152

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ RAKAELE KV+K RKPYLHESRH+HA+RRAR  GGRF+N 
Sbjct  153  EEPVYVNAKQYHGILRRRQSRAKAELEKKVIKVRKPYLHESRHQHALRRARGNGGRFLNT  212

Query  814  KK  819
            KK
Sbjct  213  KK  214



>gb|KHG20723.1| Nuclear transcription factor Y subunit A-1 -like protein [Gossypium 
arboreum]
Length=315

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 82/112 (73%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + + +    G+   RM LP+E+  +EPVYVNA
Sbjct  122  ELVGHSIACASNPYIDPLYGGMMAAYGHQPMGYPPFVGMPHARMTLPIEMA-QEPVYVNA  180

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE KVVK+RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  181  KQYQGILRRRQARAKAELEKKVVKSRKPYLHESRHQHALRRARGSGGRFAKK  232



>ref|XP_003558692.1| PREDICTED: nuclear transcription factor Y subunit A-7-like [Brachypodium 
distachyon]
Length=239

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = +1

Query  529  YPYTEPAFLGAAGGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRRRQL  693
            YPY +P + GA G  +V+H    G+    R+ LP+E    EEP+YVNAKQYH ILRRRQL
Sbjct  92   YPYADPFYGGAYGSHAVMHPQIVGMVPSSRVPLPIEQAAAEEPIYVNAKQYHAILRRRQL  151

Query  694  RAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RAK E ENK+VK+RKPYLHESRH HAM+RAR  GGRF+N K+
Sbjct  152  RAKLEAENKLVKSRKPYLHESRHLHAMKRARGTGGRFLNSKQ  193



>gb|EYU31369.1| hypothetical protein MIMGU_mgv1a013110mg [Erythranthe guttata]
Length=230

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 97/142 (68%), Gaps = 8/142 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG--AAGGESVVHQ--SAQGVRMVLPLEVTTEEPVYVNAKQ  663
            +L+GHSI CA  PY +P + G  AA G+ +V        +RM LPLE+  +EPVYVNAKQ
Sbjct  77   ELVGHSIACASNPY-DPYYGGMMAAYGQPMVPHLYDMHHMRMPLPLEMA-QEPVYVNAKQ  134

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKKsdst--sn  837
            YHGILRRRQ RAKAELE K++K RKPYLHESRH+HAM+RAR  GGRF  K  +D++  + 
Sbjct  135  YHGILRRRQSRAKAELERKLIKARKPYLHESRHQHAMKRARGTGGRFAKKSDADTSKGTG  194

Query  838  ntppcssnvnssEAKNCISDSH  903
            +    S     +EA+N  S SH
Sbjct  195  SESAVSDAAKVTEAQNMYSSSH  216



>ref|XP_010419841.1| PREDICTED: nuclear transcription factor Y subunit A-1 isoform 
X2 [Camelina sativa]
Length=274

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GH I C P PY +P +   +GA G + +  +   G+   R  LPL++  +EPVYVNA
Sbjct  119  ELVGHYIACVPNPYQDPYYGGMMGAYGHQPMGFRPYLGMPRERTALPLDMA-QEPVYVNA  177

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRR+ RAKAELE KV+++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  178  KQYEGILRRRKARAKAELERKVIRDRKPYLHESRHKHAMRRARASGGRFAKK  229



>ref|XP_008791883.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Phoenix 
dactylifera]
Length=341

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 80/110 (73%), Gaps = 8/110 (7%)
 Frame = +1

Query  511  SIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYH  669
            SI C P PY +P F   L A G  +V+H    G+    R+ LP +   +EP+YVNAKQYH
Sbjct  137  SIACIPCPYADPYFGGILAAYGSHAVIHPQLAGMAPSARVPLP-QPLEDEPIYVNAKQYH  195

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            GILRRRQLRAK E +NK++K+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  196  GILRRRQLRAKLEAQNKLIKDRKPYLHESRHRHAMKRARGSGGRFLNTKQ  245



>ref|XP_009778037.1| PREDICTED: nuclear transcription factor Y subunit A-7-like [Nicotiana 
sylvestris]
Length=230

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQY  666
            +L GHS     YPY +  + G     + VH     +   RM LPL++  EEPVYVNAKQY
Sbjct  24   ELTGHSAMLTSYPYPDLQYGGMMTYGAPVHPHLFEIHHARMPLPLDME-EEPVYVNAKQY  82

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            HGILRRRQ+RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  83   HGILRRRQIRAKAELEKKAIKARKPYLHESRHQHAMRRARGTGGRFLNTKK  133



>emb|CDX78492.1| BnaA03g04040D [Brassica napus]
Length=205

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 78/112 (70%), Gaps = 13/112 (12%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVR---------MVLPLEVTTEEPVY  648
            +L+GH I C P PY +P + G  G     HQ  QG R           LPL++T +EPVY
Sbjct  59   ELVGHYIACVPNPYQDPYYGGMVGAYG--HQQLQGFRPYPGMPGERTALPLDMT-QEPVY  115

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            VNAKQYHGILRRR+ RAKAELE K++ NRKPYLHESRHKHAM+RAR  GGRF
Sbjct  116  VNAKQYHGILRRRKARAKAELERKLI-NRKPYLHESRHKHAMKRARASGGRF  166



>ref|XP_007015064.1| Nuclear transcription factor Y subunit A-9, putative [Theobroma 
cacao]
 gb|EOY32683.1| Nuclear transcription factor Y subunit A-9, putative [Theobroma 
cacao]
Length=315

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + + +    G+   RM LP+E+  +EPVYVNA
Sbjct  122  ELVGHSIACAANPYQDPFYGGMMAAYGHQPLGYPPFVGMPHARMALPIEMA-QEPVYVNA  180

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE KVVK RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  181  KQYQGILRRRQARAKAELEKKVVKVRKPYLHESRHQHAMRRARGSGGRFAKK  232



>ref|XP_010492016.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Camelina sativa]
Length=274

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GH I C P PY +P +   +GA G + +  +   G+   R  LPL++  +EPVYVNA
Sbjct  119  ELVGHYIACVPNPYQDPYYGGMMGAYGHQPMGFRPYLGMPRERTALPLDMA-QEPVYVNA  177

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRR+ RAKAELE KV+++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  178  KQYEGILRRRKARAKAELERKVIRDRKPYLHESRHKHAMRRARASGGRFAKK  229



>ref|XP_010419840.1| PREDICTED: nuclear transcription factor Y subunit A-1 isoform 
X1 [Camelina sativa]
Length=275

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GH I C P PY +P +   +GA G + +  +   G+   R  LPL++  +EPVYVNA
Sbjct  120  ELVGHYIACVPNPYQDPYYGGMMGAYGHQPMGFRPYLGMPRERTALPLDMA-QEPVYVNA  178

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRR+ RAKAELE KV+++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  179  KQYEGILRRRKARAKAELERKVIRDRKPYLHESRHKHAMRRARASGGRFAKK  230



>gb|KHG16591.1| Nuclear transcription factor Y subunit A-1 -like protein [Gossypium 
arboreum]
Length=315

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 87/124 (70%), Gaps = 9/124 (7%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGV---RMVLPLEVTTE  636
            H  P ++ +L GHSI    YP ++  + G  A+ G  ++     G+   RM LPL++  E
Sbjct  91   HLEPNSQMELAGHSIVLKSYPCSDSQYSGIQASYGPQIMVSPLYGMHHARMPLPLQME-E  149

Query  637  EPVYVNAKQYHGILRRRQLRAKAELENKVVKNRK---PYLHESRHKHAMRRARDGGGRFV  807
            EPVYVNAKQYHGILRRRQ+RAKAELE KV+K RK   PYLHESRH HAMRRAR  GGRF+
Sbjct  150  EPVYVNAKQYHGILRRRQIRAKAELEKKVIKVRKVEPPYLHESRHLHAMRRARGSGGRFL  209

Query  808  NKKK  819
            NKKK
Sbjct  210  NKKK  213



>ref|XP_003551355.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Glycine 
max]
Length=338

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 117/211 (55%), Gaps = 27/211 (13%)
 Frame = +1

Query  238  IGSFTWCQAMVSRNPWNNTLYE----NSSAVDPGNNATSAHMLWEDNGGMHHTAPE-PKG  402
            IG     Q M   N  N++  E    +S + + G + +++ M  ED+     + P  P G
Sbjct  32   IGYNPVAQTMAGANASNSSSLECPNGDSESNEEGQSLSNSGMNEEDDDATKDSQPAAPNG  91

Query  403  FTEL--------HTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLG  558
                        HT+     +  E +  +P       + +L+GHSI CA  PY +P + G
Sbjct  92   TGNYGQEQQGMQHTASSAPSMREECLTQTP-------QLELVGHSIACATNPYQDPYYGG  144

Query  559  ---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENK  720
               A G + + +    G+   RM LPLE+  +EPVYVNAKQY GILRRRQ RAKAELE K
Sbjct  145  MMAAYGHQQLGYAPFIGMPHARMPLPLEMA-QEPVYVNAKQYQGILRRRQARAKAELERK  203

Query  721  VVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            ++K+RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  204  LIKSRKPYLHESRHQHAMRRARGTGGRFAKK  234



>emb|CAN70549.1| hypothetical protein VITISV_002755 [Vitis vinifera]
Length=446

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%), Gaps = 7/109 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + +VH    G+   RM LPLE+T ++PVYVN 
Sbjct  224  ELVGHSIACASNPYQDPYYGGMMTAYGPQPLVHPHLLGMHEARMPLPLEMT-QDPVYVNP  282

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            KQYHGILRRRQ RAKAELE K++K RKPYLHESRH+HA+RRAR  GGRF
Sbjct  283  KQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHALRRARSSGGRF  331



>ref|XP_010492015.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Camelina sativa]
Length=275

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GH I C P PY +P +   +GA G + +  +   G+   R  LPL++  +EPVYVNA
Sbjct  120  ELVGHYIACVPNPYQDPYYGGMMGAYGHQPMGFRPYLGMPRERTALPLDMA-QEPVYVNA  178

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRR+ RAKAELE KV+++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  179  KQYEGILRRRKARAKAELERKVIRDRKPYLHESRHKHAMRRARASGGRFAKK  230



>ref|XP_010453331.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Camelina sativa]
Length=272

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 116/210 (55%), Gaps = 26/210 (12%)
 Frame = +1

Query  259  QAMVSRNPW--NNTLY-----------ENSSAVDPGNNATS--AHMLWED---NGGMHHT  384
            Q M+   PW  NN+              NSS++D  N + S   H   ED   NG    T
Sbjct  21   QPMMYPEPWWKNNSFNVVPQARPSIVPSNSSSLDCANGSESNDVHSASEDGALNGENDGT  80

Query  385  APEPKGFTELHTSDKNCKVESENVAMSPHHSRPATEH-DLMGHSIQCAPYPYTEPAF---  552
              + +  T   + +   +     ++M   H +   +  +L+GH I C P PY +P +   
Sbjct  81   WKDSQAATSSRSDNNGMEGNDPALSMRNMHDQQLVQPPELVGHYIACVPNPYQDPYYGGM  140

Query  553  LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKV  723
            +GA G + +  +   G+   R  LPL++  +EPVYVNAKQY GILRRR+ RAKAELE KV
Sbjct  141  MGAYGHQPMGFRPYLGMPRERTALPLDMA-QEPVYVNAKQYEGILRRRKARAKAELERKV  199

Query  724  VKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            +++RKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  200  IRDRKPYLHESRHKHAMRRARASGGRFAKK  229



>gb|KHN31720.1| Nuclear transcription factor Y subunit A-1 [Glycine soja]
Length=338

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 117/211 (55%), Gaps = 27/211 (13%)
 Frame = +1

Query  238  IGSFTWCQAMVSRNPWNNTLYE----NSSAVDPGNNATSAHMLWEDNGGMHHTAPE-PKG  402
            IG     Q M   N  N++  E    +S + + G + +++ M  ED+     + P  P G
Sbjct  32   IGYNPVAQTMAGANASNSSSLECPNGDSESNEEGQSLSNSGMNEEDDDATKDSQPAAPNG  91

Query  403  FTEL--------HTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLG  558
                        HT+     +  E +  +P       + +L+GHSI CA  PY +P + G
Sbjct  92   TGNYGQEQQGMQHTASSAPSMREECLTQTP-------QLELVGHSIACATNPYQDPYYGG  144

Query  559  ---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENK  720
               A G + + +    G+   RM LPLE+  +EPVYVNAKQY GILRRRQ RAKAELE K
Sbjct  145  MMAAYGHQQLGYAPFIGMPHARMPLPLEMA-QEPVYVNAKQYQGILRRRQARAKAELERK  203

Query  721  VVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            ++K+RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  204  LIKSRKPYLHESRHQHAMRRARGTGGRFAKK  234



>ref|XP_010261975.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X1 [Nelumbo nucifera]
Length=338

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 77/104 (74%), Gaps = 6/104 (6%)
 Frame = +1

Query  526  PYPYTEP---AFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            PYPY EP    +L A G ++V+H    G+   R+ LPL+VT +EP+YVNAKQY GILRRR
Sbjct  140  PYPYAEPYMNGYLAAYGPQAVIHPQMIGMVPARVPLPLDVTDDEPIYVNAKQYRGILRRR  199

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            Q RAK E +NK+ K RKPYLHESRH HA+RRAR  GGRF++ KK
Sbjct  200  QSRAKLEAQNKLAKGRKPYLHESRHLHALRRARGSGGRFLDTKK  243



>ref|XP_006650437.1| PREDICTED: nuclear transcription factor Y subunit A-9-like [Oryza 
brachyantha]
Length=165

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 80/115 (70%), Gaps = 10/115 (9%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQ------GV---RMVLPLEVTTEEPVYVN  654
            +   I  A Y Y +  ++G  G       SAQ      G+   RM LPLE++ EEPVYVN
Sbjct  17   LNQPIASAAYQYPDSYYMGMVGPYGPQAMSAQTHYQLPGLTHSRMPLPLEIS-EEPVYVN  75

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            AKQYHGILRRRQ RAKAELE K+VK+RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  76   AKQYHGILRRRQSRAKAELERKLVKSRKPYLHESRHQHAMRRARGTGGRFLNTKK  130



>ref|XP_010673645.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Beta 
vulgaris subsp. vulgaris]
Length=303

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 82/112 (73%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +  + G   A G + +V     G+   RM LPLE+  +EPVYVNA
Sbjct  125  ELVGHSIACASTPYPDLYYGGMMAAYGPQPLVPPQFYGMHQPRMPLPLEMA-QEPVYVNA  183

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQYHGILRRRQ+RAKAELE K++K RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  184  KQYHGILRRRQVRAKAELERKLIKIRKPYLHESRHQHALRRARGTGGRFAKK  235



>gb|EYU29033.1| hypothetical protein MIMGU_mgv1a012967mg [Erythranthe guttata]
Length=234

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 85/117 (73%), Gaps = 7/117 (6%)
 Frame = +1

Query  487  TEHDLMGHSIQC-APYPY-TEPAFLGAAGGESVVHQ----SAQGVRMVLPLEVTTEEPVY  648
            ++ +L+GHSI   + YPY T P + G     + VH        G RM LPLE+  EEPVY
Sbjct  66   SQMELVGHSIMLTSSYPYPTGPQYGGMLTYGAPVHPHLLGYLPGARMPLPLEME-EEPVY  124

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQY GILRRR++RA+A+LE K+VKN+KPYLHESRHKHAM+RAR  GGRF+N KK
Sbjct  125  VNAKQYRGILRRREIRARADLEKKLVKNKKPYLHESRHKHAMKRARGTGGRFLNTKK  181



>ref|XP_003532204.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoformX1 
[Glycine max]
 ref|XP_006586181.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Glycine max]
 gb|KHN01803.1| Nuclear transcription factor Y subunit A-1 [Glycine soja]
Length=336

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 95/158 (60%), Gaps = 26/158 (16%)
 Frame = +1

Query  358  EDNGGMHHTAPEPKGFTELHTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPY  537
            ++  GM HTA  P    E       C  ++  +             +L+GHSI C+  PY
Sbjct  97   QEQQGMQHTASSPPSMRE------ECLTQTPQL-------------ELVGHSIACSTNPY  137

Query  538  TEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRA  699
             +P + G   A G + + +    G+   RM LPLE+  +EPVYVNAKQY GILRRRQ RA
Sbjct  138  QDPYYGGMMAAYGHQQLGYAPFIGMPHARMPLPLEMA-QEPVYVNAKQYQGILRRRQARA  196

Query  700  KAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KAELE K++K+RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  197  KAELERKLIKSRKPYLHESRHQHAMRRARGTGGRFAKK  234



>ref|XP_004985516.1| PREDICTED: nuclear transcription factor Y subunit A-6-like isoform 
X2 [Setaria italica]
Length=237

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY +P + GA    G  +++H    G+    R+ LP+E   EEP+YVNAKQYH ILRRR
Sbjct  95   YPYADPYYGGAVAAYGPHAIMHPQLVGMVPSSRVPLPIEPAAEEPIYVNAKQYHAILRRR  154

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  155  QLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNTKQ  198



>ref|XP_006446125.1| hypothetical protein CICLE_v10015808mg [Citrus clementina]
 ref|XP_006446126.1| hypothetical protein CICLE_v10015808mg [Citrus clementina]
 ref|XP_006446127.1| hypothetical protein CICLE_v10015808mg [Citrus clementina]
 ref|XP_006446128.1| hypothetical protein CICLE_v10015808mg [Citrus clementina]
 ref|XP_006470619.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006470620.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Citrus sinensis]
 ref|XP_006470621.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X3 [Citrus sinensis]
 ref|XP_006470622.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X4 [Citrus sinensis]
 gb|ESR59365.1| hypothetical protein CICLE_v10015808mg [Citrus clementina]
 gb|ESR59366.1| hypothetical protein CICLE_v10015808mg [Citrus clementina]
 gb|ESR59367.1| hypothetical protein CICLE_v10015808mg [Citrus clementina]
 gb|ESR59368.1| hypothetical protein CICLE_v10015808mg [Citrus clementina]
 gb|KDO61240.1| hypothetical protein CISIN_1g019036mg [Citrus sinensis]
 gb|KDO61241.1| hypothetical protein CISIN_1g019036mg [Citrus sinensis]
 gb|KDO61242.1| hypothetical protein CISIN_1g019036mg [Citrus sinensis]
 gb|KDO61243.1| hypothetical protein CISIN_1g019036mg [Citrus sinensis]
 gb|KDO61244.1| hypothetical protein CISIN_1g019036mg [Citrus sinensis]
Length=347

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + V +    G+   RM LPLE+  +EPVYVNA
Sbjct  123  ELVGHSIACASNPYQDPYYGGMMAAYGHQPVGYPQFVGMPHARMPLPLEMA-QEPVYVNA  181

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  182  KQYMGILRRRQARAKAELEKKLIKVRKPYLHESRHQHAMRRARGSGGRFAKK  233



>ref|XP_007146701.1| hypothetical protein PHAVU_006G062200g [Phaseolus vulgaris]
 gb|ESW18695.1| hypothetical protein PHAVU_006G062200g [Phaseolus vulgaris]
Length=338

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 118/211 (56%), Gaps = 27/211 (13%)
 Frame = +1

Query  238  IGSFTWCQAMVSRNPWNNTLYE----NSSAVDPGNNATSAHMLWEDNGGMHHTAP----E  393
            IG     Q M   N  N++  E    +S + + G + +++ M  ED+     + P    E
Sbjct  32   IGYNPLAQTMAGANASNSSSLECPNGDSESNEEGQSLSNSGMNEEDDDATKDSQPAAPNE  91

Query  394  PKGFTE-----LHTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF--  552
            P  + +      HT+     +  E +  +P       + +L+GHSI CA  PY +P +  
Sbjct  92   PGNYGQEQQGIQHTASSAPSMREECLTQTP-------QLELVGHSIACATNPYQDPYYGS  144

Query  553  -LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENK  720
             +   G + + +    G+   RM LPLE+  +EPVYVNAKQY GILRRRQ RAKAELE K
Sbjct  145  MMAVYGHQQLGYPPFIGMPHARMPLPLEMA-QEPVYVNAKQYQGILRRRQARAKAELERK  203

Query  721  VVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            ++K+RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  204  LIKSRKPYLHESRHQHALRRARGTGGRFAKK  234



>gb|KDO61245.1| hypothetical protein CISIN_1g019036mg [Citrus sinensis]
Length=274

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + V +    G+   RM LPLE+  +EPVYVNA
Sbjct  50   ELVGHSIACASNPYQDPYYGGMMAAYGHQPVGYPQFVGMPHARMPLPLEMA-QEPVYVNA  108

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  109  KQYMGILRRRQARAKAELEKKLIKVRKPYLHESRHQHAMRRARGSGGRFAKK  160



>ref|XP_004985518.1| PREDICTED: nuclear transcription factor Y subunit A-6-like isoform 
X4 [Setaria italica]
Length=232

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY +P + GA    G  +++H    G+    R+ LP+E   EEP+YVNAKQYH ILRRR
Sbjct  90   YPYADPYYGGAVAAYGPHAIMHPQLVGMVPSSRVPLPIEPAAEEPIYVNAKQYHAILRRR  149

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  150  QLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNTKQ  193



>gb|AAF37266.1|AF220405_1 transcription factor [Vitis riparia]
Length=215

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 82/122 (67%), Gaps = 19/122 (16%)
 Frame = +1

Query  454  VAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVRMVLPLEVTT  633
            + M+ +H  P ++ +L+GHSI        +  FLG               RM LP+E+  
Sbjct  4    MTMAEYHLAPPSQLELVGHSI-------VQSQFLGV-----------NVARMALPIEMA-  44

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF+N 
Sbjct  45   EEPVYVNAKQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHAMRRARGCGGRFLNT  104

Query  814  KK  819
            KK
Sbjct  105  KK  106



>ref|XP_008778422.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X3 [Phoenix dactylifera]
Length=212

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 6/113 (5%)
 Frame = +1

Query  493  HDLMGHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGVR---MVLPLEVTTEEPVYVNA  657
            H   GH++    YPY +P + G  AA G++V H    G++   + LP E   EEPVYVNA
Sbjct  51   HLETGHAVAQIAYPYVDPYYGGGFAAFGQTVFHPQMMGMQHPGVPLPTEAV-EEPVYVNA  109

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            KQYHGILRRRQ RAKAE ENK++K+RKPYLHESRH HA++RAR  GGRF+N K
Sbjct  110  KQYHGILRRRQSRAKAESENKLIKSRKPYLHESRHLHALKRARGCGGRFLNSK  162



>ref|XP_002517826.1| Nuclear transcription factor Y subunit A-1, putative [Ricinus 
communis]
 gb|EEF44633.1| Nuclear transcription factor Y subunit A-1, putative [Ricinus 
communis]
Length=336

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 87/122 (71%), Gaps = 7/122 (6%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P ++ +L+GHSI    YPY++  + G   +   +++V     G+   RM LPLE+  
Sbjct  108  HVEPNSQMELVGHSIVLTSYPYSDAQYGGMLPSYAPQAMVTPQLYGMHHARMALPLEME-  166

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQ++GILRRRQ RAKAE+E K +K RKPYLHESRH+HAMRRAR  GGRF++ 
Sbjct  167  EEPVYVNAKQFNGILRRRQARAKAEIEKKAIKARKPYLHESRHQHAMRRARGCGGRFLSS  226

Query  814  KK  819
            KK
Sbjct  227  KK  228



>ref|XP_004291784.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=340

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 93/143 (65%), Gaps = 10/143 (7%)
 Frame = +1

Query  412  LHTSDKNCKVESENVAMSPHHSRPAT---EHDLMGHSIQCAPYPYTEPAFLG---AAGGE  573
            L   +KN  ++ ++  +   H    T   + +L+GHSI CA  PY +P + G   A G +
Sbjct  87   LSVGNKNQDLQLDSSTVPTVHDEGVTHPPQLELIGHSIACASNPYQDPYYAGMMAAYGHQ  146

Query  574  SVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPY  744
             + +    G+   RM LPLE+  +EPVYVNAKQY GILRRRQ RAKAELE K++K RKPY
Sbjct  147  PLGYPPFVGMPHARMPLPLEMA-QEPVYVNAKQYQGILRRRQARAKAELEKKLIKVRKPY  205

Query  745  LHESRHKHAMRRARDGGGRFVNK  813
            LHESRH+HAMRRAR  GGRF  K
Sbjct  206  LHESRHQHAMRRARGTGGRFAKK  228



>ref|XP_010241195.1| PREDICTED: nuclear transcription factor Y subunit A-7 isoform 
X2 [Nelumbo nucifera]
Length=201

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  HDLMGHSIQCAPYPYTEPAF---LGAAGGESV--VHQSAQGVRMV-LPLEVTTEEPVYVN  654
            H  +GHS+  A YPY +P +       G + +  +H    G+    +PL +  EEPVYVN
Sbjct  53   HHEVGHSVAQAVYPYPDPYYRSIFAPYGAQPMCQMHPHLMGIHQAGVPLPLDAEEPVYVN  112

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            AKQYHGILRRRQ RAKAE ENK++K+RKPYLHESRH HAMRRAR  GGRF+N K
Sbjct  113  AKQYHGILRRRQSRAKAESENKLIKSRKPYLHESRHLHAMRRARGCGGRFLNAK  166



>ref|XP_010105454.1| Nuclear transcription factor Y subunit A-9 [Morus notabilis]
 gb|EXC04782.1| Nuclear transcription factor Y subunit A-9 [Morus notabilis]
Length=352

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 93/145 (64%), Gaps = 12/145 (8%)
 Frame = +1

Query  409  ELHTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQ----CAPYPYTEPAF--LGAAGG  570
            E+  SD+ C  +     +SP    P T  + +    Q    C+ YPY++P +  + A G 
Sbjct  96   EIIQSDRKCGEDQHMQRVSP--VTPPTMTEYLAPPPQLEFACSSYPYSDPYYGVMPAYGP  153

Query  571  ESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKP  741
             ++V     G+   RM LPL++  EEPVYVNAKQYHGILRRRQ RAKAELE K++K RKP
Sbjct  154  HALVQPHCLGLSSARMALPLDMA-EEPVYVNAKQYHGILRRRQSRAKAELEKKLIKVRKP  212

Query  742  YLHESRHKHAMRRARDGGGRFVNKK  816
            YLHESRH HAMRRAR  GGRF+N K
Sbjct  213  YLHESRHLHAMRRARGSGGRFLNTK  237



>ref|XP_009131295.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X5 [Brassica rapa]
 ref|XP_009131296.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X5 [Brassica rapa]
Length=253

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 13/112 (12%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVR---------MVLPLEVTTEEPVY  648
            +L+GH I C P PY +P + G  G  +  HQ  QG R           LPL++T +EPVY
Sbjct  107  ELVGHYIACVPNPYQDPYYGGMVG--AYGHQQLQGFRPYPGMPGERTALPLDMT-QEPVY  163

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            VNAKQYHGILRRR+ RAKAELE K++ NRKPYLHESRHKHAM+RAR  GGRF
Sbjct  164  VNAKQYHGILRRRKARAKAELERKLI-NRKPYLHESRHKHAMKRARASGGRF  214



>ref|XP_010241197.1| PREDICTED: nuclear transcription factor Y subunit A-7 isoform 
X4 [Nelumbo nucifera]
Length=190

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  HDLMGHSIQCAPYPYTEPAF---LGAAGGESV--VHQSAQGVRMV-LPLEVTTEEPVYVN  654
            H  +GHS+  A YPY +P +       G + +  +H    G+    +PL +  EEPVYVN
Sbjct  42   HHEVGHSVAQAVYPYPDPYYRSIFAPYGAQPMCQMHPHLMGIHQAGVPLPLDAEEPVYVN  101

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            AKQYHGILRRRQ RAKAE ENK++K+RKPYLHESRH HAMRRAR  GGRF+N K
Sbjct  102  AKQYHGILRRRQSRAKAESENKLIKSRKPYLHESRHLHAMRRARGCGGRFLNAK  155



>ref|XP_009131291.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Brassica rapa]
Length=254

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 13/112 (12%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVR---------MVLPLEVTTEEPVY  648
            +L+GH I C P PY +P + G  G  +  HQ  QG R           LPL++T +EPVY
Sbjct  108  ELVGHYIACVPNPYQDPYYGGMVG--AYGHQQLQGFRPYPGMPGERTALPLDMT-QEPVY  164

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            VNAKQYHGILRRR+ RAKAELE K++ NRKPYLHESRHKHAM+RAR  GGRF
Sbjct  165  VNAKQYHGILRRRKARAKAELERKLI-NRKPYLHESRHKHAMKRARASGGRF  215



>ref|XP_009626582.1| PREDICTED: nuclear transcription factor Y subunit A-9-like isoform 
X3 [Nicotiana tomentosiformis]
Length=285

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQY  666
            +L GHS     YPY +  + G     + VH     +   RM LPL++  EEPV+VNAKQY
Sbjct  80   ELTGHSAMLTSYPYPDLQYGGMMTYGAPVHPHLFEIHHARMPLPLDME-EEPVFVNAKQY  138

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            HGILRRRQ+RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  139  HGILRRRQIRAKAELEKKAIKARKPYLHESRHQHAMRRARGTGGRFLNTKK  189



>ref|XP_010247690.1| PREDICTED: nuclear transcription factor Y subunit A-10-like isoform 
X3 [Nelumbo nucifera]
Length=326

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAF--LGAAGGESVVHQSAQGVRMVLPLEVTTEEPVYVNAKQYHGI  675
            +G  + CA YPY +  +      G ++V++Q     R++LPL +T + P+YVNAKQYHGI
Sbjct  124  LGQPMACANYPYMDQCYGIFTTYGSQTVMNQG----RVMLPLNMTEDGPIYVNAKQYHGI  179

Query  676  LRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            +RRRQ RAKAE+ENK++K RKPYLHESRH HAMRRAR  GGRF+N K
Sbjct  180  IRRRQSRAKAEMENKLIKVRKPYLHESRHLHAMRRARGCGGRFLNTK  226



>ref|XP_010923675.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X2 [Elaeis guineensis]
Length=203

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGVR---MVLPLEVTTEEPVYVNAKQYH  669
            GH++    YP+ +P + G  AA G++V+H    G+    + LP E   EEPVYVNAKQYH
Sbjct  17   GHAVAPIAYPFVDPYYGGVFAAYGQTVIHPQMMGMHHAGVPLPAE-AVEEPVYVNAKQYH  75

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            GILRRRQ RAKAE ENK+++ RKPYLHESRH HA++RAR  GGRF+N K
Sbjct  76   GILRRRQSRAKAESENKLIRTRKPYLHESRHLHALKRARGSGGRFLNSK  124



>ref|XP_010241198.1| PREDICTED: nuclear transcription factor Y subunit A-7 isoform 
X5 [Nelumbo nucifera]
Length=186

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  HDLMGHSIQCAPYPYTEPAF---LGAAGGESV--VHQSAQGVRMV-LPLEVTTEEPVYVN  654
            H  +GHS+  A YPY +P +       G + +  +H    G+    +PL +  EEPVYVN
Sbjct  38   HHEVGHSVAQAVYPYPDPYYRSIFAPYGAQPMCQMHPHLMGIHQAGVPLPLDAEEPVYVN  97

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            AKQYHGILRRRQ RAKAE ENK++K+RKPYLHESRH HAMRRAR  GGRF+N K
Sbjct  98   AKQYHGILRRRQSRAKAESENKLIKSRKPYLHESRHLHAMRRARGCGGRFLNAK  151



>gb|KDP34934.1| hypothetical protein JCGZ_09222 [Jatropha curcas]
Length=213

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 80/120 (67%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGAA-------------GGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+ +VH    G++   +PL     EE
Sbjct  59   GHTMAAAAYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPTDAVEE  118

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKV+K+RKPYLHESRH+HA+RRAR  GGRF+N KK
Sbjct  119  PVFVNAKQYHGILRRRQSRAKAESENKVIKSRKPYLHESRHQHALRRARGLGGRFLNSKK  178



>ref|XP_002465770.1| hypothetical protein SORBIDRAFT_01g045500 [Sorghum bicolor]
 gb|EER92768.1| hypothetical protein SORBIDRAFT_01g045500 [Sorghum bicolor]
Length=243

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 76/104 (73%), Gaps = 7/104 (7%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            YPY +P + GA    G  +++H    G+    R+ LP+E   EEP+YVNAKQYH ILRRR
Sbjct  90   YPYADPYYGGAVAAYGSHAIMHPQLVGMVSSSRVPLPIEPAAEEPIYVNAKQYHAILRRR  149

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QLRAK E ENK+VK+RKPYLHESRH HAM+RAR  GGRF+N K+
Sbjct  150  QLRAKLEAENKLVKSRKPYLHESRHLHAMKRARGTGGRFLNTKQ  193



>ref|XP_008664545.1| PREDICTED: uncharacterized protein LOC100194365 isoform X3 [Zea 
mays]
 tpg|DAA43651.1| TPA: hypothetical protein ZEAMMB73_480714 [Zea mays]
 tpg|DAA43652.1| TPA: hypothetical protein ZEAMMB73_480714 [Zea mays]
Length=237

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA----GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA     G  +++H    G+    R+ LP+E   EEP+YVNAKQYH ILRR
Sbjct  86   YPYADPYYGGAVAAAYGPHAIMHPQLVGMVPSSRVPLPIEPAAEEPIYVNAKQYHAILRR  145

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH HAM+RAR  GGRF+N K+
Sbjct  146  RQLRAKLEAENKLVKSRKPYLHESRHLHAMKRARGTGGRFLNTKQ  190



>ref|XP_009626581.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=302

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQY  666
            +L GHS     YPY +  + G     + VH     +   RM LPL++  EEPV+VNAKQY
Sbjct  97   ELTGHSAMLTSYPYPDLQYGGMMTYGAPVHPHLFEIHHARMPLPLDME-EEPVFVNAKQY  155

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            HGILRRRQ+RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  156  HGILRRRQIRAKAELEKKAIKARKPYLHESRHQHAMRRARGTGGRFLNTKK  206



>gb|KDP22098.1| hypothetical protein JCGZ_25929 [Jatropha curcas]
Length=306

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P +   + A G +S+ +    G+   RM LP E+  +EPVYVNA
Sbjct  83   ELVGHSIACASNPYQDPYYGGMMAAYGHQSLGYPHLLGMHHARMPLPHEMA-QEPVYVNA  141

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  142  KQYQGILRRRQARAKAELEKKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  193



>ref|XP_010241196.1| PREDICTED: nuclear transcription factor Y subunit A-7 isoform 
X3 [Nelumbo nucifera]
Length=192

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  HDLMGHSIQCAPYPYTEPAF---LGAAGGESV--VHQSAQGVRMV-LPLEVTTEEPVYVN  654
            H  +GHS+  A YPY +P +       G + +  +H    G+    +PL +  EEPVYVN
Sbjct  44   HHEVGHSVAQAVYPYPDPYYRSIFAPYGAQPMCQMHPHLMGIHQAGVPLPLDAEEPVYVN  103

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            AKQYHGILRRRQ RAKAE ENK++K+RKPYLHESRH HAMRRAR  GGRF+N K
Sbjct  104  AKQYHGILRRRQSRAKAESENKLIKSRKPYLHESRHLHAMRRARGCGGRFLNAK  157



>ref|XP_004985515.1| PREDICTED: nuclear transcription factor Y subunit A-6-like isoform 
X1 [Setaria italica]
Length=238

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGA--AGGESVVHQSAQGVRMV------LPLEVTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA  A G   +    Q V MV      LP+E   EEP+YVNAKQYH ILRR
Sbjct  95   YPYADPYYGGAVAAYGPHAIQMHPQLVGMVPSSRVPLPIEPAAEEPIYVNAKQYHAILRR  154

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  155  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNTKQ  199



>ref|XP_009626580.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=309

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +1

Query  490  EHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAK  660
            + +L GHS     YPY +  + G     + VH     +   RM LPL++  EEPV+VNAK
Sbjct  102  QKELTGHSAMLTSYPYPDLQYGGMMTYGAPVHPHLFEIHHARMPLPLDME-EEPVFVNAK  160

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QYHGILRRRQ+RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  161  QYHGILRRRQIRAKAELEKKAIKARKPYLHESRHQHAMRRARGTGGRFLNTKK  213



>ref|XP_004985517.1| PREDICTED: nuclear transcription factor Y subunit A-6-like isoform 
X3 [Setaria italica]
Length=233

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGA--AGGESVVHQSAQGVRMV------LPLEVTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA  A G   +    Q V MV      LP+E   EEP+YVNAKQYH ILRR
Sbjct  90   YPYADPYYGGAVAAYGPHAIQMHPQLVGMVPSSRVPLPIEPAAEEPIYVNAKQYHAILRR  149

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  150  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNTKQ  194



>ref|XP_008664533.1| PREDICTED: uncharacterized protein LOC100194365 isoform X1 [Zea 
mays]
 gb|ACN26797.1| unknown [Zea mays]
 tpg|DAA43659.1| TPA: hypothetical protein ZEAMMB73_480714 [Zea mays]
Length=249

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA----GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA     G  +++H    G+    R+ LP+E   EEP+YVNAKQYH ILRR
Sbjct  98   YPYADPYYGGAVAAAYGPHAIMHPQLVGMVPSSRVPLPIEPAAEEPIYVNAKQYHAILRR  157

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH HAM+RAR  GGRF+N K+
Sbjct  158  RQLRAKLEAENKLVKSRKPYLHESRHLHAMKRARGTGGRFLNTKQ  202



>ref|XP_010247679.1| PREDICTED: nuclear transcription factor Y subunit A-10-like isoform 
X1 [Nelumbo nucifera]
Length=380

 Score =   129 bits (325),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAF--LGAAGGESVVHQSAQGVRMVLPLEVTTEEPVYVNAKQYHGI  675
            +G  + CA YPY +  +      G ++V++Q     R++LPL +T + P+YVNAKQYHGI
Sbjct  178  LGQPMACANYPYMDQCYGIFTTYGSQTVMNQG----RVMLPLNMTEDGPIYVNAKQYHGI  233

Query  676  LRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            +RRRQ RAKAE+ENK++K RKPYLHESRH HAMRRAR  GGRF+N K
Sbjct  234  IRRRQSRAKAEMENKLIKVRKPYLHESRHLHAMRRARGCGGRFLNTK  280



>ref|XP_009396059.1| PREDICTED: nuclear transcription factor Y subunit A-4-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=292

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 71/87 (82%), Gaps = 4/87 (5%)
 Frame = +1

Query  568  GESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRK  738
            G+S+VH    G+   RM LPLE+T EEPVYVNAKQYHGILRRRQ RAKAELE KV+K RK
Sbjct  110  GQSIVHPQIIGMPHPRMPLPLEMT-EEPVYVNAKQYHGILRRRQSRAKAELEKKVIKVRK  168

Query  739  PYLHESRHKHAMRRARDGGGRFVNKKK  819
            PYLHESRH HAMRRAR  GGRF+N KK
Sbjct  169  PYLHESRHLHAMRRARGCGGRFLNTKK  195



>ref|XP_009366099.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Pyrus 
x bretschneideri]
 ref|XP_009366100.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Pyrus 
x bretschneideri]
Length=348

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY EP + G   A G + + +    G+   RM LPLE+  +EPVYVNA
Sbjct  121  ELVGHSIACASNPYQEPYYGGMMAAYGHQPLGYPPFFGMPHARMPLPLEMA-QEPVYVNA  179

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  180  KQYQGILRRRQARAKAELERKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  231



>ref|XP_008664541.1| PREDICTED: uncharacterized protein LOC100194365 isoform X2 [Zea 
mays]
 gb|ACG39368.1| nuclear transcription factor Y subunit A-3 [Zea mays]
 gb|ACL52857.1| unknown [Zea mays]
 gb|ACN36676.1| unknown [Zea mays]
 tpg|DAA43654.1| TPA: nuclear transcription factor Y subunit A-3 isoform 1 [Zea 
mays]
 tpg|DAA43655.1| TPA: nuclear transcription factor Y subunit A-3 isoform 2 [Zea 
mays]
Length=244

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA----GGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA     G  +++H    G+    R+ LP+E   EEP+YVNAKQYH ILRR
Sbjct  93   YPYADPYYGGAVAAAYGPHAIMHPQLVGMVPSSRVPLPIEPAAEEPIYVNAKQYHAILRR  152

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH HAM+RAR  GGRF+N K+
Sbjct  153  RQLRAKLEAENKLVKSRKPYLHESRHLHAMKRARGTGGRFLNTKQ  197



>ref|XP_010923674.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Elaeis guineensis]
Length=241

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGVR---MVLPLEVTTEEPVYVNAKQYH  669
            GH++    YP+ +P + G  AA G++V+H    G+    + LP E   EEPVYVNAKQYH
Sbjct  55   GHAVAPIAYPFVDPYYGGVFAAYGQTVIHPQMMGMHHAGVPLPAEAV-EEPVYVNAKQYH  113

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            GILRRRQ RAKAE ENK+++ RKPYLHESRH HA++RAR  GGRF+N K
Sbjct  114  GILRRRQSRAKAESENKLIRTRKPYLHESRHLHALKRARGSGGRFLNSK  162



>ref|XP_010241193.1| PREDICTED: nuclear transcription factor Y subunit A-7 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010241194.1| PREDICTED: nuclear transcription factor Y subunit A-7 isoform 
X1 [Nelumbo nucifera]
Length=202

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  HDLMGHSIQCAPYPYTEPAF---LGAAGGESV--VHQSAQGVRMV-LPLEVTTEEPVYVN  654
            H  +GHS+  A YPY +P +       G + +  +H    G+    +PL +  EEPVYVN
Sbjct  54   HHEVGHSVAQAVYPYPDPYYRSIFAPYGAQPMCQMHPHLMGIHQAGVPLPLDAEEPVYVN  113

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            AKQYHGILRRRQ RAKAE ENK++K+RKPYLHESRH HAMRRAR  GGRF+N K
Sbjct  114  AKQYHGILRRRQSRAKAESENKLIKSRKPYLHESRHLHAMRRARGCGGRFLNAK  167



>ref|XP_003600468.1| Nuclear transcription factor Y subunit [Medicago truncatula]
Length=289

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G       + + +    GV   RM LPLE+  +EPVYVNA
Sbjct  79   ELVGHSIACATNPYQDPYYGGMMAAYPHQPLGYPPFIGVPHARMPLPLEMA-QEPVYVNA  137

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K+RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  138  KQYQGILRRRQARAKAELERKLIKSRKPYLHESRHQHALRRARGTGGRFAKK  189



>ref|XP_009408550.1| PREDICTED: nuclear transcription factor Y subunit A-7-like [Musa 
acuminata subsp. malaccensis]
Length=234

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGVR---MVLPLEVTTEEPVYVNAKQ  663
            +G ++   PYPY +P + G   A GG+ V+H    GV    + LP +   EEPVYVNAKQ
Sbjct  55   VGQTMAPTPYPYVDPYYGGIFAAYGGQHVIHPQLIGVNHSGVPLPTDAV-EEPVYVNAKQ  113

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            YHGILRRRQ RAKAE ENK+ K RKPYLHESRH HA+RRAR  GGRF+N K
Sbjct  114  YHGILRRRQSRAKAESENKLAKLRKPYLHESRHLHALRRARGCGGRFLNSK  164



>ref|XP_002454647.1| hypothetical protein SORBIDRAFT_04g034760 [Sorghum bicolor]
 gb|EES07623.1| hypothetical protein SORBIDRAFT_04g034760 [Sorghum bicolor]
Length=264

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 73/113 (65%), Gaps = 9/113 (8%)
 Frame = +1

Query  505  GHSIQCAPYPYTE-------PAFLGAAGGESVVHQ--SAQGVRMVLPLEVTTEEPVYVNA  657
            G +I C  YPY          A+       +V H   S  G R+ LPLE+   EP+YVN 
Sbjct  43   GQTIACISYPYNHSGSGGVWAAYESGTTATTVFHSQISGGGARIPLPLELAENEPIYVNP  102

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            KQYHGILRRRQLRAK E +NK+VK RKPYLHESRH HAM+RAR  GGRF+N K
Sbjct  103  KQYHGILRRRQLRAKLEAQNKLVKARKPYLHESRHLHAMKRARGSGGRFLNTK  155



>ref|XP_008227314.1| PREDICTED: nuclear transcription factor Y subunit A-1 [Prunus 
mume]
 ref|XP_008227315.1| PREDICTED: nuclear transcription factor Y subunit A-1 [Prunus 
mume]
 ref|XP_008227316.1| PREDICTED: nuclear transcription factor Y subunit A-1 [Prunus 
mume]
Length=351

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   + G + + +    G+   RM LPLE+  +EPVYVNA
Sbjct  124  ELVGHSIACASNPYQDPYYAGMMASYGHQPLGYPPFLGMPHARMPLPLEMA-QEPVYVNA  182

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  183  KQYQGILRRRQARAKAELERKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  234



>emb|CDX70480.1| BnaC03g05640D [Brassica napus]
Length=259

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 78/112 (70%), Gaps = 13/112 (12%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVR---------MVLPLEVTTEEPVY  648
            +L+GH I C P PY +P + G    E+  HQ  QG R           LPL++T +EPVY
Sbjct  108  ELVGHYIACVPNPYQDPYYGGMV--EAYGHQQLQGFRPYLGMPGERTALPLDMT-QEPVY  164

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            VNAKQY GILRRR+ RAKAELE KV+ N+KPYLHESRHKHAMRRAR  GGRF
Sbjct  165  VNAKQYQGILRRRKARAKAELERKVI-NKKPYLHESRHKHAMRRARASGGRF  215



>ref|XP_008344681.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Malus 
domestica]
Length=348

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + + +    G+   RM LPLE+  +EPVYVNA
Sbjct  121  ELVGHSIACASNPYQDPYYGGMMAAYGHQPLGYPPFLGMPHARMPLPLEMA-QEPVYVNA  179

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  180  KQYQGILRRRQARAKAELERKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  231



>gb|AIZ68346.1| CCAAT-binding transcription factor B [Triticum aestivum]
Length=254

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 92/147 (63%), Gaps = 10/147 (7%)
 Frame = +1

Query  391  EPKGFTELHTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAAGG  570
            +PKG +   + D + +     +     HS  A+++   GH + C  YP+ +   + AA G
Sbjct  12   DPKGDSFGKSVDDHMR---STLTFGDKHSVFASQNTDYGHPMACISYPFNDSGSVWAAYG  68

Query  571  ESVVHQS--AQG-----VRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVK  729
               + Q   A+G      R+ LP+E+  +EP++VN KQY+GILRRRQLRAK E +NK+ K
Sbjct  69   SRAMFQPLMAEGGASATARVPLPVELAADEPIFVNPKQYNGILRRRQLRAKLEAQNKLTK  128

Query  730  NRKPYLHESRHKHAMRRARDGGGRFVN  810
            NRKPYLHESRH HAM+RAR  GGRF+N
Sbjct  129  NRKPYLHESRHLHAMKRARGSGGRFLN  155



>ref|XP_007212260.1| hypothetical protein PRUPE_ppa006634mg [Prunus persica]
 gb|EMJ13459.1| hypothetical protein PRUPE_ppa006634mg [Prunus persica]
Length=402

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G + + +    G+   RM LPLE+  +EPVYVNA
Sbjct  124  ELVGHSIACASNPYQDPYYAGMMAAYGHQPLGYPPFLGMPHARMPLPLEMA-QEPVYVNA  182

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  183  KQYQGILRRRQARAKAELERKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  234



>ref|XP_010520178.1| PREDICTED: nuclear transcription factor Y subunit A-4-like isoform 
X2 [Tarenaya hassleriana]
Length=270

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 78/107 (73%), Gaps = 10/107 (9%)
 Frame = +1

Query  514  IQCA---PYPYTEPAFLGAAGGESVVHQSAQGV--RMVLPLEVTTEEPVYVNAKQYHGIL  678
            I CA   PY   +P +        + +  + GV  RMVLPLE+  EEPVYVNAKQYHGIL
Sbjct  105  ISCAHSDPYYRVDPVY----DPNPMAYPHSLGVQERMVLPLEMA-EEPVYVNAKQYHGIL  159

Query  679  RRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RRR+LRAKAELENKV+K RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  160  RRRKLRAKAELENKVLKVRKPYLHESRHLHAMRRARGCGGRFLNTKK  206



>ref|XP_007133814.1| hypothetical protein PHAVU_011G211300g [Phaseolus vulgaris]
 ref|XP_007133815.1| hypothetical protein PHAVU_011G211300g [Phaseolus vulgaris]
 ref|XP_007133816.1| hypothetical protein PHAVU_011G211300g [Phaseolus vulgaris]
 ref|XP_007133817.1| hypothetical protein PHAVU_011G211300g [Phaseolus vulgaris]
 gb|ESW05808.1| hypothetical protein PHAVU_011G211300g [Phaseolus vulgaris]
 gb|ESW05809.1| hypothetical protein PHAVU_011G211300g [Phaseolus vulgaris]
 gb|ESW05810.1| hypothetical protein PHAVU_011G211300g [Phaseolus vulgaris]
 gb|ESW05811.1| hypothetical protein PHAVU_011G211300g [Phaseolus vulgaris]
Length=275

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 83/122 (68%), Gaps = 8/122 (7%)
 Frame = +1

Query  472  HSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTT  633
            H  P    + +GHS+     PY +  +   L   G + +++    G+   RM LPLE+  
Sbjct  73   HLAPNPHTEFVGHSVVLTS-PYLDAQYGQMLTTYGQQVMINPPLYGMHQARMALPLEME-  130

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ RAKAELE KV++NRKPYLHESRH HA+RRAR  GGRF+N 
Sbjct  131  EEPVYVNAKQYHGILRRRQSRAKAELEKKVIRNRKPYLHESRHLHAIRRARGNGGRFLNT  190

Query  814  KK  819
            KK
Sbjct  191  KK  192



>ref|XP_009343714.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Pyrus x bretschneideri]
Length=348

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G   + +    G+   RM LPLE+  +EPVYVNA
Sbjct  121  ELVGHSIACASNPYQDPYYGGMMAAYGHPPLGYPPFLGMPHARMPLPLEMA-QEPVYVNA  179

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  180  KQYQGILRRRQARAKAELERKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  231



>emb|CDP18655.1| unnamed protein product [Coffea canephora]
Length=144

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 88/137 (64%), Gaps = 16/137 (12%)
 Frame = +1

Query  604  RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRA  783
            R+ LPLE+  EEPVYVNAKQYHGILRRRQLRAKAELENKV K RKPYLHESRH HAMRRA
Sbjct  5    RLALPLELA-EEPVYVNAKQYHGILRRRQLRAKAELENKVAKARKPYLHESRHLHAMRRA  63

Query  784  RDGGGRFVNKK---KsdstsnntppcssnvnssEAKNCISDSH--------GC---PGSE  921
            R  GGRF++KK   KSDS + +      N   +E K+ +   H         C    G  
Sbjct  64   RGCGGRFLSKKNVDKSDSRAASKKSIDFNATPTEMKDSLGSQHPFSSTSQKSCNEVKGFL  123

Query  922  ASGMQGSAEYVQWGYEY  972
               MQ +  + +WGY+Y
Sbjct  124  LQEMQNTNTF-EWGYQY  139



>ref|XP_009131289.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Brassica rapa]
 ref|XP_009131290.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Brassica rapa]
Length=255

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 80/113 (71%), Gaps = 14/113 (12%)
 Frame = +1

Query  496  DLMGHSIQ-CAPYPYTEPAFLGAAGGESVVHQSAQGVR---------MVLPLEVTTEEPV  645
            +L+GH IQ C P PY +P + G  G  +  HQ  QG R           LPL++T +EPV
Sbjct  108  ELVGHYIQACVPNPYQDPYYGGMVG--AYGHQQLQGFRPYPGMPGERTALPLDMT-QEPV  164

Query  646  YVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            YVNAKQYHGILRRR+ RAKAELE K++ NRKPYLHESRHKHAM+RAR  GGRF
Sbjct  165  YVNAKQYHGILRRRKARAKAELERKLI-NRKPYLHESRHKHAMKRARASGGRF  216



>ref|XP_004306538.1| PREDICTED: nuclear transcription factor Y subunit A-9-like [Fragaria 
vesca subsp. vesca]
Length=338

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 85/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  487  TEHDLMGHSIQ-----CAPYPYTEPAFLGAA---GGESVVHQSAQGV---RMVLPLEVTT  633
            ++ +L+GHSI         YPY +P + G     G  ++V     G+   RM LPLE+  
Sbjct  109  SQMELVGHSIAQKFLVLTSYPYPDPQYGGMLTHYGPRAMVPPQFYGLHHGRMPLPLEME-  167

Query  634  EEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            EEPVYVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH+HA+RRAR  GGRF+N 
Sbjct  168  EEPVYVNAKQYHGILRRRQSRAKAELERKLIKVRKPYLHESRHQHALRRARGCGGRFLNT  227

Query  814  KK  819
            KK
Sbjct  228  KK  229



>gb|ADY38377.1| nuclear transcription factor Y subunit A7 [Triticum monococcum]
Length=235

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  93   YPYADPYYGGAVAAYGAHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQYHAILRR  152

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  153  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  197



>ref|XP_009131294.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X4 [Brassica rapa]
Length=254

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 80/113 (71%), Gaps = 14/113 (12%)
 Frame = +1

Query  496  DLMGHSIQ-CAPYPYTEPAFLGAAGGESVVHQSAQGVR---------MVLPLEVTTEEPV  645
            +L+GH IQ C P PY +P + G  G  +  HQ  QG R           LPL++T +EPV
Sbjct  107  ELVGHYIQACVPNPYQDPYYGGMVG--AYGHQQLQGFRPYPGMPGERTALPLDMT-QEPV  163

Query  646  YVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            YVNAKQYHGILRRR+ RAKAELE K++ NRKPYLHESRHKHAM+RAR  GGRF
Sbjct  164  YVNAKQYHGILRRRKARAKAELERKLI-NRKPYLHESRHKHAMKRARASGGRF  215



>gb|AFK49647.1| nuclear transcription factor Y subunit A5 [Medicago truncatula]
 gb|AES70719.2| CCAAT-binding transcription factor [Medicago truncatula]
Length=329

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G       + + +    GV   RM LPLE+  +EPVYVNA
Sbjct  119  ELVGHSIACATNPYQDPYYGGMMAAYPHQPLGYPPFIGVPHARMPLPLEMA-QEPVYVNA  177

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K+RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  178  KQYQGILRRRQARAKAELERKLIKSRKPYLHESRHQHALRRARGTGGRFAKK  229



>gb|AGH62008.1| nuclear transcription factor Y subunit A-3 [Arachis hypogaea]
Length=224

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 81/114 (71%), Gaps = 10/114 (9%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAFLGA-------AGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            HS+  AP+PY+EP F G+       A G+  +     G+   R+ LPL++  + P+YVNA
Sbjct  23   HSMAHAPFPYSEPFFGGSLVAYGPQAVGQPQMLPQVLGLGSPRIALPLDLAEDGPIYVNA  82

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            KQYHGILRRRQ RAK E +NK++KNRKPYLHESRH+HA++R R  GGRF++ K+
Sbjct  83   KQYHGILRRRQSRAKLEAQNKLIKNRKPYLHESRHRHALKRVRGSGGRFLSAKQ  136



>ref|XP_006399769.1| hypothetical protein EUTSA_v10014364mg [Eutrema salsugineum]
 gb|ESQ41222.1| hypothetical protein EUTSA_v10014364mg [Eutrema salsugineum]
Length=273

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 81/112 (72%), Gaps = 8/112 (7%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GH I C P PY +P +   +GA G + +  +   G+   R  LPL++T +EPV+VNA
Sbjct  121  ELVGHYIACVPNPYQDPYYGGMMGAYGHQPLGFRPYLGMPRARTALPLDMT-QEPVFVNA  179

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRR+ RAKAELE KV+ NRKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  180  KQYEGILRRRKARAKAELERKVI-NRKPYLHESRHKHAMRRARASGGRFAKK  230



>ref|XP_006399770.1| hypothetical protein EUTSA_v10014364mg [Eutrema salsugineum]
 gb|ESQ41223.1| hypothetical protein EUTSA_v10014364mg [Eutrema salsugineum]
Length=274

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 81/112 (72%), Gaps = 8/112 (7%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GH I C P PY +P +   +GA G + +  +   G+   R  LPL++T +EPV+VNA
Sbjct  122  ELVGHYIACVPNPYQDPYYGGMMGAYGHQPLGFRPYLGMPRARTALPLDMT-QEPVFVNA  180

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRR+ RAKAELE KV+ NRKPYLHESRHKHAMRRAR  GGRF  K
Sbjct  181  KQYEGILRRRKARAKAELERKVI-NRKPYLHESRHKHAMRRARASGGRFAKK  231



>ref|XP_010102352.1| Nuclear transcription factor Y subunit A-1 [Morus notabilis]
 gb|EXB93313.1| Nuclear transcription factor Y subunit A-1 [Morus notabilis]
Length=349

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G     G + + +    G+   RM LPLE+  +EPVYVNA
Sbjct  122  ELVGHSIACASNPYQDPYYGGMMTVYGHQPLGYPPFFGMPQARMPLPLEMA-QEPVYVNA  180

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  181  KQYQGILRRRQARAKAELEKKLIKVRKPYLHESRHQHAMRRARGSGGRFAKK  232



>ref|XP_009343707.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009343708.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009343709.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009343710.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009343711.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009343713.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Pyrus x bretschneideri]
Length=358

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G   + +    G+   RM LPLE+  +EPVYVNA
Sbjct  131  ELVGHSIACASNPYQDPYYGGMMAAYGHPPLGYPPFLGMPHARMPLPLEMA-QEPVYVNA  189

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  190  KQYQGILRRRQARAKAELERKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  241



>ref|XP_010278974.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Nelumbo nucifera]
Length=329

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 80/113 (71%), Gaps = 19/113 (17%)
 Frame = +1

Query  481  PATEHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVRMVLPLEVTTEEPVYVNAK  660
            P T+ +L+GHSI         P  LG       +H +    RM LPLE+T EEPVYVNAK
Sbjct  120  PHTQLELIGHSI-------AHPHLLG-------MHHT----RMPLPLEMT-EEPVYVNAK  160

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QYHGILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  161  QYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHAMRRARGCGGRFLNTKK  213



>ref|XP_009374949.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Pyrus x bretschneideri]
Length=348

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G   + +    G+   RM LPLE+  +EPVYVNA
Sbjct  121  ELVGHSIACASNPYQDPHYGGMMAAYGHPPLGYPPFLGMPHARMPLPLEMA-QEPVYVNA  179

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  180  KQYQGILRRRQARAKAELERKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  231



>ref|XP_009374946.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009374948.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Pyrus x bretschneideri]
Length=358

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G   A G   + +    G+   RM LPLE+  +EPVYVNA
Sbjct  131  ELVGHSIACASNPYQDPHYGGMMAAYGHPPLGYPPFLGMPHARMPLPLEMA-QEPVYVNA  189

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  190  KQYQGILRRRQARAKAELERKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  241



>ref|XP_010088228.1| Nuclear transcription factor Y subunit A-9 [Morus notabilis]
 gb|EXB32780.1| Nuclear transcription factor Y subunit A-9 [Morus notabilis]
Length=316

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV--  603
            V S     +  H  P ++ +L+       PYPY +P +   LG  G   +V     G+  
Sbjct  97   VPSSTTLAAGEHLDPNSQMELV-----LTPYPYGDPHYSGVLGPYGLPPMVPPHLYGMYP  151

Query  604  -RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRR  780
             RM LPLE+  EEPVYVNAKQYHGILRRRQ RAKAELE K +K RKPYLHESRH HAMRR
Sbjct  152  GRMPLPLEME-EEPVYVNAKQYHGILRRRQSRAKAELEKKAIKARKPYLHESRHLHAMRR  210

Query  781  ARDGGGRFVNKKK  819
            AR  GGRF+N KK
Sbjct  211  ARGCGGRFLNTKK  223



>gb|AIZ68348.1| CCAAT-binding transcription factor B [Triticum aestivum]
Length=243

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  93   YPYADPYYGGAVAAYGAHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQYHAILRR  152

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  153  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  197



>emb|CAM12542.1| YA4 [Antirrhinum majus]
Length=304

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 91/147 (62%), Gaps = 21/147 (14%)
 Frame = +1

Query  421  SDKNCKVESENVAMSPHHSRPATEH--------DLMGHSIQCAPYPY-TEPAFLGAAGGE  573
            SD+N + E  ++   P    P  +         +L GHSI CA  PY T    + AA G+
Sbjct  87   SDRNYRQEGSSLQQVPPTLHPINDGSLTQPPQLELTGHSIACASNPYDTYYGGMMAAYGQ  146

Query  574  SVV-------HQSAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKN  732
             +V       HQ+    RM LPLE+  +EPVYVNAKQYHGILRRRQ RAKAELE K++K 
Sbjct  147  PLVPSHLYEMHQT----RMPLPLEMA-QEPVYVNAKQYHGILRRRQSRAKAELEKKLIKV  201

Query  733  RKPYLHESRHKHAMRRARDGGGRFVNK  813
            RKPYLHESRH+HA+RR R  GGRF  K
Sbjct  202  RKPYLHESRHQHALRRERGSGGRFAKK  228



>gb|AES70718.2| CCAAT-binding transcription factor [Medicago truncatula]
Length=349

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G       + + +    GV   RM LPLE+  +EPVYVNA
Sbjct  139  ELVGHSIACATNPYQDPYYGGMMAAYPHQPLGYPPFIGVPHARMPLPLEMA-QEPVYVNA  197

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K+RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  198  KQYQGILRRRQARAKAELERKLIKSRKPYLHESRHQHALRRARGTGGRFAKK  249



>ref|XP_010520177.1| PREDICTED: nuclear transcription factor Y subunit A-5-like isoform 
X1 [Tarenaya hassleriana]
Length=300

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 78/107 (73%), Gaps = 10/107 (9%)
 Frame = +1

Query  514  IQCA---PYPYTEPAFLGAAGGESVVHQSAQGV--RMVLPLEVTTEEPVYVNAKQYHGIL  678
            I CA   PY   +P +        + +  + GV  RMVLPLE+  EEPVYVNAKQYHGIL
Sbjct  135  ISCAHSDPYYRVDPVY----DPNPMAYPHSLGVQERMVLPLEMA-EEPVYVNAKQYHGIL  189

Query  679  RRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RRR+LRAKAELENKV+K RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  190  RRRKLRAKAELENKVLKVRKPYLHESRHLHAMRRARGCGGRFLNTKK  236



>ref|XP_009414802.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414803.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414804.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414805.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV----RMVLPLEVTTEEPVYVNAKQY  666
             S    PYPY +P + G     G  +V+     G+    R+ LPL+   EEP+YVNAKQY
Sbjct  142  QSFAPVPYPYADPYYGGIFAVCGPHAVIQPQMTGIASPARVPLPLQPAAEEPIYVNAKQY  201

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            + ILRRRQLRAK E +NK++KNRKPYLHESRH HAM+RAR  GGRF+N K
Sbjct  202  NAILRRRQLRAKLEAQNKLIKNRKPYLHESRHLHAMKRARGSGGRFLNTK  251



>gb|AAS78480.1| CCAAT-box transcription factor complex WHAP6 [Triticum aestivum]
Length=242

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  92   YPYADPYYGGAVAAYGAHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQYHAILRR  151

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  152  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  196



>ref|XP_003600467.1| Nuclear transcription factor Y subunit [Medicago truncatula]
Length=349

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGG---ESVVHQSAQGV---RMVLPLEVTTEEPVYVNA  657
            +L+GHSI CA  PY +P + G       + + +    GV   RM LPLE+  +EPVYVNA
Sbjct  139  ELVGHSIACATNPYQDPYYGGMMAAYPHQPLGYPPFIGVPHARMPLPLEMA-QEPVYVNA  197

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            KQY GILRRRQ RAKAELE K++K+RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  198  KQYQGILRRRQARAKAELERKLIKSRKPYLHESRHQHALRRARGTGGRFAKK  249



>gb|AAS78482.1| CCAAT-box transcription factor complex WHAP8 [Triticum aestivum]
Length=242

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  92   YPYADPYYGGAVAAYGAHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQYHAILRR  151

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  152  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  196



>gb|KHG16925.1| Nuclear transcription factor Y subunit A-5 -like protein [Gossypium 
arboreum]
Length=302

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 11/131 (8%)
 Frame = +1

Query  439  VESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQG-VR  606
            + + N  +SP H           HS+ CA YPYT+  F G     G +++   +     R
Sbjct  103  LNNPNTLLSPSHPN-------YNHSMACAQYPYTDAYFTGLFTPYGQQTIAQMTGTAPTR  155

Query  607  MVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRAR  786
            + LPL++  +EP+YVN KQYHGILRRR+ RAK E  NK+VK+RKPYLHESRH HAM R R
Sbjct  156  IPLPLDLAEDEPIYVNPKQYHGILRRRRHRAKVETRNKLVKSRKPYLHESRHLHAMNRIR  215

Query  787  DGGGRFVNKKK  819
              GGRF++KKK
Sbjct  216  GSGGRFLSKKK  226



>gb|AGT16982.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
Length=263

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 72/115 (63%), Gaps = 11/115 (10%)
 Frame = +1

Query  505  GHSIQCAPYPYTE-------PAFLGAAGGESVVHQSAQG----VRMVLPLEVTTEEPVYV  651
            G +I C  YPY          A+       +V H    G     R+ LPLE+   EP+YV
Sbjct  40   GQTIACISYPYNHSGSGGVWAAYESGTTAATVFHSQISGGGTSARIPLPLELAENEPIYV  99

Query  652  NAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            N KQYHGILRRRQLRAK E +NK+VK RKPYLHESRH HAM+RAR  GGRF+N K
Sbjct  100  NPKQYHGILRRRQLRAKLEAQNKLVKARKPYLHESRHLHAMKRARGSGGRFLNTK  154



>gb|AGT16671.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
Length=263

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 72/115 (63%), Gaps = 11/115 (10%)
 Frame = +1

Query  505  GHSIQCAPYPYTE-------PAFLGAAGGESVVHQSAQG----VRMVLPLEVTTEEPVYV  651
            G +I C  YPY          A+       +V H    G     R+ LPLE+   EP+YV
Sbjct  40   GQTIACISYPYNHSGSGGVWAAYESGTTAATVFHSQISGGGTSARIPLPLELAENEPIYV  99

Query  652  NAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            N KQYHGILRRRQLRAK E +NK+VK RKPYLHESRH HAM+RAR  GGRF+N K
Sbjct  100  NPKQYHGILRRRQLRAKLEAQNKLVKARKPYLHESRHLHAMKRARGSGGRFLNTK  154



>ref|XP_006448911.1| hypothetical protein CICLE_v10016491mg [Citrus clementina]
 gb|ESR62151.1| hypothetical protein CICLE_v10016491mg [Citrus clementina]
Length=212

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGA-------------AGGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+ +VH    G++   +PL     EE
Sbjct  59   GHAMAPAAYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPTDAVEE  118

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKV+K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  119  PVFVNAKQYHGILRRRQSRAKAESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKK  178



>ref|XP_008778424.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X5 [Phoenix dactylifera]
Length=177

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 6/101 (6%)
 Frame = +1

Query  529  YPYTEPAFLG--AAGGESVVHQSAQGVR---MVLPLEVTTEEPVYVNAKQYHGILRRRQL  693
            YPY +P + G  AA G++V H    G++   + LP E   EEPVYVNAKQYHGILRRRQ 
Sbjct  28   YPYVDPYYGGGFAAFGQTVFHPQMMGMQHPGVPLPTEAV-EEPVYVNAKQYHGILRRRQS  86

Query  694  RAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            RAKAE ENK++K+RKPYLHESRH HA++RAR  GGRF+N K
Sbjct  87   RAKAESENKLIKSRKPYLHESRHLHALKRARGCGGRFLNSK  127



>ref|XP_006468306.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X3 [Citrus sinensis]
 gb|KDO75267.1| hypothetical protein CISIN_1g0264741mg [Citrus sinensis]
Length=212

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGA-------------AGGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+ +VH    G++   +PL     EE
Sbjct  59   GHAMAPAAYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPTDAVEE  118

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKV+K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  119  PVFVNAKQYHGILRRRQSRAKAESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKK  178



>gb|AGT15964.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
 gb|AGT16579.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
 gb|AGT16615.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
 gb|AGT16633.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
 gb|AGT16650.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
 gb|AGT16700.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
 gb|AGT16745.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
Length=263

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 72/115 (63%), Gaps = 11/115 (10%)
 Frame = +1

Query  505  GHSIQCAPYPYTE-------PAFLGAAGGESVVHQSAQG----VRMVLPLEVTTEEPVYV  651
            G +I C  YPY          A+       +V H    G     R+ LPLE+   EP+YV
Sbjct  40   GQTIACISYPYNHSGSGGVWAAYESGTTAATVFHSQISGGGTSARIPLPLELAENEPIYV  99

Query  652  NAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            N KQYHGILRRRQLRAK E +NK+VK RKPYLHESRH HAM+RAR  GGRF+N K
Sbjct  100  NPKQYHGILRRRQLRAKLEAQNKLVKARKPYLHESRHLHAMKRARGSGGRFLNTK  154



>ref|XP_010273959.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Nelumbo 
nucifera]
 ref|XP_010273960.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Nelumbo 
nucifera]
Length=300

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = +1

Query  508  HSIQCAPYPYTEP---AFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYH  669
             S+ C PYPY EP    +L A   ++V+H    G+   R+ LPL ++ +EP+YVNAKQY 
Sbjct  100  QSVACIPYPYAEPYLSGYLTAYVPQTVIHPQMIGMVPARIPLPLGLSEDEPIYVNAKQYR  159

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            GILRRRQ RAK E +NK+VK+RK YLHESRH HA++RAR  GGRF+N K+
Sbjct  160  GILRRRQSRAKLEAQNKLVKSRKAYLHESRHLHALKRARGSGGRFLNIKQ  209



>emb|CDX97206.1| BnaC09g44190D [Brassica napus]
Length=285

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 85/122 (70%), Gaps = 9/122 (7%)
 Frame = +1

Query  469  HHSRPATEHDLMGHSIQCAP-YPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEV  627
            H+ +P    +L+GH + C P  PY +P +   +GA G + +  +   G+   R  LPL++
Sbjct  120  HNQQPVQPPELVGHYMACVPPNPYQDPYYAGMMGAYGHQPLGFRPYLGMPRERTALPLDI  179

Query  628  TTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFV  807
            T +EPVYVNAKQY GILRRR+ RAKAELE KV+ NRKPYLHESRHKHAMRRAR  GGRF 
Sbjct  180  T-QEPVYVNAKQYEGILRRRKARAKAELERKVI-NRKPYLHESRHKHAMRRARASGGRFA  237

Query  808  NK  813
             K
Sbjct  238  KK  239



>ref|XP_011012079.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Populus euphratica]
 ref|XP_011012080.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Populus euphratica]
 ref|XP_011012081.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Populus euphratica]
Length=207

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 86/135 (64%), Gaps = 15/135 (11%)
 Frame = +1

Query  460  MSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLG-------------AAGGESVVHQSAQG  600
            +SP + + AT     GH++  A YPY +P +                 G + +VH    G
Sbjct  38   ISPPNFQCATPQLGAGHAMAPAAYPYPDPYYRSIFAPYDAQPYAPQPYGAQPMVHLQLMG  97

Query  601  VRMV-LPLEV-TTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAM  774
            ++   +PL     EEPV+VNAKQYHGILRRRQ RAKAELENK +K+RKPYLHESRH+HA+
Sbjct  98   IQQAGVPLPSDAVEEPVFVNAKQYHGILRRRQSRAKAELENKAIKSRKPYLHESRHQHAL  157

Query  775  RRARDGGGRFVNKKK  819
            +RAR  GGRF+N KK
Sbjct  158  KRARGCGGRFLNSKK  172



>ref|XP_006468307.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X4 [Citrus sinensis]
 gb|KDO75269.1| hypothetical protein CISIN_1g0264741mg [Citrus sinensis]
Length=176

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGA-------------AGGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+ +VH    G++   +PL     EE
Sbjct  23   GHAMAPAAYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPTDAVEE  82

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKV+K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  83   PVFVNAKQYHGILRRRQSRAKAESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKK  142



>gb|AGT16714.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
Length=263

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 72/115 (63%), Gaps = 11/115 (10%)
 Frame = +1

Query  505  GHSIQCAPYPYTE-------PAFLGAAGGESVVHQSAQG----VRMVLPLEVTTEEPVYV  651
            G +I C  YPY          A+       +V H    G     R+ LPLE+   EP+YV
Sbjct  40   GQTIACISYPYNHSGSGGVWAAYESGTTAATVFHSQISGGGTSARIPLPLELAENEPIYV  99

Query  652  NAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            N KQYHGILRRRQLRAK E +NK+VK RKPYLHESRH HAM+RAR  GGRF+N K
Sbjct  100  NPKQYHGILRRRQLRAKLEAQNKLVKARKPYLHESRHLHAMKRARGSGGRFLNTK  154



>ref|XP_008794455.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X3 [Phoenix dactylifera]
Length=187

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGVRMV---LPLEVTTEEPVYVNAKQYH  669
            GH++    YP+ +P   G  AA G++V+     G++ V   LP E   EEPVYVNAKQYH
Sbjct  17   GHAVAQVAYPFVDPYSGGVFAAYGQTVMQPQMMGMQHVGVPLPTE-AVEEPVYVNAKQYH  75

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            GILRRRQ RAKAE ENK++K RKPYLHESRH HA++RAR  GGRF+N K
Sbjct  76   GILRRRQSRAKAESENKLIKTRKPYLHESRHLHAVKRARGSGGRFLNSK  124



>gb|AGT16937.1| nuclear transcription factor [Saccharum hybrid cultivar R570]
Length=262

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 72/115 (63%), Gaps = 11/115 (10%)
 Frame = +1

Query  505  GHSIQCAPYPYTE-------PAFLGAAGGESVVHQSAQG----VRMVLPLEVTTEEPVYV  651
            G +I C  YPY          A+       +V H    G     R+ LPLE+   EP+YV
Sbjct  39   GQTIACISYPYNHSGSGGVWAAYESGTTAATVFHSQISGGGTSARIPLPLELAENEPIYV  98

Query  652  NAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            N KQYHGILRRRQLRAK E +NK+VK RKPYLHESRH HAM+RAR  GGRF+N K
Sbjct  99   NPKQYHGILRRRQLRAKLEAQNKLVKARKPYLHESRHLHAMKRARGSGGRFLNTK  153



>ref|XP_010031785.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Eucalyptus 
grandis]
 ref|XP_010031786.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Eucalyptus 
grandis]
 ref|XP_010031787.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Eucalyptus 
grandis]
Length=222

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 6/111 (5%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAK  660
            +L+GH+I CA  PY +P + G  A  G   +     G+   RM LPL++  +EPVYVNAK
Sbjct  13   ELVGHTIACASNPYQDPYYGGLMAQYGHQSMAYPFVGIPHARMPLPLDLA-QEPVYVNAK  71

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            Q+ GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  72   QFQGILRRRQARAKAELEKKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  122



>dbj|BAJ86591.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=243

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  92   YPYADPYYGGAVAAYGTHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQYHAILRR  151

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  152  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  196



>gb|AAS78479.1| CCAAT-box transcription factor complex WHAP5 [Triticum aestivum]
Length=244

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  92   YPYADPYYGGAVAAYGTHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQYHAILRR  151

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  152  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  196



>ref|XP_006448912.1| hypothetical protein CICLE_v10016491mg [Citrus clementina]
 gb|ESR62152.1| hypothetical protein CICLE_v10016491mg [Citrus clementina]
Length=220

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGAA-------------GGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+ +VH    G++   +PL     EE
Sbjct  67   GHAMAPAAYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPTDAVEE  126

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKV+K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  127  PVFVNAKQYHGILRRRQSRAKAESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKK  186



>gb|AAS78478.1| CCAAT-box transcription factor complex WHAP4 [Triticum aestivum]
 gb|AIZ68349.1| CCAAT-binding transcription factor B [Triticum aestivum]
Length=244

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  92   YPYADPYYGGAVAAYGTHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQYHAILRR  151

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  152  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  196



>gb|AAS78477.1| CCAAT-box transcription factor complex WHAP3 [Triticum aestivum]
Length=244

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  92   YPYADPYYGGAVAAYGTHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQYHAILRR  151

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  152  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  196



>ref|XP_006468305.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X2 [Citrus sinensis]
 gb|KDO75264.1| hypothetical protein CISIN_1g0264741mg [Citrus sinensis]
Length=220

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGAA-------------GGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+ +VH    G++   +PL     EE
Sbjct  67   GHAMAPAAYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPTDAVEE  126

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKV+K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  127  PVFVNAKQYHGILRRRQSRAKAESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKK  186



>ref|XP_006826447.1| hypothetical protein AMTR_s00004p00174960 [Amborella trichopoda]
 gb|ERM93684.1| hypothetical protein AMTR_s00004p00174960 [Amborella trichopoda]
Length=273

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 82/113 (73%), Gaps = 6/113 (5%)
 Frame = +1

Query  487  TEHDL-MGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVRMVLPLEVT-TEEPVYVNAK  660
            T  DL +G ++ CA YP+ +  F G     S   Q+  G R++LPLE+T  E+P+YVNAK
Sbjct  56   TRCDLGLGQAMVCANYPHVD-QFCGLF--SSYGSQAMNG-RLLLPLEMTEDEQPIYVNAK  111

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QY  ILRRRQ RAKAELENKV+K RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  112  QYRQILRRRQSRAKAELENKVIKARKPYLHESRHLHAMRRARGCGGRFLNTKK  164



>gb|AAS78487.1| CCAAT-box transcription factor complex WHAP13 [Triticum aestivum]
Length=244

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQYH ILRR
Sbjct  92   YPYADPYYGGAVAAYGTHAIMHPQMVGMVPASRVPLPIEPAAAEEPIYVNAKQYHAILRR  151

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  152  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  196



>ref|XP_006448913.1| hypothetical protein CICLE_v10016491mg [Citrus clementina]
 gb|ESR62153.1| hypothetical protein CICLE_v10016491mg [Citrus clementina]
Length=238

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGAA-------------GGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+ +VH    G++   +PL     EE
Sbjct  85   GHAMAPAAYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPTDAVEE  144

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKV+K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  145  PVFVNAKQYHGILRRRQSRAKAESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKK  204



>ref|XP_007212071.1| hypothetical protein PRUPE_ppa011627mg [Prunus persica]
 ref|XP_008225593.1| PREDICTED: nuclear transcription factor Y subunit A-7 [Prunus 
mume]
 gb|EMJ13270.1| hypothetical protein PRUPE_ppa011627mg [Prunus persica]
Length=202

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 78/120 (65%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLG-------------AAGGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+  VH    G++   +PL     EE
Sbjct  49   GHAVAPAAYPYPDPYYRSIFAPYDTQPYPPQPYGGQPTVHLQLMGIQQAGVPLPSDAVEE  108

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENK +K+RKPYLHESRH+HA+RRAR  GGRF+N KK
Sbjct  109  PVFVNAKQYHGILRRRQSRAKAESENKALKSRKPYLHESRHQHALRRARGCGGRFLNAKK  168



>emb|CDY53967.1| BnaA10g29990D [Brassica napus]
Length=284

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 85/122 (70%), Gaps = 9/122 (7%)
 Frame = +1

Query  469  HHSRPATEHDLMGHSIQCAP-YPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEV  627
            H+ +P    +L+GH + C P  PY +P +   +GA G + +  +   G+   R  LPL++
Sbjct  120  HNQQPVQPPELVGHYMACVPPNPYQDPYYAGMMGAYGHQPLGFRPYLGMPRERTALPLDI  179

Query  628  TTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFV  807
            T +EPVYVNAKQY GILRRR+ RAKAELE KV+ NRKPYLHESRHKHAMRRAR  GGRF 
Sbjct  180  T-QEPVYVNAKQYEGILRRRKARAKAELERKVI-NRKPYLHESRHKHAMRRARASGGRFA  237

Query  808  NK  813
             K
Sbjct  238  KK  239



>ref|XP_006468304.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Citrus sinensis]
 gb|KDO75266.1| hypothetical protein CISIN_1g0264741mg [Citrus sinensis]
Length=238

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGAA-------------GGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                 GG+ +VH    G++   +PL     EE
Sbjct  85   GHAMAPAAYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPTDAVEE  144

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKV+K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  145  PVFVNAKQYHGILRRRQSRAKAESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKK  204



>ref|XP_011020342.1| PREDICTED: nuclear transcription factor Y subunit A-10-like [Populus 
euphratica]
Length=305

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 77/113 (68%), Gaps = 19/113 (17%)
 Frame = +1

Query  481  PATEHDLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVRMVLPLEVTTEEPVYVNAK  660
            P+T+ +L+GHSI  + Y    PA                  RMVLP E+  EEPVYVNAK
Sbjct  111  PSTQLELVGHSIVHSQYAGPNPA------------------RMVLPHEMA-EEPVYVNAK  151

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            QYHGILRRRQ RAKAELE K++K RKPYLHESRH HAMRRAR  GGRF+N KK
Sbjct  152  QYHGILRRRQSRAKAELERKLIKTRKPYLHESRHLHAMRRARGCGGRFLNTKK  204



>ref|XP_010247683.1| PREDICTED: nuclear transcription factor Y subunit A-10-like isoform 
X2 [Nelumbo nucifera]
Length=377

 Score =   126 bits (317),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 5/105 (5%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLGAAGGESVVHQSAQGVRMVLPLEVTTEEPVYVNAKQYHGILR  681
            +G  + CA YPY +  +     G    + S    R++LPL +T + P+YVNAKQYHGI+R
Sbjct  178  LGQPMACANYPYMDQCY-----GIFTTYGSQTVGRVMLPLNMTEDGPIYVNAKQYHGIIR  232

Query  682  RRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            RRQ RAKAE+ENK++K RKPYLHESRH HAMRRAR  GGRF+N K
Sbjct  233  RRQSRAKAEMENKLIKVRKPYLHESRHLHAMRRARGCGGRFLNTK  277



>emb|CAN68910.1| hypothetical protein VITISV_000211 [Vitis vinifera]
Length=342

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 77/103 (75%), Gaps = 7/103 (7%)
 Frame = +1

Query  529  YPYTEP---AFLGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQ  690
            YPY +P     + + G +++VH    G+   RM LPLE+  EEPVYVNAKQYHGILRRRQ
Sbjct  67   YPYQDPHNVGIMTSYGPQAMVHPHLFGMHQPRMPLPLEME-EEPVYVNAKQYHGILRRRQ  125

Query  691  LRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
             RAKAELE K +K RKPYLHESRH+HAMRRAR  GGRF+N KK
Sbjct  126  SRAKAELEKKAIKVRKPYLHESRHQHAMRRARGCGGRFLNTKK  168



>gb|KHF97628.1| Nuclear transcription factor Y subunit A-7 [Gossypium arboreum]
Length=203

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 98/177 (55%), Gaps = 26/177 (15%)
 Frame = +1

Query  337  TSAHMLWEDNGGMHHTAPEPKGFTELHTSDKNCKVESENVAMSPHH-SRPATEHDLMGHS  513
            +S H L++DN           G  + H+   N +  S    +SP   + P   +    H+
Sbjct  3    SSVHDLYDDNE---------IGEQQKHSEPHN-QSSSPATGLSPSAITTPNIPYTTSQHA  52

Query  514  IQCAPYPYTEPAFLG-------------AAGGESVVHQSAQGVRMV-LPLEV-TTEEPVY  648
            +  A YPY +P +                 GG+ +VH    G++   +PL     EEPV+
Sbjct  53   VAPATYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPSGAVEEPVF  112

Query  649  VNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            VNAKQYHGILRRRQ RAKAE ENK +K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  113  VNAKQYHGILRRRQSRAKAESENKAIKSRKPYLHESRHLHALRRARGSGGRFLNSKK  169



>ref|XP_008794453.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Phoenix dactylifera]
Length=225

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGVRMV---LPLEVTTEEPVYVNAKQYH  669
            GH++    YP+ +P   G  AA G++V+     G++ V   LP E   EEPVYVNAKQYH
Sbjct  55   GHAVAQVAYPFVDPYSGGVFAAYGQTVMQPQMMGMQHVGVPLPTE-AVEEPVYVNAKQYH  113

Query  670  GILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            GILRRRQ RAKAE ENK++K RKPYLHESRH HA++RAR  GGRF+N K
Sbjct  114  GILRRRQSRAKAESENKLIKTRKPYLHESRHLHAVKRARGSGGRFLNSK  162



>gb|AHI94929.1| transcription factor subunit NF-YA1A [Brassica napus]
Length=285

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 9/122 (7%)
 Frame = +1

Query  469  HHSRPATEHDLMGHSIQCAP-YPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEV  627
            H+ +P    +L+GH + C P  PY +P +   +GA G   +  +   G+   R  LPL++
Sbjct  120  HNQQPVQPPELVGHYMACVPPNPYQDPYYAGMMGAYGHRPLGFRPYLGMPRERTALPLDI  179

Query  628  TTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFV  807
            T +EPVYVNAKQY GILRRR+ RAKAELE KV+ NRKPYLHESRHKHAMRRAR  GGRF 
Sbjct  180  T-QEPVYVNAKQYEGILRRRKARAKAELERKVI-NRKPYLHESRHKHAMRRARASGGRFA  237

Query  808  NK  813
             K
Sbjct  238  KK  239



>ref|XP_009769785.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Nicotiana 
sylvestris]
 ref|XP_009769786.1| PREDICTED: nuclear transcription factor Y subunit A-3-like [Nicotiana 
sylvestris]
Length=325

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 6/114 (5%)
 Frame = +1

Query  493  HDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVN  654
            H  + H + CA YP+ +  F   +   G  ++++    GV   R+ LPLE T   P+YVN
Sbjct  129  HVHINHPMACASYPWADTYFGRLVATYGSNAIIYPQMVGVTSTRVALPLECTESFPIYVN  188

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            AKQY  IL+RRQ+RAK E +NK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K
Sbjct  189  AKQYSAILKRRQVRAKLEAQNKLVKDRKPYLHESRHRHAMKRARGTGGRFLNTK  242



>ref|XP_002282043.1| PREDICTED: nuclear transcription factor Y subunit A-7 [Vitis 
vinifera]
 ref|XP_010655736.1| PREDICTED: nuclear transcription factor Y subunit A-7 [Vitis 
vinifera]
 emb|CBI30998.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 78/120 (65%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGAAG-------------GESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++  A YPY +P +                  G+ +VH    G++   +PL     EE
Sbjct  55   GHAMAQAAYPYPDPYYRSIFAPYDAQPYPAQHYSGQPMVHLQLMGIQQAGVPLPSDAVEE  114

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENKVVK+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  115  PVFVNAKQYHGILRRRQSRAKAESENKVVKSRKPYLHESRHLHALRRARGCGGRFLNSKK  174



>ref|XP_006580212.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X2 [Glycine max]
Length=217

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 100/181 (55%), Gaps = 26/181 (14%)
 Frame = +1

Query  331  NATSAHMLW--EDNGGMHHTAP-EPKGFTELHTSDKNCKVESENVAMSPHHSRPATEHDL  501
            N TSAH L   ED+G     +P +P     +  SD     ++ NV  +      A     
Sbjct  11   NMTSAHDLTDNEDDGQQQSESPMQPPSVNGI--SDPGISTQNVNVQYA------APGQLG  62

Query  502  MGHSIQCAPYPYTEPAFLG-------------AAGGESVVHQSAQGVRMV-LPLEV-TTE  636
             GH++    YPY +P +               A  G+ +VH    G++   +PL     E
Sbjct  63   TGHAMVPHVYPYPDPYYRSIFAPYDTQPYPPQAYSGQPMVHLQLMGIQQAGVPLPTDAVE  122

Query  637  EPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            EPV+VNAKQYHGILRRRQ RAKAE ENK+++NRKPYLHESRHKHA+ R R  GGRF+N K
Sbjct  123  EPVFVNAKQYHGILRRRQYRAKAESENKIIRNRKPYLHESRHKHALTRPRGCGGRFLNSK  182

Query  817  K  819
            K
Sbjct  183  K  183



>ref|XP_010555019.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Tarenaya hassleriana]
Length=261

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  469  HHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVT  630
            H  + A   +L+GH I C   PY +P +   +GA G + +      G+   R  LPL++T
Sbjct  109  HDQQLAQPPELVGHYIACVSNPYRDPYYGGMMGAYGHQPLGFPPYVGMPRERTALPLDMT  168

Query  631  TEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVN  810
             +EPVYVNAKQY GILRRR+ RAKAELE K +K+RKPYLHESRH+HAMRR R  GGRF  
Sbjct  169  -QEPVYVNAKQYEGILRRRKARAKAELERKAIKDRKPYLHESRHRHAMRRPRASGGRFAK  227

Query  811  K  813
            K
Sbjct  228  K  228



>ref|XP_004293988.1| PREDICTED: nuclear transcription factor Y subunit A-7-like [Fragaria 
vesca subsp. vesca]
Length=204

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 76/120 (63%), Gaps = 15/120 (13%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLG-------------AAGGESVVHQSAQGVRMV-LPLEV-TTEE  639
            GH++    YPY +P +                 GG+  VH    G++   +PL     EE
Sbjct  54   GHAVAPGAYPYPDPYYRSIFAPYDTQAYPPQPYGGQPTVHLQLMGIQQAGVPLPTDAVEE  113

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            PV+VNAKQYHGILRRRQ RAKAE ENK +KNRKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  114  PVFVNAKQYHGILRRRQSRAKAESENKALKNRKPYLHESRHLHALRRARGCGGRFLNAKK  173



>ref|XP_010555018.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X1 [Tarenaya hassleriana]
Length=262

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  469  HHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVT  630
            H  + A   +L+GH I C   PY +P +   +GA G + +      G+   R  LPL++T
Sbjct  110  HDQQLAQPPELVGHYIACVSNPYRDPYYGGMMGAYGHQPLGFPPYVGMPRERTALPLDMT  169

Query  631  TEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVN  810
             +EPVYVNAKQY GILRRR+ RAKAELE K +K+RKPYLHESRH+HAMRR R  GGRF  
Sbjct  170  -QEPVYVNAKQYEGILRRRKARAKAELERKAIKDRKPYLHESRHRHAMRRPRASGGRFAK  228

Query  811  K  813
            K
Sbjct  229  K  229



>ref|XP_008231270.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Prunus 
mume]
Length=337

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 15/140 (11%)
 Frame = +1

Query  427  KNCKVESENVAMSP---HHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQ  588
            KN +++S + ++ P    H  P ++ +L+        YPY++P +   L   G ++++  
Sbjct  95   KNQQIKSISSSVVPTMGEHHDPNSQMELV-----LTSYPYSDPQYGGMLTPYGAQAMLPP  149

Query  589  SAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESR  759
               G+   RM LPLE+  EEPVYVNAKQYHGILRRRQ RAK ELE K++K RKPYLHESR
Sbjct  150  HFYGIHHGRMPLPLEME-EEPVYVNAKQYHGILRRRQSRAKTELEKKLIKARKPYLHESR  208

Query  760  HKHAMRRARDGGGRFVNKKK  819
            H HA+RRAR  GGRF+N KK
Sbjct  209  HLHALRRARGCGGRFLNTKK  228



>ref|XP_002523193.1| Nuclear transcription factor Y subunit A-4, putative [Ricinus 
communis]
 gb|EEF39224.1| Nuclear transcription factor Y subunit A-4, putative [Ricinus 
communis]
Length=213

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 76/112 (68%), Gaps = 15/112 (13%)
 Frame = +1

Query  529  YPYTEPAFLGA-------------AGGESVVHQSAQGVRMV-LPLEV-TTEEPVYVNAKQ  663
            YPY +P +                 GG+ +VH    G++   +PL   T EEPV+VNAKQ
Sbjct  67   YPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPSDTVEEPVFVNAKQ  126

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            YHGILRRRQ RAKAE ENKV+K+RKPYLHESRH+HA+RRAR  GGRF+N KK
Sbjct  127  YHGILRRRQSRAKAESENKVIKSRKPYLHESRHQHALRRARGLGGRFLNAKK  178



>ref|XP_006854167.1| hypothetical protein AMTR_s00048p00192930 [Amborella trichopoda]
 gb|ERN15634.1| hypothetical protein AMTR_s00048p00192930 [Amborella trichopoda]
Length=326

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 77/111 (69%), Gaps = 8/111 (7%)
 Frame = +1

Query  505  GHSIQCAPYPYTEPAFLGAA----GGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQ  663
            GHS    P PY   ++ G A    G ++++     G+   RM+LPL+ T EEPVYVNAKQ
Sbjct  134  GHSFTHVPCPYMAASYFGGALAPYGSQTMLTSQTLGLQQTRMLLPLDWT-EEPVYVNAKQ  192

Query  664  YHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            YH ILRRRQ RAK E +NK+VK+RKPYLHESRH HAM+R R  GGRFVN K
Sbjct  193  YHAILRRRQSRAKLEAQNKLVKSRKPYLHESRHLHAMKRVRGRGGRFVNTK  243



>ref|XP_002513499.1| Nuclear transcription factor Y subunit A-1, putative [Ricinus 
communis]
 gb|EEF48902.1| Nuclear transcription factor Y subunit A-1, putative [Ricinus 
communis]
Length=350

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = +1

Query  487  TEHDLMGHSIQCAPYPYTEPAFLGAA---GGESVVHQSAQG--VRMVLPLEVTTEEPVYV  651
            T+ +L+GHSI CA  PY +P + G     G + + +    G  VRM LP E+  +EPVYV
Sbjct  121  TQLELVGHSIACASNPYQDPYYGGMMAPYGHQPLGYPFLGGHQVRMALPNEIA-QEPVYV  179

Query  652  NAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            NAKQY GILRRRQ RAKAE E K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  180  NAKQYPGILRRRQARAKAEHEKKLIKVRKPYLHESRHQHAMRRARGSGGRFAKK  233



>ref|XP_009131293.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X3 [Brassica rapa]
Length=254

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 82/110 (75%), Gaps = 9/110 (8%)
 Frame = +1

Query  496  DLMGHSIQ-CAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVN  654
            +L+GH IQ C P PY +P +   +GA G + +  +   G+   R  LPL++T +EPVYVN
Sbjct  108  ELVGHYIQACVPNPYQDPYYGGMVGAYGHQQLGFRPYPGMPGERTALPLDMT-QEPVYVN  166

Query  655  AKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            AKQYHGILRRR+ RAKAELE K++ NRKPYLHESRHKHAM+RAR  GGRF
Sbjct  167  AKQYHGILRRRKARAKAELERKLI-NRKPYLHESRHKHAMKRARASGGRF  215



>gb|KCW51172.1| hypothetical protein EUGRSUZ_J00764 [Eucalyptus grandis]
Length=321

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 6/111 (5%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAK  660
            +L+GH+I CA  PY +P + G  A  G   +     G+   RM LPL++  +EPVYVNAK
Sbjct  112  ELVGHTIACASNPYQDPYYGGLMAQYGHQSMAYPFVGIPHARMPLPLDLA-QEPVYVNAK  170

Query  661  QYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            Q+ GILRRRQ RAKAELE K++K RKPYLHESRH+HAMRRAR  GGRF  K
Sbjct  171  QFQGILRRRQARAKAELEKKLIKVRKPYLHESRHQHAMRRARGTGGRFAKK  221



>ref|XP_004245059.1| PREDICTED: nuclear transcription factor Y subunit A-8-like [Solanum 
lycopersicum]
 ref|XP_010325013.1| PREDICTED: nuclear transcription factor Y subunit A-8-like [Solanum 
lycopersicum]
Length=325

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 9/119 (8%)
 Frame = +1

Query  478  RPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEE  639
            +P   H+   H + C  YP+ +  F   + A G  ++++    GV   R+ LPLE T   
Sbjct  127  QPQVNHN---HPMACVSYPFADTYFGRLVTAYGSNAIIYPQMVGVTSTRVALPLECTESL  183

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            P+YVNAKQY  IL+RRQ+RAK E +NK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K
Sbjct  184  PIYVNAKQYSAILKRRQVRAKLEAQNKLVKDRKPYLHESRHRHAMKRARGSGGRFLNTK  242



>gb|AHI94930.1| transcription factor subunit NF-YA1B [Brassica napus]
Length=257

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 77/111 (69%), Gaps = 12/111 (11%)
 Frame = +1

Query  496  DLMGHSIQCAPYPYTEPAFLGAAGGESVVHQSA--------QGVRMVLPLEVTTEEPVYV  651
            +L+GH I C P PY +P + G    E+  HQ           G R  LPL++T +EPVYV
Sbjct  107  ELVGHYIACVPNPYQDPYYGGMV--EAYGHQQLGFRPYLGMPGERTALPLDMT-QEPVYV  163

Query  652  NAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRF  804
            NAKQY GILRRR+ RAKAELE KV+ N+KPYLHESRHKHAMRRAR  GGRF
Sbjct  164  NAKQYQGILRRRKARAKAELERKVI-NKKPYLHESRHKHAMRRARASGGRF  213



>gb|KHF97629.1| Nuclear transcription factor Y subunit A-7 [Gossypium arboreum]
Length=205

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAFLGAA-------------GGESVVHQSAQGVRMV-LPLEV-TTEEP  642
            H++  A YPY +P +                 GG+ +VH    G++   +PL     EEP
Sbjct  53   HAVAPATYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPSGAVEEP  112

Query  643  VYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            V+VNAKQYHGILRRRQ RAKAE ENK +K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  113  VFVNAKQYHGILRRRQSRAKAESENKAIKSRKPYLHESRHLHALRRARGSGGRFLNSKK  171



>ref|XP_004513462.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004513463.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X2 [Cicer arietinum]
 ref|XP_004513464.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X3 [Cicer arietinum]
 ref|XP_004513465.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X4 [Cicer arietinum]
 ref|XP_004513466.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X5 [Cicer arietinum]
 ref|XP_004513467.1| PREDICTED: nuclear transcription factor Y subunit A-3-like isoform 
X6 [Cicer arietinum]
Length=232

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 77/114 (68%), Gaps = 10/114 (9%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAFLGA--AGGESVVHQ--------SAQGVRMVLPLEVTTEEPVYVNA  657
            HS+  APYPY +P F G+  A     V+Q             R+ LPL++  + P+YVNA
Sbjct  23   HSMAHAPYPYGDPIFAGSLVAYAPQAVNQPQMLPQMMGLASTRVALPLDLAQDGPIYVNA  82

Query  658  KQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            KQYHGILRRRQ RAK E +NK++K+RKPYLHESRHKHA+ R R  GGRF++ K+
Sbjct  83   KQYHGILRRRQSRAKLEAQNKLIKSRKPYLHESRHKHALNRVRGSGGRFLSTKQ  136



>gb|KDP26024.1| hypothetical protein JCGZ_21057 [Jatropha curcas]
Length=306

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 76/104 (73%), Gaps = 7/104 (7%)
 Frame = +1

Query  514  IQCAPYPYTEPAFLGAAGGESVVHQ--SAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRR  687
            ++C   P T+P      G  S VH    A   RMVLPLE+T EEPVYVNAKQYHGILRRR
Sbjct  109  VECLAPP-TQPDL---DGYYSFVHSHLGAYNTRMVLPLEMT-EEPVYVNAKQYHGILRRR  163

Query  688  QLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            + RAKAELE K++K RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  164  RSRAKAELEKKLIKVRKPYLHESRHLHALRRARGCGGRFLNTKK  207



>ref|XP_011075221.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Sesamum 
indicum]
Length=298

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 87/144 (60%), Gaps = 12/144 (8%)
 Frame = +1

Query  424  DKNCKVESENVAMS--PH----HSRPATEHDLMGHSIQCAPYPYTEP----AFLGAAGGE  573
            D  C+ E  ++A S  PH    H    T  D  G S  C+ Y Y +P    + L  A  +
Sbjct  79   DAVCRQEHGSLASSIVPHAMDEHLMQETLQDQSGGSNTCSSYSYPDPCPRDSKLANARPQ  138

Query  574  SVV--HQSAQGVRMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYL  747
             +      A   R    L +T EEPVYVNAKQYHGILRRRQLRAKAELENKV + RKPYL
Sbjct  139  LICPDLHGAPHCRTASSLALTLEEPVYVNAKQYHGILRRRQLRAKAELENKVTRVRKPYL  198

Query  748  HESRHKHAMRRARDGGGRFVNKKK  819
            HESRH HA+RRAR  GGRF+N KK
Sbjct  199  HESRHLHALRRARGCGGRFINTKK  222



>ref|XP_007022876.1| Nuclear transcription factor Y subunit A-7 [Theobroma cacao]
 gb|EOY25498.1| Nuclear transcription factor Y subunit A-7 [Theobroma cacao]
Length=203

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAFLG-------------AAGGESVVHQSAQGVRMV-LPLEV-TTEEP  642
            H++  A YPY +P +                 GG+ +VH    G++   +PL     EEP
Sbjct  51   HAVAPATYPYPDPYYRSIFAPYDAQPYPPQPYGGQPMVHLQLMGIQQAGVPLPSDAVEEP  110

Query  643  VYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            V+VNAKQYHGILRRRQ RAKAE ENKV+K RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  111  VFVNAKQYHGILRRRQSRAKAESENKVLKPRKPYLHESRHLHALRRARGSGGRFLNAKK  169



>ref|XP_008449710.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Cucumis melo]
 ref|XP_008449711.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Cucumis melo]
Length=336

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = +1

Query  514  IQCAPYPYTEPAFLG--AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGIL  678
            + CA  PY +P + G  AA G    +    G+   RM LPLEVT +EPV+VNAKQY GIL
Sbjct  118  LACASNPYQDPYYAGVMAAYGHQPGYPPFLGMPHARMALPLEVT-QEPVFVNAKQYQGIL  176

Query  679  RRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RRRQ RAKAE+ENK++K RKPYLHESRH+HAMRRAR  GGRF  K +
Sbjct  177  RRRQARAKAEVENKLIKVRKPYLHESRHQHAMRRARGSGGRFAKKNE  223



>ref|YP_009049690.1| hypothetical protein (mitochondrion) [Capsicum annuum]
 gb|AIG89945.1| hypothetical protein (mitochondrion) [Capsicum annuum]
 gb|AIG90048.1| hypothetical protein (mitochondrion) [Capsicum annuum]
Length=301

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 9/119 (8%)
 Frame = +1

Query  478  RPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVTTEE  639
            +P   HD   H   C  YP+ +  F   +   G  ++++    GV   R+ LPLE T   
Sbjct  99   QPQVHHD---HPTACLSYPWADTYFGRLVATYGSNAIIYPQMVGVTSTRVALPLECTESL  155

Query  640  PVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKK  816
            P+YVNAKQY  IL+RRQ+RAK + +NK+VKNRKPYLHESRH+HAM+RAR  GGRF+N K
Sbjct  156  PIYVNAKQYSAILKRRQVRAKRQAQNKLVKNRKPYLHESRHRHAMKRARGSGGRFLNTK  214



>gb|KHN48069.1| Nuclear transcription factor Y subunit A-7 [Glycine soja]
Length=206

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 74/101 (73%), Gaps = 3/101 (3%)
 Frame = +1

Query  523  APYPYTEPAFLGAAGGESVVHQSAQGVRMV-LPLEV-TTEEPVYVNAKQYHGILRRRQLR  696
            APY  T+P    A  G+ +VH    G++   +PL     EEPV+VNAKQYHGILRRRQ R
Sbjct  73   APYD-TQPYPPQAYSGQPMVHLQLMGIQQAGVPLPTDAVEEPVFVNAKQYHGILRRRQSR  131

Query  697  AKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            AKAE ENKV++NRKPYLHESRHKHA+RR R  GGRF+N KK
Sbjct  132  AKAESENKVIRNRKPYLHESRHKHALRRPRGCGGRFLNSKK  172



>gb|ACU19519.1| unknown [Glycine max]
Length=206

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 99/179 (55%), Gaps = 26/179 (15%)
 Frame = +1

Query  337  TSAHMLW--EDNGGMHHTAP-EPKGFTELHTSDKNCKVESENVAMSPHHSRPATEHDLMG  507
            TSAH L   ED+G     +P +P     +  SD     ++ NV  +      A      G
Sbjct  2    TSAHDLTDNEDDGQQQSESPMQPPSVNGI--SDPGISTQNVNVQYA------APGQLGTG  53

Query  508  HSIQCAPYPYTEPAFLG-------------AAGGESVVHQSAQGVRMV-LPLEV-TTEEP  642
            H++    YPY +P +               A  G+ +VH    G++   +PL     EEP
Sbjct  54   HAMVPHVYPYPDPYYRSIFAPYDTQPYPPQAYSGQPMVHLQLMGIQQAGVPLPTDAVEEP  113

Query  643  VYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            V+VNAKQYHGILRRRQ RAKAE ENK+++NRKPYLHESRHKHA+ R R  GGRF+N KK
Sbjct  114  VFVNAKQYHGILRRRQYRAKAESENKIIRNRKPYLHESRHKHALTRPRGCGGRFLNSKK  172



>ref|XP_010536085.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Tarenaya 
hassleriana]
 ref|XP_010536086.1| PREDICTED: nuclear transcription factor Y subunit A-1-like [Tarenaya 
hassleriana]
Length=265

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 81/123 (66%), Gaps = 7/123 (6%)
 Frame = +1

Query  469  HHSRPATEHDLMGHSIQCAPYPYTEPAF---LGAAGGESVVHQSAQGV---RMVLPLEVT  630
            H  + A   +L+GH I C   PY +  +   +GA G + V      G+   R  LPL++T
Sbjct  100  HDQQLAQPPELVGHYIACISNPYQDAYYGGMMGAYGHQPVGFPPYIGMPRERTALPLDMT  159

Query  631  TEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVN  810
             +EPVYVNAKQY GILRRR+ RAKAELE KV K+RKPYLHESRHKHAMRR R  GGRF  
Sbjct  160  -QEPVYVNAKQYEGILRRRKARAKAELERKVTKDRKPYLHESRHKHAMRRLRASGGRFAK  218

Query  811  KKK  819
            K +
Sbjct  219  KSE  221



>ref|XP_009631356.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X2 [Nicotiana tomentosiformis]
Length=317

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 79/111 (71%), Gaps = 6/111 (5%)
 Frame = +1

Query  502  MGHSIQCAPYPYTEPAFLG--AAGGESVVHQSAQGV---RMVLPLEVTTEEPVYVNAKQY  666
            M HSI  AP+ Y++P   G  AA G  V  Q   G+   R+ LPL++  + P+YVNAKQY
Sbjct  137  MAHSISHAPFGYSDPYLSGLYAAYGPHVFPQ-MMGIAPARLPLPLDLAEDGPIYVNAKQY  195

Query  667  HGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            HGILRRRQ+RAK E +NK+VK RKPYLHESRH HA++R R  GGRF++ KK
Sbjct  196  HGILRRRQIRAKLEAQNKLVKARKPYLHESRHLHAVKRVRGSGGRFLSTKK  246



>ref|XP_003524992.1| PREDICTED: nuclear transcription factor Y subunit A-7-like isoform 
X1 [Glycine max]
Length=206

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 99/179 (55%), Gaps = 26/179 (15%)
 Frame = +1

Query  337  TSAHMLW--EDNGGMHHTAP-EPKGFTELHTSDKNCKVESENVAMSPHHSRPATEHDLMG  507
            TSAH L   ED+G     +P +P     +  SD     ++ NV  +      A      G
Sbjct  2    TSAHDLTDNEDDGQQQSESPMQPPSVNGI--SDPGISTQNVNVQYA------APGQLGTG  53

Query  508  HSIQCAPYPYTEPAFLG-------------AAGGESVVHQSAQGVRMV-LPLEV-TTEEP  642
            H++    YPY +P +               A  G+ +VH    G++   +PL     EEP
Sbjct  54   HAMVPHVYPYPDPYYRSIFAPYDTQPYPPQAYSGQPMVHLQLMGIQQAGVPLPTDAVEEP  113

Query  643  VYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            V+VNAKQYHGILRRRQ RAKAE ENK+++NRKPYLHESRHKHA+ R R  GGRF+N KK
Sbjct  114  VFVNAKQYHGILRRRQYRAKAESENKIIRNRKPYLHESRHKHALTRPRGCGGRFLNSKK  172



>gb|KHG15597.1| Nuclear transcription factor Y subunit A-7 -like protein [Gossypium 
arboreum]
Length=203

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = +1

Query  508  HSIQCAPYPYTEPAFLG-------------AAGGESVVHQSAQGVRMV-LPLEV-TTEEP  642
            H++  A YPY +P +                 GG+ +VH    G++   +PL     EEP
Sbjct  51   HAVAPAAYPYPDPYYRSIFAPYDAQSYPPQPYGGQPMVHLQLMGIQQAGVPLPSDAVEEP  110

Query  643  VYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            V+VNAKQYHGILRRRQ RAKAE ENK+ K+RKPYLHESRH HA+RRAR  GGRF+N KK
Sbjct  111  VFVNAKQYHGILRRRQSRAKAESENKLAKSRKPYLHESRHLHALRRARGSGGRFLNSKK  169



>ref|XP_011080345.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011080346.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011080347.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011080348.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011080349.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011080350.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011080351.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011080352.1| PREDICTED: nuclear transcription factor Y subunit A-1-like isoform 
X2 [Sesamum indicum]
Length=316

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 82/116 (71%), Gaps = 9/116 (8%)
 Frame = +1

Query  484  ATEHDLMGHSIQCAPYPYTEPAFLG---AAGGESVVHQSAQGV---RMVLPLEVTTEEPV  645
            A + +L+GHS+ C   PY +  + G   AA  +S+V      +   RM LPLE+  +EPV
Sbjct  113  APQLELVGHSVACGSNPYDQ--YYGGMMAAYAQSLVPPYLHDMHHARMPLPLEMA-QEPV  169

Query  646  YVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNK  813
            YVNAKQYHGILRRRQ RAKAELE K++K RKPYLHESRH+HA+RRAR  GGRF  K
Sbjct  170  YVNAKQYHGILRRRQSRAKAELEKKLIKVRKPYLHESRHQHALRRARGTGGRFAKK  225



>gb|AAS78481.1| CCAAT-box transcription factor complex WHAP7 [Triticum aestivum]
Length=242

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +1

Query  529  YPYTEPAFLGAA---GGESVVHQSAQGV----RMVLPLE-VTTEEPVYVNAKQYHGILRR  684
            YPY +P + GA    G  +++H    G+    R+ LP+E    EEP+YVNAKQ+H ILRR
Sbjct  92   YPYADPYYGGAVAAYGAHAIMHPQMVGMVPSSRVPLPIEPAAAEEPIYVNAKQHHAILRR  151

Query  685  RQLRAKAELENKVVKNRKPYLHESRHKHAMRRARDGGGRFVNKKK  819
            RQLRAK E ENK+VK+RKPYLHESRH+HAM+RAR  GGRF+N K+
Sbjct  152  RQLRAKLEAENKLVKSRKPYLHESRHQHAMKRARGTGGRFLNAKE  196



>ref|XP_009793851.1| PREDICTED: nuclear transcription factor Y subunit A-4-like isoform 
X2 [Nicotiana sylvestris]
Length=314

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 92/142 (65%), Gaps = 7/142 (5%)
 Frame = +1

Query  409  ELHTSDKNCKVESENVAMSPHHSRPATEHDLMGHSIQCAPYPYTEPAFLG--AAGGESVV  582
            E +  +K  ++++      P +    ++ + M HSI  AP+ Y++P   G  AA G  V 
Sbjct  107  ESYKRNKQAQIKTNPFIRYPEYPTDCSQSE-MAHSISHAPFGYSDPYLSGFYAAYGPHVF  165

Query  583  HQSAQGV---RMVLPLEVTTEEPVYVNAKQYHGILRRRQLRAKAELENKVVKNRKPYLHE  753
             Q   G+   R+ LPL++  + PVYVNAKQYHGILRRRQ+RAK E +NK+VK RKPYLHE
Sbjct  166  PQMI-GIAPARVPLPLDLAEDGPVYVNAKQYHGILRRRQMRAKLEAQNKLVKARKPYLHE  224

Query  754  SRHKHAMRRARDGGGRFVNKKK  819
            SRH HA++R R  GGRF++ KK
Sbjct  225  SRHLHAVKRVRGSGGRFLSTKK  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3768748596378