BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16036_g2_i1 len=1467 path=[1445:0-529 1975:530-568 2014:569-1466]

Length=1467
                                                                      Score     E

gb|EYU39328.1|  hypothetical protein MIMGU_mgv1a009594mg                436   9e-147   
ref|XP_009629207.1|  PREDICTED: mitogen-activated protein kinase ...    433   2e-145   
ref|XP_011099128.1|  PREDICTED: mitogen-activated protein kinase ...    431   2e-144   
gb|AHW50675.1|  mitogen-activated protein kinase kinase kinase 3        425   3e-142   
ref|XP_009796739.1|  PREDICTED: mitogen-activated protein kinase ...    424   6e-142   
ref|XP_009628421.1|  PREDICTED: mitogen-activated protein kinase ...    423   2e-141   
ref|XP_006360216.1|  PREDICTED: mitogen-activated protein kinase ...    420   3e-140   
ref|XP_009803912.1|  PREDICTED: mitogen-activated protein kinase ...    420   3e-140   
ref|XP_009628862.1|  PREDICTED: mitogen-activated protein kinase ...    417   3e-139   
ref|XP_004233440.1|  PREDICTED: mitogen-activated protein kinase ...    416   7e-139   
ref|XP_004232023.1|  PREDICTED: mitogen-activated protein kinase ...    414   4e-138   
ref|XP_011075325.1|  PREDICTED: mitogen-activated protein kinase ...    412   3e-137   
gb|AGV06259.1|  fertilization-related kinase 3                          412   3e-137   
ref|XP_006339890.1|  PREDICTED: mitogen-activated protein kinase ...    411   9e-137   
ref|XP_009758194.1|  PREDICTED: mitogen-activated protein kinase ...    409   4e-136   
emb|CDP02503.1|  unnamed protein product                                405   2e-134   
ref|XP_004233626.1|  PREDICTED: mitogen-activated protein kinase ...    400   2e-132   
gb|EYU44409.1|  hypothetical protein MIMGU_mgv1a008588mg                399   5e-132   
ref|XP_006339888.1|  PREDICTED: mitogen-activated protein kinase ...    397   3e-131   
ref|XP_006339889.1|  PREDICTED: mitogen-activated protein kinase ...    397   3e-131   
ref|XP_004233627.1|  PREDICTED: mitogen-activated protein kinase ...    395   1e-130   
ref|XP_009611038.1|  PREDICTED: mitogen-activated protein kinase ...    394   2e-129   
gb|EPS73022.1|  hypothetical protein M569_01733                         347   6e-112   
gb|KEH16526.1|  MAP3K-like kinase                                       339   5e-109   
ref|XP_007047281.1|  Mitogen-activated protein kinase kinase kina...    338   1e-108   
gb|KDP31943.1|  hypothetical protein JCGZ_12404                         337   5e-108   
gb|KEH16420.1|  MAP3K-like kinase                                       335   2e-107   
ref|XP_010558598.1|  PREDICTED: mitogen-activated protein kinase ...    333   3e-106   
emb|CDY17760.1|  BnaC08g21680D                                          329   3e-105   
ref|XP_006286153.1|  hypothetical protein CARUB_v10007712mg             329   4e-105   
ref|XP_002282686.1|  PREDICTED: mitogen-activated protein kinase ...    328   1e-104   Vitis vinifera
ref|XP_007029410.1|  Mitogen-activated protein kinase kinase kina...    328   1e-104   
gb|KEH16527.1|  MAP3K-like kinase                                       327   2e-104   
emb|CBI21416.3|  unnamed protein product                                328   2e-104   
gb|AGA37217.1|  mitogen-activated protein kinase kinase kinase 20.1     327   3e-104   
ref|XP_009115702.1|  PREDICTED: mitogen-activated protein kinase ...    327   3e-104   
emb|CDY30595.1|  BnaAnng03700D                                          326   5e-104   
ref|NP_001241003.1|  mitogen-activated protein kinase kinase kina...    325   9e-104   
emb|CDX83120.1|  BnaA01g21200D                                          325   1e-103   
ref|XP_009101744.1|  PREDICTED: mitogen-activated protein kinase ...    325   2e-103   
ref|NP_201509.1|  mitogen-activated protein kinase kinase kinase 19     325   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KDO79193.1|  hypothetical protein CISIN_1g017746mg                   325   3e-103   
ref|XP_010464552.1|  PREDICTED: mitogen-activated protein kinase ...    324   4e-103   
ref|XP_010547520.1|  PREDICTED: mitogen-activated protein kinase ...    324   5e-103   
ref|XP_010093629.1|  Mitogen-activated protein kinase kinase kina...    326   5e-103   
ref|XP_006425909.1|  hypothetical protein CICLE_v10025910mg             325   5e-103   
ref|XP_006466595.1|  PREDICTED: mitogen-activated protein kinase ...    323   2e-102   
ref|XP_006404041.1|  hypothetical protein EUTSA_v10010509mg             322   2e-102   
ref|XP_010550362.1|  PREDICTED: mitogen-activated protein kinase ...    322   2e-102   
ref|XP_010095583.1|  Mitogen-activated protein kinase kinase kina...    322   4e-102   
ref|XP_009367209.1|  PREDICTED: mitogen-activated protein kinase ...    321   5e-102   
ref|XP_010503702.1|  PREDICTED: mitogen-activated protein kinase ...    320   2e-101   
ref|XP_002866718.1|  MAPKKK19                                           320   2e-101   
ref|NP_001078504.1|  mitogen-activated protein kinase kinase kina...    319   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010095581.1|  Mitogen-activated protein kinase kinase kina...    322   4e-101   
ref|XP_007204693.1|  hypothetical protein PRUPE_ppa007987mg             318   1e-100   
ref|XP_009343294.1|  PREDICTED: mitogen-activated protein kinase ...    318   1e-100   
ref|XP_008340193.1|  PREDICTED: mitogen-activated protein kinase ...    317   4e-100   
ref|XP_006411921.1|  hypothetical protein EUTSA_v10027234mg             316   6e-100   
ref|XP_003524649.1|  PREDICTED: mitogen-activated protein kinase ...    316   6e-100   
ref|XP_003521050.1|  PREDICTED: mitogen-activated protein kinase ...    316   7e-100   
ref|XP_006282279.1|  hypothetical protein CARUB_v10028563mg             315   8e-100   
ref|XP_010444696.1|  PREDICTED: mitogen-activated protein kinase ...    315   1e-99    
ref|XP_008241469.1|  PREDICTED: mitogen-activated protein kinase ...    315   2e-99    
ref|XP_010426575.1|  PREDICTED: mitogen-activated protein kinase ...    314   3e-99    
ref|XP_010484556.1|  PREDICTED: mitogen-activated protein kinase ...    314   3e-99    
gb|KCW54938.1|  hypothetical protein EUGRSUZ_I00911                     315   4e-99    
ref|XP_009345960.1|  PREDICTED: mitogen-activated protein kinase ...    314   4e-99    
ref|XP_006292547.1|  hypothetical protein CARUB_v10018782mg             313   6e-99    
ref|XP_002869001.1|  hypothetical protein ARALYDRAFT_328051             327   6e-99    
ref|XP_002877738.1|  MAPKKK20                                           313   8e-99    
ref|XP_009343169.1|  PREDICTED: mitogen-activated protein kinase ...    313   9e-99    
ref|XP_006393906.1|  hypothetical protein EUTSA_v10004510mg             313   9e-99    
gb|AGA37216.1|  mitogen-activated protein kinase kinase kinase 19.1     313   9e-99    
ref|XP_007155919.1|  hypothetical protein PHAVU_003G243300g             313   9e-99    
ref|XP_010515391.1|  PREDICTED: mitogen-activated protein kinase ...    312   2e-98    
ref|XP_008338323.1|  PREDICTED: mitogen-activated protein kinase ...    312   2e-98    
emb|CDY12801.1|  BnaC07g16320D                                          311   3e-98    
gb|KFK34285.1|  hypothetical protein AALP_AA5G125300                    311   5e-98    
ref|XP_010446694.1|  PREDICTED: mitogen-activated protein kinase ...    311   5e-98    
gb|AAM63486.1|  protein kinase-like protein                             310   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003539360.1|  PREDICTED: mitogen-activated protein kinase ...    310   9e-98    
ref|XP_010531244.1|  PREDICTED: mitogen-activated protein kinase ...    309   2e-97    
emb|CDX69280.1|  BnaC01g01730D                                          309   3e-97    
ref|NP_190600.1|  mitogen-activated protein kinase kinase kinase 20     308   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511921.1|  PREDICTED: mitogen-activated protein kinase ...    309   7e-97    
emb|CDY01441.1|  BnaA07g12140D                                          308   1e-96    
ref|XP_004173609.1|  PREDICTED: mitogen-activated protein kinase ...    307   2e-96    
gb|KHN08178.1|  Mitogen-activated protein kinase kinase kinase 3        306   2e-96    
ref|XP_002523600.1|  ATP binding protein, putative                      307   2e-96    Ricinus communis
emb|CAB16796.1|  MAP3K-like protein kinase                              320   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263514.1|  PREDICTED: mitogen-activated protein kinase ...    308   3e-96    
ref|XP_010093628.1|  Mitogen-activated protein kinase kinase kina...    306   4e-96    
ref|XP_010028246.1|  PREDICTED: mitogen-activated protein kinase ...    307   4e-96    
ref|XP_010437255.1|  PREDICTED: mitogen-activated protein kinase ...    305   1e-95    
ref|XP_010028245.1|  PREDICTED: mitogen-activated protein kinase ...    306   1e-95    
ref|XP_010432085.1|  PREDICTED: mitogen-activated protein kinase ...    305   2e-95    
ref|XP_010028244.1|  PREDICTED: mitogen-activated protein kinase ...    304   4e-95    
ref|XP_004288026.1|  PREDICTED: uncharacterized protein LOC101291755    315   6e-95    
gb|KFK28386.1|  hypothetical protein AALP_AA8G508200                    303   6e-95    
ref|XP_003517304.1|  PREDICTED: mitogen-activated protein kinase ...    303   6e-95    
ref|XP_009103457.1|  PREDICTED: mitogen-activated protein kinase ...    303   9e-95    
emb|CDX75628.1|  BnaA01g00740D                                          303   1e-94    
ref|XP_009138381.1|  PREDICTED: mitogen-activated protein kinase ...    302   1e-94    
ref|XP_011008530.1|  PREDICTED: mitogen-activated protein kinase ...    302   1e-94    
ref|XP_010028241.1|  PREDICTED: mitogen-activated protein kinase ...    302   4e-94    
ref|XP_010269485.1|  PREDICTED: mitogen-activated protein kinase ...    300   3e-93    
ref|XP_010028242.1|  PREDICTED: mitogen-activated protein kinase ...    299   1e-92    
ref|XP_004141910.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    309   1e-92    
ref|XP_008440288.1|  PREDICTED: mitogen-activated protein kinase ...    297   2e-92    
ref|XP_007156794.1|  hypothetical protein PHAVU_002G018100g             296   2e-92    
ref|XP_003611720.1|  Protein kinase-like protein                        294   2e-91    
ref|XP_010109773.1|  hypothetical protein L484_000226                   292   4e-91    
ref|XP_010028243.1|  PREDICTED: mitogen-activated protein kinase ...    293   1e-90    
ref|XP_010106871.1|  Mitogen-activated protein kinase kinase kina...    289   4e-90    
ref|XP_010093632.1|  Mitogen-activated protein kinase kinase kina...    292   2e-89    
ref|XP_010028240.1|  PREDICTED: mitogen-activated protein kinase ...    290   2e-89    
ref|XP_008799260.1|  PREDICTED: mitogen-activated protein kinase ...    289   4e-89    
ref|XP_011043532.1|  PREDICTED: mitogen-activated protein kinase ...    288   5e-89    
gb|KHN42087.1|  Mitogen-activated protein kinase kinase kinase 3        284   3e-88    
ref|XP_007158842.1|  hypothetical protein PHAVU_002G186600g             283   1e-87    
ref|XP_002310721.2|  hypothetical protein POPTR_0007s10930g             285   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_002306473.2|  hypothetical protein POPTR_0005s18240g             282   6e-87    Populus trichocarpa [western balsam poplar]
ref|XP_010667409.1|  PREDICTED: mitogen-activated protein kinase ...    281   1e-86    
ref|XP_008457763.1|  PREDICTED: mitogen-activated protein kinase ...    280   3e-86    
gb|KHN01177.1|  Mitogen-activated protein kinase kinase kinase 1        277   1e-85    
ref|XP_010926984.1|  PREDICTED: mitogen-activated protein kinase ...    279   2e-85    
ref|XP_010275096.1|  PREDICTED: mitogen-activated protein kinase ...    283   5e-85    
ref|XP_002306472.2|  hypothetical protein POPTR_0005s18230g             276   1e-84    Populus trichocarpa [western balsam poplar]
ref|XP_004149711.1|  PREDICTED: mitogen-activated protein kinase ...    276   2e-84    
ref|XP_003611723.1|  Mitogen-activated protein kinase kinase kina...    270   1e-82    
ref|XP_011101212.1|  PREDICTED: mitogen-activated protein kinase ...    265   5e-82    
ref|XP_011093943.1|  PREDICTED: mitogen-activated protein kinase ...    264   2e-81    
ref|XP_004512214.1|  PREDICTED: mitogen-activated protein kinase ...    264   2e-80    
ref|XP_011073592.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    258   1e-79    
ref|XP_009418852.1|  PREDICTED: mitogen-activated protein kinase ...    264   2e-79    
ref|XP_011070691.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    253   9e-78    
ref|XP_009396717.1|  PREDICTED: mitogen-activated protein kinase ...    262   1e-77    
gb|KHN08177.1|  Serine/threonine-protein kinase BCK1/SLK1/SSP31         258   1e-77    
ref|XP_009802290.1|  PREDICTED: mitogen-activated protein kinase ...    261   2e-77    
ref|XP_009615697.1|  PREDICTED: mitogen-activated protein kinase ...    254   3e-75    
ref|XP_003520404.1|  PREDICTED: serine/threonine-protein kinase B...    254   1e-74    
ref|XP_009783859.1|  PREDICTED: mitogen-activated protein kinase ...    251   3e-74    
ref|XP_010273710.1|  PREDICTED: mitogen-activated protein kinase ...    251   5e-74    
ref|XP_010273783.1|  PREDICTED: mitogen-activated protein kinase ...    249   2e-73    
ref|XP_009604127.1|  PREDICTED: mitogen-activated protein kinase ...    249   3e-73    
ref|XP_006341415.1|  PREDICTED: mitogen-activated protein kinase ...    248   4e-73    
ref|XP_011020573.1|  PREDICTED: protein kinase byr2-like                247   8e-73    
gb|KCW54944.1|  hypothetical protein EUGRSUZ_I00918                     245   1e-72    
ref|XP_004235890.1|  PREDICTED: mitogen-activated protein kinase ...    244   1e-71    
ref|XP_009626328.1|  PREDICTED: mitogen-activated protein kinase ...    241   1e-71    
ref|XP_011073306.1|  PREDICTED: mitogen-activated protein kinase ...    243   5e-71    
ref|XP_006356256.1|  PREDICTED: mitogen-activated protein kinase ...    244   5e-71    
ref|XP_009613015.1|  PREDICTED: mitogen-activated protein kinase ...    239   6e-71    
ref|XP_010273708.1|  PREDICTED: mitogen-activated protein kinase ...    243   1e-70    
ref|XP_002303860.2|  hypothetical protein POPTR_0003s18240g             239   4e-70    Populus trichocarpa [western balsam poplar]
ref|XP_010040778.1|  PREDICTED: mitogen-activated protein kinase ...    238   7e-70    
ref|XP_009602038.1|  PREDICTED: mitogen-activated protein kinase ...    237   9e-70    
ref|XP_008782769.1|  PREDICTED: mitogen-activated protein kinase ...    234   1e-69    
ref|XP_004241675.1|  PREDICTED: mitogen-activated protein kinase ...    239   2e-69    
ref|XP_010273738.1|  PREDICTED: mitogen-activated protein kinase ...    236   2e-69    
gb|EYU24575.1|  hypothetical protein MIMGU_mgv1a008079mg                238   2e-69    
ref|XP_011034576.1|  PREDICTED: protein kinase byr2-like                238   3e-69    
gb|EYU27064.1|  hypothetical protein MIMGU_mgv1a024020mg                232   2e-68    
ref|XP_009801510.1|  PREDICTED: mitogen-activated protein kinase ...    233   2e-68    
ref|XP_010275095.1|  PREDICTED: mitogen-activated protein kinase ...    233   2e-68    
ref|XP_006368487.1|  hypothetical protein POPTR_0001s03390g             235   3e-68    
gb|EYU27067.1|  hypothetical protein MIMGU_mgv1a022903mg                229   7e-67    
ref|XP_006437583.1|  hypothetical protein CICLE_v10033465mg             230   8e-67    
ref|XP_009783074.1|  PREDICTED: mitogen-activated protein kinase ...    229   1e-66    
ref|XP_008781652.1|  PREDICTED: mitogen-activated protein kinase ...    226   4e-66    
ref|XP_006484585.1|  PREDICTED: mitogen-activated protein kinase ...    228   7e-66    
emb|CDP04579.1|  unnamed protein product                                225   4e-64    
ref|XP_011082542.1|  PREDICTED: mitogen-activated protein kinase ...    224   4e-64    
ref|XP_001768190.1|  predicted protein                                  218   3e-63    
ref|XP_009405196.1|  PREDICTED: mitogen-activated protein kinase ...    223   7e-63    
gb|KHN40490.1|  MAP kinase kinase kinase mkh1                           216   3e-62    
ref|XP_006603574.1|  PREDICTED: mitogen-activated protein kinase ...    216   3e-62    
ref|XP_008441103.1|  PREDICTED: mitogen-activated protein kinase ...    221   5e-62    
gb|EYU21752.1|  hypothetical protein MIMGU_mgv1a021677mg                217   7e-62    
emb|CDP14935.1|  unnamed protein product                                218   8e-62    
ref|XP_004244346.1|  PREDICTED: mitogen-activated protein kinase ...    219   8e-62    
ref|XP_009383559.1|  PREDICTED: mitogen-activated protein kinase ...    219   1e-61    
ref|XP_009132644.1|  PREDICTED: mitogen-activated protein kinase ...    218   2e-61    
ref|XP_004134977.1|  PREDICTED: mitogen-activated protein kinase ...    216   3e-61    
ref|XP_006283707.1|  hypothetical protein CARUB_v10004778mg             218   4e-61    
gb|KGN49092.1|  hypothetical protein Csa_6G513560                       216   4e-61    
ref|XP_009614381.1|  PREDICTED: mitogen-activated protein kinase ...    218   8e-61    
ref|XP_006346260.1|  PREDICTED: mitogen-activated protein kinase ...    216   1e-60    
ref|XP_009793037.1|  PREDICTED: mitogen-activated protein kinase ...    217   2e-60    
ref|XP_006367880.1|  PREDICTED: mitogen-activated protein kinase ...    212   2e-60    
ref|XP_007145474.1|  hypothetical protein PHAVU_007G242000g             211   2e-60    
ref|XP_010536673.1|  PREDICTED: mitogen-activated protein kinase ...    216   2e-60    
ref|XP_006367881.1|  PREDICTED: mitogen-activated protein kinase ...    211   2e-60    
ref|XP_002869589.1|  hypothetical protein ARALYDRAFT_492112             216   2e-60    
ref|XP_010099184.1|  Mitogen-activated protein kinase kinase kina...    215   3e-60    
ref|XP_010445108.1|  PREDICTED: mitogen-activated protein kinase ...    215   3e-60    
ref|XP_010926215.1|  PREDICTED: mitogen-activated protein kinase ...    216   6e-60    
ref|XP_002512746.1|  Mitogen-activated protein kinase kinase kina...    212   1e-59    Ricinus communis
ref|XP_010436369.1|  PREDICTED: mitogen-activated protein kinase ...    214   1e-59    
ref|XP_008782219.1|  PREDICTED: serine/threonine-protein kinase 4...    216   2e-59    
ref|XP_010545229.1|  PREDICTED: mitogen-activated protein kinase ...    214   2e-59    
ref|XP_009421493.1|  PREDICTED: mitogen-activated protein kinase ...    213   2e-59    
gb|AAR87851.1|  fertilization-related kinase 2                          209   2e-59    Solanum chacoense
emb|CDY17301.1|  BnaA10g09350D                                          213   2e-59    
ref|XP_008784479.1|  PREDICTED: mitogen-activated protein kinase ...    214   3e-59    
ref|XP_004289177.1|  PREDICTED: mitogen-activated protein kinase ...    212   4e-59    
ref|XP_002321133.2|  kinase family protein                              209   5e-59    Populus trichocarpa [western balsam poplar]
ref|XP_004170035.1|  PREDICTED: mitogen-activated protein kinase ...    208   5e-59    
gb|EEE56860.1|  hypothetical protein OsJ_06484                          211   5e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121273.1|  PREDICTED: mitogen-activated protein kinase ...    212   5e-59    
ref|XP_010644538.1|  PREDICTED: mitogen-activated protein kinase ...    212   6e-59    
ref|XP_009394082.1|  PREDICTED: mitogen-activated protein kinase ...    210   9e-59    
ref|XP_001755952.1|  predicted protein                                  206   9e-59    
gb|EYU33654.1|  hypothetical protein MIMGU_mgv1a021391mg                208   9e-59    
emb|CDY19916.1|  BnaC09g31820D                                          211   1e-58    
ref|XP_007026132.1|  Mitogen-activated protein kinase kinase kina...    212   1e-58    
ref|XP_002267176.1|  PREDICTED: mitogen-activated protein kinase ...    207   1e-58    Vitis vinifera
ref|XP_009403739.1|  PREDICTED: mitogen-activated protein kinase ...    211   1e-58    
ref|XP_010090302.1|  Mitogen-activated protein kinase kinase kina...    207   2e-58    
ref|XP_007212556.1|  hypothetical protein PRUPE_ppa015439mg             207   2e-58    
ref|XP_001760609.1|  predicted protein                                  205   2e-58    
dbj|BAD15943.1|  protein kinase-like                                    210   3e-58    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046691.2|  Os02g0322400                                       209   3e-58    Oryza sativa Japonica Group [Japonica rice]
emb|CDY36728.1|  BnaA03g11580D                                          210   3e-58    
ref|XP_008224751.1|  PREDICTED: mitogen-activated protein kinase ...    209   3e-58    
ref|XP_010451165.1|  PREDICTED: mitogen-activated protein kinase ...    210   4e-58    
ref|XP_009629290.1|  PREDICTED: serine/threonine-protein kinase 1...    206   4e-58    
gb|EEC73042.1|  hypothetical protein OsI_06987                          210   4e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_008238330.1|  PREDICTED: mitogen-activated protein kinase ...    207   5e-58    
ref|XP_009403738.1|  PREDICTED: mitogen-activated protein kinase ...    209   5e-58    
ref|XP_009404796.1|  PREDICTED: mitogen-activated protein kinase ...    209   6e-58    
ref|XP_006582632.1|  PREDICTED: mitogen-activated protein kinase ...    205   7e-58    
ref|XP_010916795.1|  PREDICTED: mitogen-activated protein kinase ...    211   7e-58    
ref|XP_009394653.1|  PREDICTED: mitogen-activated protein kinase ...    207   8e-58    
ref|XP_007032910.1|  Mitogen-activated protein kinase kinase kina...    204   1e-57    
emb|CDY69540.1|  BnaCnng64060D                                          209   1e-57    
ref|XP_006389580.1|  hypothetical protein POPTR_0021s00300g             206   1e-57    
ref|XP_004242223.1|  PREDICTED: serine/threonine-protein kinase p...    206   1e-57    
gb|KFK43030.1|  hypothetical protein AALP_AA1G069700                    207   1e-57    
gb|KDP32595.1|  hypothetical protein JCGZ_13145                         204   1e-57    
ref|XP_011095801.1|  PREDICTED: mitogen-activated protein kinase ...    208   2e-57    
gb|KDP41958.1|  hypothetical protein JCGZ_26976                         206   2e-57    
ref|XP_009418854.1|  PREDICTED: mitogen-activated protein kinase ...    207   2e-57    
ref|XP_009796297.1|  PREDICTED: mitogen-activated protein kinase ...    207   3e-57    
ref|XP_010244478.1|  PREDICTED: mitogen-activated protein kinase ...    207   3e-57    
ref|XP_007210946.1|  hypothetical protein PRUPE_ppa024142mg             206   3e-57    
ref|XP_002267449.1|  PREDICTED: mitogen-activated protein kinase ...    206   3e-57    Vitis vinifera
ref|XP_009790439.1|  PREDICTED: mitogen-activated protein kinase ...    206   3e-57    
ref|XP_006367818.1|  PREDICTED: mitogen-activated protein kinase ...    204   4e-57    
ref|XP_010090324.1|  Mitogen-activated protein kinase kinase kina...    202   4e-57    
ref|XP_008228909.1|  PREDICTED: protein kinase byr2-like                206   4e-57    
ref|XP_002892383.1|  hypothetical protein ARALYDRAFT_334013             212   5e-57    
ref|XP_010275098.1|  PREDICTED: mitogen-activated protein kinase ...    204   5e-57    
gb|KEH36902.1|  MAP kinase kinase kinase                                204   5e-57    
gb|AHW50674.1|  mitogen-activated protein kinase kinase kinase a        205   7e-57    
ref|XP_006582671.1|  PREDICTED: mitogen-activated protein kinase ...    202   1e-56    
ref|XP_007213446.1|  hypothetical protein PRUPE_ppa025047mg             206   1e-56    
ref|XP_007213172.1|  hypothetical protein PRUPE_ppa026317mg             202   1e-56    
ref|XP_002302871.2|  hypothetical protein POPTR_0002s21350g             205   1e-56    Populus trichocarpa [western balsam poplar]
gb|EYU38261.1|  hypothetical protein MIMGU_mgv1a023811mg                203   1e-56    
ref|XP_010323839.1|  PREDICTED: mitogen-activated protein kinase ...    204   1e-56    
ref|XP_011087640.1|  PREDICTED: mitogen-activated protein kinase ...    203   1e-56    
ref|XP_001780526.1|  predicted protein                                  201   1e-56    
emb|CAN65217.1|  hypothetical protein VITISV_024689                     205   1e-56    Vitis vinifera
gb|KDO78298.1|  hypothetical protein CISIN_1g040569mg                   204   2e-56    
ref|XP_009127060.1|  PREDICTED: mitogen-activated protein kinase ...    206   2e-56    
ref|XP_008228961.1|  PREDICTED: protein kinase byr2-like                203   3e-56    
ref|XP_008380362.1|  PREDICTED: mitogen-activated protein kinase ...    204   3e-56    
ref|XP_007217367.1|  hypothetical protein PRUPE_ppa021834mg             201   3e-56    
ref|XP_008348361.1|  PREDICTED: mitogen-activated protein kinase ...    204   3e-56    
ref|XP_011006457.1|  PREDICTED: mitogen-activated protein kinase ...    203   4e-56    
ref|XP_008226949.1|  PREDICTED: mitogen-activated protein kinase ...    205   4e-56    
ref|XP_009600573.1|  PREDICTED: mitogen-activated protein kinase ...    204   4e-56    
ref|XP_002960952.1|  hypothetical protein SELMODRAFT_74353              199   4e-56    
ref|XP_009616882.1|  PREDICTED: mitogen-activated protein kinase ...    201   4e-56    
ref|XP_007217338.1|  hypothetical protein PRUPE_ppa020755mg             203   5e-56    
ref|XP_002269660.1|  PREDICTED: mitogen-activated protein kinase ...    203   5e-56    Vitis vinifera
ref|XP_009790438.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    201   6e-56    
ref|XP_006353711.1|  PREDICTED: mitogen-activated protein kinase ...    201   6e-56    
ref|XP_007019852.1|  Mitogen-activated protein kinase kinase kina...    200   6e-56    
ref|XP_011100411.1|  PREDICTED: mitogen-activated protein kinase ...    202   6e-56    
ref|XP_007217499.1|  hypothetical protein PRUPE_ppa025731mg             202   7e-56    
ref|XP_004305802.1|  PREDICTED: mitogen-activated protein kinase ...    200   8e-56    
ref|XP_009588015.1|  PREDICTED: mitogen-activated protein kinase ...    200   1e-55    
ref|XP_008461430.1|  PREDICTED: mitogen-activated protein kinase ...    200   1e-55    
ref|XP_007216275.1|  hypothetical protein PRUPE_ppa017376mg             201   1e-55    
ref|XP_002967055.1|  hypothetical protein SELMODRAFT_86715              198   1e-55    
ref|XP_009765082.1|  PREDICTED: serine/threonine-protein kinase p...    201   1e-55    
ref|XP_006468187.1|  PREDICTED: mitogen-activated protein kinase ...    204   2e-55    
ref|XP_004243483.1|  PREDICTED: mitogen-activated protein kinase ...    199   2e-55    
gb|EYU27355.1|  hypothetical protein MIMGU_mgv1a026298mg                202   2e-55    
gb|AAR87850.2|  fertilization-related kinase 1                          199   2e-55    
ref|XP_008379645.1|  PREDICTED: mitogen-activated protein kinase ...    202   2e-55    
ref|XP_002304913.2|  hypothetical protein POPTR_0004s00910g             201   2e-55    
ref|XP_008385962.1|  PREDICTED: mitogen-activated protein kinase ...    204   2e-55    
ref|XP_011008032.1|  PREDICTED: mitogen-activated protein kinase ...    204   2e-55    
ref|XP_004136102.1|  PREDICTED: serine/threonine-protein kinase B...    199   2e-55    
ref|XP_006355242.1|  PREDICTED: mitogen-activated protein kinase ...    200   2e-55    
ref|XP_010252458.1|  PREDICTED: mitogen-activated protein kinase ...    203   3e-55    
gb|AAL87297.1|  unknown protein                                         201   3e-55    
ref|XP_006353717.1|  PREDICTED: mitogen-activated protein kinase ...    199   3e-55    
ref|XP_002309365.2|  hypothetical protein POPTR_0006s19480g             197   3e-55    
gb|AGV06258.1|  fertilization-related kinase 1                          199   3e-55    
emb|CAN71722.1|  hypothetical protein VITISV_012221                     202   3e-55    
ref|NP_200320.1|  mitogen-activated protein kinase kinase kinase 15     202   3e-55    
ref|XP_009766255.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    197   3e-55    
gb|EYU35020.1|  hypothetical protein MIMGU_mgv1a019444mg                199   4e-55    
gb|KDP24854.1|  hypothetical protein JCGZ_24448                         201   4e-55    
ref|XP_006353719.1|  PREDICTED: mitogen-activated protein kinase ...    197   4e-55    
ref|XP_007216771.1|  hypothetical protein PRUPE_ppa024327mg             199   5e-55    
emb|CAB36535.1|  putative NPK1-related protein kinase                   201   6e-55    
dbj|BAF00528.1|  putative NPK1-related protein kinase                   201   6e-55    
ref|NP_194419.2|  mitogen-activated protein kinase kinase kinase 16     201   6e-55    
ref|XP_008228964.1|  PREDICTED: mitogen-activated protein kinase ...    198   6e-55    
ref|XP_010651429.1|  PREDICTED: mitogen-activated protein kinase ...    202   7e-55    
emb|CDP10763.1|  unnamed protein product                                201   7e-55    
ref|XP_004158828.1|  PREDICTED: serine/threonine-protein kinase B...    198   8e-55    
ref|XP_010246145.1|  PREDICTED: mitogen-activated protein kinase ...    198   8e-55    
ref|XP_006413128.1|  hypothetical protein EUTSA_v10027219mg             202   9e-55    
gb|KHN37195.1|  Mitogen-activated protein kinase kinase kinase ANP1     195   9e-55    
ref|XP_008371167.1|  PREDICTED: mitogen-activated protein kinase ...    201   1e-54    
ref|XP_009361098.1|  PREDICTED: mitogen-activated protein kinase ...    201   1e-54    
ref|XP_008228068.1|  PREDICTED: mitogen-activated protein kinase ...    199   1e-54    
emb|CDO97638.1|  unnamed protein product                                197   1e-54    
ref|XP_009767132.1|  PREDICTED: mitogen-activated protein kinase ...    198   1e-54    
ref|XP_007021680.1|  Mitogen-activated protein kinase kinase kina...    197   1e-54    
ref|XP_007020769.1|  Mitogen-activated protein kinase kinase kina...    200   2e-54    
ref|XP_004243852.1|  PREDICTED: mitogen-activated protein kinase ...    197   2e-54    
ref|XP_010236368.1|  PREDICTED: mitogen-activated protein kinase ...    201   2e-54    
ref|XP_009144845.1|  PREDICTED: mitogen-activated protein kinase ...    200   2e-54    
ref|XP_008806975.1|  PREDICTED: mitogen-activated protein kinase ...    197   2e-54    
ref|XP_002529924.1|  Mitogen-activated protein kinase kinase kina...    200   2e-54    
emb|CDP15776.1|  unnamed protein product                                200   2e-54    
ref|XP_010046333.1|  PREDICTED: mitogen-activated protein kinase ...    199   3e-54    
ref|XP_002281578.1|  PREDICTED: mitogen-activated protein kinase ...    198   3e-54    
emb|CDX97370.1|  BnaC08g12350D                                          198   3e-54    
ref|XP_003534712.1|  PREDICTED: mitogen-activated protein kinase ...    198   4e-54    
ref|XP_009613859.1|  PREDICTED: mitogen-activated protein kinase ...    196   5e-54    
ref|XP_004136103.1|  PREDICTED: serine/threonine-protein kinase B...    196   5e-54    
ref|XP_010910534.1|  PREDICTED: mitogen-activated protein kinase ...    196   5e-54    
ref|XP_009118988.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    198   5e-54    
ref|XP_009623765.1|  PREDICTED: mitogen-activated protein kinase ...    196   5e-54    
ref|XP_007217287.1|  hypothetical protein PRUPE_ppa017881mg             196   5e-54    
ref|XP_009598440.1|  PREDICTED: mitogen-activated protein kinase ...    196   5e-54    
ref|XP_011097967.1|  PREDICTED: mitogen-activated protein kinase ...    199   5e-54    
ref|XP_006449765.1|  hypothetical protein CICLE_v10014400mg             204   5e-54    
ref|XP_006364162.1|  PREDICTED: mitogen-activated protein kinase ...    196   5e-54    
ref|XP_002512849.1|  ATP binding protein, putative                      195   6e-54    
ref|XP_009141244.1|  PREDICTED: mitogen-activated protein kinase ...    196   6e-54    
ref|XP_009607835.1|  PREDICTED: mitogen-activated protein kinase ...    196   6e-54    
ref|XP_008228067.1|  PREDICTED: mitogen-activated protein kinase ...    196   7e-54    
ref|XP_009120374.1|  PREDICTED: mitogen-activated protein kinase ...    198   7e-54    
ref|XP_008461431.1|  PREDICTED: mitogen-activated protein kinase ...    195   7e-54    
ref|XP_004295838.1|  PREDICTED: mitogen-activated protein kinase ...    198   8e-54    
emb|CDY06612.1|  BnaC02g13360D                                          199   9e-54    
ref|XP_006847256.1|  hypothetical protein AMTR_s00015p00050440          197   9e-54    
ref|XP_008342026.1|  PREDICTED: mitogen-activated protein kinase ...    193   1e-53    
ref|XP_006353638.1|  PREDICTED: mitogen-activated protein kinase ...    194   1e-53    
ref|XP_010322731.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    195   1e-53    
ref|XP_009627572.1|  PREDICTED: serine/threonine-protein kinase g...    196   1e-53    
ref|XP_002866074.1|  MAPKKK15                                           197   1e-53    
dbj|BAF01224.1|  hypothetical protein                                   197   1e-53    
ref|XP_001755249.1|  predicted protein                                  192   2e-53    
ref|XP_004243853.1|  PREDICTED: mitogen-activated protein kinase ...    194   2e-53    
ref|XP_006342282.1|  PREDICTED: mitogen-activated protein kinase ...    194   2e-53    
ref|XP_004486314.1|  PREDICTED: mitogen-activated protein kinase ...    197   2e-53    
ref|XP_004242227.1|  PREDICTED: mitogen-activated protein kinase ...    194   2e-53    
ref|XP_004158829.1|  PREDICTED: protein kinase byr2-like                194   2e-53    
emb|CDX89295.1|  BnaA01g15980D                                          197   2e-53    
emb|CDY52049.1|  BnaCnng21650D                                          194   2e-53    
emb|CDY10252.1|  BnaC05g04950D                                          197   2e-53    
dbj|BAJ92652.1|  predicted protein                                      196   3e-53    
ref|XP_006401496.1|  hypothetical protein EUTSA_v10015237mg             197   3e-53    
ref|XP_006280356.1|  hypothetical protein CARUB_v10026284mg             198   3e-53    
ref|XP_009761682.1|  PREDICTED: serine/threonine-protein kinase g...    194   3e-53    
ref|XP_006307241.1|  hypothetical protein CARUB_v10008850mg             198   3e-53    
gb|EPS71117.1|  hypothetical protein M569_03641                         194   3e-53    
ref|XP_006367407.1|  PREDICTED: mitogen-activated protein kinase ...    194   3e-53    
ref|XP_007216264.1|  hypothetical protein PRUPE_ppa017296mg             193   3e-53    
ref|XP_006353720.1|  PREDICTED: mitogen-activated protein kinase ...    194   3e-53    
emb|CDY19144.1|  BnaA04g18840D                                          194   3e-53    
ref|XP_009347129.1|  PREDICTED: mitogen-activated protein kinase ...    196   3e-53    
gb|EPS63968.1|  hypothetical protein M569_10815                         192   3e-53    
emb|CAN66202.1|  hypothetical protein VITISV_015759                     197   3e-53    
ref|XP_009353299.1|  PREDICTED: mitogen-activated protein kinase ...    196   4e-53    
ref|NP_001184927.1|  mitogen-activated protein kinase kinase kina...    197   4e-53    
gb|KDP32604.1|  hypothetical protein JCGZ_13154                         190   5e-53    
gb|EYU33995.1|  hypothetical protein MIMGU_mgv1a025547mg                193   5e-53    
ref|XP_010541461.1|  PREDICTED: mitogen-activated protein kinase ...    194   5e-53    
ref|XP_010658122.1|  PREDICTED: mitogen-activated protein kinase ...    194   5e-53    
ref|XP_002881230.1|  MAPKKK17                                           194   5e-53    
ref|XP_002524836.1|  Mitogen-activated protein kinase kinase kina...    196   5e-53    
ref|XP_006417836.1|  hypothetical protein EUTSA_v10007482mg             197   6e-53    
ref|NP_172195.1|  mitogen-activated protein kinase kinase kinase 13     197   6e-53    
ref|XP_002312977.2|  hypothetical protein POPTR_0009s13360g             192   6e-53    
gb|KFK23513.1|  hypothetical protein AALP_AAs67696U000200               194   7e-53    
ref|XP_008228988.1|  PREDICTED: mitogen-activated protein kinase ...    198   7e-53    
ref|XP_010096874.1|  Mitogen-activated protein kinase kinase kina...    196   7e-53    
ref|XP_007217525.1|  hypothetical protein PRUPE_ppa023656mg             192   8e-53    
ref|XP_009396715.1|  PREDICTED: mitogen-activated protein kinase ...    197   9e-53    
ref|XP_002518446.1|  ATP binding protein, putative                      192   9e-53    
ref|XP_010242319.1|  PREDICTED: mitogen-activated protein kinase ...    192   9e-53    
emb|CAN76632.1|  hypothetical protein VITISV_032336                     191   9e-53    
ref|XP_011004631.1|  PREDICTED: mitogen-activated protein kinase ...    191   9e-53    
ref|XP_009352665.1|  PREDICTED: mitogen-activated protein kinase ...    196   1e-52    
ref|XP_007222400.1|  hypothetical protein PRUPE_ppa008119mg             192   1e-52    
ref|XP_004301562.1|  PREDICTED: mitogen-activated protein kinase ...    192   1e-52    
ref|XP_006364180.1|  PREDICTED: mitogen-activated protein kinase ...    193   1e-52    
ref|XP_006355243.1|  PREDICTED: mitogen-activated protein kinase ...    191   1e-52    
emb|CDY52115.1|  BnaA10g29440D                                          196   1e-52    
ref|XP_011046960.1|  PREDICTED: mitogen-activated protein kinase ...    195   1e-52    
ref|XP_009587571.1|  PREDICTED: mitogen-activated protein kinase ...    192   2e-52    
ref|XP_002960951.1|  hypothetical protein SELMODRAFT_73444              190   2e-52    
ref|XP_009625704.1|  PREDICTED: mitogen-activated protein kinase ...    191   2e-52    
ref|XP_010686869.1|  PREDICTED: mitogen-activated protein kinase ...    193   2e-52    
ref|XP_003633375.1|  PREDICTED: mitogen-activated protein kinase ...    189   2e-52    
gb|EYU34013.1|  hypothetical protein MIMGU_mgv1a020948mg                191   2e-52    
ref|XP_010938267.1|  PREDICTED: mitogen-activated protein kinase ...    196   3e-52    
ref|XP_006836834.1|  hypothetical protein AMTR_s00099p00063540          193   3e-52    
gb|EYU41367.1|  hypothetical protein MIMGU_mgv1a017677mg                190   3e-52    
ref|XP_004243871.1|  PREDICTED: mitogen-activated protein kinase ...    191   3e-52    
ref|XP_004954858.1|  PREDICTED: serine/threonine-protein kinase D...    196   3e-52    
ref|XP_002267830.1|  PREDICTED: mitogen-activated protein kinase ...    191   4e-52    
ref|XP_010475182.1|  PREDICTED: mitogen-activated protein kinase ...    191   4e-52    
ref|XP_009355446.1|  PREDICTED: mitogen-activated protein kinase ...    191   4e-52    
ref|XP_010482930.1|  PREDICTED: mitogen-activated protein kinase ...    193   5e-52    
ref|XP_006447587.1|  hypothetical protein CICLE_v10015460mg             192   7e-52    
ref|XP_004151935.1|  PREDICTED: mitogen-activated protein kinase ...    192   8e-52    
emb|CDX80352.1|  BnaC09g33900D                                          193   8e-52    
ref|XP_006364160.1|  PREDICTED: mitogen-activated protein kinase ...    190   9e-52    
ref|XP_010457586.1|  PREDICTED: mitogen-activated protein kinase ...    190   9e-52    
ref|XP_010655415.1|  PREDICTED: mitogen-activated protein kinase ...    192   1e-51    
gb|KDP39158.1|  hypothetical protein JCGZ_00915                         191   1e-51    
emb|CDX97857.1|  BnaC04g40820D                                          192   1e-51    
ref|XP_011033508.1|  PREDICTED: mitogen-activated protein kinase ...    189   1e-51    
ref|XP_003560747.1|  PREDICTED: mitogen-activated protein kinase ...    194   1e-51    
ref|XP_006349303.1|  PREDICTED: mitogen-activated protein kinase ...    190   1e-51    
emb|CDX84864.1|  BnaA03g13660D                                          193   1e-51    
ref|XP_004173671.1|  PREDICTED: mitogen-activated protein kinase ...    190   1e-51    
ref|XP_006418061.1|  hypothetical protein EUTSA_v10008116mg             189   1e-51    
ref|XP_009357591.1|  PREDICTED: mitogen-activated protein kinase ...    192   2e-51    
ref|XP_010655414.1|  PREDICTED: mitogen-activated protein kinase ...    191   2e-51    
ref|XP_008228822.1|  PREDICTED: mitogen-activated protein kinase ...    189   2e-51    
ref|XP_007216898.1|  hypothetical protein PRUPE_ppa019617mg             188   2e-51    
emb|CDY24036.1|  BnaC03g16550D                                          194   2e-51    
ref|XP_002313986.2|  hypothetical protein POPTR_0009s07730g             190   3e-51    
emb|CDY12200.1|  BnaC04g12300D                                          189   3e-51    
ref|XP_004487421.1|  PREDICTED: mitogen-activated protein kinase ...    190   3e-51    
ref|XP_002264624.2|  PREDICTED: mitogen-activated protein kinase ...    189   4e-51    
ref|XP_010089475.1|  Mitogen-activated protein kinase kinase kina...    190   4e-51    
ref|NP_180810.1|  mitogen-activated protein kinase kinase kinase 17     189   4e-51    
ref|XP_008218686.1|  PREDICTED: mitogen-activated protein kinase ...    188   5e-51    
ref|XP_010096875.1|  Mitogen-activated protein kinase kinase kina...    188   6e-51    
ref|XP_004243851.1|  PREDICTED: mitogen-activated protein kinase ...    187   6e-51    
ref|XP_008228449.1|  PREDICTED: mitogen-activated protein kinase ...    188   7e-51    
ref|XP_008339420.1|  PREDICTED: mitogen-activated protein kinase ...    187   8e-51    
ref|XP_009607566.1|  PREDICTED: protein kinase byr2-like                187   8e-51    
ref|XP_010543009.1|  PREDICTED: mitogen-activated protein kinase ...    187   1e-50    
ref|XP_009791903.1|  PREDICTED: mitogen-activated protein kinase ...    187   1e-50    
ref|XP_010484689.1|  PREDICTED: mitogen-activated protein kinase ...    187   1e-50    
ref|XP_009416709.1|  PREDICTED: mitogen-activated protein kinase ...    189   1e-50    
ref|XP_008384252.1|  PREDICTED: mitogen-activated protein kinase ...    189   1e-50    
ref|XP_004144594.1|  PREDICTED: mitogen-activated protein kinase ...    187   1e-50    
ref|XP_008365330.1|  PREDICTED: mitogen-activated protein kinase ...    187   1e-50    
ref|XP_006294159.1|  hypothetical protein CARUB_v10023152mg             190   1e-50    
ref|XP_010543052.1|  PREDICTED: mitogen-activated protein kinase ...    191   1e-50    
ref|XP_002967056.1|  hypothetical protein SELMODRAFT_408419             191   2e-50    
ref|XP_004233946.1|  PREDICTED: mitogen-activated protein kinase ...    186   2e-50    
gb|KDO54709.1|  hypothetical protein CISIN_1g015500mg                   188   2e-50    
ref|XP_010475855.1|  PREDICTED: mitogen-activated protein kinase ...    189   2e-50    
ref|NP_180565.1|  mitogen-activated protein kinase kinase kinase 14     189   2e-50    
ref|XP_007217373.1|  hypothetical protein PRUPE_ppa022286mg             185   2e-50    
ref|XP_008229344.1|  PREDICTED: mitogen-activated protein kinase ...    186   2e-50    
gb|KDP42471.1|  hypothetical protein JCGZ_00268                         186   2e-50    
ref|XP_004167046.1|  PREDICTED: mitogen-activated protein kinase ...    187   2e-50    
ref|XP_007216957.1|  hypothetical protein PRUPE_ppa015524mg             185   3e-50    
ref|XP_008245684.1|  PREDICTED: mitogen-activated protein kinase ...    186   3e-50    
ref|XP_009143997.1|  PREDICTED: mitogen-activated protein kinase ...    186   3e-50    
ref|XP_004295280.1|  PREDICTED: mitogen-activated protein kinase ...    187   3e-50    
ref|XP_010557200.1|  PREDICTED: mitogen-activated protein kinase ...    188   3e-50    
ref|XP_009414371.1|  PREDICTED: mitogen-activated protein kinase ...    190   3e-50    
ref|XP_008229101.1|  PREDICTED: mitogen-activated protein kinase ...    185   3e-50    
ref|XP_010522353.1|  PREDICTED: mitogen-activated protein kinase ...    186   4e-50    
ref|XP_010102787.1|  Protein kinase byr2                                190   4e-50    
emb|CDY20789.1|  BnaA02g09290D                                          188   4e-50    
ref|XP_006367406.1|  PREDICTED: mitogen-activated protein kinase ...    189   4e-50    
ref|XP_010112432.1|  Zinc finger CCCH domain-containing protein 17      191   4e-50    
emb|CBI23211.3|  unnamed protein product                                195   4e-50    
emb|CDY42094.1|  BnaA05g10920D                                          186   4e-50    
ref|XP_010469578.1|  PREDICTED: mitogen-activated protein kinase ...    186   4e-50    
ref|XP_008349313.1|  PREDICTED: mitogen-activated protein kinase ...    187   5e-50    
ref|XP_002269638.1|  PREDICTED: mitogen-activated protein kinase ...    186   5e-50    
ref|XP_004972119.1|  PREDICTED: mitogen-activated protein kinase ...    188   6e-50    
ref|XP_010413987.1|  PREDICTED: mitogen-activated protein kinase ...    185   7e-50    
ref|XP_008455899.1|  PREDICTED: mitogen-activated protein kinase ...    187   7e-50    
ref|XP_006295854.1|  hypothetical protein CARUB_v10024983mg             185   8e-50    
ref|XP_002879245.1|  MAPKKK14                                           186   8e-50    
gb|KCW44336.1|  hypothetical protein EUGRSUZ_L02203                     185   9e-50    
ref|XP_010556997.1|  PREDICTED: mitogen-activated protein kinase ...    185   9e-50    



>gb|EYU39328.1| hypothetical protein MIMGU_mgv1a009594mg [Erythranthe guttata]
Length=337

 Score =   436 bits (1120),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 262/353 (74%), Gaps = 21/353 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE +G GSF  VSLA P +   +G  P M  KSCG S   SL NEK +LD+L+ C
Sbjct  1     MDWVRGEKLGHGSFATVSLAAPTNQS-SGLPPLMAAKSCGFSHSSSLANEKLILDDLQNC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E+IRCFG+  S+ENGE+LYN+LLE+AS G+LADK+K S   RL E E+RRY+KALLRG+
Sbjct  60    PEIIRCFGERISYENGEQLYNILLEYASGGSLADKLKSSGGSRLPESEVRRYTKALLRGV  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR--NGGKNLGCELRGTPMYMSPEMV  687
              YIH+VGYVHCDIKLQNILL ENG VKIADFGLAKR   GG+  GCELRGTPMYMSPEMV
Sbjct  120   NYIHEVGYVHCDIKLQNILLGENGAVKIADFGLAKRVFGGGEYSGCELRGTPMYMSPEMV  179

Query  688   NGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
              GG+QGPA DIWA+GCAV EM  GAPAW+ S+VA LLM+IGVG E+PEIPG LSD+GKDF
Sbjct  180   AGGDQGPAVDIWAVGCAVVEMLSGAPAWRCSDVASLLMKIGVGGEVPEIPGDLSDEGKDF  239

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L +CFIKDP KRWTAEMLL+HPFI G+D   +    N T            PR PFDF D
Sbjct  240   LGRCFIKDPLKRWTAEMLLDHPFIDGQDFVISAVKENTTS-----------PRSPFDFSD  288

Query  1048  WVSESDHLQSSITSLPPPE---SEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             WVS    +  SITSLPPPE      SPA+RL+ +VS+QSP+WS   D WV VR
Sbjct  289   WVSS---VGCSITSLPPPEYSAGSVSPAERLRQLVSYQSPDWSVSVD-WVTVR  337



>ref|XP_009629207.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Nicotiana tomentosiformis]
Length=356

 Score =   433 bits (1114),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 225/362 (62%), Positives = 264/362 (73%), Gaps = 20/362 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE VG+GSFGKVS A+P         P MVVKS   S   +L NEK +LDEL+ C
Sbjct  1     MDWVRGEAVGQGSFGKVSFAIPTKQ-TTQILPLMVVKSSWVSHSATLRNEKKILDELKSC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E+IRCFGD YS ENGE LYNVLLE+AS G+LADK+K SEN RLSE E++ Y+K +LRGL
Sbjct  60    PEIIRCFGDSYSCENGENLYNVLLEYASGGSLADKLKNSENLRLSEFEVKGYTKGMLRGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              YIHK  YVHCDIKLQNILL ++G+VKIADFGLAKR G K   NL CELRGTP+YMSPEM
Sbjct  120   NYIHKSAYVHCDIKLQNILLGQDGKVKIADFGLAKRVGTKKEDNLRCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQG AADIWALGC VAEM  G PAW+ ++V ELLM IGV  ++P+IP KLS++GKD
Sbjct  180   VTGGEQGTAADIWALGCVVAEMVTGVPAWRCTDVTELLMAIGVKNQLPQIPEKLSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FLEKCF+KDP KRWTAEMLLNHPF++  D   TV+L  +   E     PS SP+CPFDFP
Sbjct  240   FLEKCFVKDPSKRWTAEMLLNHPFVADHDYYGTVTLNEENKSE----IPSTSPKCPFDFP  295

Query  1045  DWVSESDHLQSSITSLPPPESE-----------YSPADRLQGIVSHQSPNWSQDSDEWVN  1191
             DWVS+      SIT LP  E++            S A+RL+G+VS   P WS  +D+WVN
Sbjct  296   DWVSDQLPETCSITCLPSSENQEKLNLSSGSWYNSAAERLRGLVSEIRPEWSS-ADDWVN  354

Query  1192  VR  1197
             VR
Sbjct  355   VR  356



>ref|XP_011099128.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Sesamum indicum]
Length=358

 Score =   431 bits (1107),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/370 (62%), Positives = 271/370 (73%), Gaps = 34/370 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             MDWVRGE +G+GSF  VSLAVPR  G +   PP M VKSCG S   SL+NE+ VL+ELR 
Sbjct  1     MDWVRGEKLGQGSFATVSLAVPR--GRSSFLPPLMAVKSCGVSHSSSLVNERLVLEELRD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E+IRCFG+ +S+ENGE+LYNVLLE+AS G+LADK+KKS +  L E ++R+Y+K+LL+G
Sbjct  59    CPEIIRCFGENFSYENGERLYNVLLEYASGGSLADKLKKSGDRGLPESDVRQYTKSLLKG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNL--GCELRGTPMYMSPEM  684
             L YIHKVG+VHCDIKLQNILL  NG VKIADFGLAKR G K+    CELRGTPMYMSPEM
Sbjct  119   LRYIHKVGFVHCDIKLQNILLGPNGGVKIADFGLAKRVGKKSAVPRCELRGTPMYMSPEM  178

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V  GEQG  ADIWALGC VAEM  GAPAW  S VA LLMRIGVGEE+P IPG LS++GKD
Sbjct  179   VGAGEQGAPADIWALGCVVAEMVAGAPAWSSSNVAGLLMRIGVGEEVPAIPGILSEEGKD  238

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FL KCF+K+P KRWTAEMLLNHPF+S +D      L +   ++      S SPRCPFDFP
Sbjct  239   FLGKCFVKNPSKRWTAEMLLNHPFVSDQD------LDDAALKDRLTNTASTSPRCPFDFP  292

Query  1045  DWVSESDHLQSSITSLPPP------------ESEY-------SPADRLQGIVSHQSPNWS  1167
             DWVS +     SITSLP P            ES +       SPA+RLQG+VS QSP+WS
Sbjct  293   DWVSSA---TCSITSLPSPAHFPESGLWFCEESNFRKESWSISPAERLQGLVSEQSPHWS  349

Query  1168  QDSDEWVNVR  1197
               SD+WV +R
Sbjct  350   V-SDDWVTIR  358



>gb|AHW50675.1| mitogen-activated protein kinase kinase kinase 3 [Nicotiana tabacum]
Length=360

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/368 (60%), Positives = 267/368 (73%), Gaps = 28/368 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE VG GSFGKVS A+PR          MVVKS  AS   +L+NEK +LDEL+ C
Sbjct  1     MDWVRGEAVGHGSFGKVSFAIPRKQSTQA----MVVKSSAASRSATLMNEKTILDELKSC  56

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +IRC GD YS+ENGEKLYNVLLE+AS G L++K+K S +HRL E E+R Y+KALL+GL
Sbjct  57    PNIIRCLGDNYSYENGEKLYNVLLEYASGGDLSNKLKNSGDHRLPEFEVRNYTKALLKGL  116

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              YIHK GYVHCDIKLQNILL E+G++KIADFGLAKR   K   +L CELRGTP+YMSPEM
Sbjct  117   HYIHKSGYVHCDIKLQNILLGEDGQLKIADFGLAKRAESKKDDSLRCELRGTPLYMSPEM  176

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQG  ADIWALGC VAEM  G P W +S + +LLM IGVG+E+PE P KLS+ GKD
Sbjct  177   VTGGEQGTPADIWALGCVVAEMEAGVPVWNYSNITQLLMTIGVGDELPEFPAKLSELGKD  236

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGED-DGATVSLRNDTHREasapapspspRCPFDF  1041
             FLE+CF+KDPRKRWTAEMLLNHPF++ +  D ATV+L ++T     +  PS SPRCPFDF
Sbjct  237   FLERCFVKDPRKRWTAEMLLNHPFVADQQYDDATVTLNDET---CGSGTPSSSPRCPFDF  293

Query  1042  PDWVSESDHLQS---SITSLPPPESE-----------YSPADRLQGIVSHQSP--NWSQD  1173
             PDWVS+     S   SITSLP P  +            +PA RL+ +V  + P  +WS  
Sbjct  294   PDWVSDGSAESSATCSITSLPSPAIQELLNLNGGSWSTTPAKRLRVLVGERRPESDWSA-  352

Query  1174  SDEWVNVR  1197
             +D+WV+VR
Sbjct  353   ADDWVSVR  360



>ref|XP_009796739.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana sylvestris]
Length=360

 Score =   424 bits (1090),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 221/368 (60%), Positives = 268/368 (73%), Gaps = 28/368 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE VG GSFGKVS A+PR          MVVKS  AS   +L+NEK +LDEL+ C
Sbjct  1     MDWVRGEAVGHGSFGKVSFAIPRKQSTQA----MVVKSSAASRSTTLMNEKTILDELKSC  56

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +IRC GD YS+ENGEKLYNVLLE+A+ G L++K+K S +HRL E E+++Y+KALL+GL
Sbjct  57    PNIIRCLGDNYSYENGEKLYNVLLEYAAGGDLSNKLKNSGDHRLPEFEVKKYTKALLKGL  116

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              YIHK GYVHCDIKLQNILL ++G+VKIADFGLAKR   K   NL CELRGTP+YM+PEM
Sbjct  117   HYIHKTGYVHCDIKLQNILLGDDGQVKIADFGLAKRVESKKDDNLRCELRGTPLYMAPEM  176

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQG  ADIWALGC VAEMA G P W +S + +LLM IGVG+E+PE P KLS+ GKD
Sbjct  177   VTGGEQGTPADIWALGCVVAEMAAGVPVWNYSNITQLLMTIGVGDELPEFPAKLSEQGKD  236

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGED-DGATVSLRNDTHREasapapspspRCPFDF  1041
             FLEKCF+KDPRKRWTAEMLLNHPF++ +  D ATV+L ++T     +  PS SPRCPFDF
Sbjct  237   FLEKCFVKDPRKRWTAEMLLNHPFVADQHYDDATVTLNDET---CGSGTPSTSPRCPFDF  293

Query  1042  PDWV---SESDHLQSSITSLPPPESE-----------YSPADRLQGIVSHQSP--NWSQD  1173
             PDWV   S       SITSLP P  +            +PA+RL+ +V  + P  +WS  
Sbjct  294   PDWVSDASAESSAACSITSLPSPAIQELLNLNGGSWSTAPAERLRVLVGERRPESDWSA-  352

Query  1174  SDEWVNVR  1197
             +D+WV+VR
Sbjct  353   ADDWVSVR  360



>ref|XP_009628421.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana tomentosiformis]
Length=360

 Score =   423 bits (1087),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/368 (60%), Positives = 267/368 (73%), Gaps = 28/368 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE VG GSFGKVS A+PR          MVVKS  AS   +L+NEK +LDEL+ C
Sbjct  1     MDWVRGEAVGHGSFGKVSFAIPRKQSTQA----MVVKSSAASRSATLMNEKTILDELKSC  56

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +IRC GD YS+ENGEKLYNVLLE+AS G L++K+K S +HRL E E+R Y+KALL+GL
Sbjct  57    PNIIRCLGDNYSYENGEKLYNVLLEYASGGDLSNKLKNSGDHRLPEFEVRNYTKALLKGL  116

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              YIHK GYVHCDIKLQNILL E+G++KIADFGLAKR   K   +L CELRGTP+YMSPEM
Sbjct  117   HYIHKSGYVHCDIKLQNILLGEDGQLKIADFGLAKRAESKKDDSLRCELRGTPLYMSPEM  176

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQG  ADIWALGC VAEM  G P W +S + +LLM IGVG+E+PE P KLS+ GKD
Sbjct  177   VTGGEQGTPADIWALGCVVAEMEAGVPIWNYSNITQLLMTIGVGDELPEFPAKLSELGKD  236

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGED-DGATVSLRNDTHREasapapspspRCPFDF  1041
             FLEKCF+KDP+KRWTAEMLLNHPF++ +  D ATV+L ++T     +  PS SPRCPFDF
Sbjct  237   FLEKCFVKDPKKRWTAEMLLNHPFVADQHYDDATVTLNDET---CGSGTPSTSPRCPFDF  293

Query  1042  PDWVSESDHLQS---SITSLPPPESE-----------YSPADRLQGIVSHQSP--NWSQD  1173
             PDWVS+     S   SITSLP P  +            +PA+RL+ +   + P  +WS  
Sbjct  294   PDWVSDGSAESSATCSITSLPSPAIQELLNLNGGSWSTTPAERLRVLAGERRPESDWSA-  352

Query  1174  SDEWVNVR  1197
             +D+WV+VR
Sbjct  353   ADDWVSVR  360



>ref|XP_006360216.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Solanum tuberosum]
Length=356

 Score =   420 bits (1079),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 220/364 (60%), Positives = 267/364 (73%), Gaps = 24/364 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE VG GSFGKV+LA+PR        P MV+KS G S   SL+NEK +LDEL GC
Sbjct  1     MDWVRGEAVGHGSFGKVNLAIPRKQSTQ-FLPLMVMKSSGVSHSVSLVNEKKILDELNGC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E+IRCFG+ YSFENG+ LYN+LLE+A+ G+LA+K+KKSEN++LSE E+  Y+K +L+GL
Sbjct  60    SEIIRCFGESYSFENGDSLYNLLLEYATGGSLAEKLKKSENYKLSEFEVSGYTKGILKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN---LGCELRGTPMYMSPEM  684
              Y+H+VGY HCDIKLQNILL E+G+VKIADFGLAKR G K    L CELRGTP+YMSPEM
Sbjct  120   QYVHEVGYAHCDIKLQNILLGEDGKVKIADFGLAKRVGIKKDDELRCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQG  ADIWALGC VAEM  G PA++FS V ELLM IGV  ++P+IP +LS++GKD
Sbjct  180   VTGGEQGTPADIWALGCVVAEMVAGVPAYRFSNVTELLMAIGVKNQLPQIPEELSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FL KCF++DPRKRWTAEMLL HPF++  D   T++L N+   E     PS SP+CPFDFP
Sbjct  240   FLSKCFVQDPRKRWTAEMLLKHPFVADHD---TLTLLNE---EIKNGVPSISPKCPFDFP  293

Query  1045  DWVSE---SDHLQSSITSLPPPES--------EYSPADRLQGIVSHQSP--NWSQDSDEW  1185
             DWVS+      +  SIT LP PE+          SPA+RL G+VS  S    W  D D+W
Sbjct  294   DWVSDECAQSSVTCSITFLPSPENLNSSCGCWSTSPAERLMGLVSEFSTESEWCSD-DDW  352

Query  1186  VNVR  1197
             V VR
Sbjct  353   VTVR  356



>ref|XP_009803912.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Nicotiana sylvestris]
Length=363

 Score =   420 bits (1079),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 218/368 (59%), Positives = 268/368 (73%), Gaps = 25/368 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW+RGE+VG GSFGKV+LA+PR    +   P MVVKS  ASC  +LLNEK +LDEL+GC
Sbjct  1     MDWIRGESVGHGSFGKVNLAIPRCQS-SLFCPSMVVKSSSASCSATLLNEKLILDELKGC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++I C GD Y++ENGEKLYNVLLE+AS G L+DK+KKS +H L E E+++Y+KALL+GL
Sbjct  60    SQIINCLGDSYTYENGEKLYNVLLEYASGGDLSDKLKKSSDHILPEFEVKKYTKALLKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              YIHK GYVHCDIKLQNILL E+G+VKIADFGLAKR   +    L CELRGTP+YMSPEM
Sbjct  120   YYIHKSGYVHCDIKLQNILLGEDGQVKIADFGLAKRTKSRKDDKLRCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQ   ADIWALGC + EMA G PAW+ ++   LLM IGV +++PEIP KL ++GKD
Sbjct  180   VTGGEQDTPADIWALGCVLVEMATGNPAWRCTDTTRLLMTIGVSDQLPEIPEKLCEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGED-DGATVSLRNDTHREasapapspspRCPFDF  1041
             FLEKCF+KDP+KRWTAEMLLNHPF++G+  D  TV L++ T        PS SP+CPFDF
Sbjct  240   FLEKCFVKDPKKRWTAEMLLNHPFVAGQTYDDDTVILKDQTCES---GTPSTSPKCPFDF  296

Query  1042  PDWVSESDHLQS---SITSLPPPESE-----------YSPADRLQGIVSHQSP--NWSQD  1173
             PDWVS+     S   SITSLP P  +            +PA+RL+ +V    P   WS  
Sbjct  297   PDWVSDDSGKSSATCSITSLPSPAIQELRNLNGGSWSAAPAERLRVLVGEHRPESEWST-  355

Query  1174  SDEWVNVR  1197
             +D WV+VR
Sbjct  356   ADGWVSVR  363



>ref|XP_009628862.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Nicotiana tomentosiformis]
Length=363

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 269/368 (73%), Gaps = 25/368 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW+RGE VG GSFGKVS A+PR    +   P MVVKS  ASC  +L+NEK +LDEL+GC
Sbjct  1     MDWIRGEAVGHGSFGKVSFAIPRCQS-SLFCPSMVVKSSSASCSATLMNEKLILDELKGC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++I C GD Y++ENGEKLYNVLLE+AS G  ++K+K S +H L E E+R+Y+K+LL+GL
Sbjct  60    PQIINCLGDSYTYENGEKLYNVLLEYASGGDFSNKLKNSGDHILPEFEVRKYTKSLLKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              +IHK GYVHCDIKLQNILL ++G+VKIADFGLAKR   +    L CELRGTP+YMSPEM
Sbjct  120   HFIHKSGYVHCDIKLQNILLGQDGQVKIADFGLAKRTKSRKDDKLRCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQ   ADIWALGC + EMA G PAWK S++  LLM+IGVG+++PEIP KLS++GKD
Sbjct  180   VTGGEQESPADIWALGCVLVEMATGNPAWKCSDMTRLLMKIGVGDQLPEIPEKLSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGED-DGATVSLRNDTHREasapapspspRCPFDF  1041
             FLEKCF+KDPRKRWTAEMLLNHPF++G++ D  TV+L++ T        PS SPRCPFDF
Sbjct  240   FLEKCFVKDPRKRWTAEMLLNHPFVAGQNYDDDTVTLKDQTCES---GTPSTSPRCPFDF  296

Query  1042  PDWVSESDHLQS---SITSLPPPESE-----------YSPADRLQGIVSHQSP--NWSQD  1173
             PDWVS      S   SI SLP P  +            +PA+RL+ +V  + P   WS  
Sbjct  297   PDWVSNESGKSSVACSIRSLPSPAIQELLNLNGGSWSTTPAERLRVLVGERRPESEWST-  355

Query  1174  SDEWVNVR  1197
             +D WV+VR
Sbjct  356   ADGWVSVR  363



>ref|XP_004233440.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Solanum lycopersicum]
Length=359

 Score =   416 bits (1070),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 221/367 (60%), Positives = 267/367 (73%), Gaps = 27/367 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE +G GSFGKV+LA PR        P MVVKS G S   SL+NEK +LDEL GC
Sbjct  1     MDWVRGEAIGHGSFGKVNLARPRKQSTQ-FLPLMVVKSSGVSHSVSLVNEKKILDELNGC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E+IRCFG+ YSFE GE LYN+LLE+AS G+LA+K+KKSEN++LSE E+  Y+K +L+GL
Sbjct  60    SEIIRCFGESYSFEKGENLYNLLLEYASGGSLAEKLKKSENYKLSEFEVCGYTKGILKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              Y+H++GYVHCDIKLQNILL E+G+VKIADFGLAKR G K   +L CELRGTP+YMSPEM
Sbjct  120   QYVHEIGYVHCDIKLQNILLGEDGKVKIADFGLAKRVGIKKDDDLRCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             + GGEQG  +DIWALGC VAEM  G PA+KFS V ELLM IGV  ++PEIP +LS++GKD
Sbjct  180   ITGGEQGTPSDIWALGCVVAEMVAGVPAYKFSGVTELLMAIGVKNQLPEIPQELSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FL KCFI+DP KRWTAEMLL HPF+S  D    V+L N+   E     PS SP+CPFDFP
Sbjct  240   FLNKCFIQDPSKRWTAEMLLKHPFVSDHD---AVTLLNE---EIKNGVPSISPKCPFDFP  293

Query  1045  DWVSE---SDHLQSSITSLPPPESE-----------YSPADRLQGIVSHQSP--NWSQDS  1176
             DWVS+      +  SIT LP PE++            SPA+RL+G++S   P   W  D 
Sbjct  294   DWVSDECVQSSVTCSITFLPSPENQENLNMSCGYWSTSPAERLRGLMSEFGPESEWCSD-  352

Query  1177  DEWVNVR  1197
             D+WV VR
Sbjct  353   DDWVTVR  359



>ref|XP_004232023.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=360

 Score =   414 bits (1065),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 217/367 (59%), Positives = 267/367 (73%), Gaps = 26/367 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGETVG GSFGKVS  +PR+      +P MVVKSC ASC  +L+NEK +LDEL+GC
Sbjct  1     MDWVRGETVGHGSFGKVSFVIPRNQSTL-FSPSMVVKSCSASCSATLMNEKIILDELKGC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++I C GD YS+ENGEKLYNVLLE+A  GAL+DK+K S + RL E+E+R Y+K LLRG+
Sbjct  60    PQIINCVGDSYSYENGEKLYNVLLEYACGGALSDKLKNSGDQRLPELEVREYTKGLLRGI  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              YIHK G+VHCDIKL NILL ENG+VKIADFGLAKR   K    L CELRGTP+YMSPEM
Sbjct  120   HYIHKNGFVHCDIKLPNILLGENGQVKIADFGLAKRAESKRDDKLRCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQ   ADIWALGC VAEMA G P W+  ++++LLM IG+G+++PEIP  LS++GKD
Sbjct  180   VIGGEQNTPADIWALGCVVAEMATGNPVWRCLDISKLLMTIGLGDQLPEIPQNLSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FLEKC +KDP+KRWTAEMLL HPF++ EDD  TV L    +   ++ +PS SPRCPFDFP
Sbjct  240   FLEKCLMKDPKKRWTAEMLLEHPFVADEDD--TVLL---NYERCNSGSPSTSPRCPFDFP  294

Query  1045  DWVSES---DHLQSSITSLPPPESE-----------YSPADRLQGIVSHQSP--NWSQDS  1176
             DWVS +     +  SITSLP P  +            SP +R++ +V  + P   WS  +
Sbjct  295   DWVSNNSAESSVTCSITSLPSPAFQELMNWNDGSWSTSPTERIRELVCERKPESEWST-A  353

Query  1177  DEWVNVR  1197
             D WV+VR
Sbjct  354   DGWVSVR  360



>ref|XP_011075325.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Sesamum indicum]
Length=359

 Score =   412 bits (1059),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 222/372 (60%), Positives = 259/372 (70%), Gaps = 37/372 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE +G GSF  V+LA   S    G  P M VKSCG S   SL+NEK +LD+L+ C
Sbjct  1     MDWVRGENLGHGSFATVNLATAGSQS-CGFPPLMAVKSCGFSHSSSLMNEKLILDDLKDC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E+IRCFG+  S+E GEKLYNVLLE+A  GALADK++ S   R+SE E+R Y+KALL+G+
Sbjct  60    PEIIRCFGESCSYEKGEKLYNVLLEYAPGGALADKLRNSGGGRMSESEVRGYTKALLKGI  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN---LGCELRGTPMYMSPEM  684
              YIHK GYVHCDIKLQNILL  NG VKIADFGLAKR GG+     GCELRGTP+YMSPEM
Sbjct  120   YYIHKFGYVHCDIKLQNILLGGNGRVKIADFGLAKRYGGRKGAATGCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQGP ADIWALGC VAEM  G PAW++S++A L+MRIGVGEE+PEIP  LS++GKD
Sbjct  180   VAGGEQGPPADIWALGCVVAEMLSGNPAWRYSDIAGLMMRIGVGEEVPEIPKGLSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FL KCF+KDP KRWTAEMLLNHPF   +D        +D  +     +PS SPRC FDFP
Sbjct  240   FLGKCFVKDPSKRWTAEMLLNHPFTCDQD------FEDDGSKNREENSPSTSPRCAFDFP  293

Query  1045  DWVSESDHLQSSITSLPPPESEYSP---------------------ADRLQGIVSHQSPN  1161
             DW S    +  SITSL  P SEYSP                     A RL  +VS Q+PN
Sbjct  294   DWASS---VTCSITSL--PRSEYSPESGSWFSGESSSGSGSWSNRAAARLMELVSDQNPN  348

Query  1162  WSQDSDEWVNVR  1197
             WS  SD+WV +R
Sbjct  349   WSV-SDDWVTIR  359



>gb|AGV06259.1| fertilization-related kinase 3 [Solanum chacoense]
Length=352

 Score =   412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 218/361 (60%), Positives = 264/361 (73%), Gaps = 22/361 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE VG GSFGKV+LA+PR        P MV+KS G S   SL+NEK +LDEL GC
Sbjct  1     MDWVRGEAVGHGSFGKVNLAIPRKQSTQ-FLPLMVMKSSGVSHSVSLVNEKKILDELNGC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E+IRCFG+ YSFENG+ LYN+LLE+A+ G+LA+K+KKSEN++LSE E+  Y+K +L+GL
Sbjct  60    PEIIRCFGESYSFENGDSLYNLLLEYATGGSLAEKLKKSENYKLSEFEVSGYTKGILKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H+VGY HCDIKLQNILL E+G+VKIADFGLAKR   + L  ELRGTP+YMSPEMV G
Sbjct  120   QYVHEVGYAHCDIKLQNILLGEDGKVKIADFGLAKRVDDE-LRYELRGTPLYMSPEMVTG  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLE  873
             GEQG  ADIWALGC VAEM  G PA++FS V ELLM IGV  ++P+IP +LS++GKDFL 
Sbjct  179   GEQGTPADIWALGCVVAEMVAGVPAFRFSNVTELLMAIGVKNQLPQIPEELSEEGKDFLS  238

Query  874   KCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDWV  1053
             KCF++DPRKRWTAEMLL HPF++  D   TV+L N+   E     PS SP+CPFDFPDWV
Sbjct  239   KCFVQDPRKRWTAEMLLKHPFVADHD---TVTLLNE---EIKNGVPSISPKCPFDFPDWV  292

Query  1054  SESDHLQS---SITSLPPPES--------EYSPADRLQGIVSHQSP--NWSQDSDEWVNV  1194
             S+     S   SIT LP PE+          SPA+RL G+VS  S    W    D+WV V
Sbjct  293   SDESAQSSVTCSITFLPSPENLNSSCGRWSTSPAERLMGLVSEFSTESEWCSH-DDWVTV  351

Query  1195  R  1197
             R
Sbjct  352   R  352



>ref|XP_006339890.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum tuberosum]
Length=360

 Score =   411 bits (1056),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 264/367 (72%), Gaps = 26/367 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGETVG GSFGKVS A+PR+      +P  VVKS  ASC  +L+NEK +LDEL+GC
Sbjct  1     MDWVRGETVGHGSFGKVSFAIPRNQSTM-FSPSTVVKSSSASCSATLMNEKIILDELKGC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++I C GD YS+ENGEKLYNVLLE+A  GAL+DK+K S + RL E EIR+Y+K L++G+
Sbjct  60    PQIINCVGDSYSYENGEKLYNVLLEYACGGALSDKLKNSSDQRLPEFEIRKYTKELIKGI  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSPEM  684
              YIHK GYVHCDIKL NILL ENG+VKIADFGLAKR   K    L CELRGTP+YMSPEM
Sbjct  120   HYIHKNGYVHCDIKLPNILLSENGQVKIADFGLAKRAESKKDDKLRCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQ   ADIWALGC VAEM  G P W+ S++ +LLM IG+G+++PEIP  LS++GKD
Sbjct  180   VIGGEQDTPADIWALGCVVAEMVTGNPVWRCSDITKLLMTIGLGDQLPEIPQNLSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FLEKC +KDP+KRWTAEMLL HPF++ EDD  TV L  +     ++ +PS SPRCPFDFP
Sbjct  240   FLEKCLVKDPKKRWTAEMLLKHPFVADEDD--TVLLNEE---RCNSGSPSTSPRCPFDFP  294

Query  1045  DWVSES---DHLQSSITSLPPPESE-----------YSPADRLQGIVSHQSP--NWSQDS  1176
             DWVS +     +  SITSLP P  +            SP +R++ +V    P   WS  +
Sbjct  295   DWVSNNSAESSVTCSITSLPSPAFQESMNWSDGSWSTSPTERIRELVCECRPEFEWST-A  353

Query  1177  DEWVNVR  1197
             D WV+VR
Sbjct  354   DGWVSVR  360



>ref|XP_009758194.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana sylvestris]
Length=358

 Score =   409 bits (1051),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 262/364 (72%), Gaps = 22/364 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE VG GSFGKV+ A+PR       +  MVVKS  ASC  +LLNEK +LDEL  C
Sbjct  1     MDWVRGEAVGHGSFGKVNYALPRCQNTL-FSQSMVVKSSAASCSATLLNEKLILDELNSC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +I C GD Y++ENGEK+YNVLLE+AS G L+DK+K S +H+L E E+++ +KALLRGL
Sbjct  60    PHIINCLGDNYTYENGEKIYNVLLEYASGGDLSDKLKNSGDHKLPEFEVKKNTKALLRGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG---KNLGCELRGTPMYMSPEM  684
              YIHK GYVHCDIKLQNILL E+G+VKIADFGLAKR        L CELRGTP+YMSPEM
Sbjct  120   HYIHKSGYVHCDIKLQNILLGEDGQVKIADFGLAKRTKSTEDNKLRCELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQ   ADIWALGC VAEMA G P WK+S + +LLM IGVG+++PE P KLS++GKD
Sbjct  180   VTGGEQDCPADIWALGCVVAEMAAGVPVWKYSNITQLLMAIGVGDQLPEFPAKLSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGED-DGATVSLRNDTHREasapapspspRCPFDF  1041
             FL KCF+KDPR RWTAEMLLNHPF++ +  D  TV+L ++T     + +PS SPRCPFDF
Sbjct  240   FLGKCFVKDPRNRWTAEMLLNHPFVADQHYDDVTVTLNDET---CGSGSPSTSPRCPFDF  296

Query  1042  PDWVSESDHLQSSITSLPPPESE-----------YSPADRLQGIVSH-QSPNWSQDSDEW  1185
             PDWVS +    S+ITSLP P  +            +PA+RL+ +++      WS D D W
Sbjct  297   PDWVSYAS-AASAITSLPSPAIQELLKFCGGSWSTTPAERLRELINEGPESEWSTD-DGW  354

Query  1186  VNVR  1197
             V VR
Sbjct  355   VCVR  358



>emb|CDP02503.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   405 bits (1040),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 213/367 (58%), Positives = 261/367 (71%), Gaps = 30/367 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDELR  327
             M+WVRG+ +G GSFG VSLA P S   +    P  M VKSCG S   SLLNEK VLD  +
Sbjct  1     MEWVRGDILGHGSFGTVSLAKPGSSRSSCHNIPELMAVKSCGVSSSASLLNEKEVLDGFK  60

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C E+I+C+GDG+SFENGEKLYNV LE+AS G LADK+  S +HRL E E+RRY++ +LR
Sbjct  61    DCPEIIQCYGDGHSFENGEKLYNVFLEYASGGTLADKLNNSCDHRLPEDEVRRYTRGVLR  120

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMV  687
             GL  +H+ G+VHCDIKLQNILL ++G VKI DFGLAK++  + +GCELRGTP+YMSPEMV
Sbjct  121   GLRRVHENGFVHCDIKLQNILLGQDGAVKIGDFGLAKKDAAEKVGCELRGTPLYMSPEMV  180

Query  688   NGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
              GG+Q   ADIWALGC VAEM  G PAW+ S+VA LLMRIGVG+E+PEIPGKLS++GKDF
Sbjct  181   AGGDQSSPADIWALGCLVAEMFTGVPAWRCSDVAALLMRIGVGDEVPEIPGKLSEEGKDF  240

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             + KCF+KDP++RWTAEMLL+HPF+   DD  TV+ +           PS SPR  FDFPD
Sbjct  241   VGKCFVKDPKERWTAEMLLDHPFVCDHDDRGTVTFKE---------VPSTSPRSAFDFPD  291

Query  1048  WVSESDHLQSSITSLPPPESEY----------------SPADRLQGIVS-HQSPNWSQDS  1176
             WVS+   L  SITSL  PES+                 SPA RLQG+V+ HQ   +   S
Sbjct  292   WVSQQSSLTFSITSLSSPESQSWVDGPELNTFDGSWSNSPAKRLQGLVNDHQLECFG--S  349

Query  1177  DEWVNVR  1197
             D+W+ VR
Sbjct  350   DDWITVR  356



>ref|XP_004233626.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=356

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 206/366 (56%), Positives = 257/366 (70%), Gaps = 28/366 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE VG GSFGKV  A+P+ H      P MVVKS  AS   +L+NEK +LDEL  C
Sbjct  1     MDWVRGEAVGHGSFGKVDFAIPKLHK-THILPLMVVKSSAASSSATLINEKMILDELNSC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +IRC GD Y++E GEKLYNVLLE+AS GAL++K+  S + RL E+EIR+YSKALL+GL
Sbjct  60    PYIIRCLGDSYTYEKGEKLYNVLLEYASGGALSEKLNNSGDRRLPEIEIRKYSKALLKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG---KNLGCELRGTPMYMSPEM  684
              YIHK  YVHCDIK QNILL ++G+VKIADFGLAKR        L  ELRGTP+YMSPEM
Sbjct  120   HYIHKRRYVHCDIKPQNILLGKDGQVKIADFGLAKRAESVKDDKLRSELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQ   ADIWALGC ++E+A G P W +S++ +LLM+IGVG+E+PE P KLS++GKD
Sbjct  180   VTGGEQDTPADIWALGCVISEIATGVPVWGYSDLTQLLMKIGVGDELPEFPTKLSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FLEKC +KDP+KRWTAEMLL HPF++ EDD  T++              S SPRCPFDFP
Sbjct  240   FLEKCLVKDPKKRWTAEMLLKHPFVTDEDDTVTLNYSGSP---------STSPRCPFDFP  290

Query  1045  DWVSES---DHLQSSITSLPPPESE-----------YSPADRLQGIVSHQSPN-WSQDSD  1179
             DW+S+      + S ITSLP P  +            SPA+RL+G+++  + + WS   D
Sbjct  291   DWISDDSVESSVTSQITSLPSPAIQELLNFSGGSLSTSPAERLRGLMNELTKSEWSDADD  350

Query  1180  EWVNVR  1197
              WV++R
Sbjct  351   NWVSIR  356



>gb|EYU44409.1| hypothetical protein MIMGU_mgv1a008588mg [Erythranthe guttata]
Length=368

 Score =   399 bits (1025),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/379 (59%), Positives = 261/379 (69%), Gaps = 42/379 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHG---IAGAAPPMVVKSCGASCFDSLLNEKAVLDEL  324
             MDWVRGE +G GSF  VSLA  RS G    A   P M VKSCG S   SL++EK +L+E 
Sbjct  1     MDWVRGEKLGHGSFATVSLAARRSCGGGESASLPPLMAVKSCGVSHSSSLMSEKLILEEF  60

Query  325   RGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
              GC E+I CFG+ +S ENGEKLYNVLLE+A+ G+LADK++ S+  RL E E+R+Y+KALL
Sbjct  61    EGCPEIITCFGERFSNENGEKLYNVLLEYAAGGSLADKLEGSDGRRLPESEVRQYTKALL  120

Query  505   RGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRN---GGKNLGCELRGTPMYMS  675
             +GL YIHK GYVHCDIKLQNILLC +G VKIADFGLAKR    GG +  CELRGTPMYMS
Sbjct  121   KGLHYIHKYGYVHCDIKLQNILLCRDGGVKIADFGLAKRAAAVGGDSRRCELRGTPMYMS  180

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDD  855
             PEMV+GGEQG  ADIWALGC V+EM  G+PAW+ S+VA LLMRIGVGEE+PEIPG LS +
Sbjct  181   PEMVSGGEQGAPADIWALGCVVSEMVAGSPAWRCSDVAGLLMRIGVGEEVPEIPGILSKE  240

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGE--DDGATVSLRNDTHREasapapspspRC  1029
             GKDFL KCF K+P +RWTAEMLLNHPF+  +  D G   +       E      S SPRC
Sbjct  241   GKDFLGKCFAKNPTERWTAEMLLNHPFVQDQYSDFGGAAA-------EEKIKTTSTSPRC  293

Query  1030  PFDFPDWVSESDHLQSSITSLPP----PES-------------------EYSPADRLQGI  1140
             PFDFP+WVS +     SITSLP     PES                     S A+RL  +
Sbjct  294   PFDFPEWVSSA---ACSITSLPSTVDFPESGLWFTEESILKEGSSWWSSTASTAERLLEL  350

Query  1141  VSHQSPNWSQDSDEWVNVR  1197
             V+ Q P+WS  SD+WV VR
Sbjct  351   VTEQVPDWSV-SDDWVTVR  368



>ref|XP_006339888.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum tuberosum]
Length=360

 Score =   397 bits (1020),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 210/367 (57%), Positives = 268/367 (73%), Gaps = 26/367 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE+VG GSFGKV+ A+P+ H      P MVVKS  AS   +L+NEK +LDEL  C
Sbjct  1     MDWVRGESVGHGSFGKVNFAIPKFHN-THILPLMVVKSSAASSSATLINEKMILDELNSC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +IRC GD Y++E GEKLYNVLLE+AS GAL++K+K S + +L E EIR+Y+KALL+GL
Sbjct  60    PYIIRCIGDSYTYEKGEKLYNVLLEYASGGALSEKLKNSGDGKLPENEIRKYTKALLKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG---KNLGCELRGTPMYMSPEM  684
              YIHK  YVHCDIK QNIL+ E+G+VKIADFGLAK         L  ELRGTP+YMSPEM
Sbjct  120   HYIHKSRYVHCDIKPQNILIGEDGQVKIADFGLAKSAESVKDDKLRSELRGTPLYMSPEM  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V GGEQG  ADIWALGC ++EMA G P W +S++ +LLMRIGVG+E+PE P KLS++GKD
Sbjct  180   VTGGEQGTPADIWALGCVISEMATGVPVWGYSDLTQLLMRIGVGDELPEFPTKLSEEGKD  239

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FLEKC +K+P+KRWTA+MLL HPF++ EDD  TV+L ++     ++ +PS SPRCPFDFP
Sbjct  240   FLEKCLVKEPKKRWTAKMLLKHPFVADEDD--TVTLNDE---RCNSGSPSTSPRCPFDFP  294

Query  1045  DWVSESDHLQSS----ITSLPPPESE-----------YSPADRLQGIVSHQSPN-WSQDS  1176
             DW+S+ D  +SS    ITSLP P  +            SPA+RL+G+++  + + WS   
Sbjct  295   DWISD-DSAESSVTYQITSLPSPAIQELLNFSGGSLSTSPAERLRGLMNELTQSEWSDAD  353

Query  1177  DEWVNVR  1197
             D WV++R
Sbjct  354   DNWVSIR  360



>ref|XP_006339889.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum tuberosum]
Length=356

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 211/366 (58%), Positives = 265/366 (72%), Gaps = 28/366 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE +G GSFGKVS A+PR      +   MVVKS  AS  D+L+NEK +LDE++GC
Sbjct  1     MDWVRGEAIGHGSFGKVSFAIPRKQ----STQVMVVKSSTASRSDTLMNEKLILDEIKGC  56

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++I C GD YS+E GEKLYNVLLE+AS GAL++K+K S + +L E+EIR+Y+K+LL+GL
Sbjct  57    PQIINCLGDSYSYEKGEKLYNVLLEYASGGALSEKLKNSGDRKLLEIEIRKYTKSLLKGL  116

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG---KNLGCELRGTPMYMSPEM  684
              YIHK GYVHCDIK QNILL E+G+VKIADFGLAKR        L CELRGTP+YMSPEM
Sbjct  117   HYIHKCGYVHCDIKPQNILLGEDGQVKIADFGLAKRIESIKDDKLRCELRGTPLYMSPEM  176

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             V  GE    ADIWALGC +AEMA G P W +S++A+LLM+IGVG+E+PE P KLS++G D
Sbjct  177   VTAGELDTPADIWALGCVIAEMATGVPVWGYSDLAQLLMKIGVGDELPEFPTKLSEEGND  236

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FLEKCF+KD +KRWTAEMLL HPF++ EDD  TV L  +     ++ + S SPRCPFDFP
Sbjct  237   FLEKCFVKDSKKRWTAEMLLKHPFVADEDD--TVLLNEE---RCNSGSLSTSPRCPFDFP  291

Query  1045  DWVSESDHLQSS---ITSLPPPESE-----------YSPADRLQGIVSHQ-SPNWSQDSD  1179
             DWVS+     S    ITSLP P  +            +PA+RL+ ++S +  P+WS  +D
Sbjct  292   DWVSDDSSESSVTYPITSLPSPAIQELRNLNGGSWSTTPAERLRALLSGEIRPDWSA-AD  350

Query  1180  EWVNVR  1197
              WV+VR
Sbjct  351   GWVSVR  356



>ref|XP_004233627.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=355

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 211/367 (57%), Positives = 262/367 (71%), Gaps = 31/367 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE +G GSFGKVS AVPR      ++  MVVKS  AS   +L+NEK +L+E++GC
Sbjct  1     MDWVRGEAIGHGSFGKVSFAVPRKQ----SSQVMVVKSSLASHSATLMNEKLILEEIKGC  56

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++I C GD Y+FENGEKLYNVLLE+A  GAL++K+K S + +L E+EIR+Y+KALL+GL
Sbjct  57    PQLINCLGDSYTFENGEKLYNVLLEYAPGGALSEKLKNSGDRKLPEIEIRKYTKALLKGL  116

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              YIHK GYVHCDIK QNIL  ENG+VKIADFGLAK      L CELRGTP+YMSPE+V  
Sbjct  117   HYIHKCGYVHCDIKPQNILFGENGQVKIADFGLAKSIKDDKLRCELRGTPLYMSPEIVTA  176

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLE  873
             GEQ   ADIWALGC ++EMA G P W +SE+A+LLM IGVG E+PE P  LS++GKDFLE
Sbjct  177   GEQDTPADIWALGCVISEMATGVPVWGYSELAQLLMNIGVGNELPEFPTMLSEEGKDFLE  236

Query  874   KCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDWV  1053
             KC +KD +KRWTAEMLL HPF++ EDD  TV L ++     ++ +PS SPRCPFDFPDWV
Sbjct  237   KCLVKDSKKRWTAEMLLLHPFVADEDD--TVLLNDE---RCNSGSPSTSPRCPFDFPDWV  291

Query  1054  SESDHLQSS-----ITSLPPPESE-----------YSPADRLQGIVS---HQSPNWSQDS  1176
               SDH   S     ITSLP P  +            +PA+RL+ ++S       +WS  +
Sbjct  292   --SDHSSESSVTCPITSLPSPAIQELRNLNGGSWSTTPAERLRALLSGAIRPESDWSA-A  348

Query  1177  DEWVNVR  1197
             D WV+VR
Sbjct  349   DGWVSVR  355



>ref|XP_009611038.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana tomentosiformis]
Length=408

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 210/363 (58%), Positives = 256/363 (71%), Gaps = 24/363 (7%)
 Frame = +1

Query  166   RGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQEVI  345
              GE VG GSFGKV+ A+PR       +  MVVKS  ASC  +LLNEK +LDEL  C + I
Sbjct  51    HGEAVGHGSFGKVNFAIPRCQNTL-FSQSMVVKSSAASCSATLLNEKLILDELNSCPQTI  109

Query  346   RCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGYIH  525
              C GD +++ENGEK+YNVLLE+AS G L++K+  S +HRL E EIR+ +KALLRGL YIH
Sbjct  110   NCLGDNFTYENGEKIYNVLLEYASGGDLSEKLMNSSDHRLPEFEIRKNTKALLRGLHYIH  169

Query  526   KVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG---KNLGCELRGTPMYMSPEMVNGG  696
             K GYVHCDIKLQNILL ++G+VKIADFGLAKR       NL CELRGTP+YMSPEMV GG
Sbjct  170   KSGYVHCDIKLQNILLGKDGQVKIADFGLAKRADSVKVDNLRCELRGTPLYMSPEMVTGG  229

Query  697   EQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLEK  876
             EQ   ADIWALGC VAEMA G P WK+S + +LLM IGVG+++PE P KLSD+GKDFL K
Sbjct  230   EQDSPADIWALGCVVAEMAAGVPVWKYSNITQLLMAIGVGDQLPEFPAKLSDEGKDFLGK  289

Query  877   CFIKDPRKRWTAEMLLNHPFISGED-DGATVSLRNDTHREasapapspspRCPFDFPDWV  1053
             CF+KDPR RWTAEMLL+HPF++ +  D  TV+L ++T     + +PS SPRCPFDFPDWV
Sbjct  290   CFVKDPRNRWTAEMLLHHPFVADQHYDDVTVTLNDET---CGSGSPSTSPRCPFDFPDWV  346

Query  1054  SESDHLQS---SITSLPPPESE-----------YSPADRLQGIVSH-QSPNWSQDSDEWV  1188
             S+     S   SIT LP P  +            +PA+RL+ +++      WS D D WV
Sbjct  347   SDDSAESSATCSITYLPSPAIQELLNFSGGSWSTTPAERLRELINEGPESEWSTD-DGWV  405

Query  1189  NVR  1197
              VR
Sbjct  406   CVR  408



>gb|EPS73022.1| hypothetical protein M569_01733, partial [Genlisea aurea]
Length=341

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 235/359 (65%), Gaps = 28/359 (8%)
 Frame = +1

Query  151   AMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRG  330
              M+W+RGE +GRGSF  V+LA  R  G +   P M VKSC AS   + + E+ +L+EL+ 
Sbjct  1     VMEWIRGEELGRGSFCTVNLAAAR-RGDSVLPPLMAVKSCLASQSAAAVRERVILEELKC  59

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C +++RC GD +S+E GE+LYN+LLEF + G+LAD +K    + L E ++RRY+K LL+G
Sbjct  60    CPQIVRCLGDSFSYEKGERLYNILLEFVAGGSLADHLKIFRGYGLPEFDVRRYTKQLLKG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             + +IHK GYVHCDIKLQNILL  +  VKIADFGLAKR  G +      GT MYMSPE++ 
Sbjct  120   IEHIHKSGYVHCDIKLQNILLSPDYGVKIADFGLAKRAEGGDSAAA--GTLMYMSPEIIA  177

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              GEQ  A+DIWALGC V+EMA G PAW+ SE A L+ +IG GE+ PEIP  +S++G+DF+
Sbjct  178   SGEQSTASDIWALGCVVSEMASGLPAWRCSESAALIRKIGSGEDTPEIPLSVSEEGRDFM  237

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
              KCFIKDP  RWT EMLL+HPF+   D+   V +               SPRCPFDFP+W
Sbjct  238   NKCFIKDPTARWTVEMLLDHPFVREVDEIRAVQIATS-----------FSPRCPFDFPEW  286

Query  1051  VSESDHLQSSITSLPPPE----------SEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
              S    +  SITSLP P            + SP DR+Q ++  Q P+WS DS  W+ VR
Sbjct  287   TSP---VNCSITSLPSPSDPQSTIEFGLDDISPWDRIQSLIGEQWPDWS-DSSRWIAVR  341



>gb|KEH16526.1| MAP3K-like kinase [Medicago truncatula]
Length=335

 Score =   339 bits (869),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 238/358 (66%), Gaps = 33/358 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGETVGRGSF  V+L +P+S+     + P  VK+   S   SL NEK VL +L  C
Sbjct  1     MDWVRGETVGRGSFATVNLVIPKSNS---NSTPTAVKTSEVSTSSSLKNEKYVLHQLGSC  57

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             Q +I CFGD Y+FENG++ YN+ LE+AS G+L+D++K +   R+ E  IRRY+++++ GL
Sbjct  58    QRIIPCFGDDYTFENGKEYYNLFLEYASAGSLSDQVKLN-GGRIPEQHIRRYTRSIVEGL  116

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH+ G+VHCDIKLQNIL+  +GE+KIADFGLAK+ G K    E RGTP++MSPE VN 
Sbjct  117   DHIHRNGFVHCDIKLQNILVFNDGEIKIADFGLAKKTGEKQ-SFECRGTPLFMSPESVNN  175

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             GE    ADIWALGCAV EM  G PAW   K S +  LL++IG GEE P IP +LS +GKD
Sbjct  176   GEHESPADIWALGCAVVEMVTGKPAWNLEKDSNMWSLLLQIGAGEESPLIPEELSKEGKD  235

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             F+EKCF+KDPRKRWTAEMLLNHPF+                 E        SPR  FDF 
Sbjct  236   FVEKCFVKDPRKRWTAEMLLNHPFV-----------------EEVINVNESSPRNHFDFN  278

Query  1045  DWVSE-SDHLQSSITSLPPPESEY-----SPADRLQGIVSHQSP-NWSQDSDEWVNVR  1197
             DWVS+ SD + SS  S    + ++     S  DRL+ +V+ Q P +WS+ SD W++VR
Sbjct  279   DWVSDASDSVPSSPESEDSNQWDFDSKFCSAVDRLRQLVTDQGPMSWSR-SDSWISVR  335



>ref|XP_007047281.1| Mitogen-activated protein kinase kinase kinase 19, putative [Theobroma 
cacao]
 gb|EOX91438.1| Mitogen-activated protein kinase kinase kinase 19, putative [Theobroma 
cacao]
Length=358

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 243/363 (67%), Gaps = 20/363 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG+T+G GSFG V+L +P+  G + +   M VKSC      SL +EK VLD+L  C
Sbjct  1     MDWVRGDTIGCGSFGTVNLVLPK-KGFSKSPSVMAVKSCETIKSVSLKSEKEVLDQLGFC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++IRCFGDGY+ ENGE LYN+ LE+A +G+LAD++KKS  + L E ++RRY++++L+GL
Sbjct  60    PQIIRCFGDGYTLENGESLYNLFLEYADKGSLADQVKKSGGN-LIESDVRRYARSILKGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR----NGGKNLGCELRGTPMYMSPE  681
              ++H  G+ HCDIK+QN+LL  NG VKI DFGLAKR     G +    E+RGTP+ ++PE
Sbjct  119   LFVHAKGFAHCDIKVQNVLLFGNGNVKITDFGLAKRIGEEEGDEPRRIEIRGTPLNIAPE  178

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSD  852
              VN  E     DIWALGC + EM  G PAW     + +A LL++IGV +E+PEIP +LS+
Sbjct  179   SVNDNEYDSPVDIWALGCVIVEMFTGKPAWNLKPGTNLAALLIKIGVSDELPEIPAELSE  238

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHR-EasapapspspRC  1029
             DGKDFLEKCF+KDP  RWTAEMLL+HPF++ +D+  TV+L  ++     S    S SPRC
Sbjct  239   DGKDFLEKCFVKDPNNRWTAEMLLDHPFVAADDE--TVALEEESPSPNCSCEEFSMSPRC  296

Query  1030  PFDFPDWV-------SESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWV  1188
             PFDFPDWV       S+S   ++S           SP DR+  +  HQ+PNWS  S  W+
Sbjct  297   PFDFPDWVSTQYTASSQSTFQENSSLVSSFSSYLSSPLDRIHQLACHQAPNWSV-SGSWI  355

Query  1189  NVR  1197
              +R
Sbjct  356   TLR  358



>gb|KDP31943.1| hypothetical protein JCGZ_12404 [Jatropha curcas]
Length=348

 Score =   337 bits (863),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 244/363 (67%), Gaps = 30/363 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLL--NEKAVLDELR  327
             MDW+RGE++G GSF  V+LA+PR +    +AP M VKSC    FDS+L  NEK VL  L 
Sbjct  1     MDWIRGESLGCGSFSSVNLAIPRKN----SAPLMAVKSCDL--FDSVLLENEKEVLLHLG  54

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C+ VI+C G   S ENGEK YN+LLE+AS G+LA K+ K+    L E EI+R+++++L+
Sbjct  55    KCENVIQCLGSDQSVENGEKFYNLLLEYASGGSLA-KLVKNSGGCLPESEIKRFTRSILK  113

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMV  687
             GL  IH  G+VHCDIKLQN+LL +NGEVKIADFGLA + G K+   E+RGTP+YMSPE V
Sbjct  114   GLRDIHAKGFVHCDIKLQNLLLFDNGEVKIADFGLATKTGEKSGRMEIRGTPLYMSPESV  173

Query  688   NGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEIPGKLSDDG  858
             N  E     DIWALGCA+ EMA G PAW   K + VA LL+RIG+G+E+PEIP +LS +G
Sbjct  174   NENEYNSPCDIWALGCALVEMATGKPAWNCKKETNVAALLIRIGLGDELPEIPQELSKEG  233

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFD  1038
             KDFL KCFI+DP+ RWTAEMLL+H F++ + +  TV+L+N    E        SPRCPF+
Sbjct  234   KDFLSKCFIRDPKSRWTAEMLLDHSFVADDINNCTVTLKNREEEE-------ESPRCPFE  286

Query  1039  FPDWVS-ESDHLQSSITSLPPPESEY---------SPADRLQGIVSHQSPNWSQDSDEWV  1188
             FP+W S  S   +S + S    ES           S ADR++ + S Q  NWS  S+ WV
Sbjct  287   FPEWNSFPSSTPKSELWSHGEAESRIDWSNLTCSSSLADRIRQLQSDQCCNWSF-SESWV  345

Query  1189  NVR  1197
              VR
Sbjct  346   TVR  348



>gb|KEH16420.1| MAP3K-like kinase, partial [Medicago truncatula]
Length=355

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/380 (49%), Positives = 239/380 (63%), Gaps = 45/380 (12%)
 Frame = +1

Query  106   ISELQNSTICSTRRGAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCF  285
             I  +   ++ +    +MDWVRGE VGRGSF  V+L +P+ +  +    P  VK+   S  
Sbjct  5     IHHINKKSLNNDIVSSMDWVRGEAVGRGSFATVNLVIPKGNSYST---PTAVKTSEVSTS  61

Query  286   DSLLNEKAVLDELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRL  465
              SL NEK VL +L  CQ +I CFGD Y+FENG++ YN+ LE+AS G L+D++K +   R+
Sbjct  62    SSLKNEKHVLHQLGSCQRIIPCFGDDYTFENGKEYYNLFLEYASAGTLSDQVKLN-GGRI  120

Query  466   SEMEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK-NLG  642
              E  IRRY+++++ GL +IH+ G+VHCDIKLQNIL+  +GE+KIADFGLAK+ GGK +L 
Sbjct  121   PEQHIRRYTRSIVEGLDHIHRNGFVHCDIKLQNILVFNDGEIKIADFGLAKKTGGKQSLK  180

Query  643   CELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGV  813
             C  RGTP++MSPE VN GE    ADIWALGCAV EM  G PAW   K S +  LL+RIG 
Sbjct  181   C--RGTPLFMSPESVNHGEHESPADIWALGCAVVEMVTGKPAWNLEKDSNMWSLLLRIGT  238

Query  814   GEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHRE  993
             GEE P IP +LS +GKDF+EKCF+KDPRKRWTAEMLLNHPF+    +    S RN     
Sbjct  239   GEESPVIPEELSKEGKDFVEKCFVKDPRKRWTAEMLLNHPFVEEVKNVNESSPRNH----  294

Query  994   asapapspspRCPFDFPDWVSESDHLQSSITSLP-PPESEY-----------SPADRLQG  1137
                          FDF DWVS      S+  S+P  PESE            S ADRL  
Sbjct  295   -------------FDFNDWVS------SATDSVPNSPESEESSPWDFDSKFCSAADRLWQ  335

Query  1138  IVSHQSPNWSQDSDEWVNVR  1197
             +V+ +    S + D W++VR
Sbjct  336   LVTDERLVSSSELDSWISVR  355



>ref|XP_010558598.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Tarenaya hassleriana]
Length=357

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/365 (49%), Positives = 233/365 (64%), Gaps = 30/365 (8%)
 Frame = +1

Query  151   AMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRG  330
             +MDWVRGET+G G+F  VSLA P S       P M VKS       SL NEK+VLD+L  
Sbjct  7     SMDWVRGETIGYGTFATVSLATPASKYSGQFPPLMAVKSADFYGAASLANEKSVLDQLGH  66

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RC G   + ENG+++YN+ LE+AS+G LA  +KKS  + L E  +R ++ ++LRG
Sbjct  67    CPEIVRCLGHDQTVENGQEMYNLFLEYASRGNLATHVKKSGGNGLPESAVRGHTLSVLRG  126

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG------GKNLGCELRGTPMYM  672
             L +IH  G+ HCDIKL NIL+ ++G VKIADFGLAKR G        + G ++RGTP+YM
Sbjct  127   LRHIHAGGFAHCDIKLGNILIFDDGAVKIADFGLAKRTGVVDGEETASEGLQIRGTPLYM  186

Query  673   SPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGK  843
             +PE VN  E G  AD+WALGCAV EM  G  AW F E      LLMRIGVG+E+P IPG 
Sbjct  187   APESVNNNEYGSQADVWALGCAVVEMFSGKTAWSFKEGSNFMALLMRIGVGDELPRIPGD  246

Query  844   LSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHRE-------asa  1002
             LS++G+DFL KCF+KDP++RWTAEMLL+HPF++       V L +D H +          
Sbjct  247   LSEEGRDFLSKCFVKDPKRRWTAEMLLSHPFVA-------VDLGHDDHHQREEFVVGLKK  299

Query  1003  papspspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDE  1182
                S SP+ PFDFPDWVSES     S T   P +   SP +R+  + +   P+WS  +D 
Sbjct  300   EKISASPKGPFDFPDWVSES---LDSQTQYQPFD---SPDERIGNLANDSFPDWSV-TDN  352

Query  1183  WVNVR  1197
             WV VR
Sbjct  353   WVTVR  357



>emb|CDY17760.1| BnaC08g21680D [Brassica napus]
Length=342

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 231/352 (66%), Gaps = 14/352 (4%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+W RGET+G G+F  VSLA P +   +G  P  M VKS  ++ +  + NEK+VLD L  
Sbjct  1     MEWFRGETIGYGTFSTVSLATPSNIKGSGEYPSLMAVKS--SNSYGGIANEKSVLDSLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG+  + E GEKL+N+LLE+AS+G+LA ++KK     L E  +RR++  +LRG
Sbjct  59    CPEIVRCFGEDQTVEKGEKLHNLLLEYASRGSLASQLKKLNGEGLPETTVRRHTGTVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+ HCDIKL+NILL  +G VKIADFGLA+       G E+RGTP+YM+PE VN
Sbjct  119   LRHIHSSGFAHCDIKLENILLFGDGAVKIADFGLARDLTASKEGGEIRGTPLYMAPESVN  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGK  861
               E G AAD+WALGCAV EM  G  AW   E       L+RIGVGEE+P +P +LS +GK
Sbjct  179   DNEYGAAADVWALGCAVVEMFSGETAWTVEEGSHFMSFLLRIGVGEELPRVPEELSGEGK  238

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCF+KDP KRWTAEMLLNHPF++ + +      R++   +      S SPRCPF F
Sbjct  239   DFLSKCFVKDPEKRWTAEMLLNHPFVAVDCEDDDYDQRDELFLK-GKDEVSKSPRCPFGF  297

Query  1042  PDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PDW  ES   +S I   P      SP +RL  +VS + P+WS  S++WV VR
Sbjct  298   PDW--ESTSSESEIQYQPLD----SPVERLASLVSERVPDWSV-SEDWVTVR  342



>ref|XP_006286153.1| hypothetical protein CARUB_v10007712mg [Capsella rubella]
 gb|EOA19051.1| hypothetical protein CARUB_v10007712mg [Capsella rubella]
Length=346

 Score =   329 bits (844),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 240/359 (67%), Gaps = 24/359 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+R ET+G GSF  VSLA           P M VKS G  C  +L NE+ VLD L  C
Sbjct  1     MEWIRRETIGHGSFSTVSLATTSGSSATLFPPLMAVKSSGVVCSAALRNERDVLDYLGDC  60

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E++RCFG+G + ENGE++YN+ LE+AS G LAD++K S    L E E+RR+++++++GL
Sbjct  61    SEIVRCFGEGRTVENGEEIYNLFLEYASGGNLADRVKNS-GEALPEFEVRRFTRSIVKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IHK G+ HCD+KL+N+L+  +G+VKI+DFGLAKR  G+ +G E+RGTP+YM+PE VN 
Sbjct  120   CHIHKNGFSHCDLKLENVLVFGDGDVKISDFGLAKRRSGE-VGVEIRGTPLYMAPECVNH  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW------KFSEVAELLMRIGVGEEIPEIPGKLSDD  855
             GE    ADIWALGC+V EM+ G  AW        S V  L++RIG GEE+P IP +LS++
Sbjct  179   GEFESPADIWALGCSVVEMSSGKTAWCLEEGDMMSNVMSLMVRIGSGEEVPRIPVELSEE  238

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDG---ATVSLRNDTHREasapapspspR  1026
             GKDF+ KCF+KD  +RWTA+MLL+HPF++ +DDG    ++SLR     E      S SPR
Sbjct  239   GKDFVSKCFVKDAAERWTAQMLLDHPFVAVDDDGEESGSLSLRCGEEEE----KASVSPR  294

Query  1027  CPFDFPDWVSESDHLQSSIT--SLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
              PFDFP W S    +  ++T  SL       SP +R+ G+VS + P+WS   D WVNVR
Sbjct  295   NPFDFPGWNSVQSPVNETVTFRSLVS-----SPEERISGLVS-EMPDWSVSCD-WVNVR  346



>ref|XP_002282686.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Vitis 
vinifera]
Length=353

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 188/373 (50%), Positives = 237/373 (64%), Gaps = 45/373 (12%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M WVRG T+GRGSF  VSLAV R+ G     P M VKSCG     +L NE  VL  L  C
Sbjct  1     MTWVRGGTIGRGSFATVSLAVSRA-GEDRFPPLMAVKSCGVEDSATLRNETQVLSRLGDC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             QEV+RC+GD YS E G +LYNVLLE+A+ G+LAD ++  +   L E +++RY++++LRGL
Sbjct  60    QEVLRCYGDEYSCEGGRELYNVLLEYAAGGSLADYVR--DFGALVESDVKRYTRSILRGL  117

Query  514   GYIHKVGYVHCDIKLQNILLCENGE----VKIADFGLAKRNGGKNLGCELRGTPMYMSPE  681
              YIH VG+VHCD+KLQN+LLC + +     KI DFGLAK+          RGTPMYM+PE
Sbjct  118   DYIHGVGFVHCDVKLQNLLLCSSNDSVFCAKIGDFGLAKKAEKVAEKKGFRGTPMYMAPE  177

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSD  852
              ++G E   AADIWALGCAV EMA G PAW+    ++   LL RI  G+  PE P +LS+
Sbjct  178   CLSGEEHSAAADIWALGCAVVEMASGKPAWQCQPGTDANALLFRIWGGKASPETPSELSE  237

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
             +GKDFLEKCF++DPRKRWTAEMLL+HPF++G D   TV L+            S SPR P
Sbjct  238   EGKDFLEKCFLRDPRKRWTAEMLLDHPFVAGTD--VTVPLKQSDE-------ASTSPRSP  288

Query  1033  FDFPDWVSESDHLQSSITSLPPPESE------------------YSPADRLQGIVSHQSP  1158
             FDFP+W   SDH  S     P P+SE                   SPADR++ +V+ Q+P
Sbjct  289   FDFPEWA--SDHTPS-----PTPDSEACFDRDLNSWLNSSSHSWTSPADRIRQLVTDQTP  341

Query  1159  NWSQDSDEWVNVR  1197
             NWS  S+ W  VR
Sbjct  342   NWSV-SESWFAVR  353



>ref|XP_007029410.1| Mitogen-activated protein kinase kinase kinase 19, putative [Theobroma 
cacao]
 gb|EOY09912.1| Mitogen-activated protein kinase kinase kinase 19, putative [Theobroma 
cacao]
Length=363

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 242/369 (66%), Gaps = 27/369 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+RGET+G GSFG V+L VP+  G + + P M VKSC      SL +EK VLD+L  C
Sbjct  1     MEWIRGETIGHGSFGTVNLVVPKK-GTSKSCPVMAVKSCETINSASLKHEKEVLDQLGFC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++IRCFG+ Y+ ENG + YN+ LE+A +G LAD++KKS  + L E ++RRY++++L+GL
Sbjct  60    PQIIRCFGEEYTAENGGE-YNLFLEYADKGCLADQVKKSGGN-LIESDVRRYARSILKGL  117

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG-----GKNLGCELRGTPMYMSP  678
              ++H  G+ HCDIKLQNILL  NG+VKIADFGLAKRNG     G +   E+RGTP+ ++P
Sbjct  118   RFVHAKGFAHCDIKLQNILLFGNGDVKIADFGLAKRNGEEEGEGPHRRIEIRGTPLSIAP  177

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLS  849
             E V   +     DIWALGCA+ EM  G PAW F   S VA LL++IGV +E+P +P +LS
Sbjct  178   ESVMENQYDSPVDIWALGCAIVEMFTGKPAWTFKPGSNVAALLIKIGVSDELPVVPAELS  237

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRND----THREasapapsp  1017
             + GKDFL KCF+KDP  RWTAEMLL+HPF++ +D+   +  R +    T  + S    + 
Sbjct  238   EYGKDFLSKCFVKDPNNRWTAEMLLDHPFVAADDENIAIMNRFEEEASTSPKCSFEEFTM  297

Query  1018  spRCPFDFPDWVSESDHL---------QSSITSLPPPESEYSPADRLQGIVSHQSPNWSQ  1170
             SPRCPFDFPDWVS    +          S +T  P   S  SP DR++ +   Q+PNWS 
Sbjct  298   SPRCPFDFPDWVSTQSTVSSQSSFQENSSPVTLFPSYVS--SPLDRIRQLACDQAPNWSV  355

Query  1171  DSDEWVNVR  1197
              S  W+  R
Sbjct  356   -SGSWITSR  363



>gb|KEH16527.1| MAP3K-like kinase [Medicago truncatula]
Length=335

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 233/358 (65%), Gaps = 33/358 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG+TVGRGSF  V+LA+P+++  +    P  VK+   S   SL NEK VL +L  C
Sbjct  1     MDWVRGKTVGRGSFATVNLAIPKANSYST---PTAVKTSEVSTSSSLKNEKHVLHQLGSC  57

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             Q +I CFGD Y+FENG++ YN+ LE+AS G L+D++K +   R+ E  IRRY+++++ GL
Sbjct  58    QRIIPCFGDDYTFENGKEYYNLFLEYASAGTLSDQVKLN-GGRIPEQHIRRYTRSIVEGL  116

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH+ G+VHCDIKLQNIL+  +GE+KIADFGLAK+ G K    E RGTP++MSPE VN 
Sbjct  117   DHIHRNGFVHCDIKLQNILVFNDGEIKIADFGLAKKTGEKQ-SFECRGTPLFMSPESVNN  175

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
             GE    ADIWALGCAV EM  G PAW   K S +  LL++IG GEE P IP +LS +GKD
Sbjct  176   GEHESPADIWALGCAVVEMVTGKPAWNLEKDSNMWSLLLQIGAGEESPLIPEELSKEGKD  235

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             F+EKCF+KD RKRWTAEMLLNHPF+    +    S RN                  FDF 
Sbjct  236   FVEKCFVKDRRKRWTAEMLLNHPFVEEVKNVDESSPRNH-----------------FDFN  278

Query  1045  DWVS---ESDHLQSSITSLPPPESEY---SPADRLQGIVSHQSP-NWSQDSDEWVNVR  1197
             DWVS   +S      +  L P + +    S  DRL  +++ + P +WS+ SD W++VR
Sbjct  279   DWVSSVNDSAPNSPELEELSPWDVDSSIDSAVDRLGKLLTVEKPVSWSE-SDSWISVR  335



>emb|CBI21416.3| unnamed protein product [Vitis vinifera]
Length=369

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 188/373 (50%), Positives = 237/373 (64%), Gaps = 45/373 (12%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M WVRG T+GRGSF  VSLAV R+ G     P M VKSCG     +L NE  VL  L  C
Sbjct  1     MTWVRGGTIGRGSFATVSLAVSRA-GEDRFPPLMAVKSCGVEDSATLRNETQVLSRLGDC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             QEV+RC+GD YS E G +LYNVLLE+A+ G+LAD ++  +   L E +++RY++++LRGL
Sbjct  60    QEVLRCYGDEYSCEGGRELYNVLLEYAAGGSLADYVR--DFGALVESDVKRYTRSILRGL  117

Query  514   GYIHKVGYVHCDIKLQNILLCENGE----VKIADFGLAKRNGGKNLGCELRGTPMYMSPE  681
              YIH VG+VHCD+KLQN+LLC + +     KI DFGLAK+          RGTPMYM+PE
Sbjct  118   DYIHGVGFVHCDVKLQNLLLCSSNDSVFCAKIGDFGLAKKAEKVAEKKGFRGTPMYMAPE  177

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSD  852
              ++G E   AADIWALGCAV EMA G PAW+    ++   LL RI  G+  PE P +LS+
Sbjct  178   CLSGEEHSAAADIWALGCAVVEMASGKPAWQCQPGTDANALLFRIWGGKASPETPSELSE  237

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
             +GKDFLEKCF++DPRKRWTAEMLL+HPF++G D   TV L+            S SPR P
Sbjct  238   EGKDFLEKCFLRDPRKRWTAEMLLDHPFVAGTD--VTVPLKQSDE-------ASTSPRSP  288

Query  1033  FDFPDWVSESDHLQSSITSLPPPESE------------------YSPADRLQGIVSHQSP  1158
             FDFP+W   SDH  S     P P+SE                   SPADR++ +V+ Q+P
Sbjct  289   FDFPEWA--SDHTPS-----PTPDSEACFDRDLNSWLNSSSHSWTSPADRIRQLVTDQTP  341

Query  1159  NWSQDSDEWVNVR  1197
             NWS  S+ W  VR
Sbjct  342   NWSV-SESWFAVR  353



>gb|AGA37217.1| mitogen-activated protein kinase kinase kinase 20.1 [Brassica 
napus]
Length=342

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 229/352 (65%), Gaps = 14/352 (4%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGET+G G+F  VSLA P +   +G  P  M VKS  ++ +  + NEK+VLD L  
Sbjct  1     MEWVRGETIGYGTFSTVSLATPSNTKGSGEYPSLMAVKS--SNSYGGIANEKSVLDSLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG+  + E GEKL+N+LLE+AS+G+LA ++KK     L E  +RR++ ++LRG
Sbjct  59    CPEIVRCFGEDQTVEKGEKLHNLLLEYASRGSLASQLKKLNGEGLPETTVRRHTGSVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L  IH  G+ HCDIKL+NILL  +G VKIADFGLA+       G E+RGTP+YM+PE VN
Sbjct  119   LRRIHSRGFAHCDIKLENILLFGDGAVKIADFGLARDLTASKEGVEIRGTPLYMAPESVN  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGK  861
               E G AAD+WALGCAV EM  G  AW   E       L+RIGVGEE+P +P +LS++GK
Sbjct  179   YNEYGAAADVWALGCAVVEMFSGETAWSVEEGSHFMSFLLRIGVGEELPRVPEELSEEGK  238

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCF+KDP KRWT EMLLNHPF++ + +      R++   +      S SPRCPF F
Sbjct  239   DFLSKCFVKDPEKRWTVEMLLNHPFVAVDCEDDDYDQRDELCLK-GKDKVSKSPRCPFGF  297

Query  1042  PDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PDW S S   +S I   P      SP +R   +VS   PNWS  S+ WV VR
Sbjct  298   PDWESMSS--ESEIQYQPLD----SPVERFASLVSESIPNWSV-SEGWVTVR  342



>ref|XP_009115702.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Brassica rapa]
Length=342

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 229/352 (65%), Gaps = 14/352 (4%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGET+G G+F  VSLA P +   +G  P  M VKS  ++ +  + NEK+VLD L  
Sbjct  1     MEWVRGETIGYGTFSTVSLATPSNTKGSGEYPSLMAVKS--SNSYGGIANEKSVLDSLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG+  + E GEKL+N+LLE+AS+G+LA ++KK     L E  +RR++ ++LRG
Sbjct  59    CPEIVRCFGEDQTVEKGEKLHNLLLEYASRGSLASQLKKLNGEGLPETTVRRHTGSVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L  IH  G+ HCDIKL+NILL  +G VKIADFGLA+       G E+RGTP+YM+PE VN
Sbjct  119   LRRIHSKGFAHCDIKLENILLFGDGAVKIADFGLARDLTASKEGVEIRGTPLYMAPESVN  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGK  861
               E G AAD+WALGCAV EM  G  AW   E       L+RIGVGEE+P +P +LS++GK
Sbjct  179   YNEYGAAADVWALGCAVVEMFSGETAWSVEEGSHFMSFLLRIGVGEELPRVPEELSEEGK  238

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCF+KDP KRWT EMLLNHPF++ + +      R++   +      S SPRCPF F
Sbjct  239   DFLSKCFVKDPEKRWTVEMLLNHPFVAVDCEDDDYDQRDELCLK-GKDKVSKSPRCPFGF  297

Query  1042  PDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PDW  ES   +S I   P      SP +R   +VS   PNWS  S+ WV VR
Sbjct  298   PDW--ESMSSESEIQYQPLD----SPVERFASLVSESIPNWSV-SEGWVTVR  342



>emb|CDY30595.1| BnaAnng03700D [Brassica napus]
Length=342

 Score =   326 bits (836),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 229/352 (65%), Gaps = 14/352 (4%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGET+G G+F  VSLA P +   +G  P  M VKS  ++ +  + NEK+VLD L  
Sbjct  1     MEWVRGETIGYGTFSTVSLATPSNIKGSGEYPSLMAVKS--SNSYGGIANEKSVLDSLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG+  + E GEKL+N+LLE+AS+G+LA ++KK     L E  +RR++ ++LRG
Sbjct  59    CPEIVRCFGEDQTVEKGEKLHNLLLEYASRGSLASQLKKLNGEGLPETTVRRHTGSVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L  IH  G+ HCDIKL+NILL  +G VKIADFGLA+       G E+RGTP+YM+PE VN
Sbjct  119   LRRIHSKGFAHCDIKLENILLFGDGAVKIADFGLARDLTASKEGVEIRGTPLYMAPESVN  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGK  861
               E G AAD+WALGCAV EM  G  AW   E       L+RIGVGEE+P +P +LS++GK
Sbjct  179   YNEYGAAADVWALGCAVVEMFSGETAWSVEEGSHFMSFLLRIGVGEELPRVPEELSEEGK  238

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCF+KDP KRWT EMLLNHPF++ + +      R++   +      S SPRCPF F
Sbjct  239   DFLSKCFVKDPEKRWTVEMLLNHPFVAVDCEDDDYDQRDELCLK-GKDKVSKSPRCPFGF  297

Query  1042  PDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PDW  ES   +S I   P      SP +R   +VS   PNWS  S+ WV VR
Sbjct  298   PDW--ESMSSESEIQYQPLD----SPVERFASLVSESIPNWSV-SEGWVTVR  342



>ref|NP_001241003.1| mitogen-activated protein kinase kinase kinase 2-like [Glycine 
max]
 gb|AEO14878.1| rsmv23 protein [Glycine max]
 gb|KHN19401.1| Serine/threonine-protein kinase BCK1/SLK1/SSP31 [Glycine soja]
Length=341

 Score =   325 bits (834),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 183/362 (51%), Positives = 236/362 (65%), Gaps = 35/362 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPM-VVKSCGASCFDSLLNEKAVLDELRG  330
             MDWVRG+ VGRGSF  VSLA+P ++      P + VVKS  A     L NEK VLD L  
Sbjct  1     MDWVRGDAVGRGSFATVSLAIPTTN--YNQFPSLTVVKSADAQTSCWLRNEKHVLDRLGS  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C  +IRCFGD  SFENG + YN+ LE+A+ G+LAD+++  +  R+ E + R Y++ ++ G
Sbjct  59    CPRIIRCFGDDCSFENGVEYYNLFLEYAAGGSLADELRNHDG-RIPEPQAREYTRDIVEG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG---GKNLGCELRGTPMYMSPE  681
             L ++HK G+VHCDIKLQNIL+ E+G +KIADFGLA+  G   GK   C  RGTPM+MSPE
Sbjct  118   LSHVHKNGFVHCDIKLQNILVFEDGRIKIADFGLAREAGERQGKKSEC--RGTPMFMSPE  175

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSD  852
              V GGE    ADIWALGCAV EM  G PAW+    S +  LL+RIGVG+E+PEIP  LS+
Sbjct  176   QVTGGECESPADIWALGCAVVEMVTGKPAWQVENGSSMWSLLLRIGVGQEVPEIPNNLSE  235

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
             DGKDF+EKCFIKDP+KRW+AEMLL HPF+  +D   TVS +              SPR  
Sbjct  236   DGKDFIEKCFIKDPKKRWSAEMLLKHPFLLNDD---TVSFKR----------VHESPRSH  282

Query  1033  FDFPDWVSESDHLQSSITSLPPPESEY-------SPADRLQGIVSHQSPNWSQDSDEWVN  1191
             FDFPDWVS    + +S+ S P  + ++       SP DRL+ +++   P    +SD W +
Sbjct  283   FDFPDWVSS---VANSLPSSPEFQEKWGFDDEFCSPEDRLRQLLTVNRPASWSESDGWSS  339

Query  1192  VR  1197
             VR
Sbjct  340   VR  341



>emb|CDX83120.1| BnaA01g21200D [Brassica napus]
Length=339

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 229/353 (65%), Gaps = 19/353 (5%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRGET+G G+F  VSLA P   G  G  P M VKS  +    SL+NEK+VLD L  C
Sbjct  1     MEWVRGETIGYGTFSTVSLATPSDSG--GFPPLMAVKSADSYGATSLVNEKSVLDSLGDC  58

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E++RC+G+  + E GEKL+N+LLE+A +G+LA ++ K     L E  +RR++ +LLRGL
Sbjct  59    PEIVRCYGEDQTVEKGEKLHNLLLEYAWRGSLATQLMKLNGEGLPESTVRRHTGSLLRGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  G+ HCDIKL NILL ++G VKIADFGLA+       G E+RGTP+YM+PE VN 
Sbjct  119   RHIHSRGFAHCDIKLGNILLFDDGAVKIADFGLARDLTVSKEGVEIRGTPLYMAPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGKD  864
                G AAD+WALGCAV EM+ G  AW   E      LL+RIGVG+E+P++P  LS++GKD
Sbjct  179   NVYGTAADVWALGCAVVEMSSGKTAWSVEEGLNFMSLLIRIGVGDELPKVPEDLSEEGKD  238

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGATVSLRNDTHREasapapspspRCPFD  1038
             FL KCF+KDP +RWTAEMLLNHPF++   ED+G     R D   E      S SPRCPF+
Sbjct  239   FLSKCFVKDPEERWTAEMLLNHPFVAVDCEDNGQ----REDLFVE-VKEKVSTSPRCPFE  293

Query  1039  FPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             F DW   +     S+    P +   SP +R + +VS   PNWS  +  WV VR
Sbjct  294   FSDWEPIASE---SVMQYQPLD---SPVERFESLVSESIPNWSI-AQGWVTVR  339



>ref|XP_009101744.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Brassica rapa]
Length=339

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 229/353 (65%), Gaps = 19/353 (5%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRGET+G G+F  VSLA P   G  G  P M VKS  +    SL+NEK+VLD L  C
Sbjct  1     MEWVRGETIGYGTFSTVSLATPSDSG--GFPPLMAVKSADSYGATSLVNEKSVLDSLGDC  58

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E++RC+G+  + E GEKL+N+LLE+A +G+LA ++ K     L E  +RR++ +LLRGL
Sbjct  59    PEIVRCYGEDQTVEKGEKLHNLLLEYAWRGSLATQLMKLNGEGLPESTVRRHTGSLLRGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  G+ HCDIKL NILL ++G VKIADFGLA+       G E+RGTP+YM+PE VN 
Sbjct  119   RHIHSRGFAHCDIKLGNILLFDDGAVKIADFGLARDLTVSREGVEIRGTPLYMAPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGKD  864
                G AAD+WALGCAV EM+ G  AW   E      LL+RIGVG+E+P++P  LS++GKD
Sbjct  179   NVYGTAADVWALGCAVVEMSSGKTAWSVEEGLNFMSLLIRIGVGDELPKVPEDLSEEGKD  238

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGATVSLRNDTHREasapapspspRCPFD  1038
             FL KCF+KDP +RWTAEMLLNHPF++   ED+G     R D   E      S SPRCPF+
Sbjct  239   FLSKCFVKDPEERWTAEMLLNHPFVAVDCEDNGQ----REDLFVE-VKEKVSTSPRCPFE  293

Query  1039  FPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             F DW   +     S+    P +   SP +R + +VS   PNWS  +  WV VR
Sbjct  294   FSDWEPIASE---SVMQYQPLD---SPVERFESLVSESIPNWSI-AQGWVTVR  339



>ref|NP_201509.1| mitogen-activated protein kinase kinase kinase 19 [Arabidopsis 
thaliana]
 dbj|BAB10942.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AED98298.1| mitogen-activated protein kinase kinase kinase 19 [Arabidopsis 
thaliana]
Length=344

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 229/356 (64%), Gaps = 20/356 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDEL-R  327
             M+W+RGET+G G+F  VSLA  RS+  +G  PP M VKS  +    SL NEK+VLD L  
Sbjct  1     MEWIRGETIGYGTFSTVSLAT-RSNNDSGEFPPLMAVKSADSYGAASLANEKSVLDNLGD  59

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C E++RCFG+  + ENGE+++N+ LE+AS+G+L   +KK     + E  +RR++ ++LR
Sbjct  60    DCNEIVRCFGEDRTVENGEEMHNLFLEYASRGSLESYLKKLAGEGVPESTVRRHTGSVLR  119

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG---GKNLGCELRGTPMYMSP  678
             GL +IH  G+ HCD+KL NILL  +G VKIADFGLAKR G     N G ++RGTP+YM+P
Sbjct  120   GLRHIHANGFAHCDLKLGNILLFGDGAVKIADFGLAKRIGDLTALNYGVQIRGTPLYMAP  179

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G   D+WALGC V EM  G  AW   E      LL+RIGVG+E+P IP +LS
Sbjct  180   ESVNDNEYGSEGDVWALGCVVVEMFSGKTAWSLKEGSNFMSLLLRIGVGDEVPMIPEELS  239

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRC  1029
             + G+DFL KCF+KDP+KRWTAEMLLNHPF++ + D   +    D          S SPRC
Sbjct  240   EQGRDFLSKCFVKDPKKRWTAEMLLNHPFVTVDVDHDVLVKEEDFVVNMKTEDVSTSPRC  299

Query  1030  PFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PF+FPDWVS S   Q+            SP +R+  +V+   P+WS  ++ WV VR
Sbjct  300   PFEFPDWVSVSSGSQTI----------DSPDERVASLVTDMIPDWSV-TNSWVTVR  344



>gb|KDO79193.1| hypothetical protein CISIN_1g017746mg [Citrus sinensis]
Length=366

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/370 (49%), Positives = 243/370 (66%), Gaps = 26/370 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDS---LLNEKAVLDE  321
             M+W+RG+ +G GSFG V+LA  ++  ++   P  M VKSC A C  S   L NEK  LD+
Sbjct  1     MEWLRGDVIGHGSFGSVNLA--KASKVSSEFPSLMAVKSC-ADCPPSSVTLKNEKEALDQ  57

Query  322   LRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKAL  501
             +  C +++RCFGD YSFE GE+ YN+LLE+AS+G+LAD++KK  N RL E +++RY++++
Sbjct  58    IGICPQIVRCFGDDYSFEKGERFYNLLLEYASRGSLADRVKKQNNGRLQESDVKRYTRSM  117

Query  502   LRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR---NGGKNLGCELRGTPMYM  672
             L+GL +IH  G+VHCDIKLQN+L+ +N E KIADFGLAK+   +G ++   E RGTP+YM
Sbjct  118   LKGLRHIHSKGFVHCDIKLQNVLVFDNDEAKIADFGLAKKSSCDGERSQSFECRGTPLYM  177

Query  673   SPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGK  843
             SPE VN  E     DIWALGCAV EMA G PAW     S V  LL+RIGVG+E+P IPG 
Sbjct  178   SPESVNENEYEAPCDIWALGCAVVEMASGKPAWNHKQDSNVFSLLIRIGVGDELPNIPGD  237

Query  844   LSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFI-----SGEDDGATVSLRNDTH-REasap  1005
             LS+ GKDFL KCF+KDP++RWTAEMLLNHPF+     +G+D G  +   +    +     
Sbjct  238   LSEQGKDFLIKCFLKDPKRRWTAEMLLNHPFVCADDQTGDDGGIHIHSSSSPSLKGIKDE  297

Query  1006  apspspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPA-----DRLQGIV-SHQSPNWS  1167
               S SPR PF FP+WVS       + +   P    +  +     DR++ +    + PNWS
Sbjct  298   KFSQSPRSPFGFPEWVSVQSSSSVTSSINSPSFDSFLSSRDCLLDRIRVLAGDDERPNWS  357

Query  1168  QDSDEWVNVR  1197
              DS+ WV VR
Sbjct  358   -DSECWVTVR  366



>ref|XP_010464552.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Camelina sativa]
Length=346

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 238/364 (65%), Gaps = 34/364 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDEL-R  327
             M+W+RGET+G G+F  VSLA   S+  +GA P  M VKS  +    SL NEKAVLD+L  
Sbjct  1     MEWIRGETIGYGTFSTVSLASSPSNNGSGAFPTFMAVKSADSYGAASLENEKAVLDKLGY  60

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C E++RCFGD  + ENGE+++N+ LE+AS+G+L   +KK     L E  +RR++ ++LR
Sbjct  61    ECDEIVRCFGDDRTVENGEEMHNLFLEYASRGSLESYLKKLGGEGLPESTVRRHTGSVLR  120

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG---GKNLGCELRGTPMYMSP  678
             GL +IH  G+ HCD+KL NILL  +G VKIADFGLAKR G     N G ++RGTP+YM+P
Sbjct  121   GLRHIHANGFAHCDLKLGNILLFGDGAVKIADFGLAKRVGEVTALNEGVQIRGTPLYMAP  180

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G   D+WALGCAV EM  G  AW F E      LL+RIGVG+E+P IP +LS
Sbjct  181   EAVNDNEYGSEGDVWALGCAVVEMFSGKTAWSFKEGSNFMSLLIRIGVGDEVPLIPEELS  240

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS--------GEDDGATVSLRNDTHREasap  1005
             + G+DFL KCF+KDP+KRWTAEMLL+HPF++         E++G  V+L+  T +E    
Sbjct  241   EQGRDFLTKCFVKDPKKRWTAEMLLHHPFVAVDLDHDGLVEEEGFVVNLK--TEKE----  294

Query  1006  apspspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEW  1185
               S SPRCPF+FPDWVS S   Q+            SP +R+  + +  +P+WS  ++ W
Sbjct  295   -VSTSPRCPFEFPDWVSVSSGSQTI----------DSPEERVTSLAADSTPDWSV-TNSW  342

Query  1186  VNVR  1197
             V VR
Sbjct  343   VTVR  346



>ref|XP_010547520.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Tarenaya hassleriana]
Length=351

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 230/367 (63%), Gaps = 35/367 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRGET+G G+F  VSLA P         P M VKS  +    SL NEK+VLD+L  C
Sbjct  1     MEWVRGETIGYGTFATVSLATPAKKCSGEFPPLMAVKSADSYGAASLANEKSVLDQLGHC  60

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E++R FGD  + ENGE++ N+ LE+AS+G+LA  +KKS    L E  +RR++ ++LRGL
Sbjct  61    PEIVRFFGDDRTVENGEEMCNLFLEYASRGSLATHVKKSGGDGLPESAVRRHTLSVLRGL  120

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN------LGCELRGTPMYMS  675
              +IH  G+ HCDIKL NIL+  +G VKIADFGLAKR G  N       G ++RGTP+YM+
Sbjct  121   CHIHANGFAHCDIKLGNILMFGDGAVKIADFGLAKRTGVTNGEETVSEGSQIRGTPLYMA  180

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKL  846
             PE VN  E G  AD+WA GCAV EM  G  AW F E      LLMRIGVG+E+P IP +L
Sbjct  181   PESVNDNEYGSEADVWAFGCAVVEMFSGKTAWSFKEGSNFMSLLMRIGVGDELPRIPEEL  240

Query  847   SDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS------GEDDGATVSLRNDTHREasapa  1008
             S++G+DFL KCF+KDP+KRWTAEMLL+HPFI+       +DDG     R +   E     
Sbjct  241   SEEGRDFLSKCFVKDPKKRWTAEMLLSHPFIAVDLEHEDDDDG-----REEIFVELQKDE  295

Query  1009  pspspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIV----SHQSPNWSQDS  1176
              S SPR P DFPDWVSES   Q          ++  P D L+ I+    +  SP+WS  +
Sbjct  296   VSVSPRGPLDFPDWVSESSDSQ----------TQCQPYDSLEEIIGSLATDCSPDWSV-T  344

Query  1177  DEWVNVR  1197
               WV VR
Sbjct  345   QGWVTVR  351



>ref|XP_010093629.1| Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis]
 gb|EXB54390.1| Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis]
Length=402

 Score =   326 bits (835),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 181/357 (51%), Positives = 235/357 (66%), Gaps = 25/357 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+RGE +G GSF  +S A P +   +   P M VKS  A C  SL NEK VLD +  C
Sbjct  1     MEWIRGEEIGHGSFATISKATP-TKSSSQFPPLMAVKSSEACCSASLKNEKRVLDTIGLC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++IRCFG+  S E GE+ +N+L+E+AS G+LAD++K S+  RLSE+EIRR++K++L+GL
Sbjct  60    PQIIRCFGEEQSVEKGEEFHNLLMEYASGGSLADRVK-SQGGRLSELEIRRHTKSILKGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  G+VHCDIKLQNIL+  +G  KIADFGLAK    K   CE+RGTP+YMSPE VN 
Sbjct  119   SFIHSKGFVHCDIKLQNILVFHDGAAKIADFGLAKETATKRNKCEIRGTPLYMSPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
                    D+WALGCA+AEMA G P W     + V  LL+RIG GEE P IP + S++GKD
Sbjct  179   NVYESPCDVWALGCAMAEMATGKPVWDHKAGASVWPLLIRIG-GEEEPPIPSEFSEEGKD  237

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FL KCF+KDP KRWTAEMLLNH F+  E D       ++T     + +PSPSPRCPFDFP
Sbjct  238   FLRKCFVKDPAKRWTAEMLLNHAFVVSEYDEDF----DETVLSKESNSPSPSPRCPFDFP  293

Query  1045  DWVSES--------DHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVN  1191
             +WVS S        +++ SS T  P      S  D ++ +V+ ++ NWS  SD WV 
Sbjct  294   EWVSASEPEFSPAFEYVFSSTTRFP------SSDDGIRNLVTDEALNWSF-SDSWVT  343



>ref|XP_006425909.1| hypothetical protein CICLE_v10025910mg [Citrus clementina]
 gb|ESR39149.1| hypothetical protein CICLE_v10025910mg [Citrus clementina]
Length=366

 Score =   325 bits (832),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 179/369 (49%), Positives = 242/369 (66%), Gaps = 24/369 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCG--ASCFDSLLNEKAVLDEL  324
             M+W+RG+ +G GSFG V+LA  ++  ++   P  M VKSC    S   +L NEK  LD++
Sbjct  1     MEWLRGDVIGHGSFGSVNLA--KASKVSSEFPSLMAVKSCSDCPSSSVTLKNEKEALDQI  58

Query  325   RGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
               C +++RCFGD YSFE GE+ YN+LLE+AS+G+LAD++KK  N RL E +++RY++++L
Sbjct  59    GICPQIVRCFGDDYSFEKGERFYNLLLEYASRGSLADRVKKQNNGRLQESDVKRYTRSML  118

Query  505   RGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR---NGGKNLGCELRGTPMYMS  675
             +GL +IH  G+VHCDIKLQN+L+ +N E KIADFGLAK+   +G ++   E RGTP+YMS
Sbjct  119   KGLRHIHSKGFVHCDIKLQNVLVFDNDEAKIADFGLAKKSSCDGERSESFECRGTPLYMS  178

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKL  846
             PE VN  E     DIWALGCAV EMA G PAW     S V  LL+RIGVG+E+P IPG L
Sbjct  179   PESVNENEYEAPCDIWALGCAVVEMASGKPAWNHKQDSNVFSLLIRIGVGDELPNIPGDL  238

Query  847   SDDGKDFLEKCFIKDPRKRWTAEMLLNHPFI-----SGEDDGATVSLRNDTH-REasapa  1008
             S+ GKDFL KCF+KDP++RWTAEMLLNHPF+     +G+D G  +   +    +      
Sbjct  239   SEQGKDFLIKCFLKDPKRRWTAEMLLNHPFVCADDQTGDDGGIHIHSSSSPSLKGIKDEK  298

Query  1009  pspspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPA-----DRLQGIV-SHQSPNWSQ  1170
              S SPR PF FP+WVS       + +   P    +  +     DR++ +    + PNWS 
Sbjct  299   FSQSPRSPFGFPEWVSVQSSSSVTSSLNSPSFDSFLSSRDCLLDRIRVLAGDDERPNWS-  357

Query  1171  DSDEWVNVR  1197
             DS+ WV VR
Sbjct  358   DSECWVTVR  366



>ref|XP_006466595.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Citrus sinensis]
Length=366

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 180/370 (49%), Positives = 242/370 (65%), Gaps = 26/370 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDS---LLNEKAVLDE  321
             M+W+RG+ +G GSFG V+LA  ++  ++   P  M VKSC A C  S   L NEK  LD+
Sbjct  1     MEWLRGDVIGHGSFGSVNLA--KASKVSSEFPSLMAVKSC-ADCPPSSVTLKNEKEALDQ  57

Query  322   LRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKAL  501
             +  C +++RCFGD YSFE GE+ YN+ LE+AS+G+LAD++KK  N RL E +++RY++++
Sbjct  58    IGICPQIVRCFGDDYSFEKGERFYNLFLEYASRGSLADRVKKQNNGRLQESDVKRYTRSM  117

Query  502   LRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR---NGGKNLGCELRGTPMYM  672
             L+GL +IH  G+VHCDIKLQN+L+ +N E KIADFGLAK+   +G ++   E RGTP+YM
Sbjct  118   LKGLRHIHSKGFVHCDIKLQNVLVFDNDEAKIADFGLAKKSSCDGERSQSFECRGTPLYM  177

Query  673   SPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGK  843
             SPE VN  E     DIWALGCAV EMA G PAW     S V  LL+RIGVG+E+P IPG 
Sbjct  178   SPESVNENEYEAPCDIWALGCAVVEMASGKPAWNHKQDSNVFSLLIRIGVGDELPNIPGD  237

Query  844   LSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFI-----SGEDDGATVSLRNDTH-REasap  1005
             LS+ GKDFL KCF+KDP++RWTAEMLLNHPF+     +G+D G  +   +    +     
Sbjct  238   LSEQGKDFLIKCFLKDPKRRWTAEMLLNHPFVCADDETGDDGGIHIHSSSSPSLKGIKDE  297

Query  1006  apspspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPA-----DRLQGIV-SHQSPNWS  1167
               S SPR PF FP+WVS       + +   P    +  +     DR++ +    + PNWS
Sbjct  298   KFSQSPRSPFGFPEWVSVQSSSSVTSSINSPSFDSFLSSRDCLLDRIRVLAGDDERPNWS  357

Query  1168  QDSDEWVNVR  1197
              DS+ WV VR
Sbjct  358   -DSECWVTVR  366



>ref|XP_006404041.1| hypothetical protein EUTSA_v10010509mg [Eutrema salsugineum]
 gb|ESQ45494.1| hypothetical protein EUTSA_v10010509mg [Eutrema salsugineum]
Length=346

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/357 (51%), Positives = 230/357 (64%), Gaps = 20/357 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRGET+G G+F  VSLA P + G   A   M VKS  +   D++ NEK+VLD L  C
Sbjct  1     MEWVRGETIGYGTFSTVSLATPLNIGELPAL--MAVKSSDSYGADAIANEKSVLDSLGDC  58

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E++RCFG+  + E GEK YN+LLE+AS+G+LA ++KK     L E  +RR++ ++LRGL
Sbjct  59    SEIVRCFGEDQTVEKGEKFYNLLLEYASRGSLATQLKKLNGEGLPESTVRRHTGSVLRGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK----NLGCELRGTPMYMSPE  681
              +IH  G+ HCDIKL NILL  +G VKIADFGLA+R  G+      G E+RGTP+ M+PE
Sbjct  119   RHIHSNGFAHCDIKLGNILLFGDGAVKIADFGLARRINGELTASKEGVEIRGTPLNMAPE  178

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSD  852
              VN  E G AAD+WALGCAV EM  G  AW   E      LL+RIGVG+E+P+IP +LS+
Sbjct  179   SVNDNEYGSAADVWALGCAVVEMFSGKTAWSVKEGSNYMSLLLRIGVGDELPKIPEELSE  238

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGE-DDGATVSLRNDTHREasapapspspRC  1029
             +GKDFL KCF+KDP KRWTAEMLLNH F++ + DDG           +      S SPRC
Sbjct  239   EGKDFLSKCFVKDPEKRWTAEMLLNHSFVAVDCDDGQKEEFF--MKVKEEEEEVSTSPRC  296

Query  1030  PFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSH-QSPNWSQDSDEWVNVR  1197
             PF FPDW  ES  L S     P      SP +R + +V+    P+WS   D WVNVR
Sbjct  297   PFGFPDW--ESVSLDSDTQYQPLD----SPVERFESLVTESMMPDWSVAGD-WVNVR  346



>ref|XP_010550362.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Tarenaya hassleriana]
Length=351

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/361 (51%), Positives = 236/361 (65%), Gaps = 23/361 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M WVRGETVG GSF  VSLA P ++  +G  PP M VKS       SL NEK+VLD+L  
Sbjct  1     MKWVRGETVGYGSFATVSLATP-ANKYSGEFPPLMAVKSAEKYGAASLANEKSVLDQLGH  59

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C+E++RCFGD  + ENGE++YN+LLE+AS+G+LA  +KKS+   L E  +RR+++++LRG
Sbjct  60    CREIVRCFGDDRTVENGEEIYNLLLEYASRGSLATHVKKSDG--LPESAVRRHTESVLRG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR----NGGKNL--GCELRGTPMYM  672
             L +IH  G+ HCDIKL NIL+  NG VKIADFGLAKR    +G +    G ++RGTP+YM
Sbjct  118   LRHIHASGFAHCDIKLGNILMFGNGAVKIADFGLAKRIKVVDGEETASEGTKIRGTPLYM  177

Query  673   SPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGK  843
             +PE VN  E G  AD+WALGCAV EM  G  AW F E      LLMRIGVG+E P +P +
Sbjct  178   APESVNDNEYGSEADVWALGCAVVEMFSGKTAWSFKENSNFMSLLMRIGVGDETPRVPEE  237

Query  844   LSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS---GEDDGATVSLRNDTHREasapaps  1014
             LS+ G+DFL KCF+KDP+KRWTAEMLL HPF++   G DD     L  +   E      S
Sbjct  238   LSEVGRDFLSKCFVKDPKKRWTAEMLLCHPFVAVDLGHDDDDDHQLDEEFAVETKKEEVS  297

Query  1015  pspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNV  1194
              SP+ PFDFPDW SES   Q+    L  PE      +R+  + +   P+WS   + WV V
Sbjct  298   ASPKGPFDFPDWDSESLDSQTRSQPLDWPE------ERIGSLATDFIPDWSVTGN-WVTV  350

Query  1195  R  1197
             R
Sbjct  351   R  351



>ref|XP_010095583.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB61156.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=346

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 234/355 (66%), Gaps = 22/355 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M WVRG T+G GSF  +S+A PR    A   P M VKS   SC DSL NEK VLD +  C
Sbjct  1     MKWVRGATIGHGSFATISIATPRK-SCAEFPPLMAVKSSKVSCSDSLKNEKRVLDAIGSC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++IRCF +  S ENGEK +N+ +E+AS G+LA+++K S+  RL E EIR+++K++L+GL
Sbjct  60    PQIIRCFREAQSVENGEKFHNLFMEYASGGSLANRVK-SQGRRLPESEIRQHAKSILKGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              ++H  G+VHCDIK QNIL+ +NG VKIADFGLAK +G +     +RGT +YMSPE VN 
Sbjct  119   SFMHAKGFVHCDIKPQNILVFDNGSVKIADFGLAKESGMEQNNYMIRGTALYMSPESVNN  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGKD  864
              E     D+WALGC VAEMA G P W   E   V  LL+RIG GEE PEIP ++S++GKD
Sbjct  179   NEYESPCDVWALGCTVAEMATGKPVWDHEEGASVWPLLIRIG-GEEEPEIPSEISEEGKD  237

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGE----DDGATVSLRNDTHREasapapspspRCP  1032
             FL  CF+KDPRKRWTAEMLL+HPF+  +    DD     L N+ +        S SPRCP
Sbjct  238   FLRNCFVKDPRKRWTAEMLLSHPFVVSDYDNGDDAKDTVLLNEEN------CVSTSPRCP  291

Query  1033  FDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             +DFP WVS S+   S   S  P     SPAD+LQ +V+ + PNWS  SD W  VR
Sbjct  292   YDFPAWVSTSEQEISPELSCFP-----SPADKLQELVTEERPNWSF-SDSWATVR  340



>ref|XP_009367209.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3 [Pyrus 
x bretschneideri]
Length=350

 Score =   321 bits (823),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 177/369 (48%), Positives = 238/369 (64%), Gaps = 42/369 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+W+RG+ +GRGSF  +  A P S   +   PP+V VKS  +   DSL NEK VLD++  
Sbjct  1     MEWIRGKEIGRGSFATIYAAKPTSP--SSHLPPLVAVKSSVSGYSDSLKNEKKVLDQIGS  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C ++IRCFGD ++ ENGEK +N++LE+A  G LAD++K++   RL E ++RR++K++LRG
Sbjct  59    CPQIIRCFGDDHTVENGEKFFNLVLEYAGGGTLADELKRN-GGRLPEFDVRRHAKSVLRG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KLQN+L+  NG  KIADFGLAK+ G      E+RGTP+YM+PE VN
Sbjct  118   LEFIHAKGFVHCDLKLQNVLVFGNGTAKIADFGLAKKAGESENKVEVRGTPLYMAPESVN  177

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E   ++DIWA GC VAEMA G PAW  +    + ++LMRIG G+E+P+IP +LS++GK
Sbjct  178   DNEYESSSDIWAFGCLVAEMASGKPAWDHNPAMNMFKILMRIG-GDELPQIPEELSEEGK  236

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DF+ KCF+KD R+RWTAEMLL HPF+SG+D   TV L             S SPR PFDF
Sbjct  237   DFVSKCFVKDTRQRWTAEMLLKHPFVSGDDH--TVLLEEKAE-------LSGSPRGPFDF  287

Query  1042  PDWVS------------------ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWS  1167
             PDWVS                  +S+   SS  S  P       ADRL+ + + ++PNWS
Sbjct  288   PDWVSIASSEISPQFGDFSRKNLDSEFDWSSRKSFVP------AADRLRQLATEETPNWS  341

Query  1168  QDSDEWVNV  1194
                D WV  
Sbjct  342   FSVD-WVTT  349



>ref|XP_010503702.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Camelina sativa]
Length=343

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 177/356 (50%), Positives = 229/356 (64%), Gaps = 21/356 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGET+G G+F  VS+A   ++  +G  P ++ VKS  +    SL NEK+VLD L  
Sbjct  1     MEWVRGETIGFGTFSTVSVAT-TTNKDSGVFPRLIAVKSSDSYGAASLSNEKSVLDSLGD  59

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RC+G+  + ENGEKL+N+LLE+AS+G+LA ++KK     L E  +RR++ ++LRG
Sbjct  60    CPEIVRCYGEDRTVENGEKLHNLLLEYASRGSLATQLKKLGGEGLPEPTVRRHTGSVLRG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG----KNLGCELRGTPMYMSP  678
             L ++H  G+ HCDIKL NILL  +G VKIADFGLA+R  G     N G E+RGTP+YM+P
Sbjct  120   LRHVHAKGFAHCDIKLGNILLFNDGAVKIADFGLARRVDGVLTPSNEGVEIRGTPLYMAP  179

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G AAD+WALGCAV EM  G  AW   E   V  LLMRIG G E+P+IP  LS
Sbjct  180   ESVNYNEYGSAADVWALGCAVVEMISGKTAWSVKEGSHVMSLLMRIGAGGELPKIPEFLS  239

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRC  1029
             ++GKDFL KCF+KDP  RW AEMLLNHPF++   D      R D   +        SP+C
Sbjct  240   EEGKDFLSKCFVKDPENRWAAEMLLNHPFVAV--DCEEHDQREDYVLKVEEEEAPTSPKC  297

Query  1030  PFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PF+FPDW S      SS +  P      SP  RL  +VS   P+WS + D W+ VR
Sbjct  298   PFEFPDWES-----MSSDSHTPSD----SPVKRLGSLVSESFPDWSVEGD-WITVR  343



>ref|XP_002866718.1| MAPKKK19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42977.1| MAPKKK19 [Arabidopsis lyrata subsp. lyrata]
Length=344

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 227/355 (64%), Gaps = 18/355 (5%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDEL-RG  330
             M+W+RGET+G G+F  VSLA P ++      P M VKS  +    SL NEK+VLD+L   
Sbjct  1     MEWIRGETIGYGTFSTVSLATPSNNDSGELPPLMAVKSADSYGAASLENEKSVLDKLGDD  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG+  + ENGE+++N+ LE+AS+G+L   +KK     L E  +RR++ ++LRG
Sbjct  61    CNEIVRCFGEDRTVENGEEMHNLFLEYASRGSLESYLKKLAGEGLPESTVRRHTGSVLRG  120

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG---GKNLGCELRGTPMYMSPE  681
             L +IH  G+ HCD+KL NIL   +G VKIADFGLAKR G     N G ++RGTP+YM+PE
Sbjct  121   LRHIHANGFAHCDLKLGNILWFGDGAVKIADFGLAKRIGEVTAINEGVQIRGTPLYMAPE  180

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSD  852
              VN  E G   D+WALGCAV EM  G  AW   E      LL+RIGVG+E+P IP +LS+
Sbjct  181   SVNDNEYGSEGDVWALGCAVVEMFSGKTAWSLKEGSNFMSLLIRIGVGDELPMIPEELSE  240

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
              GKDFL KCF+KDP+KRWTAEMLL+HPF++ + D   +    D   +      S SPRCP
Sbjct  241   QGKDFLSKCFVKDPKKRWTAEMLLHHPFVAVDLDYDGLVEEEDFVVKLKTEEVSTSPRCP  300

Query  1033  FDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             F+FPDWVS S   Q             SP +R+  +V+   P+WS  ++ WV VR
Sbjct  301   FEFPDWVSVSSGSQMI----------DSPEERVTSLVTDLIPDWSV-TNSWVTVR  344



>ref|NP_001078504.1| mitogen-activated protein kinase kinase kinase 21 [Arabidopsis 
thaliana]
 gb|AAL49865.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20179.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86723.1| mitogen-activated protein kinase kinase kinase 21 [Arabidopsis 
thaliana]
Length=336

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 234/361 (65%), Gaps = 38/361 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+R ET+G GSF  VSLA             M VKS G  C  +L NE+ VLD+L  C
Sbjct  1     MEWIRRETIGHGSFSTVSLATTSGSSSKAFPSLMAVKSSGVVCSAALRNERDVLDDLGDC  60

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E++RCFG+G + ENGE++YN+ LE+AS G+LAD+IK S    L E E+RR+++++++GL
Sbjct  61    SEIVRCFGEGRTVENGEEIYNLFLEYASGGSLADRIKSS-GEALPEFEVRRFTRSIVKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  G+ HCDIKL+N+L+  +G+VKI+DFGLAKR  G+ +  E+RGTP+YM+PE VN 
Sbjct  120   CHIHGNGFTHCDIKLENVLVFGDGDVKISDFGLAKRRSGE-VCVEIRGTPLYMAPESVNH  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSE-----VAELLMRIGVGEEIPEIPGKLSDDG  858
             GE    ADIWALGC+V EM+ G  AW   +     V  LL+RIG G+E+P IP +LS++G
Sbjct  179   GEFESPADIWALGCSVVEMSSGKTAWCLEDGVMNNVMSLLVRIGSGDEVPRIPVELSEEG  238

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFI-----SGEDDGA-TVSLRNDTHREasapapsps  1020
             KDF+ KCF+K+  +RWTAEMLL+HPF+     SGE+D A +VS RN              
Sbjct  239   KDFVSKCFVKNAAERWTAEMLLDHPFLAVDDESGEEDEACSVSPRN--------------  284

Query  1021  pRCPFDFPDWVSESDHLQSSIT--SLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNV  1194
                PFDFP W S    +  S+   SL       SP +R+ G+VS + P+WS   D WVNV
Sbjct  285   ---PFDFPGWNSVQSPVNDSVMFGSLVG-----SPEERISGLVSEKVPDWSVSCD-WVNV  335

Query  1195  R  1197
             R
Sbjct  336   R  336



>ref|XP_010095581.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB61154.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=423

 Score =   322 bits (824),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 239/369 (65%), Gaps = 22/369 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M WVRG T+G GSF  +S+A PR    A   P M VKS   SC DSL NEK VLD +  C
Sbjct  1     MKWVRGATIGHGSFATISIATPRK-SCAEFPPLMAVKSSKVSCSDSLKNEKRVLDAIGSC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++IRCF +  S ENGEK +N+ +E+AS G+LA+++K S+  RL E EIR+++K++L+GL
Sbjct  60    PQIIRCFREAQSVENGEKFHNLFMEYASGGSLANRVK-SQGRRLPESEIRQHAKSILKGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              ++H  G+VHCDIK QNIL+ +NG VKIADFGLAK +G +     +RGT +YMSPE VN 
Sbjct  119   SFMHAKGFVHCDIKPQNILVFDNGSVKIADFGLAKESGMEQNNYMIRGTALYMSPESVNN  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGKD  864
              E     D+WALGC VAEMA G P W   E   V  LL+RIG GEE PEIP ++S++GKD
Sbjct  179   NEYESPCDVWALGCTVAEMATGKPVWDHEEGASVWPLLIRIG-GEEEPEIPSEISEEGKD  237

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGE----DDGATVSLRNDTHREasapapspspRCP  1032
             FL  CF+KDPRKRWTAEMLL+HPF+  +    DD     L N+ +        S SPRCP
Sbjct  238   FLRNCFVKDPRKRWTAEMLLSHPFVVSDYDNGDDAKDTVLLNEEN------CVSTSPRCP  291

Query  1033  FDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR*CQMS  1212
             +DFP WVS S+   S   S  P     SPAD+LQ +V+ + PNWS  SD W  V      
Sbjct  292   YDFPAWVSTSEQEISPELSCFP-----SPADKLQELVTEERPNWSF-SDSWATVNFLLSW  345

Query  1213  TVNLQKLQS  1239
               N +KL++
Sbjct  346   LKNSKKLET  354



>ref|XP_007204693.1| hypothetical protein PRUPE_ppa007987mg [Prunus persica]
 gb|EMJ05892.1| hypothetical protein PRUPE_ppa007987mg [Prunus persica]
Length=349

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 172/363 (47%), Positives = 235/363 (65%), Gaps = 31/363 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG+ +GRGSF  +  A  R +  +   P M VKS  +    S+ NEK +LD++  C
Sbjct  1     MEWVRGKEIGRGSFATIYTA-KRKNPSSQLPPLMAVKSAESYYSASVENEKRILDQIGSC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++IRCFGD  + E+GE+ YN++LE+A+ G LAD++K++   RL+E ++RR++ ++L+GL
Sbjct  60    PQIIRCFGDDRTVEDGEEFYNLMLEYATGGTLADELKRN-GGRLAEADVRRHTNSVLKGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             G++H  G+VHCD+KLQN+L+ +NG  KIADFGLAK+ G      E+RGTP+YM+PE VN 
Sbjct  119   GFVHAKGFVHCDVKLQNVLVFDNGVAKIADFGLAKKAGEAEQKAEVRGTPLYMAPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGKD  864
              E   +AD+WALGC VAEMA G P W  S    + +LLMRIG G+E+P+IP  L ++GKD
Sbjct  179   NEYESSADVWALGCLVAEMASGKPVWDHSPGANIFKLLMRIG-GDELPQIPEDLCEEGKD  237

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FLEKCF+KDPRKRWTAEMLL HPF+S  D      L  +T         SPSPR PFDFP
Sbjct  238   FLEKCFVKDPRKRWTAEMLLRHPFVSNYD----AVLLEETK-------LSPSPRGPFDFP  286

Query  1045  DWVS-ESDHLQSSI------------TSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEW  1185
             DWVS  S  + S              +     +S     DRL+ + + ++PNWS   D W
Sbjct  287   DWVSMASSEISSDFGDFFGKNDLNSGSDWSSRQSSIPAVDRLRLLATEETPNWSFSGD-W  345

Query  1186  VNV  1194
             V V
Sbjct  346   VTV  348



>ref|XP_009343294.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Pyrus x bretschneideri]
Length=350

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 174/369 (47%), Positives = 236/369 (64%), Gaps = 42/369 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+W+RG+ +GRGSF  +  A P S   +   PP+V VKS  +   DSL NEK VLD++  
Sbjct  1     MEWIRGKEIGRGSFATIHAAKPTSP--SSHLPPLVAVKSSVSGYSDSLKNEKKVLDQIGS  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C ++IRCFGD ++ ENGEK +N++LE+A  G LAD++K++   RL E ++RR++K++LRG
Sbjct  59    CPQIIRCFGDDHTVENGEKFFNLVLEYAGGGTLADELKRN-GGRLPEFDVRRHAKSVLRG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KLQN+L+  NG  KIADFGLAK+ G      E+RGTP+YM+PE VN
Sbjct  118   LEFIHAKGFVHCDLKLQNVLVFGNGAAKIADFGLAKKAGESENKVEVRGTPLYMAPESVN  177

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E    +D+WA GC VAEMA G P W  +    + ++LMRIG  +E+P+IP +LS++GK
Sbjct  178   DNEYESCSDVWAFGCLVAEMASGKPVWDNNPAVNMFKILMRIG-SDELPQIPDELSEEGK  236

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DF+ KCF+KDPR+RWTAEMLL HPF+SG+D   TV L             + SPR PFDF
Sbjct  237   DFVSKCFVKDPRQRWTAEMLLKHPFVSGDDH--TVLLEEKAE-------LAGSPRGPFDF  287

Query  1042  PDWVS------------------ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWS  1167
             PDWVS                  +S+   SS  S  P       ADRL+ + + ++PNWS
Sbjct  288   PDWVSIASSEISPQFGDFSGKNLDSEFDWSSRKSFVP------AADRLRQLAAEETPNWS  341

Query  1168  QDSDEWVNV  1194
                D WV  
Sbjct  342   FSVD-WVTT  349



>ref|XP_008340193.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Malus domestica]
Length=350

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 236/369 (64%), Gaps = 42/369 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+W+RG+ +GRGSF  +  A P S   +   PP+V VKS  +   DSL NEK VL ++  
Sbjct  1     MEWIRGKEIGRGSFATIYAAKPTSP--SSHLPPLVAVKSSVSGYSDSLKNEKKVLHQIGS  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C ++IRCFGD ++ ENGEK +N++LE+AS G LAD++K++    L E ++RR+ K++LRG
Sbjct  59    CPQIIRCFGDDHTVENGEKFFNLVLEYASGGTLADELKRT-GGSLPEFDVRRHVKSVLRG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KLQN+L+  NG  KIADFGLAK+ G      E+RGTP+YM+PE VN
Sbjct  118   LEFIHAKGFVHCDLKLQNVLVFGNGAAKIADFGLAKKAGESENXVEVRGTPLYMAPESVN  177

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E    +DIWA GC VAEMA G P W  +    + ++LMRIG G+E+P+IP +LS++GK
Sbjct  178   DNEYESCSDIWAFGCLVAEMASGKPVWDHNPAVNMFKILMRIG-GDELPQIPEELSEEGK  236

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DF+ KCF+KDP++RWTAEMLL HPF+SG+D   TV L +           S SPR PFDF
Sbjct  237   DFVSKCFVKDPKQRWTAEMLLKHPFVSGDDH--TVLLDDKAE-------LSASPRGPFDF  287

Query  1042  PDWVS------------------ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWS  1167
             PDWVS                  +S+   SS  S  P       ADRL+ + + ++PNWS
Sbjct  288   PDWVSIASSEISPQFGDFSGKNLDSEFDWSSRKSFVP------AADRLRQLATEETPNWS  341

Query  1168  QDSDEWVNV  1194
                D WV  
Sbjct  342   FSVD-WVTT  349



>ref|XP_006411921.1| hypothetical protein EUTSA_v10027234mg [Eutrema salsugineum]
 gb|ESQ53374.1| hypothetical protein EUTSA_v10027234mg [Eutrema salsugineum]
Length=358

 Score =   316 bits (810),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 173/362 (48%), Positives = 241/362 (67%), Gaps = 18/362 (5%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+W+R ET+G GSF  VSLA   + G +   P  M VKS G  C  +L NE+ VLD+L  
Sbjct  1     MEWIRRETIGHGSFSTVSLAT--TSGSSTRFPALMAVKSSGVVCSAALRNERDVLDDLGE  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG+G + ENGE++YN+ LE+AS G L  +IKKS    L E ++RR+++++++G
Sbjct  59    CSEIVRCFGEGKTVENGEEIYNLFLEYASGGNLGARIKKS-GEALPEYDVRRFTRSIVKG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG--GKNLGCELRGTPMYMSPEM  684
             L +IH  G+ HCD+KL+NIL+  +G+ KI+DFGLAKR G  G+ +   +RGTP+YM+PE 
Sbjct  118   LCHIHANGFSHCDVKLENILVFGDGDAKISDFGLAKRRGEFGEEIRVNIRGTPLYMAPES  177

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE----VAELLMRIGVGEEIPEIPGKLSD  852
             VN GE    ADIWALGC+V EM+ G  AW   E    V  L++RIG GEE+P IP  LS+
Sbjct  178   VNHGEFESPADIWALGCSVVEMSSGKTAWCLEEGITNVMSLMVRIGSGEEVPRIPVGLSE  237

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGE-DDGATVSLRNDTHREasapapspspRC  1029
             +GKDF+ KCF+K+P +RWTA+MLL+HPF++ + D+ ++ S  + + R       S SPR 
Sbjct  238   EGKDFVRKCFVKNPAERWTAQMLLDHPFLAVDGDETSSTSTSSGSLRYGEEDEASVSPRD  297

Query  1030  PFDFPDWVSESDHLQSSITSLPP----PESEY--SPADRLQGIVSHQSPNWSQDSDEWVN  1191
             PFDFPDW S    +  S+T   P    P S    SP +R+ G+V+  +P+WS   D WVN
Sbjct  298   PFDFPDWNSVQSPVNDSVTVGSPVYYSPFSFLVRSPEERISGLVTENAPDWSVSCD-WVN  356

Query  1192  VR  1197
             VR
Sbjct  357   VR  358



>ref|XP_003524649.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=341

 Score =   316 bits (809),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 179/360 (50%), Positives = 232/360 (64%), Gaps = 31/360 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDEL-R  327
             MDWVRG+ +GRGSF  VSLA+P ++      P +  VKS  A     L NEK VLD L  
Sbjct  1     MDWVRGDALGRGSFATVSLAIPTTN--PNQFPSLTAVKSAEAQTSCWLRNEKHVLDRLGS  58

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
                 +IRCFGD  SFENG + YN+ LE+A+ G+LAD++K  +  ++SE E R Y++A++ 
Sbjct  59    SSPRIIRCFGDDCSFENGVEYYNLFLEYAAGGSLADELKNHDG-QISEHEAREYTRAIVE  117

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMV  687
             GL ++HK G+VHCDIKLQNIL+  +G +KIADFGLA+  G K    E RGTPM+MSPE  
Sbjct  118   GLSHVHKSGFVHCDIKLQNILVFGDGGIKIADFGLAREAGQKQEKSECRGTPMFMSPEQA  177

Query  688   NGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVA---ELLMRIGVGEEIPEIPGKLSDDG  858
              GGE    ADIWALGC + EM  G PAW+  + A    LL+RIGVGEE+PEIP  LS+DG
Sbjct  178   TGGECESPADIWALGCTIVEMVTGKPAWQVEKGASMWSLLLRIGVGEEVPEIPNNLSEDG  237

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFD  1038
             KDF+EKCFIKDP+KRW+AEMLL HPF+   +DG TV  +              SPR  FD
Sbjct  238   KDFIEKCFIKDPKKRWSAEMLLKHPFLI--NDG-TVPFKR----------VHESPRSHFD  284

Query  1039  FPDWVSESDHLQSSITSLPPPESEY-------SPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             FPDWVS    + +S+ S P  + ++       SP DRL+ +++   P    +SD W +VR
Sbjct  285   FPDWVSS---VTNSLPSSPEFQDKWDFDDGFCSPEDRLRQLLTVNRPASWSESDGWSSVR  341



>ref|XP_003521050.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
Length=348

 Score =   316 bits (809),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 235/359 (65%), Gaps = 22/359 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRGE++G GSF  V++A+P +      +    VKS        L NEK +LD L   
Sbjct  1     MNWVRGESLGSGSFATVNIAIPTNTSTQFLSS-TAVKSSHVQTSSMLKNEKEILDRLGAS  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               VI CFGD ++ ENGE+ YN+ LE+A+ G+LAD++KK    RL E  +RR +++L+ GL
Sbjct  60    PYVINCFGDDHTVENGEEYYNIFLEYAAGGSLADQVKK-HGGRLPESYVRRCTRSLVEGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  GYVHCD+KLQNIL+ +NG+VKIADFGLAK  G K    E RGTP++MSPE VN 
Sbjct  119   KHIHDNGYVHCDVKLQNILVFQNGDVKIADFGLAKEKGEKPGKLECRGTPLFMSPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKF--SEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
              E    ADIWALGCAV EM  G PAW    S +  LL+RIG GEE+P+IP +LS++GKDF
Sbjct  179   NEYESPADIWALGCAVVEMVTGKPAWDVRGSNIWSLLIRIGAGEELPKIPEELSEEGKDF  238

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L KCF+KDP KRW+AEMLLNHPF++GE    TVS +   +     P+PSPSPR  FD   
Sbjct  239   LLKCFVKDPMKRWSAEMLLNHPFVNGE----TVSFQK-VNEPLPLPSPSPSPRTHFDLTH  293

Query  1048  WVSESDHLQSSITSLPPPE--------SEYSPADRLQGIVSHQSP-NWSQDSDEWVNVR  1197
             W S    L +S+ S P  +        S  SP +RL+ +V+ Q+P NWS+ SD W ++R
Sbjct  294   WAST---LTASLPSSPDSDEWRMWEFGSSCSPENRLRRLVTVQTPANWSE-SDGWTSIR  348



>ref|XP_006282279.1| hypothetical protein CARUB_v10028563mg [Capsella rubella]
 gb|EOA15177.1| hypothetical protein CARUB_v10028563mg [Capsella rubella]
Length=343

 Score =   315 bits (808),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 171/362 (47%), Positives = 230/362 (64%), Gaps = 33/362 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDEL-RG  330
             M+W+RGET+G G+F  VSLA P ++      P M VKS  +    SL+NEK+VLD+L   
Sbjct  1     MEWIRGETIGFGTFSTVSLASPSNNDSGEFPPLMAVKSADSYGAASLVNEKSVLDKLGDK  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFGD  + ENGE+++N+ LE+AS+G+L   IK      L E  +R ++ ++LRG
Sbjct  61    CDEIVRCFGDDRTVENGEEMHNLFLEYASRGSLESYIKSLGGEGLPESTVRLHTGSVLRG  120

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG---GKNLGCELRGTPMYMSPE  681
             L +IH  G  HCD+KL NILL  +G VKIADFGLAKR G     + G ++RGTP+YM+PE
Sbjct  121   LRHIHANGVAHCDLKLGNILLFGDGAVKIADFGLAKRIGEVTALDEGVQIRGTPLYMAPE  180

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSD  852
              VN  E G   D+WALGCAV EM  G  AW F E      LL+RIGVGEE+P IP KLS+
Sbjct  181   AVNDNEYGSEGDVWALGCAVVEMFSGKTAWSFKEGSNFMSLLIRIGVGEELPMIPEKLSE  240

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGE-------DDGATVSLRNDTHREasapap  1011
              G+DFL KCF+KDP+KRWTAEMLL+HPF++ +       ++G  ++L+ +          
Sbjct  241   QGRDFLSKCFVKDPKKRWTAEMLLHHPFVAVDLDHDGLVEEGLVLNLKTE--------EV  292

Query  1012  spspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVN  1191
             S SPRCPF+FPDWVS S   Q+            S  DR+  + +   P+WS  ++ W+ 
Sbjct  293   STSPRCPFEFPDWVSVSSGSQTI----------DSAEDRVASLATDSIPDWSV-TNSWIT  341

Query  1192  VR  1197
             VR
Sbjct  342   VR  343



>ref|XP_010444696.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Camelina sativa]
Length=347

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 228/358 (64%), Gaps = 21/358 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+W+RGET+G G+F  VSLA   S+  +G  P  M VKS  +    SL NEKAVLD+L  
Sbjct  1     MEWIRGETIGYGTFSTVSLASSPSNNGSGEFPTFMAVKSADSYGAASLANEKAVLDKLGD  60

Query  331   -CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C E++RCFGD  + ENGE+++N+ LE+AS+G+L   +KK     L E  +RR++ ++LR
Sbjct  61    ECDEIVRCFGDDRTVENGEEMHNLFLEYASRGSLESYLKKLGGEGLPESTVRRHTGSVLR  120

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG---GKNLGCELRGTPMYMSP  678
             GL +IH  G+ HCD+KL NILL  +G VKIADFGLAKR G     N G ++RGTP+YM+P
Sbjct  121   GLRHIHANGFAHCDLKLGNILLFGDGAVKIADFGLAKRVGEVTALNEGVQIRGTPLYMAP  180

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G   D+WALGCAV EM  G  AW F E      LL+RIGVG+E+P IP +LS
Sbjct  181   EAVNDNEYGSEGDVWALGCAVVEMFSGKTAWSFKEGSNFMSLLIRIGVGDEVPMIPEELS  240

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGATVSLRNDTHREasapapspsp  1023
             + G+DFL KCF+KDP+KRWTAEMLL+HPF++   + DG      +      +    S SP
Sbjct  241   EQGRDFLTKCFVKDPKKRWTAEMLLHHPFVAVDLDHDGLVEEEESFVVNLKTKEEVSTSP  300

Query  1024  RCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             RCPF+FPDW S S   Q+            SP +R+  + +   P+WS  S  WV VR
Sbjct  301   RCPFEFPDWDSVSSGSQTI----------DSPDERVASLAADSIPDWSVTS-SWVTVR  347



>ref|XP_008241469.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3 [Prunus 
mume]
Length=349

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/363 (47%), Positives = 236/363 (65%), Gaps = 31/363 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG+ +GRGSF  +  A P++   +   P M VKS  +    S+ NEK +LD++  C
Sbjct  1     MEWVRGKEIGRGSFATIYTAKPKNPS-SQLPPLMAVKSAESYYSASVENEKLILDQIGSC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++I CFGD  + E+GE+ YN+++E+A+ G LAD++K++   RL+E ++RR++ ++L+GL
Sbjct  60    PQIIPCFGDDRTVEDGEEFYNLMMEYATGGTLADELKRN-GGRLAEADVRRHTNSVLKGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             G++H  G+VHCD+KLQN+L+ +NG  KIADFGLAK+ G      E+RGTP+YM+PE VN 
Sbjct  119   GFVHAKGFVHCDVKLQNVLVFDNGVAKIADFGLAKKAGEAAQKAEVRGTPLYMAPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGKD  864
              E   +AD+WA+GC VAEM  G P W  S    + +LLMRIG G+E+P+IP  L ++GKD
Sbjct  179   NEYESSADVWAVGCLVAEMVSGKPVWDHSPGANIFKLLMRIG-GDELPQIPEDLCEEGKD  237

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FLEKCF+KDPRKRWTAEMLL+HPF+S  D      L  DT        PSPSPR PFDFP
Sbjct  238   FLEKCFVKDPRKRWTAEMLLSHPFVSDYD----AVLLEDTK-------PSPSPRGPFDFP  286

Query  1045  DWVS-ESDHLQSSITSL------------PPPESEYSPADRLQGIVSHQSPNWSQDSDEW  1185
             DWVS  S  + S +                  +S     DRL+ + + ++PNWS   D W
Sbjct  287   DWVSMASSEISSDLGHFFQKNDLNSGFDWSSRQSSIPAEDRLRQLATEETPNWSFSGD-W  345

Query  1186  VNV  1194
             V V
Sbjct  346   VTV  348



>ref|XP_010426575.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Camelina sativa]
Length=343

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 225/356 (63%), Gaps = 21/356 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRG+T+G G+F  VS+A   S   +G  P ++ VKS  +    SL NEK+VLD L  
Sbjct  1     MEWVRGDTIGFGTFSTVSVATNISKD-SGEFPRLIAVKSSDSYGAASLSNEKSVLDSLGD  59

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RC+G+  + ENGEKL+N+LLE+AS+G+LA ++KK     L E  +RR++ ++LRG
Sbjct  60    CPEIVRCYGEERTVENGEKLHNLLLEYASRGSLATQLKKLGGEGLPESTVRRHTGSVLRG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG----KNLGCELRGTPMYMSP  678
             L ++H  G+ HCDIKL NILL  +G VKIADFGLA+R  G       G E+RGTP+YM+P
Sbjct  120   LRHVHAKGFAHCDIKLGNILLFNDGAVKIADFGLARRVDGVLTPSKEGVEIRGTPLYMAP  179

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G AAD+WALGCAV EM  G  AW   E      LL+RIG G E P IP  LS
Sbjct  180   ESVNYNEYGSAADVWALGCAVVEMISGKTAWSVKEGSHFMSLLLRIGAGGESPMIPEFLS  239

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRC  1029
             ++GKDFL KCF+KDP KRWT EMLLNHPF+  + D      R D   +        SP+C
Sbjct  240   EEGKDFLSKCFVKDPEKRWTVEMLLNHPFVDVDCDEH--DQREDYVLKVKEEEAPTSPKC  297

Query  1030  PFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PF+FPDW      L SS +  P      SP  RL  +VS   P+WS + D WV VR
Sbjct  298   PFEFPDW-----ELMSSDSHTPSD----SPVKRLGSLVSESLPDWSVEGD-WVTVR  343



>ref|XP_010484556.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Camelina sativa]
Length=346

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 232/364 (64%), Gaps = 34/364 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+W+RGET+G G+F  VSLA   S+  +G  P  M VKS  +    SL NEK+VLD+L  
Sbjct  1     MEWIRGETIGYGTFSTVSLASSPSNNGSGEFPTFMAVKSADSYGAASLENEKSVLDKLGD  60

Query  331   -CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C E++RCFGD  + ENGE+++N+ LE+AS+G+L   +KK     L E  +RR++ ++LR
Sbjct  61    ECDEIVRCFGDDRTVENGEEMHNLFLEYASRGSLESYLKKLGGEGLPESTVRRHTGSVLR  120

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG---GKNLGCELRGTPMYMSP  678
             GL +IH  G+ HCD+KL NILL  +G VKIADFGLA R G     N G ++RGTP+YM+P
Sbjct  121   GLRHIHANGFAHCDLKLGNILLFGDGAVKIADFGLATRVGEVTTLNEGVQIRGTPLYMAP  180

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G   D+WALGCAV EM  G  AW F E      LL+RIGVG+E+P IP +LS
Sbjct  181   EAVNDNEYGSEGDVWALGCAVVEMFSGKTAWSFKEGSNFMSLLIRIGVGDEVPMIPEELS  240

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS--------GEDDGATVSLRNDTHREasap  1005
             + G+DFL KCF+KDP+KRWTAEMLL+HPF++         E +G  V+L+ +        
Sbjct  241   EQGRDFLTKCFVKDPKKRWTAEMLLHHPFVAVDLDHDGLVEGEGFVVNLKTEEE------  294

Query  1006  apspspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEW  1185
               S SPRCPF+FPDW+S S   Q             SP +R+  +V+   P+WS  ++ W
Sbjct  295   -VSTSPRCPFEFPDWLSVSSGSQMI----------DSPEERVASLVAGSIPDWSV-TNSW  342

Query  1186  VNVR  1197
             V VR
Sbjct  343   VTVR  346



>gb|KCW54938.1| hypothetical protein EUGRSUZ_I00911 [Eucalyptus grandis]
Length=378

 Score =   315 bits (807),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 232/383 (61%), Gaps = 40/383 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG+ +G G F  V LA P     +G  P M VKSC A+   SL +E+ VL EL  C
Sbjct  1     MDWVRGKEIGHGGFATVHLAAPAGTCPSGLPPLMAVKSCDAALSSSLRHERRVLRELGDC  60

Query  334   QEVIRCFGDGYSFENG--EKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
               ++RCFGD  + E+G  E+LYNVLLE+A  G+LAD +K S    LSE E+RR+++++L 
Sbjct  61    PRIVRCFGDSLTAEHGGGEELYNVLLEYAGGGSLADSMK-SRGKPLSEPEMRRHARSILE  119

Query  508   GLGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKR------NGGKNLGCELRGTP  663
             GL ++H  G+VHCD+KLQNIL+  +G  EVKIADFGLAKR       GGK  G E RGTP
Sbjct  120   GLEFVHSKGFVHCDVKLQNILVFPDGGDEVKIADFGLAKRAGERLSKGGKRGGVEWRGTP  179

Query  664   MYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEI  834
             MYM+PE VN  E  P +D+WALGCAV EMA G PAW     S    L++RIGVGEEIP+I
Sbjct  180   MYMAPESVNCNEYEPPSDVWALGCAVVEMATGRPAWGSRAESNAYALMIRIGVGEEIPDI  239

Query  835   PGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapaps  1014
             P  LS+ GKDFL KCF K+P+KRWTA MLL HPF++ +       +  D   +       
Sbjct  240   PEGLSEQGKDFLMKCFAKNPKKRWTARMLLKHPFLALDGVNNDEEVVRDCGAD---EFAD  296

Query  1015  pspRCPFDFPDWVS-------------------ESDHLQSSIT---SLPPPESEYSPADR  1128
              SPRC FDFPDWVS                   E D  QS +T   +L       S  DR
Sbjct  297   SSPRCHFDFPDWVSLQLSGTSRESGSGSLSPSSEVDSDQSFVTEHAALEVSVGSSSATDR  356

Query  1129  LQGIVSHQSPNWSQDSDEWVNVR  1197
             +  + S   PNW + S++WV VR
Sbjct  357   IGELASQVRPNW-EHSEDWVTVR  378



>ref|XP_009345960.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Pyrus x bretschneideri]
Length=350

 Score =   314 bits (804),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 236/369 (64%), Gaps = 42/369 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+W+RG+ +GRGSF  +  A P S   +   P +V VK+  +   DSL NEK VLD++  
Sbjct  1     MEWIRGKEIGRGSFATIYTAKPTSP--SSYLPLLVAVKASESGYSDSLKNEKQVLDQIGS  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C ++IRCFG  +S ENGEK YN++LE+AS G LAD++K++   RL E +++R++K++LRG
Sbjct  59    CPQIIRCFGADHSVENGEKFYNLVLEYASGGTLADELKRN-GGRLPEFDVQRHTKSVLRG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KLQN+L+  +G  KIADFGLAK+ G  +   E+RGTP+YM+PE VN
Sbjct  118   LEFIHAKGFVHCDLKLQNVLVFGDGAAKIADFGLAKKAGESDNKVEVRGTPLYMAPESVN  177

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E    +D+WALGC VAEMA G P W  +    + +LLMRIG G+E+P+IP +LS+DGK
Sbjct  178   DNEYESCSDVWALGCLVAEMASGKPVWDHNPGVNMFKLLMRIG-GDELPQIPEELSEDGK  236

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DF+ KCF+KDPR+RWTAEMLL H F+SG+D          T         S SPR PFDF
Sbjct  237   DFVSKCFMKDPRQRWTAEMLLEHAFVSGDD---------HTVLSEEKAQLSASPRGPFDF  287

Query  1042  PDWVS------------------ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWS  1167
             PDWV                   +S+   SS  S  P       ADRL+ + + + PNWS
Sbjct  288   PDWVPVASSEISPQFVDWSGKNLDSEFDWSSRKSFVP------AADRLRQLATEEKPNWS  341

Query  1168  QDSDEWVNV  1194
               S++WV +
Sbjct  342   F-SEDWVTI  349



>ref|XP_006292547.1| hypothetical protein CARUB_v10018782mg [Capsella rubella]
 gb|EOA25445.1| hypothetical protein CARUB_v10018782mg [Capsella rubella]
Length=343

 Score =   313 bits (803),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 230/359 (64%), Gaps = 27/359 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGET+G G+F  VSLA  ++   +G  P ++ VKS  +    SL NEK+VLD L  
Sbjct  1     MEWVRGETIGFGTFSTVSLA--KNTKDSGEFPAVIAVKSADSYGAASLSNEKSVLDSLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RC+G+  + ENGE ++N+LLE+AS+G+LA ++KK     L E  +RRY+ ++LRG
Sbjct  59    CPEIVRCYGEDRTVENGENIHNLLLEYASRGSLATQLKKLGGEGLPETTVRRYTGSVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG----KNLGCELRGTPMYMSP  678
             L +IH  G+ HCD+KL NILL  +G VKIADFGLA+R  G       G E+RGTP+YM+P
Sbjct  119   LRHIHAKGFAHCDVKLGNILLFSDGAVKIADFGLARRVDGVLTPSKEGVEIRGTPLYMAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G  AD+WALGCAV EM  G  AW     S    LL+RIGVGEE+P+IP  LS
Sbjct  179   ESVNFNEYGSKADVWALGCAVVEMFSGKTAWSVNDDSHFMSLLIRIGVGEELPKIPELLS  238

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS---GEDDGATVSLRNDTHREasapapsps  1020
             ++GKDFL KCF+KDP KRWTAEMLL HPF++   G+D       R +   E      + S
Sbjct  239   EEGKDFLSKCFVKDPEKRWTAEMLLEHPFVAVGYGDD-------REEYVLELEEEKVATS  291

Query  1021  pRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             P+CPF+FPDW S S     S T   P +   +P +RL  + S   P+W    D WV VR
Sbjct  292   PKCPFEFPDWESIS---SDSHTQFQPSD---APVERLGSLGSETFPDWFFGGD-WVTVR  343



>ref|XP_002869001.1| hypothetical protein ARALYDRAFT_328051 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45260.1| hypothetical protein ARALYDRAFT_328051 [Arabidopsis lyrata subsp. 
lyrata]
Length=787

 Score =   327 bits (837),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 237/354 (67%), Gaps = 17/354 (5%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+R ET+G GSF  VSLA             M VKS G  C  +L NE+ VLD+L  C
Sbjct  1     MEWIRRETIGHGSFSTVSLATTSGSCSKAFPSLMAVKSSGVVCSGALRNERDVLDDLGDC  60

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E++RCFG+G + ENGE++YN+ LE+AS G LAD+IK S    L E E+RR+++++++GL
Sbjct  61    SEIVRCFGEGRTVENGEEIYNLFLEYASGGNLADRIKNS-GEALPECEVRRFTRSIVKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  GY HCD+KL+N+L+  +G+VKI+DFGLAKR     +G E+RGTP+YM+PE VN 
Sbjct  120   CHIHGNGYSHCDLKLENVLVFGDGDVKISDFGLAKRRSDDEIGVEIRGTPLYMAPESVNH  179

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-----KFSEVAELLMRIGVGEEIPEIPGKLSDDG  858
             GE    ADIWALGC+V EM+ G  AW       + V  L++RIG G+E+P IP +LS++G
Sbjct  180   GEFESPADIWALGCSVVEMSSGKTAWCLEDGVMNNVMSLMVRIGSGDEVPRIPMELSEEG  239

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFD  1038
             KDF+ KCF+K+  +RWTAEMLL+HPF++ +DD +  SLR     E  A + S SPR PFD
Sbjct  240   KDFVRKCFVKNAAERWTAEMLLDHPFLAVDDDKSG-SLR--CGEEDEACSVSVSPRNPFD  296

Query  1039  FPDWVSESDHLQSSIT--SLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNV  1194
             FP W S    +  S+T  SL       SP +R+ G+VS + P+WS+  D WVN+
Sbjct  297   FPGWNSVQSPVNESVTFGSLV-----CSPEERISGLVSEKVPDWSESGD-WVNI  344



>ref|XP_002877738.1| MAPKKK20 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53997.1| MAPKKK20 [Arabidopsis lyrata subsp. lyrata]
Length=342

 Score =   313 bits (801),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 177/362 (49%), Positives = 226/362 (62%), Gaps = 34/362 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGETVG G+F  VS+A       +G  P  M VKS  +    SL  EK+VLD L  
Sbjct  1     MEWVRGETVGFGTFSTVSVATNTRD--SGDFPAIMAVKSSDSYGAASLSKEKSVLDSLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RC+G+  + ENGEK++N+LLE+AS+G+LA  +KK     L E  +RR++ ++LRG
Sbjct  59    CPEIVRCYGEDLTVENGEKMHNLLLEYASRGSLATHVKKLGGEGLPESTVRRHTGSVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG----KNLGCELRGTPMYMSP  678
             L +IH +G+ HCDIKL NILL  +G VKIADFGLA+R  G         E+RGTP+YM+P
Sbjct  119   LRHIHAIGFAHCDIKLGNILLFNDGAVKIADFGLARRVDGDLTPSKKSVEIRGTPLYMAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G AAD+WALGCAV EM  G  AW   E      LL+RIGVG+E+P+IP  LS
Sbjct  179   ESVNENEYGSAADVWALGCAVVEMFSGKTAWSVKEGSHFMSLLIRIGVGDELPKIPEMLS  238

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHRE------asapap  1011
             ++GKDFL KCF+KDP KRWTAEMLLNH F++       V L  D HRE            
Sbjct  239   EEGKDFLLKCFVKDPEKRWTAEMLLNHSFVA-------VDLE-DYHREDFVVKFKEEEKV  290

Query  1012  spspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVN  1191
               SP+CPF+F DW S +    +S+          SP +RL  +VS  SP+WS     WV 
Sbjct  291   LMSPKCPFEFHDWESFTSDSHTSLD---------SPVERLGSLVSGSSPDWSV-GGSWVT  340

Query  1192  VR  1197
             VR
Sbjct  341   VR  342



>ref|XP_009343169.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Pyrus x bretschneideri]
Length=350

 Score =   313 bits (802),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 237/369 (64%), Gaps = 42/369 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+W+RG+ +GRGSF  +  A P S   +   P +V VK+  +   DSL NEK VLD++  
Sbjct  1     MEWIRGKEIGRGSFATLYTAKPTSP--SSYLPLLVAVKASESGYSDSLKNEKQVLDQIGS  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C ++IRCFG  +S ENGEK YN++LE+AS G LAD+++++   RL E +++R++K++LRG
Sbjct  59    CPQIIRCFGADHSVENGEKFYNLVLEYASGGTLADELQRN-GGRLPEFDVQRHTKSVLRG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KLQN+L+  +G  KIADFGLAK+ G  +   E+RGTP+YM+PE VN
Sbjct  118   LEFIHAKGFVHCDLKLQNVLVFGDGAAKIADFGLAKKAGESDNKVEVRGTPLYMAPESVN  177

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E    +D+WALGC VAEMA G P W  +    + +LLMRIG G+E+P+IP +LS+DGK
Sbjct  178   DNEYESCSDVWALGCLVAEMASGKPVWDHNPGVNMFKLLMRIG-GDELPQIPEELSEDGK  236

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DF+ KCF+KDPR+RWTAEMLL H F+SG+D          T         S SP+ PFDF
Sbjct  237   DFVSKCFVKDPRQRWTAEMLLEHAFVSGDD---------HTVPSEEKAQLSASPKGPFDF  287

Query  1042  PDWVS------------------ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWS  1167
             PDWVS                  +S+   SS  S  P       ADRL+ + + + PNWS
Sbjct  288   PDWVSVASSEISPQFVDWSGKNLDSEFDWSSRKSFVP------AADRLRQLATEEKPNWS  341

Query  1168  QDSDEWVNV  1194
               S++WV +
Sbjct  342   F-SEDWVTI  349



>ref|XP_006393906.1| hypothetical protein EUTSA_v10004510mg [Eutrema salsugineum]
 gb|ESQ31192.1| hypothetical protein EUTSA_v10004510mg [Eutrema salsugineum]
Length=344

 Score =   313 bits (801),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 172/361 (48%), Positives = 225/361 (62%), Gaps = 30/361 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDEL-RG  330
             M+WVRGET+G G+F  VSLA P ++      P M VKS  +    SL NEK+VLD+L   
Sbjct  1     MEWVRGETIGYGTFSTVSLATPSNNDSGELPPFMAVKSADSYGAASLANEKSVLDKLGDD  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RC G+  + ENGE+++N+ LE+AS+G+LA  +KK     L E  +RR++ ++LRG
Sbjct  61    CDEIVRCLGENRTVENGEEMHNLFLEYASRGSLASNLKKLNGQGLPESTVRRHTGSVLRG  120

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK----RNGGKNLGCELRGTPMYMSP  678
             L +IH  G+ HCD+KL+NILL  +G VKIADFGLA+           G ++RGT +YM+P
Sbjct  121   LRHIHAKGFAHCDLKLENILLFGDGAVKIADFGLARGTEEVTASIGEGVQIRGTLLYMAP  180

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G  AD+WALGCAV EM  G  AW F E      LL+RIGVG+E+P IP  LS
Sbjct  181   ESVNDNEYGSEADVWALGCAVVEMFSGQTAWSFKEGSNFMSLLIRIGVGDELPMIPMDLS  240

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapa-----ps  1014
             + G+DFL KCF+KDP+KRWTAEMLLNHPF++       V L  D   EA A        S
Sbjct  241   EQGRDFLSKCFVKDPKKRWTAEMLLNHPFVA-------VDLDTDGSEEAFAVQPKTEDVS  293

Query  1015  pspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNV  1194
              SPRCPF+FPDWVS S   Q+            S  +R+  + +   P+WS   + WV V
Sbjct  294   TSPRCPFEFPDWVSVSSGSQTQFD---------SAEERVASLATDLIPDWSV-VNNWVTV  343

Query  1195  R  1197
             R
Sbjct  344   R  344



>gb|AGA37216.1| mitogen-activated protein kinase kinase kinase 19.1 [Brassica 
napus]
Length=346

 Score =   313 bits (802),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 224/359 (62%), Gaps = 24/359 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDEL-RG  330
             M+WVRGET+G G+F  VSLA P ++        M VKS  +    SL NEK VLD L   
Sbjct  1     MEWVRGETIGHGTFSTVSLATPTNNAYGAFPQVMAVKSADSHGAASLANEKWVLDILGND  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C  ++RC G+  + ENGE+++N+ LE+AS+G+LA  +KK     L E  +RR++ ++LRG
Sbjct  61    CDGLVRCLGEDRTVENGEEMHNLFLEYASRGSLASHLKKLNGEGLPESTVRRHTGSVLRG  120

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNL----GCELRGTPMYMSP  678
             L +IH  G+ HCD+KL NILL  +G VKIADFGLAKR G        G ++RGTP+YM+P
Sbjct  121   LRHIHAKGFAHCDLKLGNILLFGDGAVKIADFGLAKRAGEVTALMDGGVQIRGTPLYMAP  180

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G  AD+WALGCAV EM  G  AW F E      LL+RIGVG+E+P IP  LS
Sbjct  181   ESVNDNEYGSEADVWALGCAVVEMFSGKTAWSFKEGSHFMSLLIRIGVGDELPRIPEDLS  240

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS---GEDDGATVSLRNDTHREasapapsps  1020
             + G+DFL KCF+KDP+KRWTAEMLLNHPF++    +DD   V ++  T           S
Sbjct  241   EQGRDFLSKCFVKDPKKRWTAEMLLNHPFVAVDLDQDDLEGVDIQLKTEE------VFAS  294

Query  1021  pRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PRCPF+F  WVS S    +   +L  PE      +R+  + +   P+WS  ++ WV VR
Sbjct  295   PRCPFEFSSWVSASCDSGTQYHTLEAPE------ERVATLAAGSIPDWSV-TNNWVTVR  346



>ref|XP_007155919.1| hypothetical protein PHAVU_003G243300g [Phaseolus vulgaris]
 gb|ESW27913.1| hypothetical protein PHAVU_003G243300g [Phaseolus vulgaris]
Length=344

 Score =   313 bits (801),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 184/364 (51%), Positives = 233/364 (64%), Gaps = 36/364 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCG--ASCFDSLLNEKAVLDEL  324
             MDWVRG+ VG+GSF  VSL +P ++  +   P +  VKS     SC+  L NEK VLD L
Sbjct  1     MDWVRGDAVGQGSFATVSLVIPTNN--SSQFPSLTAVKSSQPLTSCW--LRNEKHVLDRL  56

Query  325   RGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
               C  +IRCFGD YS ENG + YN+ LE+A+ G+LAD++      R+ E+E+RRY+++++
Sbjct  57    GSCSRIIRCFGDDYSCENGVEYYNLFLEYAAAGSLADEVNNC-GGRIPELEVRRYTRSIV  115

Query  505   RGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG-KNLGCELRGTPMYMSPE  681
              GL ++H+ G+VHCDIKLQNIL+ + GE+KIADFGLAK  G  K    E RGTP++MSPE
Sbjct  116   EGLNHVHQNGFVHCDIKLQNILVFDGGEIKIADFGLAKEAGDRKQRKSECRGTPLFMSPE  175

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSD  852
              V  GE    ADIWALGCAV +M  G PAWK    S +  L++RIGVGEEIPEIP  LS 
Sbjct  176   QVIDGECESPADIWALGCAVVQMVTGKPAWKVEKGSSMWSLMLRIGVGEEIPEIPENLSK  235

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
             +GKDF+EKCF+KDPR RW+AEMLL HPF+S  DD  TVS +              SPR  
Sbjct  236   EGKDFIEKCFVKDPRMRWSAEMLLKHPFVS--DD--TVSFKR----------VHESPRSH  281

Query  1033  FDFPDWVSESDHLQSSITSLPPP--------ESEYSPADRLQGIVSHQSP-NWSQDSDEW  1185
             FDFPDWVS +     S      P        E   +P DRL+ I +   P NWS+ SD W
Sbjct  282   FDFPDWVSSATSSLPSSPESQSPWNFDESRLEGFCAPEDRLRRISTVNRPANWSE-SDGW  340

Query  1186  VNVR  1197
              +VR
Sbjct  341   SSVR  344



>ref|XP_010515391.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Camelina sativa]
Length=344

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 228/358 (64%), Gaps = 24/358 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRG+T+G G+F  VS+A  R    +G  P ++ VKS  +    SL NEK+VLD L  
Sbjct  1     MEWVRGDTIGFGTFSTVSVATNRKD--SGEFPRVIAVKSSDSYGSASLSNEKSVLDSLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RC+GD  + ENGEKL+N+LLE+AS+G+LA ++KK     L E  +RR++ ++LRG
Sbjct  59    CPEIVRCYGDDRTVENGEKLHNLLLEYASRGSLATQLKKLGGEGLPESTVRRHTGSVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG----KNLGCELRGTPMYMSP  678
             L ++H  G+ HCDIKL NILL  +G VKIADFGLA+R  G       G E+RGTP+YM+P
Sbjct  119   LRHVHAKGFAHCDIKLGNILLFNDGAVKIADFGLARRVDGVLTPSKEGVEIRGTPLYMAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G AAD+WALGCAV EM  G  AW   E   V  LL+RIG   E+P+IP  LS
Sbjct  179   ESVNYNEYGSAADVWALGCAVVEMISGKTAWSVKEGSHVMSLLIRIGADGELPKIPEFLS  238

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRC  1029
             ++GKDFL KCF+KDP KRWTAEMLL+HPF+  + D      R D   +        SP+C
Sbjct  239   EEGKDFLSKCFVKDPEKRWTAEMLLSHPFV--DVDCEEHDQREDYVLKVKEEEAPTSPKC  296

Query  1030  PFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVS--HQSPNWSQDSDEWVNVR  1197
             PF+FPDW S      SS +  P      SP  RL  +VS     P+WS + D WV VR
Sbjct  297   PFEFPDWES-----MSSDSHTPSD----SPVKRLGSLVSECESFPDWSVEGD-WVTVR  344



>ref|XP_008338323.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Malus domestica]
 ref|XP_008352507.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Malus domestica]
Length=350

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 233/369 (63%), Gaps = 42/369 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCF-DSLLNEKAVLDELRG  330
             M+W+RG+ +GRGSF  +  A  +S   +   PP+V      S + DSL NEK VLD++  
Sbjct  1     MEWIRGKEIGRGSFATIYTA--KSTSPSSHLPPLVAXKASESGYSDSLKNEKQVLDQIGS  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C ++IRCFG  +S ENGEK YN++LE+AS G LAD++K++   RL E +++R++K++LRG
Sbjct  59    CPQIIRCFGADHSVENGEKFYNLVLEYASGGTLADELKRN-GGRLPEFDVQRHTKSVLRG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KLQN+L+  +G  KIADFGLAK  G  +   E+RGTP+YM+PE VN
Sbjct  118   LEFIHXKGFVHCDLKLQNVLVFADGAAKIADFGLAKXAGESDNKVEVRGTPLYMAPESVN  177

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E    +D+WALGC VAEMA G P W  +    + +LLM I  G+E+P+IP +LS+DGK
Sbjct  178   DNEYESCSDVWALGCLVAEMASGKPVWDHNPGVNMFKLLMXI-XGDELPQIPEELSEDGK  236

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DF+ KCF+KDPR+RWTAEMLL H F+SG+D          T         S SPR PFDF
Sbjct  237   DFVSKCFVKDPRQRWTAEMLLEHAFVSGDD---------HTVLSEEKAQLSASPRGPFDF  287

Query  1042  PDWVSESDHLQSSITSLPPPESEYS------------------PADRLQGIVSHQSPNWS  1167
             PDWVS +       + + P   E+S                   ADRL+ + + + PNWS
Sbjct  288   PDWVSVAS------SEISPQFVEWSGKNLDSEFDWSXRKSFVPAADRLRQLATEEKPNWS  341

Query  1168  QDSDEWVNV  1194
               S++WV +
Sbjct  342   F-SEDWVTI  349



>emb|CDY12801.1| BnaC07g16320D [Brassica napus]
Length=346

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 224/359 (62%), Gaps = 24/359 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDEL-RG  330
             M+WVRGET+G G+F  VSLA P ++        M VKS  +    SL NEK VLD L   
Sbjct  1     MEWVRGETIGHGTFSTVSLATPTNNAYGAFPQVMAVKSADSHGAASLANEKWVLDILGND  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C  ++RC G+  + ENGE+++N+ LE+AS+G+LA  +KK     L E  +RR++ ++LRG
Sbjct  61    CDGLVRCLGEDRTVENGEEMHNLFLEYASRGSLASHLKKLNGEGLPESTVRRHTGSVLRG  120

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNL----GCELRGTPMYMSP  678
             L +IH  G+ HCD+KL NILL  +G VKIADFGLAKR G        G ++RGTP+YM+P
Sbjct  121   LRHIHAKGFAHCDLKLGNILLFGDGAVKIADFGLAKRAGEVTALMDGGVQIRGTPLYMAP  180

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G  AD+WALGCAV EM  G  AW F E      LL+RIGVG+E+P IP  LS
Sbjct  181   ESVNDNEYGSEADVWALGCAVVEMFSGKTAWSFKEGSHFMSLLIRIGVGDELPRIPEDLS  240

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS---GEDDGATVSLRNDTHREasapapsps  1020
             + G+DFL KCF+KDP+KRWTAEMLLNHPF++    +DD   V ++  T           S
Sbjct  241   EQGRDFLSKCFVKDPKKRWTAEMLLNHPFVAVDLDQDDLEGVDIQLKTEE------VFAS  294

Query  1021  pRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PRCPF+F  WVS S    +   +L  PE      +R+  + +   P+WS  ++ WV VR
Sbjct  295   PRCPFEFSSWVSASCDSGTQYHTLEAPE------ERVATLAAGSIPDWSV-TNNWVIVR  346



>gb|KFK34285.1| hypothetical protein AALP_AA5G125300 [Arabis alpina]
Length=341

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 224/356 (63%), Gaps = 23/356 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGET+G G+F  VS A P +       P ++ VKS  +    SL NEK+VLD L  
Sbjct  1     MEWVRGETIGHGTFSVVSKATPSN---TSDFPALIAVKSSDSYGAASLSNEKSVLDSLGD  57

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C+E++RC+G   + ENGEKL N+LLE+AS G+LA ++KK     L E  +RR++K++L+G
Sbjct  58    CREIVRCYGADQTVENGEKLDNLLLEYASSGSLATQLKKLNGEGLPESVVRRHTKSVLQG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG----KNLGCELRGTPMYMSP  678
             L +IH  G+ HCDIKL NILL  +G VKIADFGLA++  G       G E+RGTP+YM+P
Sbjct  118   LRHIHSNGFAHCDIKLGNILLFGDGSVKIADFGLARKINGDLTASKEGVEIRGTPLYMAP  177

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G A D+WA GCAV EM  G  AW F E      LL+RIGV EE+PEIP +LS
Sbjct  178   ESVNYNEYGTAVDVWAFGCAVVEMFSGKTAWSFKEGSNFMSLLIRIGVSEELPEIPVELS  237

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRC  1029
             +DGKDFL KCF+KD  +RWTAEMLLNH F++ + +     +     +E        SPRC
Sbjct  238   EDGKDFLSKCFVKDHERRWTAEMLLNHSFVAVDLEREDFDVTVKGEKE-----VLASPRC  292

Query  1030  PFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             PF+F DW  ES     S T   P +   SP +R + +V    P+WS  +  WV VR
Sbjct  293   PFEFSDW--ESISSSDSQTKYQPLD---SPVERFESLVCESFPDWSVVN--WVTVR  341



>ref|XP_010446694.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Camelina sativa]
Length=351

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 174/360 (48%), Positives = 238/360 (66%), Gaps = 21/360 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+W+R ET+G GSF  VSLA           PP++ VKS G     SL+NE+ VLD    
Sbjct  1     MEWIRRETIGHGSFSTVSLATTSGSSTTTLFPPLIAVKSSGVVSSASLMNERHVLDHHGD  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG+G + ENGE++YN+ LE+AS G LAD+IKKS    L E E+RR+++++++G
Sbjct  61    CSEIVRCFGEGKTVENGEEVYNLFLEYASGGNLADRIKKS-GEALPEFEVRRFTRSIVKG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR---NGGKNLGCELRGTPMYMSPE  681
             L +IHK G+ HCD+KL+N+L+ ++  VKI+DFGLAKR   + G   G E+RGTP+YM+PE
Sbjct  120   LCHIHKNGFSHCDLKLENVLVFDD-HVKISDFGLAKRLSSSDGVGGGVEIRGTPLYMAPE  178

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE----VAELLMRIGVGEEIPEIPGKLS  849
              VN GE    ADIWALGC+V EM+ G  AW   E    V  L++RIG+G+E+P IP +LS
Sbjct  179   CVNYGEFESPADIWALGCSVVEMSSGKTAWCLDERSDNVMSLMVRIGLGDEVPRIPVELS  238

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATV--SLRNDTHREasapapspsp  1023
             ++GKDF+ KCF+KDP KRWTA+MLL+HPF++ +D   +V  S  +           S SP
Sbjct  239   EEGKDFVSKCFVKDPAKRWTAQMLLDHPFLAVDDGHESVGGSYLSLMRCGEEDEEASVSP  298

Query  1024  RCPFDFPDWVSESDHLQSSI--TSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             R PFDFP W S    +  S+  +SL       SP +R+ G+VS + P+WS   D WVNVR
Sbjct  299   RNPFDFPGWNSVQSPVNESVRFSSLVK-----SPEERISGLVS-EMPDWSVSCD-WVNVR  351



>gb|AAM63486.1| protein kinase-like protein [Arabidopsis thaliana]
Length=342

 Score =   310 bits (795),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 227/362 (63%), Gaps = 34/362 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGET+G G+F  VS A    +  +G  P ++ VKS G+    SL NEK+VLD LR 
Sbjct  1     MEWVRGETIGFGTFSTVSTATKSRN--SGDFPALIAVKSTGSYGAASLSNEKSVLDSLRD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E+IRC+G+  + ENGE+++N+ LE+AS+G+LA  +KK     L E  +RRY+ ++LRG
Sbjct  59    CPEIIRCYGEDSTVENGEEMHNLFLEYASRGSLARYMKKLGGEGLPESTVRRYTGSVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGC----ELRGTPMYMSP  678
             L +IH  G+ HCDIKL NILL  +G VKIADFGLA R  G         E+RGTP+YM+P
Sbjct  119   LRHIHAKGFAHCDIKLGNILLFNDGSVKIADFGLAMRVHGDLTALRKSEEIRGTPLYMAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G AAD+WALGCAV EM  G  AW   E      LL+RIGVG+E+P+IP  LS
Sbjct  179   ESVNDNEYGSAADVWALGCAVVEMLSGKTAWSVKEGSHFMSLLIRIGVGDELPKIPEMLS  238

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapaps-----  1014
             ++GKDFL KCF+KD  KRWTAEMLLNH F++       + L +D HRE            
Sbjct  239   EEGKDFLSKCFVKDQAKRWTAEMLLNHSFVA-------IDLEDD-HREDFVVKVKEEDKV  290

Query  1015  -pspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVN  1191
               SP+CPF+F DW S          +L    S  SP +RL  +VS   P+WS   + WV+
Sbjct  291   LMSPKCPFEFDDWDS---------FTLDSNPSLDSPVERLGSLVSGSIPDWSV-GESWVS  340

Query  1192  VR  1197
             VR
Sbjct  341   VR  342



>ref|XP_003539360.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
Length=346

 Score =   310 bits (795),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 234/363 (64%), Gaps = 32/363 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRGE +G GSF  V++A+P +      +    VKS        L NEK +LD L   
Sbjct  1     MNWVRGEPLGSGSFATVNIAIPTNTSTQFLSS-TAVKSSYVHTSSMLKNEKEILDCLGAS  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               VI CFGD ++ ENGE+ YN+ LE+A+ G+LAD++KK    RL E  +RR +++L+ GL
Sbjct  60    PYVINCFGDDHTVENGEEYYNIFLEYAAGGSLADQVKK-HGGRLPESYVRRCTRSLVEGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  GYVHCD+KLQNIL+ +NG+VKIADFGLAK  G K    E RGTP++MSPE VN 
Sbjct  119   KHIHDNGYVHCDVKLQNILVFQNGDVKIADFGLAKEKGEKQGKLECRGTPLFMSPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKF--SEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
              E    ADIWALGCAV EM  G PAW    S +  LL+RIG GEE+P+IP +LS++GKDF
Sbjct  179   NEYESPADIWALGCAVVEMLTGKPAWDVRGSNIWSLLIRIGAGEELPKIPEELSEEGKDF  238

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L KCF+KDP KRW+AEMLLNHPF++GE    TVS +         P PSPSPR  FD   
Sbjct  239   LLKCFVKDPMKRWSAEMLLNHPFVNGE----TVSFQKVNEPL---PLPSPSPRTHFDLTH  291

Query  1048  WVSESDHLQSSITSLPP--PESEY----------SPADRLQGIVSHQSP-NWSQDSDEWV  1188
             W        S++T+L P  P+S+           SP +RL+ +V+ Q+P NWS+ SD W 
Sbjct  292   WA-------STVTALLPSSPDSDEWRMWESGSSCSPENRLRRLVTVQTPANWSE-SDGWT  343

Query  1189  NVR  1197
             +VR
Sbjct  344   SVR  346



>ref|XP_010531244.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Tarenaya hassleriana]
Length=348

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 229/367 (62%), Gaps = 38/367 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+WVR +T+G GSF  VSLA   +   + A PP M VKS G      L NEK VLD L  
Sbjct  1     MEWVRRKTIGHGSFSTVSLATTTAGNSSPALPPVMAVKSSGVVGSAMLRNEKHVLDHLGD  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C +++RCFGD ++ ENGE++YN+ L++AS G+LAD ++KS    L E E+RR+++ +++G
Sbjct  61    CPQIVRCFGDAWTVENGEEIYNLFLDYASGGSLADYVRKS-GGSLPEFEVRRFTRTIVQG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK------RNGGKNLGCELRGTPMYM  672
             L +IH  G+ HCD+KL NIL+  +GE +I+DFGLAK      R+  +    E+RGTP+YM
Sbjct  120   LRHIHANGFSHCDVKLDNILMFGDGEARISDFGLAKKMENETRSTMEETRVEIRGTPLYM  179

Query  673   SPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGK  843
             +PE VN       ADIWALGC+V EMA G  AW   E   +  L  RIG G+E+P IP +
Sbjct  180   APESVNDSVFESPADIWALGCSVVEMASGKTAWCLEEGPNIMSLFFRIGAGDEVPRIPAE  239

Query  844   LSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspsp  1023
             LS++GKDFL+KCF++DP  RWTAEMLL+HPF++ +++ + +S R                
Sbjct  240   LSEEGKDFLQKCFVRDPANRWTAEMLLDHPFVAVDEEKSWISPRG---------------  284

Query  1024  RCPFDFPDWVSESDHLQSSITSLPPP--------ESEYSPADRLQGI-VSHQSPNWSQDS  1176
               PFDFP+W+S    +   +T   P         ES   P +R++GI  + ++P+WS   
Sbjct  285   --PFDFPEWISVQSSVIEPVTVGSPVNDKPFGSWESYSPPGERIRGIFTTEEAPDWSVSC  342

Query  1177  DEWVNVR  1197
             D WVNVR
Sbjct  343   D-WVNVR  348



>emb|CDX69280.1| BnaC01g01730D [Brassica napus]
Length=353

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 173/364 (48%), Positives = 243/364 (67%), Gaps = 21/364 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVR ET+G GSF  V+LA   + G + + PP++ VKS GA C  +L NE+ VLD+L  
Sbjct  1     MEWVRRETIGHGSFSTVTLAT--TSGSSTSFPPLIAVKSSGAVCSAALRNERDVLDDLGH  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG G + ENGE++YN+ LE+AS G L D+IK S    L E+E+RR+++++++G
Sbjct  59    CSEIVRCFGGGTTVENGEEVYNLFLEYASGGNLGDRIKNS-GEGLPELEVRRFTRSIVKG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L ++HK GY HCD+KL+N+L+  +  VKI+DFGLAKR G    G  +RGTP+Y++PE VN
Sbjct  118   LRHVHKNGYSHCDVKLENVLVFGDEGVKISDFGLAKRKGETADG--IRGTPLYLAPEAVN  175

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSE----VAELLMRIGVGEEIPEIPGKLSDDG  858
              GE    AD+WALG  V EM+ G  AW   E    V  L++RIG G ++P+IP +LS++G
Sbjct  176   RGEFESPADVWALGWCVVEMSSGKTAWCLEEGVGNVMSLMVRIGSG-DVPKIPVELSEEG  234

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFIS--GEDDGATVSLRNDTHREasapapspspRCP  1032
             KDF+ +CF+KDP +RWTA+MLL+HPF++   +D+ ++ SLR     E      S SPR P
Sbjct  235   KDFVRRCFVKDPVERWTAQMLLDHPFLAVDHDDERSSGSLRCGDEDE-----ASVSPRDP  289

Query  1033  FDFPDWVSESDHLQ--SSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR*CQ  1206
             FDFPDW S +D +   S +   P       P +R+ G+VS   P+WS   D WVNVR  +
Sbjct  290   FDFPDWNSVNDSVTVCSPVNYSPFSYLVRLPEERISGLVSGNVPDWSVSCD-WVNVREVK  348

Query  1207  MSTV  1218
              STV
Sbjct  349   GSTV  352



>ref|NP_190600.1| mitogen-activated protein kinase kinase kinase 20 [Arabidopsis 
thaliana]
 emb|CAB62310.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78651.1| mitogen-activated protein kinase kinase kinase 20 [Arabidopsis 
thaliana]
Length=342

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 225/362 (62%), Gaps = 34/362 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGET+G G+F  VS A    +  +G  P ++ VKS  A    SL NEK+VLD L  
Sbjct  1     MEWVRGETIGFGTFSTVSTATKSRN--SGDFPALIAVKSTDAYGAASLSNEKSVLDSLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E+IRC+G+  + ENGE+++N+LLE+AS+G+LA  +KK     L E  +RR++ ++LRG
Sbjct  59    CPEIIRCYGEDSTVENGEEMHNLLLEYASRGSLASYMKKLGGEGLPESTVRRHTGSVLRG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK----NLGCELRGTPMYMSP  678
             L +IH  G+ HCDIKL NILL  +G VKIADFGLA R  G         E+RGTP+YM+P
Sbjct  119   LRHIHAKGFAHCDIKLANILLFNDGSVKIADFGLAMRVDGDLTALRKSVEIRGTPLYMAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
             E VN  E G AAD+WALGCAV EM  G  AW   E      LL+RIGVG+E+P+IP  LS
Sbjct  179   ECVNDNEYGSAADVWALGCAVVEMFSGKTAWSVKEGSHFMSLLIRIGVGDELPKIPEMLS  238

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapaps-----  1014
             ++GKDFL KCF+KDP KRWTAEMLLNH F+       T+ L +D HRE            
Sbjct  239   EEGKDFLSKCFVKDPAKRWTAEMLLNHSFV-------TIDLEDD-HRENFVVKVKDEDKV  290

Query  1015  -pspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVN  1191
               SP+CPF+F DW S          +L    S  SP +RL  +VS   P+WS     W+ 
Sbjct  291   LMSPKCPFEFDDWDS---------FTLDSNPSFDSPVERLGSLVSGSIPDWSV-GGSWLT  340

Query  1192  VR  1197
             VR
Sbjct  341   VR  342



>ref|XP_004511921.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cicer arietinum]
Length=365

 Score =   309 bits (791),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 174/372 (47%), Positives = 236/372 (63%), Gaps = 33/372 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG ++G G+F  V LA+   H +   +    VKS       SLLNEK +LD L   
Sbjct  1     MNWVRGHSLGSGTFATVDLAIHTQHSVNFPSL-TAVKSTYLYNSYSLLNEKHILDRLGSS  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENH--RLSEMEIRRYSKALLR  507
               +++CFG   + ENG   YN+ LE+A+ G L+D++K   NH  +  E  +RRY++++++
Sbjct  60    PFIVKCFGHDQTLENGVNFYNIFLEYAAGGTLSDQLK---NHGGKFPETLVRRYTRSIVK  116

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN-LGCELRGTPMYMSPEM  684
             GL +IH+ G+VHCD+KLQNIL+ +N  VKI+DFGL+K+ G K     ELRGTPM+MSPE 
Sbjct  117   GLKHIHENGFVHCDVKLQNILVFDNDNVKISDFGLSKKKGLKQGEKWELRGTPMFMSPES  176

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDD  855
             VN       ADIWALGC V EM  G PAW  S+   +  LL+RIG+GEE+P IP +LSD+
Sbjct  177   VNDNVYESPADIWALGCTVMEMVTGEPAWNMSDNENIWLLLVRIGIGEELPLIPDELSDE  236

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREa----------sap  1005
             GKDFLEKCF+KDP KRW+AEMLL HPFI  EDD    SL  D                + 
Sbjct  237   GKDFLEKCFVKDPLKRWSAEMLLKHPFI-FEDDETISSLETDVSNNERVLLEKELLDKSL  295

Query  1006  apspspRCPFDFPDWVSESDHLQSSITSLPP--PESEY-----SPADRLQGIVSHQSP-N  1161
             + SPSP   FDFP W+S S    ++++++PP   ES++     SP +RL+ +V+ Q P +
Sbjct  296   SLSPSPTTQFDFPQWISSS---VTTVSTMPPNLNESKFKHGFASPEERLRLLVTEQRPLD  352

Query  1162  WSQDSDEWVNVR  1197
             WS+ SDEW  VR
Sbjct  353   WSE-SDEWHFVR  363



>emb|CDY01441.1| BnaA07g12140D [Brassica napus]
Length=346

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 229/360 (64%), Gaps = 26/360 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDEL-R  327
             M+WVRGET+G G+F  V+LA P ++ + GA P  M VKS  +    SL NEK VLD L  
Sbjct  1     MEWVRGETIGYGTFSTVTLATP-ANNVPGAFPQVMAVKSADSHGAASLANEKWVLDTLGD  59

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C E++RC G+  + ENGE+++N+ LEFAS+G+LA  +KK     L E  +RR++ ++LR
Sbjct  60    DCDEIVRCLGEDRTVENGEEMHNLFLEFASRGSLASHLKKLNGEGLPESTVRRHTGSVLR  119

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG----GKNLGCELRGTPMYMS  675
             GL YIH  G+ HCD+KL NILL  +G VKIADFGLAKR G      + G ++RGTP+YM+
Sbjct  120   GLRYIHAKGFAHCDLKLGNILLFGDGAVKIADFGLAKRAGEVTASVDGGVQIRGTPLYMA  179

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKL  846
             PE VN  E G  AD+WALGCAV EM  G  AW F E      LL+RIGVG+E+P IP  L
Sbjct  180   PESVNDNEYGSEADVWALGCAVVEMFSGKTAWSFKEGSHFMSLLIRIGVGDELPRIPEDL  239

Query  847   SDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS---GEDDGATVSLRNDTHREasapapsp  1017
             S+ G+DFL KCF+KDP+KRWTAEMLLNHPF++     DD   V ++  T           
Sbjct  240   SEQGRDFLTKCFVKDPKKRWTAEMLLNHPFVAVDLDHDDFEEVDIQLKTEE------VFA  293

Query  1018  spRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             SPRCPF+F  WVS S    +   +L  PE      +R+  + +   P+WS  ++ WV VR
Sbjct  294   SPRCPFEFSSWVSASSDSGTQCHTLEAPE------ERVSTLAADSIPDWSV-TNNWVIVR  346



>ref|XP_004173609.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Cucumis sativus]
 gb|KGN48531.1| hypothetical protein Csa_6G490950 [Cucumis sativus]
Length=350

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 181/364 (50%), Positives = 228/364 (63%), Gaps = 30/364 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDEL-R  327
             MDWVRG+ +G GSF  ++LA   S       PP M VKS G  C  SL NEK VLD L  
Sbjct  1     MDWVRGDEIGYGSFATINLATSCS---GDRFPPLMAVKSSGLVCSASLKNEKQVLDLLGD  57

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C ++IRCFGD  S ENGE+LYN+ LE+AS G+LAD+I+ S   RL E E+RRY++ +L 
Sbjct  58    DCPQIIRCFGDSCSVENGEELYNLFLEYASGGSLADRIQ-SRGGRLPEFEVRRYTRTILE  116

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGC-------ELRGTPM  666
             GL YIH  G+VHCD+K +NIL+  +G+ KIADFGL+K+ G   +G        +LRG+P+
Sbjct  117   GLRYIHGKGFVHCDVKPRNILVFGDGDAKIADFGLSKKAGKNRVGTGEETGKFQLRGSPL  176

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIP  837
             YMSPE VN  E     DIWA+GCAV EM  G PAW     S V  LL++IG+GEE+PEIP
Sbjct  177   YMSPESVNDNEYESPCDIWAVGCAVVEMLTGKPAWNCRPESNVFALLIKIGIGEELPEIP  236

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
               LS++GKDFL+KC +KDP KRWTA+MLL HPF++  + G  V L       A     S 
Sbjct  237   KDLSEEGKDFLKKCLVKDPLKRWTADMLLKHPFVA--ESGRCVPL-------AGVEEVST  287

Query  1018  spRCPFDFPDWVS----ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEW  1185
             SPRCPFDF DW S    ESD       +        SP +RL  +V + +  WS  +D W
Sbjct  288   SPRCPFDFEDWASIHSQESDPRNEEEANCWLNNWSCSPRERLLELVGNGAVEWSV-TDNW  346

Query  1186  VNVR  1197
             V VR
Sbjct  347   VRVR  350



>gb|KHN08178.1| Mitogen-activated protein kinase kinase kinase 3 [Glycine soja]
Length=344

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/359 (50%), Positives = 230/359 (64%), Gaps = 26/359 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRGE++G GSF  +          + A     VKS        L NEK +LD L   
Sbjct  1     MNWVRGESLGSGSFATIPTNTSTQFLSSTA-----VKSSYVHTSSMLKNEKEILDRLGAS  55

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               VI CFGD ++ ENGE+ YN+ LE+A+ G+LAD++KK    RL E  +RR +++L+ GL
Sbjct  56    PYVINCFGDDHTVENGEEYYNIFLEYAAGGSLADQVKK-HGGRLPESYVRRCTRSLVEGL  114

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  GYVHCD+KLQNIL+ +NG+VKIADFGLAK  G K    E RGTP++MSPE VN 
Sbjct  115   KHIHDNGYVHCDVKLQNILVFQNGDVKIADFGLAKEKGEKPGKLECRGTPLFMSPESVND  174

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKF--SEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
              E    ADIWALGCAV EM  G PAW    S +  LL+RIG GEE+P+IP +LS++GKDF
Sbjct  175   NEYESPADIWALGCAVVEMVTGKPAWDVRGSNIWSLLIRIGAGEELPKIPEELSEEGKDF  234

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L KCF+KDP KRW+AEMLLNHPF++GE    TVS +   +     P+PSPSPR  FD   
Sbjct  235   LLKCFVKDPMKRWSAEMLLNHPFVNGE----TVSFQK-VNEPLPLPSPSPSPRTHFDLTH  289

Query  1048  WVSESDHLQSSITSLPPPE--------SEYSPADRLQGIVSHQSP-NWSQDSDEWVNVR  1197
             W S    L +S+ S P  +        S  SP +RL+ +V+ Q+P NWS+ SD W ++R
Sbjct  290   WAST---LTASLPSSPDSDEWRMWEFGSSCSPENRLRRLVTVQTPANWSE-SDGWTSIR  344



>ref|XP_002523600.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF38795.1| ATP binding protein, putative [Ricinus communis]
Length=358

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 234/366 (64%), Gaps = 26/366 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLL--NEKAVLDELR  327
             MDWVRG ++G GSF  V+LA+PR+      A  M VKSC    FDS+   NEK VLD+L 
Sbjct  1     MDWVRGNSIGHGSFSTVNLAIPRNDS---GASLMAVKSCDV--FDSVFLENEKDVLDQLG  55

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C+ +IRCFG   S ENG +L N+LLE+A+ G+LA  +K +    L E ++R Y++++L+
Sbjct  56    DCEHIIRCFGSEESVENGHRLSNLLLEYAAGGSLAHWVKNN-GGCLRESDVRHYTRSVLK  114

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMV  687
             GL YIH  G+ HCD+KLQN+LL E+GE+KIADFGLAK+ G K  G ++RGTP+ M+PE V
Sbjct  115   GLSYIHAKGFAHCDLKLQNLLLFEDGELKIADFGLAKKVGQKLEGVQVRGTPLCMAPESV  174

Query  688   NGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDG  858
             N  E     DIWALGCAV EM  G PAW     + +A LL++IGV +E+PEIP +LS++G
Sbjct  175   NENEYDSPCDIWALGCAVVEMITGKPAWNCRADANIAALLIKIGVSDELPEIPQELSNEG  234

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFD  1038
             KDFL KCF+KDP++RWTA+MLL+H F++   D    S    T +      PS SPRCPF+
Sbjct  235   KDFLSKCFVKDPQRRWTADMLLDHSFVADHYDDEFNSTTTVTFKN-KKEVPSSSPRCPFE  293

Query  1039  FPDW-----------VSESDHLQSSIT-SLPPPESEYSPADRLQGIVS-HQSPNWSQDSD  1179
             F +W           V     L+S I  S        SP DR+Q + S HQ  NW+  SD
Sbjct  294   FQEWISIPSSSPNSEVWSHRELESRIDWSSLSSTPSSSPVDRIQQLTSDHQGCNWAF-SD  352

Query  1180  EWVNVR  1197
              W+ VR
Sbjct  353   SWITVR  358



>emb|CAB16796.1| MAP3K-like protein kinase [Arabidopsis thaliana]
 emb|CAB80361.1| MAP3K-like protein kinase [Arabidopsis thaliana]
Length=799

 Score =   320 bits (819),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 172/360 (48%), Positives = 233/360 (65%), Gaps = 38/360 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+R ET+G GSF  VSLA             M VKS G  C  +L NE+ VLD+L  C
Sbjct  1     MEWIRRETIGHGSFSTVSLATTSGSSSKAFPSLMAVKSSGVVCSAALRNERDVLDDLGDC  60

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              E++RCFG+G + ENGE++YN+ LE+AS G+LAD+IK S    L E E+RR+++++++GL
Sbjct  61    SEIVRCFGEGRTVENGEEIYNLFLEYASGGSLADRIKSS-GEALPEFEVRRFTRSIVKGL  119

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  G+ HCDIKL+N+L+  +G+VKI+DFGLAKR  G+ +  E+RGTP+YM+PE VN 
Sbjct  120   CHIHGNGFTHCDIKLENVLVFGDGDVKISDFGLAKRRSGE-VCVEIRGTPLYMAPESVNH  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-----KFSEVAELLMRIGVGEEIPEIPGKLSDDG  858
             GE    ADIWALGC+V EM+ G  AW       + V  LL+RIG G+E+P IP +LS++G
Sbjct  179   GEFESPADIWALGCSVVEMSSGKTAWCLEDGVMNNVMSLLVRIGSGDEVPRIPVELSEEG  238

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFI-----SGEDDGA-TVSLRNDTHREasapapsps  1020
             KDF+ KCF+K+  +RWTAEMLL+HPF+     SGE+D A +VS RN              
Sbjct  239   KDFVSKCFVKNAAERWTAEMLLDHPFLAVDDESGEEDEACSVSPRN--------------  284

Query  1021  pRCPFDFPDWVSESDHLQSSIT--SLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNV  1194
                PFDFP W S    +  S+   SL       SP +R+ G+VS + P+WS   D WVNV
Sbjct  285   ---PFDFPGWNSVQSPVNDSVMFGSLVG-----SPEERISGLVSEKVPDWSVSCD-WVNV  335



>ref|XP_010263514.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nelumbo nucifera]
Length=383

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 188/405 (46%), Positives = 238/405 (59%), Gaps = 72/405 (18%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHG---IAGAAPPMVVKSCGASCFDSLLNEKAVLDEL  324
             M+W RG+ VGRGSF  V+LA+P S     +      MVVKS   S   SL  EK +L  L
Sbjct  1     MEWTRGKPVGRGSFATVNLAIPTSDNSLQLVQVPQLMVVKSAVLSESSSLQVEKEILTHL  60

Query  325   RGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
             RGC +++ CFGD  + ENG+++YN+ LE+AS G LAD +KKS    L E ++RRY++++L
Sbjct  61    RGCPQILPCFGDDLTVENGKQIYNIFLEYASGGTLADLLKKSGGSLL-ESDVRRYTRSIL  119

Query  505   RGLGYIHKVGYVHCDIKLQNILLCEN----GEVKIADFGLAK---------RNGGKNLGC  645
             RGL +IH  GYVHCDIKLQNILLC +     E+K+ADFGLAK         R  G   G 
Sbjct  120   RGLRFIHANGYVHCDIKLQNILLCSSPDGSNEIKVADFGLAKKAAPGQEIRRTEGGAFG-  178

Query  646   ELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVG  816
              LRGTP+YMSPE +   E    ADIWALGCAV+EM  G PAWK    ++V+ LL RIG G
Sbjct  179   -LRGTPLYMSPESIAHNEHEAPADIWALGCAVSEMVMGKPAWKCGANTDVSALLFRIGFG  237

Query  817   EEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREa  996
             EE+PEIPG LS +GKDFL KC ++DP +RWTAEMLLNHPF++   D A V    D     
Sbjct  238   EELPEIPGGLSAEGKDFLSKCLVRDPEQRWTAEMLLNHPFVA---DEAVVLCEPDV----  290

Query  997   sapapspspRCPFDFPDWVS------------------------------ESDHLQSSIT  1086
                 PSPSPR PFDFP+W S                              E    + SIT
Sbjct  291   ----PSPSPRSPFDFPEWSSSPRSSISNSESCTSSGASSSSSVLFSTRSEEQLDRRDSIT  346

Query  1087  SLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR*CQMSTVN  1221
             S        S  +R++ +V+ Q  NWS  S  W+ VR  + S+V+
Sbjct  347   S--------SLVNRIRHLVTGQGANWST-SGSWITVREAESSSVS  382



>ref|XP_010093628.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB54389.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=360

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 181/349 (52%), Positives = 231/349 (66%), Gaps = 14/349 (4%)
 Frame = +1

Query  160   WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
             WVRG T+G GSF  +S+A PR    A     M VKS   SC DSL NEK VLD +    +
Sbjct  17    WVRGATIGHGSFATISIATPRKSS-ADIPSLMAVKSSQVSCADSLKNEKRVLDTIGSFPQ  75

Query  340   VIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGY  519
             ++RCFG+  S ENGE+ +N+ +EFAS G+LA++IK S+  RLSE+EIRR+++++L+GL +
Sbjct  76    IVRCFGEEQSVENGEEFHNLFMEFASGGSLANRIK-SQGGRLSELEIRRHARSILKGLSF  134

Query  520   IHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNGGE  699
             IH  G+VHCDIK QNIL+ ++G VKIADFGLAK    +     +RGTP+Y+SPE VN  E
Sbjct  135   IHAKGFVHCDIKPQNILVFDDGAVKIADFGLAKEAKMEQNQYMIRGTPLYVSPESVNDNE  194

Query  700   QGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
                  DIWALGC VAEMA G P     E   V  LL+RIG GEE PEIP ++S++GKDFL
Sbjct  195   YESPCDIWALGCVVAEMATGKPVRDHEEGASVWPLLLRIG-GEEEPEIPSEISEEGKDFL  253

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
              KCF+KDPRKRWTAEMLL H F+  + D    +  NDT         S SPRCPFDFP+W
Sbjct  254   RKCFVKDPRKRWTAEMLLIHAFVLSDYDNGDDA--NDTVLLNGENCVSCSPRCPFDFPEW  311

Query  1051  VSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             VS S+        LP      SPAD+++ +V+ + PNWS  +D WV VR
Sbjct  312   VSTSEP-----EILPESACFPSPADKIRELVTEERPNWSF-ADSWVTVR  354



>ref|XP_010028246.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Eucalyptus grandis]
Length=375

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 180/380 (47%), Positives = 231/380 (61%), Gaps = 37/380 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG+ +G G F  + LA P     +G  P M VKSC  +   SL +E+ VL EL  C
Sbjct  1     MDWVRGKEIGHGGFATIHLATPAETCPSGLPPLMAVKSCDEALSSSLRHERRVLSELGEC  60

Query  334   QEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               ++RCFG   + E +GE+LYNVLLE+A+ G+LAD +K S    LSE EIRR+++++L G
Sbjct  61    PRIVRCFGHSLTSERSGEELYNVLLEYAAGGSLADSMK-SRGKLLSEPEIRRHTRSILEG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKR------NGGKNLGCELRGTPM  666
             L ++H  G+VHCD+KLQNIL+  +G  EVKIADFGLAKR       GGK  G E RGTPM
Sbjct  120   LEFVHSKGFVHCDVKLQNILVFPSGGEEVKIADFGLAKRAGERLAKGGKQGGVEWRGTPM  179

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEIP  837
             YM+PE V   E  P AD+WALGCAV EMA G P W     S    L++RIGVG+EIPEIP
Sbjct  180   YMAPESVKHNEYEPPADVWALGCAVVEMATGRPPWGSRAESNAYALMIRIGVGDEIPEIP  239

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
               LS+ GKDFL KCF K+P+KRWTA MLL HPF++ +   +   +  D            
Sbjct  240   EGLSEQGKDFLMKCFAKNPKKRWTARMLLKHPFLAVDCLNSDEEVVRDC---GVVEFADA  296

Query  1018  spRCPFDFPDWVS-------------------ESDHLQSSITSLPPPESEYSPA-DRLQG  1137
             SPRC FDF DWVS                   +SD L ++  +     S+ S A DR+  
Sbjct  297   SPRCHFDFQDWVSTQCSRTSWESGSVSPSSEMDSDPLFATEHAALEISSDSSRAMDRIGQ  356

Query  1138  IVSHQSPNWSQDSDEWVNVR  1197
             + SH+ PNW + S+ W+ VR
Sbjct  357   LASHERPNW-EHSEGWLTVR  375



>ref|XP_010437255.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Camelina sativa]
Length=359

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 237/371 (64%), Gaps = 35/371 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+W+R ET+G GSF  VSLA           PP++ VKS G  C  +L+NE+ VLD L  
Sbjct  1     MEWIRRETIGHGSFSTVSLATTSGSSTTTLFPPLIAVKSSGVVCSAALMNERYVLDYLGD  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               E++RCFG+G + ENGE++YN+ LE+AS G LAD+IK S    L E E+RR+++++++G
Sbjct  61    SSEIVRCFGEGKTVENGEEVYNLFLEYASGGNLADRIKNS-GEGLPEFEVRRFTRSIVKG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKRNGGKNL---GCELRGTPMYMS  675
             L +IHK G+ HCD+KL+N+L+ ++G   VKI+DFGLAKR         G E+RGTP+YM+
Sbjct  120   LCHIHKNGFSHCDLKLENVLVFDDGYDHVKISDFGLAKRTRSSEEVVGGAEIRGTPLYMA  179

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---------VAELLMRIGVGEEIP  828
             PE VN GE    ADIWALGC+V EM+ G  AW   E         V  L++RIG G+E+P
Sbjct  180   PECVNHGEFESPADIWALGCSVVEMSSGKTAWCLDEGDMMGSNNNVMSLMVRIGSGDEVP  239

Query  829   EIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGED----DGATVSLRNDTHREa  996
              IP +LS++GKDF+ KCF+KD  +RWTA+MLL+HPF++ +D     G+ +SLR     E 
Sbjct  240   RIPVELSEEGKDFVSKCFVKDAAERWTAQMLLDHPFLAVDDGHESGGSYLSLRCGEEDE-  298

Query  997   sapapspspRCPFDFPDWVSESDHLQSSI--TSLPPPESEYSPADRLQGIVSHQ--SPNW  1164
                  S SPR PFDFP W S    +  S+  +SL       SP +R+ G+VS     P+W
Sbjct  299   ----ASVSPRNPFDFPGWNSVHSPVNESVRFSSLV-----RSPEERISGLVSEMIVVPDW  349

Query  1165  SQDSDEWVNVR  1197
             S   D WVNVR
Sbjct  350   SVSCD-WVNVR  359



>ref|XP_010028245.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Eucalyptus grandis]
 gb|KCW54943.1| hypothetical protein EUGRSUZ_I00917 [Eucalyptus grandis]
Length=369

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 228/378 (60%), Gaps = 39/378 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRGE +G G F  + LA P     +G  P M VKSC A+   SL +E+ VL EL   
Sbjct  1     MDWVRGEEIGHGGFATIHLATPAETCSSGRPPVMAVKSCDAALSSSLRHERRVLSELGDS  60

Query  334   QEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               ++RCFG   + E +GE+LYNVLLE+A+ G+LAD +K S    LSE EIRR+++++L G
Sbjct  61    PRIVRCFGHSLTSERSGEELYNVLLEYAAGGSLADSMK-SRGKPLSEPEIRRHARSILEG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKR------NGGKNLGCELRGTPM  666
             L ++H  G+VHCD+KLQNIL+   G  EVKIADFGL+KR       GGK  G E RGTPM
Sbjct  120   LEFVHSKGFVHCDVKLQNILVFPGGGEEVKIADFGLSKRAGERLLKGGKQGGVEWRGTPM  179

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEIP  837
             YM+PE VN  E  P +DIWALGCAV EMA G PAW     S    L++RIGVG+EIPEIP
Sbjct  180   YMAPESVNRNEYEPPSDIWALGCAVVEMATGRPAWGSRAVSNAYALMIRIGVGDEIPEIP  239

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS---GEDDGATVSLRNDTHREasapa  1008
               LS+ GKDFL KCF K+P+KRWTA MLL HPF++   G +D   V       R+     
Sbjct  240   EGLSEQGKDFLMKCFAKNPKKRWTACMLLKHPFLALDRGINDEEFV-------RDCGVEF  292

Query  1009  pspspRCPFDFPDWVS--------ESDHLQSSITSLPPP-------ESEYSPADRLQGIV  1143
             P  SPRC FDF  WVS        ES  L  S+     P           S   R+  + 
Sbjct  293   PDASPRCHFDFQSWVSMQCSRSSWESGSLSPSLERDSDPSVVGELSSDSSSVIHRIDQLA  352

Query  1144  SHQSPNWSQDSDEWVNVR  1197
             S + PNW  DS+ WV VR
Sbjct  353   SPERPNW-IDSEGWVTVR  369



>ref|XP_010432085.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Camelina sativa]
Length=360

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 235/367 (64%), Gaps = 26/367 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+W+R ET+G GSF  VSLA           PP++ VKS G  C  +L+NE+ VLD L  
Sbjct  1     MEWIRRETIGHGSFSTVSLATTSGSSTTTLFPPLIAVKSSGVVCSAALMNERYVLDYLGD  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               E++RCFG+G + ENGE++YN+ LE+AS G LAD+IK S    L E E+RR+++++++G
Sbjct  61    SSEIVRCFGEGKTVENGEEVYNLFLEYASGGNLADRIKNS-GEGLPEFEVRRFTRSIVKG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENGE--VKIADFGLAKR----NGGKNLGCELRGTPMYM  672
             L +IHK G+ HCD+KL+N+L+  +G+  VKI+DFGLAKR    +G  + G E+RGTP+YM
Sbjct  120   LCHIHKNGFSHCDLKLENVLVFGDGDDHVKISDFGLAKRTRSSDGVNDGGVEIRGTPLYM  179

Query  673   SPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE--------VAELLMRIGVGEEIP  828
             +PE VN GE    ADIWALGC+V EM+ G  AW   E        V  L++RIG G+E+P
Sbjct  180   APECVNHGEFESPADIWALGCSVVEMSSGKTAWCLDEGDMLRSNNVMSLMVRIGSGDEVP  239

Query  829   EIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapa  1008
              IP ++S++GKDF+ KCF+KD  +RWTA+MLL+HPF++ +D   +        R      
Sbjct  240   RIPVEMSEEGKDFVSKCFVKDAAERWTAQMLLDHPFLAVDDGHESSGSYLSLMRCGEEDE  299

Query  1009  pspspRCPFDFPDWVSESDHLQSSI--TSLPPPESEYSPADRLQGIVSHQ--SPNWSQDS  1176
              S SPR PFDFP W S    +  S+  +SL       SP +R+ G+VS     P+WS   
Sbjct  300   ASVSPRNPFDFPGWNSVHSPVNESVRFSSLV-----RSPEERISGLVSEMIVVPDWSVSC  354

Query  1177  DEWVNVR  1197
             D WVNVR
Sbjct  355   D-WVNVR  360



>ref|XP_010028244.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Eucalyptus grandis]
 gb|KCW54942.1| hypothetical protein EUGRSUZ_I00916 [Eucalyptus grandis]
Length=370

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 183/385 (48%), Positives = 228/385 (59%), Gaps = 52/385 (14%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG  +G G F  V LA P     +   P M VKSC A+   SL +E+ VL EL  C
Sbjct  1     MDWVRGREIGHGGFATVHLAAPAETCPSDRPPLMAVKSCDAALSSSLRHERRVLSELGHC  60

Query  334   QEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               ++RCFG   + E +G++LYNVLLE+A+ G+LAD++K S    LSE EIRR+++++L G
Sbjct  61    PRIVRCFGHSLTSERSGQELYNVLLEYAAGGSLADRLK-SRGKPLSEAEIRRHTRSILEG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKR------NGGKNLGCELRGTPM  666
             L ++H  G+VHCD+KLQNIL+  NG  EVKIADFGLAKR       G K  G E RGTPM
Sbjct  120   LEFVHSKGFVHCDVKLQNILVFPNGGDEVKIADFGLAKRADERLLKGRKQGGLEWRGTPM  179

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEIP  837
             YM+PE VN  E  PA+D+WALGCAV EMA G PAW     S    L++RIGVG+EIPEIP
Sbjct  180   YMAPESVNCNEYEPASDVWALGCAVVEMATGRPAWGSRAESNAYALMIRIGVGDEIPEIP  239

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
               LS+ GKDFL KCF K+P KRWTA MLL HPF++ +D+     +RN    E        
Sbjct  240   EGLSEQGKDFLMKCFAKNPEKRWTARMLLKHPFLAFDDE----VVRNCGEVE----FADS  291

Query  1018  spRCPFDFPDWVSES-------------------------DHLQSSITSLPPPESEYSPA  1122
             SPRC FDF DWVS                           +H  S I S        S  
Sbjct  292   SPRCHFDFQDWVSMQCSRTSWEAGSLWSSSDMDSDPSFVGEHATSEIWS-----DSSSAI  346

Query  1123  DRLQGIVSHQSPNWSQDSDEWVNVR  1197
             +R+  + S + PNW + S  WV VR
Sbjct  347   NRIGKLASPEKPNW-EGSGGWVAVR  370



>ref|XP_004288026.1| PREDICTED: uncharacterized protein LOC101291755 [Fragaria vesca 
subsp. vesca]
Length=744

 Score =   315 bits (807),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 231/362 (64%), Gaps = 27/362 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+RGE +GRGSF  V+ A P++       P M VKS  AS    L NEK VL+++  C
Sbjct  1     MEWIRGEQLGRGSFATVNSAKPKNQSCK-TPPLMAVKSSEASFSALLKNEKQVLNQIGCC  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++IRCFGD ++FENG   YN+ LE+AS G LAD++KK+   RL E++++RY++++L+GL
Sbjct  60    PQIIRCFGDDHTFENGMAFYNLFLEYASGGCLADQLKKN-GGRLPEIDVKRYARSVLKGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              ++H  G+VHCD+KL N+L+ ENG  KIADFGLAK+ G      E+RGTP+YMSPE VN 
Sbjct  119   RFVHSKGFVHCDVKLANVLVFENGAAKIADFGLAKKAGPTGNRVEVRGTPLYMSPESVNE  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
              E    ADIWA GC VAEM  G P W     S + +LLMRIG G+E PEIP +LS++GKD
Sbjct  179   QEFESPADIWAFGCLVAEMVTGKPVWNHGQGSNMCKLLMRIG-GDESPEIPEELSEEGKD  237

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FL KCF+KD R RWTAEMLL HPF+  +D   TV L  D   E        SPR PFDFP
Sbjct  238   FLGKCFVKDQRNRWTAEMLLEHPFVISDD---TVPLEEDVEDE-----LYSSPRGPFDFP  289

Query  1045  DWVSE-SDHLQSSITSLPP----------PESEYSPAD-RLQGIVSHQSPNWSQDSDEWV  1188
             DWVS  S  +    + L             E+  +PA  RL+ +V+ ++ +WS  S  WV
Sbjct  290   DWVSMISSEISPEFSELAASDLDSSFDWSSETSSNPAAVRLRRLVTDETQDWSV-SRSWV  348

Query  1189  NV  1194
              V
Sbjct  349   TV  350



>gb|KFK28386.1| hypothetical protein AALP_AA8G508200 [Arabis alpina]
Length=344

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 172/363 (47%), Positives = 225/363 (62%), Gaps = 34/363 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDEL-R  327
             M+W+RGET+G G+F  VSLA P  +  +G  PP M VKS  +    SL NEK+VLD L  
Sbjct  1     MEWIRGETIGYGTFSTVSLATPIKN--SGEFPPIMAVKSADSYGAVSLANEKSVLDSLGN  58

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C E++RC+G+  S E+GE+L+N+ LE+AS+G+LA+         L E  +RRY+ ++L+
Sbjct  59    DCDEIVRCYGEDRSVESGEELHNLFLEYASRGSLANG-----GEGLPESTVRRYTGSVLK  113

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR--------NGGKNLGCELRGTP  663
             GL +IH+ G+ HCD+K  NILL  +G VKIADFGLAKR        NGG   G E+RGTP
Sbjct  114   GLRHIHRNGFAHCDLKPGNILLFGDGSVKIADFGLAKRMGEVTELVNGGG--GMEIRGTP  171

Query  664   MYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEI  834
             +YM+PE VN  E G   D+WALGC V EM  G  AW F E      LL+RIGV EE+P I
Sbjct  172   LYMAPESVNDNEYGTEGDVWALGCVVVEMFSGKTAWCFKEGSNFMSLLIRIGVSEELPMI  231

Query  835   PGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDD--GATVSLRNDTHREasapa  1008
             P +LS+ G+DFL KCF+KDP+KRWT EMLLNHPF++ + D          +         
Sbjct  232   PEELSEQGRDFLLKCFVKDPKKRWTVEMLLNHPFVAVDFDHVDVLEDEEEEVVVRLKTEE  291

Query  1009  pspspRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWV  1188
              S SPRCPF+FPDWVS S   Q+            SP +R+  + S   P+WS  ++ WV
Sbjct  292   VSISPRCPFEFPDWVSVSSSSQTEFD---------SPKERVTSLASDLIPDWSV-TNNWV  341

Query  1189  NVR  1197
              VR
Sbjct  342   TVR  344



>ref|XP_003517304.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
Length=346

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 231/356 (65%), Gaps = 18/356 (5%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M WVRG+++G GSF  V++A+P +  I   +P   VKS        L NEK +LD L   
Sbjct  1     MIWVRGDSLGTGSFATVNIAIPTNTSIHFPSP-TAVKSSDVHSSSMLKNEKEILDCLGAS  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               VI+CFG  ++ ENGE+ YN+ LE+A+ G+LAD++K+    RL E  +RR +++++ GL
Sbjct  60    PYVIKCFGHDHTVENGEEYYNIFLEYAAGGSLADQVKR-HGGRLPESYVRRCTRSIVEGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH  GYVHCD+KLQNIL+ ENG+VKIADFGLAK  G K    E RGTP++MSPE VN 
Sbjct  119   KHIHDNGYVHCDVKLQNILVFENGDVKIADFGLAKEKGEKQGTFECRGTPLFMSPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKF--SEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
              E    ADIWALGCAV EM  G PAW    S +  LL+RIGVGEE+P+IP +LS++GKDF
Sbjct  179   NEYESPADIWALGCAVVEMLTGKPAWDVRGSNIWSLLIRIGVGEELPKIPEELSEEGKDF  238

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L KCF+KDP KRW+AEMLL+HPF++ E     VS           P PSPSPR  FD   
Sbjct  239   LLKCFVKDPMKRWSAEMLLHHPFVNNE----AVSFHK---VNEPLPLPSPSPRTHFDLTH  291

Query  1048  WVSE-SDHLQSSITSLPPPESEY----SPADRLQGIVSHQSP-NWSQDSDEWVNVR  1197
             W S  +  L SS  S     +E+    SP +R + +++ Q+P NWS+ SD W +VR
Sbjct  292   WASTVTTWLPSSPDSDEWRMAEFGSSCSPENRFRRLLTDQTPANWSE-SDGWTSVR  346



>ref|XP_009103457.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Brassica 
rapa]
Length=346

 Score =   303 bits (775),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 174/360 (48%), Positives = 229/360 (64%), Gaps = 26/360 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDEL-R  327
             M+WVRGET+G G+F  V+LA P ++ ++GA P  M VKS  +    SL NEK VLD L  
Sbjct  1     MEWVRGETIGYGTFSTVTLATP-ANDVSGAFPQVMAVKSADSHGAASLANEKWVLDTLGD  59

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C E++RC G+  + ENGE+++N+ LEFAS+G+LA  +KK     L E  +RR++ ++LR
Sbjct  60    DCDEIVRCLGEDRTVENGEEMHNLFLEFASRGSLASHLKKLNGEGLPESTVRRHTGSVLR  119

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG----GKNLGCELRGTPMYMS  675
             GL YIH  G+ HCD+KL NILL  +G VKIADFGLAKR G      + G ++RGTP+YM+
Sbjct  120   GLRYIHAKGFAHCDLKLGNILLFGDGAVKIADFGLAKRAGEVTASVDGGVQIRGTPLYMA  179

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKL  846
             PE VN  E G  AD+ ALGCAV EM  G  AW F E      LL+RIGVG+E+P IP  L
Sbjct  180   PESVNDNEYGSEADVPALGCAVVEMLSGKTAWSFKEGSHFMSLLIRIGVGDELPRIPEDL  239

Query  847   SDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS---GEDDGATVSLRNDTHREasapapsp  1017
             S+ G+DFL KCF+KDP+KRWTAEMLLNHPF++     DD   V ++  T           
Sbjct  240   SEQGRDFLTKCFVKDPKKRWTAEMLLNHPFVAVDLDHDDFEEVDIQLKTEE------VFA  293

Query  1018  spRCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             SPRCPF+F  WVS S    +   +L  PE      +R+  + +   P+WS  ++ WV VR
Sbjct  294   SPRCPFEFSSWVSASSDSGTQCHTLEAPE------ERVATLAAVSIPDWSV-TNNWVIVR  346



>emb|CDX75628.1| BnaA01g00740D [Brassica napus]
Length=354

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 170/364 (47%), Positives = 239/364 (66%), Gaps = 21/364 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVR ET+G GSF  VSLA   +   + + PP++ VKS GA C  +L NE+ VLD+L  
Sbjct  1     MEWVRRETIGHGSFSTVSLAT--TSASSTSFPPLIAVKSSGAVCSAALRNERDVLDDLGH  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG   + ENGE++YN+ LE+AS G L D+IK S    L E E+RR+++++++G
Sbjct  59    CPEIVRCFGGATTVENGEEVYNLFLEYASGGNLRDRIKNS-GEGLPEFEVRRFTRSIVKG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L  +H  GY HCD+KL+N+L+  +G VKI+DFGLAKR G      E+RGTP+Y++PE VN
Sbjct  118   LRRVHANGYSHCDVKLENVLVFGDGGVKISDFGLAKRRG--ETVDEIRGTPLYLAPEAVN  175

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSE----VAELLMRIGVGEEIPEIPGKLSDDG  858
              GE    AD+WALG  V EM+ G  AW   E    V  L++RIG G ++P+IP +LS++G
Sbjct  176   RGEFESPADVWALGWCVVEMSSGKTAWCLEEGVGNVMSLMVRIGSG-DVPKIPVELSEEG  234

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFIS--GEDDGATVSLRNDTHREasapapspspRCP  1032
             KDF+ +CF+KDP +RWTA+MLL+HPF++   +D+ ++ SLR     E      S SPR P
Sbjct  235   KDFVRRCFVKDPVERWTAQMLLDHPFLAVDHDDERSSGSLRCGDEDE-----ASVSPRDP  289

Query  1033  FDFPDWVSESDHLQ--SSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR*CQ  1206
             FDFPDW S +D +   S +   P       P +R+ G+VS   P+WS   D WVNVR  +
Sbjct  290   FDFPDWNSVNDSVTVCSPVNCSPFSYLVCLPKERISGLVSENVPDWSVSCD-WVNVREVE  348

Query  1207  MSTV  1218
              S++
Sbjct  349   GSSI  352



>ref|XP_009138381.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Brassica rapa]
Length=354

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 237/357 (66%), Gaps = 21/357 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVR ET+G GSF  VSLA   +   + + PP++ VKS GA C  +L NE+ VLD+L  
Sbjct  1     MEWVRRETIGHGSFSTVSLAT--TSASSTSFPPLIAVKSSGAVCSAALRNERDVLDDLGD  58

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C E++RCFG G + ENGE++YN+ LE+AS G L D+IK S    L E E+RR+++++++G
Sbjct  59    CPEIVRCFGGGTTVENGEEVYNLFLEYASGGNLRDRIKNS-GEGLPEFEVRRFTRSIVKG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L ++H  GY HCD+KL+N+L+  +G VKI+DFGLAKR G   +  E+RGTP+Y++PE VN
Sbjct  118   LRHVHANGYSHCDVKLENVLVFGDGGVKISDFGLAKRRG--VVVDEIRGTPLYLAPEAVN  175

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSE----VAELLMRIGVGEEIPEIPGKLSDDG  858
              GE    AD+WALG  V EM+ G  AW   E    V  L++RIG G+  P+IP +LS++G
Sbjct  176   RGEFESPADVWALGWCVVEMSSGKTAWCLEEGVGNVMSLMVRIGSGDA-PKIPVELSEEG  234

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFIS--GEDDGATVSLRNDTHREasapapspspRCP  1032
             KDF+ +CF+KDP +RWTA+MLL+HPF++   +D+ ++ SLR     E      S SPR P
Sbjct  235   KDFVRRCFVKDPVERWTAQMLLDHPFLAVDHDDERSSGSLRCGDEDE-----ASVSPRDP  289

Query  1033  FDFPDWVSESDHLQ--SSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
             FDFPDW S +D +   S +   P       P +R+ G+VS   P+WS   D WVNVR
Sbjct  290   FDFPDWNSVNDSVTVCSPVNCSPFSYLVCLPKERISGLVSGNVPDWSVSCD-WVNVR  345



>ref|XP_011008530.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Populus euphratica]
Length=352

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 179/371 (48%), Positives = 231/371 (62%), Gaps = 42/371 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG  +G GS   V LA  ++   +     M VKSC  S    L NE+ VL+E+  C
Sbjct  1     MEWVRGGCLGYGSSSTVHLATSKNSS-STYPEVMAVKSCNQSDTTLLENEREVLNEIGLC  59

Query  334   QEVIRCFGD-GYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              ++I+CFGD   + EN E LYN+LLE+A  G+L+ KIKKS    L E +++ Y++++L+G
Sbjct  60    PQIIQCFGDCQATAENNEFLYNLLLEYAKGGSLSYKIKKS-GGCLQEGDVKDYTRSILKG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L  +H  G+VHCD+KL NILL ENGEVKIADFGLAK+ G K    E+RGTP+YM+PE VN
Sbjct  119   LSCVHGKGFVHCDLKLDNILLFENGEVKIADFGLAKKTGQKQGRVEIRGTPLYMAPESVN  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E    ADIWALGCA+ EM  G P W +   + +  LL+RIG G+E+P IP +LS  GK
Sbjct  179   NNEYESGADIWALGCAIVEMVTGKPPWNWKPGTNMFVLLIRIGKGDELPTIPEELSQQGK  238

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCF+KDP++RWTA+MLL HPF++ +  G TV LR +         PS SPRC FDF
Sbjct  239   DFLSKCFVKDPKRRWTADMLLEHPFVADQGKG-TVPLREEIE------VPSTSPRCHFDF  291

Query  1042  PDWVSESDHLQSSITSLPPPESEY-------------------SPADRLQGIVSHQSPNW  1164
             PDWVS    +QS     P P SE+                   S ADR++ + S Q  NW
Sbjct  292   PDWVS----IQS-----PSPRSEFLSDDGVGLVFSSLNSSSWISAADRIRQLASDQCCNW  342

Query  1165  SQDSDEWVNVR  1197
             S DS  WV VR
Sbjct  343   S-DSGSWVAVR  352



>ref|XP_010028241.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Eucalyptus grandis]
 gb|KCW54939.1| hypothetical protein EUGRSUZ_I00913 [Eucalyptus grandis]
Length=372

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 227/379 (60%), Gaps = 38/379 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG  +G G F  V LA P     +   P M VKSC ++   SL +E+ VL EL  C
Sbjct  1     MDWVRGREIGHGGFATVHLAAPAKTCSSDHPPLMAVKSCDSALSSSLRHERQVLRELGEC  60

Query  334   QEVIRCFGDGYSFENG-EKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               ++RCFGD  + E G E+LYNVLLE+A+ G LAD +K S    L E EIRR+++++L G
Sbjct  61    PGIVRCFGDSLTAERGGEELYNVLLEYAAGGTLADSMK-SRGKPLLEPEIRRHTRSILEG  119

Query  511   LGYIHKVGYVHCDIKLQNILL--CENG-EVKIADFGLAKR------NGGKNLGCELRGTP  663
             L ++H  G+VHCD+KLQNIL+  C  G EVKIADFGLAKR       GGK  G ELRGTP
Sbjct  120   LDFVHSKGFVHCDVKLQNILVFPCGGGDEVKIADFGLAKRAGEQSAKGGKQGGFELRGTP  179

Query  664   MYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVA-ELLMRIGVGEEIPEIPG  840
             MYM+PE VN  E  P +D+WALGCAV EMA G PAW     A  L++RIG G+EIPEIP 
Sbjct  180   MYMAPESVNDNEYEPPSDVWALGCAVVEMATGRPAWGSRPNAYALMIRIGAGDEIPEIPE  239

Query  841   KLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsps  1020
              LS+ GKDFL KCF K+P+ RWTA MLL HPF++ +         N+  R        PS
Sbjct  240   GLSEQGKDFLMKCFAKNPKMRWTARMLLEHPFLALD-----CVQDNEVVRNCRDEFADPS  294

Query  1021  pRCPFDFPD----------WVSESDHLQSSITSLPPPESEY----------SPADRLQGI  1140
             PRC FDF D          W S S    S + S P   +E+          S  DR++ +
Sbjct  295   PRCHFDFQDSVSTQCSRTTWESGSLSPSSEMDSDPSFATEHAALEISPDSSSVTDRIREL  354

Query  1141  VSHQSPNWSQDSDEWVNVR  1197
              S + PNW + S+ WV VR
Sbjct  355   ASQERPNW-EHSEGWVTVR  372



>ref|XP_010269485.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nelumbo nucifera]
Length=380

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 192/383 (50%), Positives = 231/383 (60%), Gaps = 49/383 (13%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+W RG+ VGRGSF  VSLAVPRS       PP M VKS  AS   SL  EK +L  LRG
Sbjct  1     MEWTRGKPVGRGSFSTVSLAVPRSGCSITKFPPLMAVKSAFASKSSSLRMEKEILTHLRG  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C +++ CFGD  + ENG ++YN+ LE+A  G+LAD +K S      E ++RRY++++LRG
Sbjct  61    CPQILHCFGDDLTVENGNQIYNIFLEYAPTGSLADLLKIS-GGLFVESDVRRYARSILRG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCE-----NGEVKIADFGLAKRNGGKNLGCE-----LRGT  660
             L  IH  GYVHCDIK QNIL+C      NG VKIADFGLAK  G +    E     LRGT
Sbjct  120   LRCIHANGYVHCDIKPQNILVCSYPDGSNG-VKIADFGLAKTAGNEKRRTEGGVSELRGT  178

Query  661   PMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPE  831
             P+YMSPE +   E    ADIWALGCAV EM  G PAW+     EV  LL RIG GEE+PE
Sbjct  179   PLYMSPESIARNEHEAPADIWALGCAVLEMVLGKPAWRCRASEEVVALLYRIGFGEEVPE  238

Query  832   IPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapap  1011
             IP +LS +G+DF+EKCFIKDPRKRWTAEMLLNHPF++ ED   TVSL     +       
Sbjct  239   IPAELSAEGRDFIEKCFIKDPRKRWTAEMLLNHPFVA-ED---TVSLSECEKQ-------  287

Query  1012  spspRCPFDFPDWVS----------------ESDHLQSSITSLPPPESEYS-----PADR  1128
             SPSPR  FDFP+W S                 S     S+T     E + S      A R
Sbjct  288   SPSPRSAFDFPEWNSLRSSVSNSVDSSSSSPVSSSSSDSLTCCEEEEKDQSDSPRYSASR  347

Query  1129  LQGIVSHQSPNWSQDSDEWVNVR  1197
             ++ + + Q  NWS  SD WV VR
Sbjct  348   IREVATGQVSNWST-SDGWVTVR  369



>ref|XP_010028242.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Eucalyptus grandis]
 gb|KCW54940.1| hypothetical protein EUGRSUZ_I00914 [Eucalyptus grandis]
Length=399

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 184/405 (45%), Positives = 231/405 (57%), Gaps = 63/405 (16%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG  +G G F  V LA       +G  P M VKSC A+   SL +E+ VL EL  C
Sbjct  1     MDWVRGREIGHGGFATVHLAATAETCPSGRPPVMAVKSCDAALSSSLRHERRVLSELGHC  60

Query  334   QEVIRCFGDGYSFENG-EKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               ++RCFG+  + E G E+LYNVLLE+A+ G+LAD +K S    LS+ EIRR+++++L G
Sbjct  61    PRIVRCFGEELTAERGGEELYNVLLEYAAGGSLADSMK-SRGKPLSDAEIRRHTRSILEG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKR------NGGKNLGCELRGTPM  666
             L ++H  G+VHCD+KLQNIL+  NG  EVKIADFGLAK+       GGK  G E RGTPM
Sbjct  120   LEFVHSKGFVHCDVKLQNILVFPNGGDEVKIADFGLAKKAGEQPAKGGKQGGLEWRGTPM  179

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGK  843
             YM+PE VN  E  P +D+WALGCAV EMA G PAW   +    L++RIGVG+EIPEIP  
Sbjct  180   YMAPESVNCNEYEPPSDVWALGCAVVEMATGRPAWGSPANAYALMIRIGVGDEIPEIPEG  239

Query  844   LSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHRE-asapapsps  1020
             LS+ GKDFL KCF K+P+KRWTA MLL HPF++ +     V    +  R+  +      S
Sbjct  240   LSEQGKDFLMKCFAKNPKKRWTARMLLKHPFLALD----CVDNDEEVARDCGAVEFADSS  295

Query  1021  pRCPFDFPDWV--------------------------------------SESDHLQSSI-  1083
             PRC FDF  WV                                      S S H  S I 
Sbjct  296   PRCHFDFQYWVSMQCSRTSWESSSLSPSSEMDSDPSFAGEHTTSEIWSDSSSAHTTSEIW  355

Query  1084  --TSLPPPESEY-----SPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
               +S     SE      S  DR   + SH+ PNW +DS+ WV VR
Sbjct  356   SDSSSAHTTSEIWSDSSSAIDRFVELASHERPNW-EDSEGWVTVR  399



>ref|XP_004141910.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101215204 
[Cucumis sativus]
Length=740

 Score =   309 bits (791),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 181/364 (50%), Positives = 228/364 (63%), Gaps = 30/364 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDEL-R  327
             MDWVRG+ +G GSF  ++LA   S       PP M VKS G  C  SL NEK VLD L  
Sbjct  1     MDWVRGDEIGYGSFATINLATSCS---GDRFPPLMAVKSSGLVCSASLKNEKQVLDLLGD  57

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C ++IRCFGD  S ENGE+LYN+ LE+AS G+LAD+I+ S   RL E E+RRY++ +L 
Sbjct  58    DCPQIIRCFGDSCSVENGEELYNLFLEYASGGSLADRIQ-SRGGRLPEFEVRRYTRTILE  116

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGC-------ELRGTPM  666
             GL YIH  G+VHCD+K +NIL+  +G+ KIADFGL+K+ G   +G        +LRG+P+
Sbjct  117   GLRYIHGKGFVHCDVKPRNILVFGDGDAKIADFGLSKKAGKNRVGTGEETGKFQLRGSPL  176

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIP  837
             YMSPE VN  E     DIWA+GCAV EM  G PAW     S V  LL++IG+GEE+PEIP
Sbjct  177   YMSPESVNDNEYESPCDIWAVGCAVVEMLTGKPAWNCRPESNVFALLIKIGIGEELPEIP  236

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
               LS++GKDFL+KC +KDP KRWTA+MLL HPF++  + G  V L       A     S 
Sbjct  237   KDLSEEGKDFLKKCLVKDPLKRWTADMLLKHPFVA--ESGRCVPL-------AGVEEVST  287

Query  1018  spRCPFDFPDWVS----ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEW  1185
             SPRCPFDF DW S    ESD       +        SP +RL  +V + +  WS  +D W
Sbjct  288   SPRCPFDFEDWASIHSQESDPRNEEEANCWLNNWSCSPRERLLELVGNGAVEWSV-TDNW  346

Query  1186  VNVR  1197
             V VR
Sbjct  347   VRVR  350



>ref|XP_008440288.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Cucumis melo]
Length=354

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 176/368 (48%), Positives = 227/368 (62%), Gaps = 34/368 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDEL-R  327
             MDWVRG  +G GSF  ++LA P S       PP M VKS    C  SL NEK +LD L  
Sbjct  1     MDWVRGHEIGHGSFATINLATPSS---GDRFPPLMAVKSSELVCSSSLKNEKQILDLLGD  57

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              C ++IRCFG+  S ENGE+LYN+ LE+A+ G+LAD+I+ S   RL E E+RRY++ +L 
Sbjct  58    DCPQIIRCFGESCSVENGEELYNLFLEYATGGSLADRIQ-SCGGRLPEFEVRRYTRTILE  116

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNG------GKNLG-CELRGTPM  666
             GL YIH  G+VHCD+K +NIL+  +G+ KIADFGL+K+ G      G+  G  +LRG+P+
Sbjct  117   GLRYIHGKGFVHCDVKPRNILVFGDGDAKIADFGLSKKAGKNRVETGEETGRFQLRGSPL  176

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIP  837
             YMSPE +N  E     DIWA+GCAV EM  G PAW     S V  LL++IG+GEE+PEIP
Sbjct  177   YMSPESLNDNEYESPCDIWAVGCAVVEMFTGKPAWNCRPESNVFALLIKIGIGEELPEIP  236

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
               LS++GKDFL KC +KDP KRWTA+MLL HPF++  D G  V L             S 
Sbjct  237   KDLSEEGKDFLRKCLVKDPVKRWTADMLLKHPFVA--DSGRCVPL-------GEMDEVST  287

Query  1018  spRCPFDFPDWVS--------ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQD  1173
             SPRCPFDF DW S         ++   +   +     S  SP +RL  +V   + +WS  
Sbjct  288   SPRCPFDFEDWASIHSQERDPRNEEESNCWLNSSCSWSSSSPRERLLQLVEKGAVDWSV-  346

Query  1174  SDEWVNVR  1197
             +D WV VR
Sbjct  347   TDNWVRVR  354



>ref|XP_007156794.1| hypothetical protein PHAVU_002G018100g [Phaseolus vulgaris]
 gb|ESW28788.1| hypothetical protein PHAVU_002G018100g [Phaseolus vulgaris]
Length=341

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/353 (48%), Positives = 224/353 (63%), Gaps = 17/353 (5%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG+++G G+F  V++ VP ++G      P  VKS  +     L NEK +L  L   
Sbjct  1     MNWVRGDSLGHGTFATVNIVVP-ANGSTFFPSPAAVKSSLSHNAGLLENEKEILSRLGSS  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +I C G  ++ ENG + YNV LE A+ G+LAD++KK     L E  +RR +++++ GL
Sbjct  60    PHIINCLGHDHTIENGVEFYNVFLEQAAGGSLADQVKK-HGGSLPESFVRRCTRSIVEGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH+ G+VHCD+KLQN+L+ +NG+VKIADFGLAK  G K+  CE RGTP++MSPE VN 
Sbjct  119   RHIHEHGFVHCDVKLQNVLVFDNGKVKIADFGLAKEKGEKHGKCECRGTPLFMSPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
              E  P ADIWALGCAV EMA G PAW     S +  LL+RIGVGEE+P+IP  LS++GKD
Sbjct  179   NEYEPPADIWALGCAVVEMATGKPAWDIRDGSSIWSLLVRIGVGEELPKIPEDLSEEGKD  238

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FL KCF+KDP KRW+AEMLL HPFI  +      S+  D   E  +P    +    FDFP
Sbjct  239   FLGKCFVKDPTKRWSAEMLLKHPFIKVD------SISFDKVHEPLSPPSPSTH---FDFP  289

Query  1045  DWVSE-SDHLQSSITSLPPPESEYSPADRLQGIVSHQSP-NWSQDSDEWVNVR  1197
              W S  +  L SS  S   P    +P  RL+ +V+ + P NWS+  D W+ VR
Sbjct  290   HWASTVTASLPSSPYSDEWPGWSCTPESRLRRLVTDKRPENWSE-LDGWMRVR  341



>ref|XP_003611720.1| Protein kinase-like protein [Medicago truncatula]
 gb|AES94678.1| MAP3K-like kinase [Medicago truncatula]
Length=353

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/365 (48%), Positives = 233/365 (64%), Gaps = 34/365 (9%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAV-PRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             +WVRG+ +G G+F  V+LA  P++ GI  +   +       S F  L+NEK +L+ L   
Sbjct  3     NWVRGKMLGSGTFATVNLATHPQNSGIFPSLTAVKTSDTYGSHF--LINEKQILESLGSS  60

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENH--RLSEMEIRRYSKALLR  507
               +I+ FG   +FENGE+ YN+ LE+A+ G L+D++K   NH  +L E  +RRY++++++
Sbjct  61    PHIIKYFGHDQTFENGEECYNIFLEYAAGGTLSDQLK---NHGGKLPENLVRRYTRSVVQ  117

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLG-CELRGTPMYMSPEM  684
             GL ++H+ G+VHCD+KLQNIL+ EN EVKI+DFGLAK  G K+ G  E RGTP+YMSPE 
Sbjct  118   GLKHVHENGFVHCDVKLQNILVFENDEVKISDFGLAKEKGLKHGGKLECRGTPLYMSPEA  177

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDD  855
             VN       ADIWALGCA+ EMA G  AW  S    +  LL+RIG  +E P IP +LS  
Sbjct  178   VNESVYESPADIWALGCAIVEMATGKHAWNVSSGSNMWSLLIRIGAEDESPLIPDELSQV  237

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPF  1035
             GKDFLEKCFIKDP KRWTAEMLL H FISG++   TVSL  +   E    + SPSPR  F
Sbjct  238   GKDFLEKCFIKDPSKRWTAEMLLKHEFISGDE---TVSLVKELINE-LPLSISPSPRTHF  293

Query  1036  DFPDWVSESDHLQSSITSLPPPESEY----------SPADRLQGIVSHQSP-NWSQDSDE  1182
             DFP W S      SS+T+LPP   E           SP + LQ +V+++ P +WS+ SD 
Sbjct  294   DFPHWAS------SSVTTLPPDAKEVCELKFEQGFCSPGESLQRLVTNERPLDWSE-SDA  346

Query  1183  WVNVR  1197
             W  VR
Sbjct  347   WCFVR  351



>ref|XP_010109773.1| hypothetical protein L484_000226 [Morus notabilis]
 gb|EXC57778.1| hypothetical protein L484_000226 [Morus notabilis]
Length=321

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 187/265 (71%), Gaps = 6/265 (2%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            M+WVRGE +G GSF K+S A P +   +   P M VKS  A C  SL NEK VLD +  C
Sbjct  1    MEWVRGEQIGHGSFAKISKATP-TKSSSQFPPLMAVKSSEACCSSSLKNEKRVLDTIGLC  59

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             ++IR FG+  S E GE+ +N+L+E+AS G+LAD++K S+  RLSE+EIRR++K++L+GL
Sbjct  60   PQIIRYFGEEQSVEKGEEFHNLLMEYASGGSLADRVK-SQGGRLSELEIRRHTKSILKGL  118

Query  514  GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             +IH  G+VHCDIKLQNIL+ +NG  K+ADFGLAK    K   CE+RGTP+YMSPE VN 
Sbjct  119  SFIHSKGFVHCDIKLQNILVFQNGAAKVADFGLAKEMATKVNECEIRGTPLYMSPESVND  178

Query  694  GEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
                   D+WALGCAVAEMA G P W     + V  LL+RIG GEE P IP   S++GKD
Sbjct  179  NVYESPCDVWALGCAVAEMATGKPVWDHKAGASVWPLLIRIG-GEEEPAIPSDFSEEGKD  237

Query  865  FLEKCFIKDPRKRWTAEMLLNHPFI  939
            FL KCF+KDP +RWTAEMLLNH + 
Sbjct  238  FLRKCFLKDPAERWTAEMLLNHTYF  262



>ref|XP_010028243.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Eucalyptus grandis]
 gb|KCW54941.1| hypothetical protein EUGRSUZ_I00915 [Eucalyptus grandis]
Length=372

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 220/380 (58%), Gaps = 40/380 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG  +G G F  V LA       +G  P M VKSC A+   SL +E+ VL EL  C
Sbjct  1     MDWVRGREIGHGGFATVHLAGAAETCPSGRPPVMAVKSCDAALASSLRHERRVLSELGHC  60

Query  334   QEVIRCFGDGYSFENG-EKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               ++RC+GD  + E G E+LYNV LE+A+ G+L+D +K S    LSE EIRR+++++L G
Sbjct  61    PRIVRCYGDSVTTERGGEELYNVFLEYAAGGSLSDSLK-SRGKPLSEAEIRRHARSILEG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKRNG------GKNLGCELRGTPM  666
             L ++H  G+VHCDIKLQNIL+   G  EVKIADFGLAKR G      GK  G E RGTPM
Sbjct  120   LEFVHSKGFVHCDIKLQNILVFPRGGEEVKIADFGLAKRAGERLSKDGKQAGVEWRGTPM  179

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEIP  837
             YM+PE VN  E  P +D+WALGCAV EMA G PAW     S    L++RIGVGE+IPEIP
Sbjct  180   YMAPESVNCSEYEPPSDVWALGCAVVEMATGRPAWGSQAESNAYALMIRIGVGEQIPEIP  239

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
               LS+ GKDFL KCF K+P+ RWTA MLL HPF+      A   + ND            
Sbjct  240   EGLSEQGKDFLMKCFAKNPKMRWTARMLLKHPFL------AIDCVDNDEEIVRDCGVVEL  293

Query  1018  spRCPFDFPDWVS--------ESDHLQ--SSITSLPPPESEY----------SPADRLQG  1137
             +   P    DWVS        ESD L   S + S P    E           S  DR+  
Sbjct  294   ADSSPRCHFDWVSMQCSRTSWESDSLSPCSEMDSAPSFVGELAALEIASDSSSVMDRIGQ  353

Query  1138  IVSHQSPNWSQDSDEWVNVR  1197
             + S    NW +DS+ WV VR
Sbjct  354   LASRGRHNW-EDSEGWVTVR  372



>ref|XP_010106871.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXC12415.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=302

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 161/312 (52%), Positives = 201/312 (64%), Gaps = 19/312 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-VKSCGASCFDSLLNEKAVLDELRG  330
             M+WVRGE +G GSF  +S A           P ++ VKS  A    SL NEK VL+ +  
Sbjct  1     MEWVRGEIIGHGSFATISKATTTCRNSRSDLPTLLAVKSSDACLSSSLKNEKHVLESMGS  60

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENH--RLSEMEIRRYSKALL  504
             CQ++IRCFGD  S ENG++ YN+LLEFAS G L+D+IK   NH  RL E ++RRY+KA++
Sbjct  61    CQQIIRCFGDNSSVENGQEFYNLLLEFASGGCLSDQIK---NHGGRLPETDVRRYTKAIV  117

Query  505   RGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEM  684
              GL  +H  G+VHCDIK QNIL+ E+G  KIADFGLAK  G      ELRGTP+YMSPE 
Sbjct  118   GGLCAVHSKGFVHCDIKPQNILVFEDGAAKIADFGLAKEKGLVMKKTELRGTPLYMSPES  177

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAE-----LLMRIGVGEEIPEIPGKLS  849
             V   E     DIWALGC V EM  G P W  S + E     LL +I  GEE P IP +LS
Sbjct  178   VKANEYEAPCDIWALGCVVVEMITGKPVW--SHLTELNLFTLLKKIARGEETPRIPEELS  235

Query  850   DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRC  1029
             ++GKDFL +CFIKDP KRWTAEMLL H F+  +D+    +L + +  +   P+  PSPRC
Sbjct  236   EEGKDFLRQCFIKDPTKRWTAEMLLKHAFVGDQDE----ALLSTSSSKLYKPSTPPSPRC  291

Query  1030  PFDFPDWVSESD  1065
             PF FP  VS+S+
Sbjct  292   PFGFP--VSDSN  301



>ref|XP_010093632.1| Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis]
 ref|XP_010100232.1| Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis]
 gb|EXB54393.1| Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis]
 gb|EXC44944.1| Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis]
Length=434

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 187/265 (71%), Gaps = 6/265 (2%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            M+WVRGE +G GSF K+S A P +   +   P M VKS  A C  SL NEK VLD +  C
Sbjct  114  MEWVRGEQIGHGSFAKISKATP-TKSSSQFPPLMAVKSSEACCSSSLKNEKRVLDTIGLC  172

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             ++IR FG+  S E GE+ +N+L+E+AS G+LAD++K S+  RLSE+EIRR++K++L+GL
Sbjct  173  PQIIRYFGEEQSVEKGEEFHNLLMEYASGGSLADRVK-SQGGRLSELEIRRHTKSILKGL  231

Query  514  GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             +IH  G+VHCDIKLQNIL+ +NG  K+ADFGLAK    K   CE+RGTP+YMSPE VN 
Sbjct  232  SFIHSKGFVHCDIKLQNILVFQNGAAKVADFGLAKEMATKVNECEIRGTPLYMSPESVND  291

Query  694  GEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
                   D+WALGCAVAEMA G P W     + V  LL+RIG GEE P IP   S++GKD
Sbjct  292  NVYESPCDVWALGCAVAEMATGKPVWDHKAGASVWPLLIRIG-GEEEPAIPSDFSEEGKD  350

Query  865  FLEKCFIKDPRKRWTAEMLLNHPFI  939
            FL KCF+KDP +RWTAEMLLNH + 
Sbjct  351  FLRKCFLKDPAERWTAEMLLNHTYF  375



>ref|XP_010028240.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Eucalyptus grandis]
Length=394

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 191/276 (69%), Gaps = 14/276 (5%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            MDWVRG+ +G G F  V LA P     +G  P M VKSC A+   SL +E+ VL EL  C
Sbjct  1    MDWVRGKEIGHGGFATVHLAAPAGTCPSGLPPLMAVKSCDAALSSSLRHERRVLRELGDC  60

Query  334  QEVIRCFGDGYSFENG--EKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              ++RCFGD  + E+G  E+LYNVLLE+A  G+LAD +K S    LSE E+RR+++++L 
Sbjct  61   PRIVRCFGDSLTAEHGGGEELYNVLLEYAGGGSLADSMK-SRGKPLSEPEMRRHARSILE  119

Query  508  GLGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKR------NGGKNLGCELRGTP  663
            GL ++H  G+VHCD+KLQNIL+  +G  EVKIADFGLAKR       GGK  G E RGTP
Sbjct  120  GLEFVHSKGFVHCDVKLQNILVFPDGGDEVKIADFGLAKRAGERLSKGGKRGGVEWRGTP  179

Query  664  MYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEI  834
            MYM+PE VN  E  P +D+WALGCAV EMA G PAW     S    L++RIGVGEEIP+I
Sbjct  180  MYMAPESVNCNEYEPPSDVWALGCAVVEMATGRPAWGSRAESNAYALMIRIGVGEEIPDI  239

Query  835  PGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS  942
            P  LS+ GKDFL KCF K+P+KRWTA MLL HPF++
Sbjct  240  PEGLSEQGKDFLMKCFAKNPKKRWTARMLLKHPFLA  275



>ref|XP_008799260.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Phoenix dactylifera]
Length=385

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 224/370 (61%), Gaps = 23/370 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG TVGRGSF  VSLAV +  G +     M VKS        L  E+A+L  L+ C
Sbjct  1     MEWVRGATVGRGSFATVSLAVVQDRGDSQLPKLMAVKSAPLFQSSFLQREEAILARLQHC  60

Query  334   QEVIRCFG-DGYSFENG-EKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
               +IRCFG D   F++  E+ YN+ LE+AS G L+D +++S      E  +RR++++LL 
Sbjct  61    PYIIRCFGHDLAGFDDSDEQYYNLFLEYASGGTLSDLVRRSGGS-FPEHTVRRFTRSLLE  119

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCEL-RGTPMYMSPEM  684
             GL  IH  GYVHCDIKLQNIL+  +G+V+IADFGLAK+ G K   C L RGTP+YMSPE 
Sbjct  120   GLRSIHAEGYVHCDIKLQNILVRSDGDVRIADFGLAKKIGDKADDCTLLRGTPIYMSPES  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDD  855
             V   E    ADIW+LGC VAE A G PAW+FS   +V  LL+RIG G+E PEIP +LSD 
Sbjct  180   VARNEYEALADIWSLGCVVAETASGRPAWRFSGDEDVWHLLLRIGFGDETPEIPAELSDV  239

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFI----SGEDDGATVSL--RNDTHREasapapsp  1017
             GKDFL +CF KDP KRWTAEMLL HPF+    S +DD   V L   + T          P
Sbjct  240   GKDFLRRCFAKDPEKRWTAEMLLGHPFVADSRSFDDDADAVMLPFVSGTAGAECCTLARP  299

Query  1018  spRCPFDFPDWVSESDHLQSSITS------LPPPE-SEYSPADRLQGIVSHQ-SPNWSQD  1173
             SP    DF  WVS   H  S+ ++       P P+    SP +R+  + + Q  P+WS  
Sbjct  300   SPSSILDFSQWVSPRSHSPSTCSAASLDILTPSPDCCHASPTERISDLATGQRRPDWSCF  359

Query  1174  SD--EWVNVR  1197
             S    W++VR
Sbjct  360   SSVGSWIDVR  369



>ref|XP_011043532.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Populus euphratica]
Length=352

 Score =   288 bits (737),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 165/362 (46%), Positives = 224/362 (62%), Gaps = 24/362 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG  +G GS   V LA  +    +  A  M VKSC  S    L NE+ + +E+  C
Sbjct  1     MEWVRGGCLGYGSSSTVHLATTKKSSSSYPAV-MAVKSCNQSDTTLLKNEREIFNEIGFC  59

Query  334   QEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              E+I+CFGD  + E + E+LYN+LLE+A  G+LA ++KKS    L E +++ Y++++L+G
Sbjct  60    PEIIQCFGDCQTVEEDNERLYNLLLEYAQGGSLAFQLKKS-GGCLKESDVKDYTRSILKG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KL N+L+ ENGEVKIADFGLAK+ G K    E+RGTP+YM+PE VN
Sbjct  119   LRHIHSKGFVHCDLKLDNMLVFENGEVKIADFGLAKKAGEKQGRVEIRGTPLYMAPESVN  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E     DIWALGCA+ EM  G PAW     + +  LL+RIG G+E+P IP +LS +GK
Sbjct  179   NNEYESGVDIWALGCAIVEMVTGKPAWNSKPGANMFALLIRIGEGDELPIIPEELSQEGK  238

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCF+KDP +RWTA+MLL HPF++ +    TV  + ++         S SPRC FDF
Sbjct  239   DFLSKCFVKDPTQRWTADMLLEHPFVADQVK-ETVPFKEESEE------LSTSPRCHFDF  291

Query  1042  PDWVS----------ESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVN  1191
              +WVS           SD    SI          SP DR++ +   +S NWS DS  W+ 
Sbjct  292   SEWVSIQSLSPISEVWSDWKLESIFPSLHSSCLASPPDRIRLLTGDRSCNWS-DSGCWIT  350

Query  1192  VR  1197
             +R
Sbjct  351   IR  352



>gb|KHN42087.1| Mitogen-activated protein kinase kinase kinase 3 [Glycine soja]
Length=302

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 163/313 (52%), Positives = 209/313 (67%), Gaps = 23/313 (7%)
 Frame = +1

Query  292   LLNEKAVLDELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSE  471
             L NEK +LD L     VI CFGD ++ ENGE+ YN+ LE+A+ G+LAD++KK    RL E
Sbjct  2     LKNEKEILDCLGASPYVINCFGDDHTVENGEEYYNIFLEYAAGGSLADQVKK-HGGRLPE  60

Query  472   MEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCEL  651
               +RR +++L+ GL +IH  GYVHCD+KLQNIL+ +NG+VKIADFGLAK  G K    E 
Sbjct  61    SYVRRCTRSLVEGLKHIHDNGYVHCDVKLQNILVFQNGDVKIADFGLAKEKGEKQGKLEC  120

Query  652   RGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF--SEVAELLMRIGVGEEI  825
             RGTP++MSPE VN  E    ADIWALGCAV EM  G PAW    S +  LL+RIG GEE+
Sbjct  121   RGTPLFMSPESVNDNEYESPADIWALGCAVVEMVTGKPAWDVRGSNIWSLLIRIGAGEEL  180

Query  826   PEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasap  1005
             P+IP +LS++GKDFL KCF+KDP KRW+AEMLLNHPF++GE    TVS +         P
Sbjct  181   PKIPEELSEEGKDFLLKCFVKDPMKRWSAEMLLNHPFVNGE----TVSFQKVNEPL---P  233

Query  1006  apspspRCPFDFPDWVSESDHLQSSITSLPPPE--------SEYSPADRLQGIVSHQSP-  1158
              PSPSPR  FD   W S    + +S+ S P  +        S  SP +RL+ +V+ Q+P 
Sbjct  234   LPSPSPRTHFDLTHWAST---VTASLPSSPDSDEWRMWEFGSSCSPENRLRRLVTVQTPA  290

Query  1159  NWSQDSDEWVNVR  1197
             NWS+ SD W ++R
Sbjct  291   NWSE-SDGWTSIR  302



>ref|XP_007158842.1| hypothetical protein PHAVU_002G186600g [Phaseolus vulgaris]
 gb|ESW30836.1| hypothetical protein PHAVU_002G186600g [Phaseolus vulgaris]
Length=322

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 162/353 (46%), Positives = 217/353 (61%), Gaps = 36/353 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG+++G G+F  V++ VP ++G      P+ VKS  +   D L NEK +L  L   
Sbjct  1     MNWVRGDSLGHGTFATVNIVVP-ANGFTFFPSPVAVKSSVSHNADLLKNEKEILCRLGSS  59

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +I CFG  ++ ENGE+ YNV LE A+ G+LAD++KK     L E  +RR +++++ GL
Sbjct  60    PYIINCFGHDHTVENGEEFYNVFLEQAAGGSLADQVKK-HGGSLPEPFVRRCTRSIVEGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              +IH+ G+VHCD+KLQN+L+  NGEVKIADFGLAK  G K   CE RGTP++MSPE VN 
Sbjct  119   RHIHEHGFVHCDVKLQNVLVFHNGEVKIADFGLAKEKGEKQGKCECRGTPLFMSPESVND  178

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLE  873
              E  P ADIWALGCAV EM                +RIGVGEE+P+IP  LS++GKDFL 
Sbjct  179   NEYEPPADIWALGCAVVEM----------------IRIGVGEELPKIPEDLSEEGKDFLR  222

Query  874   KCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDWV  1053
             KCF+KDP KRW+AEMLL HPF+  +      S   D   E   P    +    FDFP W 
Sbjct  223   KCFVKDPTKRWSAEMLLKHPFVKVD------SFSFDKVNEPLPPPSPSTH---FDFPHWA  273

Query  1054  SESDHLQSSITSLPPPES----EYSPADRLQGIVSHQSP-NWSQDSDEWVNVR  1197
             S    + +S  S P  +       SP  R++ +V+ + P NWS+ SD W++VR
Sbjct  274   ST---VTASFPSSPYSDEWSGWSCSPESRIRQLVTDKRPENWSE-SDGWMSVR  322



>ref|XP_002310721.2| hypothetical protein POPTR_0007s10930g [Populus trichocarpa]
 gb|EEE91171.2| hypothetical protein POPTR_0007s10930g [Populus trichocarpa]
Length=353

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 164/362 (45%), Positives = 225/362 (62%), Gaps = 23/362 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG  +G GS   V LA  +    +  A  M VKSC  S    L NE+ + +E+  C
Sbjct  1     MEWVRGGCLGYGSSSTVHLATTKKSSSSYPAV-MAVKSCNQSDTTLLKNEREIFNEIGFC  59

Query  334   QEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              E+I+CFGD  + E + E+LYN+LLE+A  G+LA ++KKS    L E +++ Y++++L+G
Sbjct  60    PEIIQCFGDCQTVEEDNERLYNLLLEYAKGGSLAYQLKKS-GGCLQESDVKDYTRSILKG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KL N+LL ENGEVKIADFGLAK+ G K    E+RGTP+YM+PE VN
Sbjct  119   LRHIHSKGFVHCDMKLDNMLLFENGEVKIADFGLAKKAGEKQERVEIRGTPLYMAPESVN  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAE---LLMRIGVGEEIPEIPGKLSDDGK  861
               E     DIWALGC++ EM  G  AW     A    LL+RIG G+E+P IP +LS +GK
Sbjct  179   NNEYESGVDIWALGCSIVEMVTGKSAWNSKPGANMFVLLIRIGEGDELPIIPKELSQEGK  238

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCF+KDP +RWTA+MLL HPF++ +    TV  + ++           SPRC FDF
Sbjct  239   DFLSKCFVKDPTQRWTADMLLEHPFVADQVK-ETVPFKEESEE-----LLPTSPRCHFDF  292

Query  1042  PDWVS-ESDHLQSSITSLPPPESEY---------SPADRLQGIVSHQSPNWSQDSDEWVN  1191
              +WVS +S    S + S    ES +         SP+DR++ +   +S NW  DS  W+ 
Sbjct  293   SEWVSIQSLSPISEVWSDGKLESIFPSLHSSCLASPSDRIRQLTGDRSCNWC-DSGCWIT  351

Query  1192  VR  1197
             +R
Sbjct  352   IR  353



>ref|XP_002306473.2| hypothetical protein POPTR_0005s18240g [Populus trichocarpa]
 gb|EEE93469.2| hypothetical protein POPTR_0005s18240g [Populus trichocarpa]
Length=338

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 217/348 (62%), Gaps = 30/348 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG+ +G GS  +V LA  + H        + VKSC  S    L NE+ V+ EL  C
Sbjct  1     MEWVRGQCIGSGSSSRVHLATLKQH-----PSVLAVKSCAESDSSLLENEREVVTELGYC  55

Query  334   QEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              ++I+ FGD ++ E   E+LYN+LLE+A  G+L+ K+ K       E +++ Y++++L+G
Sbjct  56    PQIIQYFGDSHTVEEKNERLYNLLLEYAKGGSLSQKLNKFGC--FQERDVKDYARSILKG  113

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH  G+VHCD+KL NILL EN EVKIADFGLA++ G      E+RGTP+YM+PE VN
Sbjct  114   LRHIHAKGFVHCDLKLDNILLFENEEVKIADFGLARKAGKAQGRAEIRGTPLYMAPESVN  173

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGK  861
                     DIWALGCAV EM  G PAW     + +  LL+RIG G+E+P IP +LS  GK
Sbjct  174   DNVYESGVDIWALGCAVIEMLTGKPAWSCKPGTNMFVLLIRIGKGDELPTIPEELSQQGK  233

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCF+KDP++RWTA+MLL HPF++ +  G TV LR +          S SPRC FDF
Sbjct  234   DFLSKCFVKDPKRRWTADMLLEHPFVADQGKG-TVPLREEIE------VSSTSPRCHFDF  286

Query  1042  PDWVSESDHLQSSITSLPPPESEYSPADRLQGIV--SHQSPNWSQDSD  1179
             PDWVS    +QS     P P SE+   D + G+V  S  S +W   SD
Sbjct  287   PDWVS----IQS-----PSPRSEFLSDDGV-GLVFPSLNSSSWISASD  324



>ref|XP_010667409.1| PREDICTED: mitogen-activated protein kinase kinase kinase A [Beta 
vulgaris subsp. vulgaris]
Length=344

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/369 (45%), Positives = 226/369 (61%), Gaps = 46/369 (12%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRGE +GRGSFG V+LA+P+S      +   VVKS   S   SL NE+ +L EL   
Sbjct  1     MEWVRGEIIGRGSFGTVNLAIPKSSN----STQFVVKSSEISKCSSLKNEREILLELSNN  56

Query  334   Q-EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
                +I+  GD  S E G ++YN+ LE+AS+G+LAD +K     +    +++ Y+K++L+G
Sbjct  57    HPNIIQYLGDSLSIEKGTQIYNLFLEYASKGSLADHLKFC-GGKFEFSDVKSYTKSILKG  115

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L +IH+ G+VHCDIKLQNILL +N  +KIADFGLA+R   +  G +LRGTP+YMSPE++ 
Sbjct  116   LCHIHQNGFVHCDIKLQNILLLDNTTIKIADFGLARRVSDE-FGKQLRGTPLYMSPEIIA  174

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDDGK  861
             G +    ADIWALGCAV EM  G  AW+ S   +V+ LL RI VG E P+IPG L  +GK
Sbjct  175   GEKVESPADIWALGCAVIEMFSGISAWEMSPESDVSALLYRIAVGGESPKIPGNLCCEGK  234

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL KCFI +P +RWTA+MLL HPF+SG        L +D  ++        SPRCPF+F
Sbjct  235   DFLGKCFINNPNERWTAQMLLEHPFLSG--------LYDDKQQQ-----SFISPRCPFEF  281

Query  1042  PDWVSESDHL----------------QSSITSLPPPESEYSPADRLQG-IVSHQSPNWSQ  1170
             PDW S S                   + S T    P S      RL+G ++S + P+W  
Sbjct  282   PDWQSTSGSSSGSSSDSESISSFGFSEESWTLTSSPISH-----RLEGKLISDRIPDWGA  336

Query  1171  DSDEWVNVR  1197
              S++WV +R
Sbjct  337   -SNDWVTIR  344



>ref|XP_008457763.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Cucumis melo]
Length=346

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 168/363 (46%), Positives = 226/363 (62%), Gaps = 32/363 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLL-NEKAVLDELRG  330
             M+WVRG+ +GRG+F  +SLA   + G     P M VKS  +S     L NEK +LD +  
Sbjct  1     MEWVRGDQLGRGNFATISLA-KLTKGFDQFPPLMAVKSSVSSLSSVSLKNEKQILDRIGV  59

Query  331   CQEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
             C ++I C+GDG+S E +G+K YN+ LE+A+ G+LAD ++ +    LSE ++RRY++A+L 
Sbjct  60    CPQIITCYGDGFSVEKDGDKYYNLFLEYANGGSLADVVR-THGGGLSEFDVRRYTRAILY  118

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGC-------ELRGTPM  666
             GL ++H  G+VHCD+KL N+L+  NGEVKIADFGLAK  G    G        E RGTPM
Sbjct  119   GLRHVHGNGFVHCDLKLSNVLIFGNGEVKIADFGLAKSAG--KFGAVETEERFEWRGTPM  176

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIP  837
             YMSPE+VN GE     DIWALGCAV EM  G PAW+    +++  L+MRIGVG+E+PE P
Sbjct  177   YMSPEIVNDGEYESPCDIWALGCAVVEMVVGKPAWRVGPGTDMFGLMMRIGVGDEVPETP  236

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
               LS +GKDF+ +CF+KDP KRWTAEMLLNHPF+       TV+L+            + 
Sbjct  237   ENLSAEGKDFIRRCFVKDPSKRWTAEMLLNHPFVVAGAGDTTVTLKE-------VELTTE  289

Query  1018  spRCPFDFPDWVSE---SDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWV  1188
             SP  PFDFP++V     SD      +S  P         R++ +V+ +  +WS   D WV
Sbjct  290   SPTGPFDFPEFVCSGQGSDEWSFCSSSSSP-----EVLSRVRHLVTGKPLDWSV-MDSWV  343

Query  1189  NVR  1197
              VR
Sbjct  344   TVR  346



>gb|KHN01177.1| Mitogen-activated protein kinase kinase kinase 1 [Glycine soja]
Length=302

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 207/310 (67%), Gaps = 17/310 (5%)
 Frame = +1

Query  292   LLNEKAVLDELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSE  471
             L NEK +LD L     VI CFGD ++ ENGE+ YN+ LE+A+ G+LAD++K+    RL E
Sbjct  2     LKNEKEILDCLGASPYVINCFGDDHTIENGEEYYNIFLEYAAGGSLADQVKR-HGGRLPE  60

Query  472   MEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCEL  651
               +RR +++++ GL +IH  GYVHCD+KLQNIL+ ENG+VKIADFGLAK  G K    E 
Sbjct  61    SYVRRCTRSIVEGLKHIHDNGYVHCDVKLQNILVFENGDVKIADFGLAKEKGEKQGTFEC  120

Query  652   RGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF--SEVAELLMRIGVGEEI  825
             RGTP++MSPE VN  E    ADIWALGCAV EM  G PAW    S +  LL+RIGVGEE+
Sbjct  121   RGTPLFMSPESVNDNEYESPADIWALGCAVVEMLTGKPAWDVRGSNIWSLLIRIGVGEEL  180

Query  826   PEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasap  1005
             P+IP +LS++GKDFL KCF+KDP KRW+AEMLL+HPF++ E    TVS           P
Sbjct  181   PKIPEELSEEGKDFLLKCFVKDPMKRWSAEMLLHHPFVNNE----TVSFHKVNEP---LP  233

Query  1006  apspspRCPFDFPDWVSE-SDHLQSSITSLPPPESEY----SPADRLQGIVSHQSP-NWS  1167
              PSPSPR  FD   W S  +  L SS  S     +E+    SP +R + +++ Q+P NWS
Sbjct  234   LPSPSPRTHFDLTHWASTVTTWLPSSPDSDEWRMAEFGSSCSPENRFRRLLTDQTPANWS  293

Query  1168  QDSDEWVNVR  1197
             + SD W +VR
Sbjct  294   E-SDGWTSVR  302



>ref|XP_010926984.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Elaeis guineensis]
Length=370

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 171/365 (47%), Positives = 220/365 (60%), Gaps = 24/365 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M WVRG TVGRGSF  VSLA     G +     M VKS   S    L +E+++L  L+ C
Sbjct  1     MVWVRGATVGRGSFATVSLAFVHDGGESQLPKLMAVKSAPLSQSSFLQHEESILTRLQHC  60

Query  334   QEVIRCFGDGYS--FENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
               +IRCF    +  F+  E+ YN+ LE+AS G L+D +++S      E  +RR++++LL 
Sbjct  61    PYIIRCFSHDLAAGFDAREQSYNLFLEYASGGTLSDLVRRS-GGSFPETTVRRFTRSLLE  119

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGC-ELRGTPMYMSPEM  684
             GL  IH  GYVHCDIKLQNIL+  +G+V+IADFGLAK+ G K   C  LRGTP+YMSPE 
Sbjct  120   GLRSIHAEGYVHCDIKLQNILVQSDGDVRIADFGLAKKTGDKVDDCPRLRGTPIYMSPES  179

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLMRIGVGEEIPEIPGKLSDD  855
             V   E    ADIW+LGCAVAEMA G PAW+FS   +V  LL+RIG G+E+PEIP +LSD+
Sbjct  180   VTRNEYEEPADIWSLGCAVAEMASGRPAWRFSGDGDVWALLLRIGFGDELPEIPAELSDE  239

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPF  1035
             GKDFL +CF KD  KRWTAEMLL HPF++      + S  +D   E        SP+   
Sbjct  240   GKDFLRRCFAKDTEKRWTAEMLLGHPFVAD-----SRSFDDDDDAE-CCTPVRSSPKGIL  293

Query  1036  DFPDWVSE-----SDHLQSSITSLPPPES---EYSPADRLQGIVSHQS-PNWSQDSDE--  1182
             DF  WVS      S    +S+ SL P        SP +R+  + + Q  P WS  S    
Sbjct  294   DFSQWVSPASPSLSTCAAASLESLTPSPGGCCYASPTERIGDLATGQGRPEWSCFSSVGF  353

Query  1183  WVNVR  1197
             W++VR
Sbjct  354   WIDVR  358



>ref|XP_010275096.1| PREDICTED: mitogen-activated protein kinase kinase 4-like [Nelumbo 
nucifera]
Length=510

 Score =   283 bits (723),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 226/370 (61%), Gaps = 31/370 (8%)
 Frame = +1

Query  160   WVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             W+RGET+GRGSFG V LA   +       PP M VKS   S   SL  EK +L EL+ C 
Sbjct  6     WMRGETIGRGSFGIVYLAT--TGRTNNPLPPLMAVKSTEFSVSKSLKKEKKILTELQSCP  63

Query  337   EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
              ++RC+GD  + E G   YN+++E+AS G+LAD+I+        E E+RRY++++LRGL 
Sbjct  64    NILRCYGDDITLEGGILTYNMMMEYASGGSLADRIRAYPGG-FPESEVRRYTQSILRGLS  122

Query  517   YIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGG--KNLGCE-LRGTPMYMSPEMV  687
             +IHK GYVHCDIK QNILL     VKIADFGLAK+ G   +N  C  +RGTP+YMSPE +
Sbjct  123   HIHKHGYVHCDIKPQNILL---ETVKIADFGLAKKVGQQRRNKVCRRVRGTPLYMSPESI  179

Query  688   NGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAE---LLMRIGVGEEIPEIPGKLSDDG  858
               GEQ P +DIWALGC V EM  G PAWKF+   E   LL +IG  +E+PEIP   S +G
Sbjct  180   VNGEQEPQSDIWALGCIVIEMRTGRPAWKFTSDTEACGLLYKIGCMKELPEIPSGFSTEG  239

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDD--GATVSLRNDTHREasapapspspRCP  1032
             +DF+EKC +++P+ RWTA+ LL HPF++  D+   A     ++   +A+     PSP+C 
Sbjct  240   RDFVEKCLVRNPKLRWTADKLLKHPFVTVADEVVDANEEELDEALTDAAGVGFVPSPKCA  299

Query  1033  FDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR*CQMS  1212
             F FP         Q++      P S+ S A+ +Q +V+ + PNWS  S  W+ VR     
Sbjct  300   FYFP---------QANF-----PSSD-SLANHIQKLVTGKGPNWS-SSKSWITVRQADPV  343

Query  1213  TVNLQKLQSC  1242
             + +L K   C
Sbjct  344   SSHLNKCTVC  353



>ref|XP_002306472.2| hypothetical protein POPTR_0005s18230g, partial [Populus trichocarpa]
 gb|EEE93468.2| hypothetical protein POPTR_0005s18230g, partial [Populus trichocarpa]
Length=342

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 217/349 (62%), Gaps = 24/349 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+WVRG  +G GS   V LA  ++   +     M VKSC  S    L NE+ VL+E+  C
Sbjct  1     MEWVRGGCLGYGSSSTVHLATSKNSS-STYPEVMAVKSCNQSDTTLLENEREVLNEIGFC  59

Query  334   QEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              ++I+CFGD  + E N E LYN+LLE+A  G+L+ K+KKS    L E +++ Y++++L+G
Sbjct  60    PQIIQCFGDCQATEENNEFLYNLLLEYAKGGSLSYKLKKS-GGCLQEGDVKDYTRSILKG  118

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             L Y+H  G+VHCD+KL NILL ENGEVKIADFGLAK+ G K    E+RGTP+YM+PE VN
Sbjct  119   LSYVHGKGFVHCDLKLDNILLFENGEVKIADFGLAKKTGQKQGRAEIRGTPLYMAPESVN  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPGKLSDDGK  861
               E    ADIWALGCA+ EM  G PAW     + +  LL+RIG G+E+P IP +LS  GK
Sbjct  179   KNEYESGADIWALGCAIVEMVTGKPAWNCKPGTNMFVLLIRIGEGDELPIIPEELSQQGK  238

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL K F+KDP +RWTA+MLL HPF++ ++    V L+ ++         S SPRC F+F
Sbjct  239   DFLSKIFVKDPTQRWTADMLLKHPFVA-DNFQENVPLKEESKE------LSTSPRCHFNF  291

Query  1042  PDWVSE-----------SDHLQSSITSLPPPESEYSPADRLQGIVSHQS  1155
             P+W S            SD    S +S        SPADR++ +   QS
Sbjct  292   PEWASSQSSSSPRSELWSDGKVESTSSSLNSSCWTSPADRIRELAGDQS  340



>ref|XP_004149711.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Cucumis sativus]
 ref|XP_004169619.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Cucumis sativus]
 gb|KGN61977.1| hypothetical protein Csa_2G278170 [Cucumis sativus]
Length=345

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/363 (45%), Positives = 229/363 (63%), Gaps = 33/363 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLL--NEKAVLDELR  327
             M+W+RG+ +GRG+F  ++LA   + G     P M VKS  +S        NEK +LD + 
Sbjct  1     MEWIRGDQLGRGNFATINLA-KLTKGFDQFPPLMAVKSSVSSLSSVSSLKNEKQILDRIG  59

Query  328   GCQEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
              C ++I C+GDG+S E +G+K YN+ LE+A+ G+LAD ++      LSE ++RRY++A+L
Sbjct  60    VCPQIITCYGDGFSVEKDGDKCYNLFLEYANGGSLADALR-IHGGGLSEFDVRRYTRAIL  118

Query  505   RGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCEL------RGTPM  666
              GL ++H  G+VHCD+KL N+L+  NGEVKIADFGLAK + GK    E       RGTPM
Sbjct  119   CGLQHVHGNGFVHCDLKLSNVLIFGNGEVKIADFGLAK-SAGKFAAVETEERFEWRGTPM  177

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIP  837
             YMSPE+VN GE     DIWALGCAV EM  G PAW+    +++  L+MRIGVG+E+PE+P
Sbjct  178   YMSPEIVNDGEYESPCDIWALGCAVVEMVVGKPAWRVGPETDMFGLMMRIGVGDEVPEVP  237

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
               LS +GKDF+ +CF+KDP KRWTAE+LLNHPF++G  D  TV+L+            + 
Sbjct  238   ENLSAEGKDFIRRCFVKDPSKRWTAEILLNHPFVAGAGD--TVTLKE-------VELATE  288

Query  1018  spRCPFDFPDWVSE---SDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWV  1188
             SP  PFDFP++V     SD      +S  P         R++ +++ +  +WS   D WV
Sbjct  289   SPTGPFDFPEFVCSGQGSDEWSFCSSSSSP-----EVLSRVRQLMTGKPLDWSV-MDSWV  342

Query  1189  NVR  1197
              VR
Sbjct  343   TVR  345



>ref|XP_003611723.1| Mitogen-activated protein kinase kinase kinase A [Medicago truncatula]
 gb|AES94681.1| MAP kinase kinase kinase [Medicago truncatula]
Length=313

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 186/280 (66%), Gaps = 11/280 (4%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV--VKSCGASCFDSLLNEKAVLDELR  327
            M+WVRG ++G GSF  V LA    H       P +  VKS       SL NEK +LD L 
Sbjct  1    MNWVRGHSLGSGSFATVYLA---KHPEDSVTFPQLTAVKSSNLHDSYSLQNEKQILDRLG  57

Query  328  GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
                VI+CFG   + EN E+ YN+ LE+AS G L+D+++K    +L +  +RRY+++++ 
Sbjct  58   SSPHVIKCFGQDKTVENDEEYYNIFLEYASGGTLSDQLEK-HGGKLPDNLVRRYTRSVVE  116

Query  508  GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN-LGCELRGTPMYMSPEM  684
            GL YIHK G+VHCD+KL NIL+ ENG +KI+DFGLAK  G +     + RGTPM MSPE 
Sbjct  117  GLKYIHKKGFVHCDLKLPNILVFENGNIKISDFGLAKETGVEQGEKWQPRGTPMIMSPEA  176

Query  685  VNGGEQGPAADIWALGCAVAEMAGGAPA-WKFSEVAELLMRIGVGEEIPEIPGKLSDDGK  861
            VN      +ADIWALGCAV EM  G PA W  S++  L +RIGVGEE+P+IP +LS +GK
Sbjct  177  VNDSVYESSADIWALGCAVVEMITGEPAAWNESDMLMLTIRIGVGEELPKIPEELSQEGK  236

Query  862  DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRND  981
            DFLEKCFIKDP +RWTA+ML  HPFIS   D  TVS+ N+
Sbjct  237  DFLEKCFIKDPLRRWTADMLFKHPFIS---DVETVSVVNE  273



>ref|XP_011101212.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Sesamum indicum]
Length=205

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 153/196 (78%), Gaps = 3/196 (2%)
 Frame = +1

Query  343  IRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGYI  522
            I CFGD  S+E GEKLYNVLLE+A  GALADK++ S+   + E E+R Y+KALL+G  YI
Sbjct  10   IWCFGDSCSYEKGEKLYNVLLEYAPGGALADKLRNSDGGGMPESEVRVYTKALLKGNIYI  69

Query  523  HKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN---LGCELRGTPMYMSPEMVNG  693
            HK GYVHCDIKLQNI L  NG VKI DFGLAKR+GG+     GCELRGTP+Y+SPEMV G
Sbjct  70   HKFGYVHCDIKLQNIFLGANGRVKIGDFGLAKRDGGRKGAATGCELRGTPLYISPEMVVG  129

Query  694  GEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLE  873
            G+QGP ADIWALGC VAEM  G PAW+ S++A  +MRI VGEE+PEIP  LS +G+DFL 
Sbjct  130  GKQGPPADIWALGCVVAEMLFGNPAWRCSDIAGWMMRIEVGEEVPEIPRSLSKEGRDFLC  189

Query  874  KCFIKDPRKRWTAEML  921
            K F+KDP KRWT EML
Sbjct  190  KYFVKDPSKRWTVEML  205



>ref|XP_011093943.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Sesamum indicum]
Length=227

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 151/188 (80%), Gaps = 3/188 (2%)
 Frame = +1

Query  367  SFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGYIHKVGYVHC  546
            S+E GEKLYNVLLE+A   ALADK++ S    + E E+R Y++ALL+G+ YIHK GYVHC
Sbjct  40   SYEKGEKLYNVLLEYALGDALADKLRNSGGGGMLESEVRGYTEALLKGIHYIHKFGYVHC  99

Query  547  DIKLQNILLCENGEVKIADFGLAKRNGGKN---LGCELRGTPMYMSPEMVNGGEQGPAAD  717
            DIKLQNILL  NG VKI  FGLAKR+GG+     GCELRGTP+YMSPEMV GGEQGP  D
Sbjct  100  DIKLQNILLGANGRVKITHFGLAKRDGGRKGAATGCELRGTPLYMSPEMVVGGEQGPPTD  159

Query  718  IWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPR  897
            IWALGC VAEM  G PAW+ S++A L+MRIGVG+E+PEIP  LS++G+DFL KCF+KDP 
Sbjct  160  IWALGCVVAEMLSGNPAWRCSDIAGLMMRIGVGKEVPEIPRSLSEEGRDFLGKCFVKDPS  219

Query  898  KRWTAEML  921
            KRWTAEML
Sbjct  220  KRWTAEML  227



>ref|XP_004512214.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cicer arietinum]
Length=308

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/275 (49%), Positives = 179/275 (65%), Gaps = 14/275 (5%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            M+WVRG ++G G+F  V LA+   H +        VKS  A     LLNEK +LD L   
Sbjct  1    MNWVRGPSLGSGTFATVDLAIHTQHSV-NFPSLTAVKSAYAYNSYYLLNEKHILDRLGSS  59

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENH--RLSEMEIRRYSKALLR  507
              +++CFG   + ENG K YN+ LE+A+ G L+D++K   NH  +  E  +RRY+K++++
Sbjct  60   PFIVKCFGHDQTLENGVKFYNIFLEYAAGGTLSDQLK---NHGGKFPETLVRRYTKSIVK  116

Query  508  GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK---NLGCELRGTPMYMSP  678
            GL +IH+ G+VHCD+KLQNIL+ ++  +KI+DFGL+K  G K   N  C  RGTPM+MSP
Sbjct  117  GLKHIHENGFVHCDLKLQNILVFDDDNIKISDFGLSKAKGLKLCENWEC--RGTPMFMSP  174

Query  679  EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKLS  849
            E VN        DIWALGC V EM  G  AW   +   +  L +RIG+GEE+P IP +LS
Sbjct  175  ESVNDNVYESPTDIWALGCTVVEMVTGKSAWNVGDNDNIWSLFVRIGIGEELPLIPNELS  234

Query  850  DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDD  954
            D+GKDFLEKCF+KD  KRW AEMLL HPFI  +D+
Sbjct  235  DEGKDFLEKCFVKDHLKRWNAEMLLKHPFIFEDDE  269



>ref|XP_011073592.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase 3-like [Sesamum indicum]
Length=199

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 147/188 (78%), Gaps = 3/188 (2%)
 Frame = +1

Query  367  SFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGYIHKVGYVHC  546
            S+E GEKLYNVLLE+A  GALADK +     R+ E E+R Y+KALL+G+ YIHK GYVHC
Sbjct  12   SYEKGEKLYNVLLEYAPGGALADKFRNFGGGRMPESEVRGYTKALLKGIHYIHKFGYVHC  71

Query  547  DIKLQNILLCENGEVKIADFGLAKRNGGKN---LGCELRGTPMYMSPEMVNGGEQGPAAD  717
            DIKLQNILL  NG VKIADFGLAKR+GG+     GCELRGTP+YMSPEMV GG QG   D
Sbjct  72   DIKLQNILLGVNGRVKIADFGLAKRDGGRKGVATGCELRGTPLYMSPEMVAGGGQGRPTD  131

Query  718  IWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPR  897
            IW LGC +AEM    PAW+ S +AEL+MRIGVGEE+ EIP  LS++G+DFL KCF+KDP 
Sbjct  132  IWTLGCVMAEMLSENPAWRCSNIAELMMRIGVGEEVLEIPEXLSEEGRDFLGKCFVKDPS  191

Query  898  KRWTAEML  921
            KRWT EML
Sbjct  192  KRWTTEML  199



>ref|XP_009418852.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Musa acuminata subsp. malaccensis]
Length=397

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 166/380 (44%), Positives = 229/380 (60%), Gaps = 36/380 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV--VKSCGASCFDSLLNEKAVLDELR  327
             M+W  G  +GRGSFG V LA  R    A    P+V  VKS   +  DSL +E++VL +LR
Sbjct  1     MEWSSGAVLGRGSFGTVRLAFVRR---AEDNRPLVMAVKSAPLATSDSLRHEESVLSDLR  57

Query  328   GCQEVIRCFGDGYSFE--NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKAL  501
              C  ++RCFG   + +  +G + YN+ LE+ + G L D + +S    L E  +RRY++++
Sbjct  58    CCPHLVRCFGHDVTTDAASGAQFYNLFLEYVAGGTLRDVLGRSGGA-LREPAVRRYARSI  116

Query  502   LRGLGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKRN----GGKNLGCELRGTP  663
             LR L  +H  GYVHCD+KLQNIL+ ENG  +VKIAD GLAKR       ++ G  +RGTP
Sbjct  117   LRALDRVHSGGYVHCDLKLQNILV-ENGGADVKIADLGLAKRIEKEIDARDRG-SMRGTP  174

Query  664   MYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAE---LLMRIGVGEEIPEI  834
             +YMSPE V   E G   DIW+ GCAVAEM  G PAW  S+  +   L+ RIG  +E+P+I
Sbjct  175   LYMSPESVARREYGAPGDIWSFGCAVAEMVTGRPAWSGSDDGDAWGLMFRIGFSDELPDI  234

Query  835   PGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapaps  1014
             P KLS++GKDFL +CF+KDP KRWTAEMLL HPFI+ E+D     L +         +  
Sbjct  235   PSKLSEEGKDFLSRCFVKDPFKRWTAEMLLQHPFIAAEED-----LVDAAAACNRCSSTE  289

Query  1015  pspRCPFDFPDWV---SESDHLQSSITSLPPPESEY-SPADRLQGIVSHQS-----PNWS  1167
              SPR  F  P W+   S S+ + SS+     P+S   SP+DR++ + + Q      P+ S
Sbjct  290   SSPRSVFGLPQWLSPRSPSNSIDSSLMESVAPDSRVSSPSDRIRELATMQQPTWSSPSTS  349

Query  1168  QDSDEWVNVR*CQMSTVNLQ  1227
               +D W++VR   +S  NL+
Sbjct  350   SSADGWIDVR---ISDANLK  366



>ref|XP_011070691.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase NPK1-like [Sesamum indicum]
Length=198

 Score =   253 bits (647),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 147/188 (78%), Gaps = 3/188 (2%)
 Frame = +1

Query  367  SFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGYIHKVGYVHC  546
            S+E GEKLYNVLLE+A  GALA K++      + + E+R Y+KALL+ + YIHK GYVHC
Sbjct  11   SYEKGEKLYNVLLEYAPSGALAYKLRNFGGGGMPKSEVRGYTKALLKXIHYIHKFGYVHC  70

Query  547  DIKLQNILLCENGEVKIADFGLAKRNGGKN---LGCELRGTPMYMSPEMVNGGEQGPAAD  717
            DIKLQNILL  NG VKIA FGL KR+GG+    +GCELRGTP+YM  EMV  GEQGP AD
Sbjct  71   DIKLQNILLVANGRVKIAHFGLPKRDGGRKGAAMGCELRGTPLYMLLEMVARGEQGPPAD  130

Query  718  IWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPR  897
            IWALGC VAEM  G P W+ S++A L+MRIGVGEE+PEIP  LS++G+DFL KCF+KDP 
Sbjct  131  IWALGCVVAEMLSGNPTWRCSDIAGLIMRIGVGEEVPEIPRSLSEEGRDFLGKCFVKDPS  190

Query  898  KRWTAEML  921
            KRWTAEML
Sbjct  191  KRWTAEML  198



>ref|XP_009396717.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Musa acuminata subsp. malaccensis]
Length=473

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 210/376 (56%), Gaps = 33/376 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRG  330
             M+W RG  VGRGSFG VSLA  R        P  M VKS        L  EKAVL +L+ 
Sbjct  1     MEWTRGAVVGRGSFGTVSLAFVRREDEHRQLPSLMAVKSAPLPRAAFLREEKAVLSDLQD  60

Query  331   CQEVIRCFGDGYSFE--NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
             C  V+RCFG+  + +   G   YN+ LEF + G L D +++S    L E  +RRY++++L
Sbjct  61    CPHVVRCFGEEVAPDAATGTPTYNLFLEFVAGGTLHDLLRRSGGS-LRESSVRRYARSIL  119

Query  505   RGLGYIHKVGYVHCDIKLQNILLCENG-EVKIADFGLAKRNGGK-----NLGCELRGTPM  666
             RGL  +H  GY HCD+KLQNIL+   G +VKIADFGLA+R G K       G  +RGTP+
Sbjct  120   RGLHCVHSRGYAHCDVKLQNILVDRRGGDVKIADFGLAQRIGDKIHGGAGAGGGIRGTPL  179

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIP  837
             YMSPE    GE G  ADIW++GCAVAEM  G PAW      +  ELL RIG G+++PEIP
Sbjct  180   YMSPESAARGECGAPADIWSVGCAVAEMVSGRPAWGRPGGGDAWELLYRIGFGDQLPEIP  239

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
              +LS++GKDFL +CF+KDP +RWTAEMLL HPF++  DD    S                
Sbjct  240   SELSEEGKDFLRRCFVKDPAERWTAEMLLQHPFVAPNDDLVDDSAEAAAVDGKHCSVADA  299

Query  1018  spRCPFDF--------------PDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQS  1155
             SPR  F                 DW      ++S     P      + A R++ + + Q 
Sbjct  300   SPRSVFGLSQWSSSSRSPPSCSTDW----GLMESVAAEGPASRVLPAAAGRVRDLANTQL  355

Query  1156  PNWS--QDSDEWVNVR  1197
             P+WS    SD W++VR
Sbjct  356   PDWSSCSSSDGWIDVR  371



>gb|KHN08177.1| Serine/threonine-protein kinase BCK1/SLK1/SSP31 [Glycine soja]
Length=346

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 168/264 (64%), Gaps = 4/264 (2%)
 Frame = +1

Query  157  DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
            +WVRGE++G GS   V++A+P +        P  VKS       SL  EK VLD L    
Sbjct  4    NWVRGESLGSGSAATVNIAIPTNPSTHNFPSPTAVKSSLFLTSYSLKTEKDVLDILGPSP  63

Query  337  EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
             +I+C+G+  + ENG++ YNV LE+A+ G+LAD++KK    R  E  +RR +K++L GL 
Sbjct  64   NIIKCYGNDCTVENGKRYYNVFLEYAAGGSLADQLKKYGG-RFPEAYVRRRTKSILEGLK  122

Query  517  YIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNGG  696
            +IH  GYVHCD+K QNIL+ +NG VKIAD GLAKR G  N     RGTPMYMSPE +   
Sbjct  123  HIHSKGYVHCDVKPQNILVFDNGVVKIADLGLAKRRGEINREYVCRGTPMYMSPESLTDN  182

Query  697  EQGPAADIWALGCAVAEMAGGAPAWKFSEVAE---LLMRIGVGEEIPEIPGKLSDDGKDF  867
                  DIWALGC + EM  G  AW          L+ RIG+GEE+P+IP +LS  GKDF
Sbjct  183  VYESPVDIWALGCTIVEMITGEHAWYVGSCENTWTLMNRIGIGEELPKIPQELSQQGKDF  242

Query  868  LEKCFIKDPRKRWTAEMLLNHPFI  939
            L KC +KDP KRWTA MLLNHPFI
Sbjct  243  LGKCLVKDPNKRWTAHMLLNHPFI  266



>ref|XP_009802290.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana sylvestris]
Length=439

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/290 (49%), Positives = 181/290 (62%), Gaps = 18/290 (6%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLA-VPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELR  327
            + W RG  +G+GSFG V +A +  S    G  P  M VKS   S   S+  E+ VL+ ++
Sbjct  38   VSWYRGAMLGKGSFGHVYVAKLKNSRSKNGYLPSVMAVKSAEVSISGSIQKEREVLNNIK  97

Query  328  GCQEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
            GC  +IRC+GD  +  ENG  +YN+LLE+ S G LA++IKK  N  L E E+R Y++++L
Sbjct  98   GCPYIIRCYGDETTTDENGMMVYNLLLEYGSGGTLAERIKKLGNKGLPEFEVRSYTRSML  157

Query  505  RGLGYIHKVGYVHCDIKLQNILLCENG-------EVKIADFGLAKRNG---GKNLGCELR  654
            RGL YIH +GYVHCD+K  NILL  N          KI DFGLAKR      + L    R
Sbjct  158  RGLNYIHTIGYVHCDMKPDNILLVLNSSKGSNEFRAKIGDFGLAKRENQSKKRRLETYWR  217

Query  655  GTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEI  825
            GTPMY+SPE V    Q  AADIWALGC V EM  G P W   E     ++L +IG G E+
Sbjct  218  GTPMYLSPEAVADSVQESAADIWALGCIVFEMLTGKPPWNQKEDMDAEDVLKKIGEGHEL  277

Query  826  PEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGATVS  969
            P+IPG+LS + KDFL+ CF++ PR RWTAEMLLNHPF+ G  +DDG   S
Sbjct  278  PKIPGELSKEAKDFLKGCFVRKPRYRWTAEMLLNHPFVEGLSDDDGVEES  327



>ref|XP_009615697.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana tomentosiformis]
Length=412

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 182/286 (64%), Gaps = 19/286 (7%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDELRGC  333
            W RG  VG+GSFG V LA  ++  +  +  P  M VKS   S   S+  E+ VL+ ++GC
Sbjct  12   WYRGAMVGKGSFGCVYLATLKNPRLKNSYFPAVMAVKSAEVSVSGSIQKEREVLNNIKGC  71

Query  334  QEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              +IRCFGD  +  +NG  +YN+LLE+ S G LA++IKKS    LSE E+R Y++++LRG
Sbjct  72   PYIIRCFGDETTTGQNGAMVYNLLLEYGSGGTLAERIKKSGIKGLSEFEVRNYTRSMLRG  131

Query  511  LGYIHKVGYVHCDIKLQNILLCENG--------EVKIADFGLAKRNG---GKNLGCELRG  657
            L +IH +GYVHCD+K  N+LL  N           KI D GLAKR      + L    RG
Sbjct  132  LHFIHTIGYVHCDMKPDNVLLVPNSSDGSGAEFRAKIGDLGLAKRENQSKKRRLEPYWRG  191

Query  658  TPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE--VAE-LLMRIGVGEEIP  828
            TPMY+SPE V+   Q   ADIWALGC V EM  G P W   E  VAE +L +IG G E+P
Sbjct  192  TPMYLSPEAVSDNIQECPADIWALGCIVLEMLTGKPPWDREEYMVAEDVLKKIGGGHELP  251

Query  829  EIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGA  960
            +IPG LS + KDFL+ CF+++PR RWTAEMLLNHPF+ G  +D+G 
Sbjct  252  KIPGNLSKEAKDFLKGCFVRNPRYRWTAEMLLNHPFVEGLIDDEGV  297



>ref|XP_003520404.1| PREDICTED: serine/threonine-protein kinase BCK1/SLK1/SSP31-like 
[Glycine max]
Length=463

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 167/264 (63%), Gaps = 4/264 (2%)
 Frame = +1

Query  157  DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
            +WVRGE++G GS   V++ +P +        P  VKS       SL  EK VLD L    
Sbjct  9    NWVRGESLGSGSAATVNIVIPTNPSTHNFPSPTAVKSSLFLTSYSLKTEKDVLDILGPSP  68

Query  337  EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
             +I+C+G+  + ENG++ YNV LE+A+ G+LAD++KK    R  E  +R+ +K++L GL 
Sbjct  69   NIIKCYGNDCTVENGKRYYNVFLEYAAGGSLADQLKKYGG-RFPEACVRQCTKSILEGLK  127

Query  517  YIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNGG  696
            +IH  GYVHCD+K QNIL+ +NG VKIAD GLAKR G  N     RGTPMYMSPE +   
Sbjct  128  HIHSKGYVHCDVKPQNILVFDNGVVKIADLGLAKRRGEINREYVCRGTPMYMSPESLTDN  187

Query  697  EQGPAADIWALGCAVAEMAGGAPAWKFSEVAE---LLMRIGVGEEIPEIPGKLSDDGKDF  867
                  DIWALGC + EM  G  AW          L+ RIG+GEE+P+IP +LS  GKDF
Sbjct  188  VYESPVDIWALGCTIVEMITGEHAWYVGSCENTWTLMNRIGIGEELPKIPQELSQQGKDF  247

Query  868  LEKCFIKDPRKRWTAEMLLNHPFI  939
            L KC +KDP KRWTA MLLNHPFI
Sbjct  248  LGKCLVKDPNKRWTAHMLLNHPFI  271



>ref|XP_009783859.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana sylvestris]
Length=412

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 180/286 (63%), Gaps = 19/286 (7%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDELRGC  333
            W RG  VG+GSFG V LA  ++  +  +  P  M VKS   S   S+  E+ VL+ ++GC
Sbjct  12   WYRGAMVGKGSFGCVYLATLKNPRLKNSYFPAVMAVKSAEVSVSGSIQKEREVLNNIKGC  71

Query  334  QEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              +IRCFGD  +  +NG  +YN+LLE+ S G LA++IKKS    LSE E+R Y++++LRG
Sbjct  72   PYIIRCFGDETTTGQNGAMVYNLLLEYGSGGTLAERIKKSGIKGLSEFEVRNYTRSMLRG  131

Query  511  LGYIHKVGYVHCDIKLQNILLCENG--------EVKIADFGLAKRNG---GKNLGCELRG  657
            L +IH +GYVHCD+K  N+LL  N           KI D GLAKR      + L    RG
Sbjct  132  LHFIHTIGYVHCDMKPDNVLLVPNSSEGSGAEFRAKIGDLGLAKRENQSKKRRLEPYWRG  191

Query  658  TPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIP  828
            TPMY+SPE V+   Q   ADIWALGC V EM  G P W   E     ++L +IG G E+P
Sbjct  192  TPMYLSPEAVSDNVQECPADIWALGCIVLEMLTGKPPWDREEDMDAEDVLKKIGGGHELP  251

Query  829  EIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGA  960
            +IPG LS + K+FL+ CF+++PR RWTAEML+NHPF+ G  +D+G 
Sbjct  252  KIPGNLSKEAKNFLKGCFVRNPRYRWTAEMLMNHPFVEGLIDDEGV  297



>ref|XP_010273710.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Nelumbo nucifera]
Length=422

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 180/291 (62%), Gaps = 30/291 (10%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVP------RSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDE  321
            W RG T+G+GSFG VSLA        RS+      P + VK    S   SL  EK +L  
Sbjct  20   WTRGATIGKGSFGTVSLAKTTGPNKRRSY----LPPSIAVKWTEVSDSYSLQKEKEILSN  75

Query  322  LRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKAL  501
              GC  ++ CFG+  + ENG+ +YNVLLE+ + G+LAD+I+ S    L E E++RY++++
Sbjct  76   FSGCPYILHCFGEEVTVENGQMIYNVLLEYGAGGSLADRIRNSAGG-LPESEVKRYTRSI  134

Query  502  LRGLGYIHKVGYVHCDIKLQNILLC------------ENGEVKIADFGLAKR--NGGKNL  639
            LRGL YIH   YVHCDIK QNILL             E+   KIADFG+AK+     KN 
Sbjct  135  LRGLSYIHAQSYVHCDIKPQNILLVPASSLIKKRRKGEDYVAKIADFGVAKKVQQKWKNE  194

Query  640  GCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW--KFSEVAE-LLMRIG  810
                RGTP+YMSPE +    Q P +DIWALGC V+EM  G PAW  K  E  + LL RIG
Sbjct  195  TPCWRGTPLYMSPESIAHNSQEPPSDIWALGCVVSEMISGKPAWSCKPGETRDDLLQRIG  254

Query  811  VGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS--GEDDG  957
               E+P IPG LS++GKDFL++CF++    RWTAEMLL+HPF++  GED G
Sbjct  255  WSHELPRIPGDLSNEGKDFLKRCFVRTTMFRWTAEMLLHHPFVASDGEDIG  305



>ref|XP_010273783.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nelumbo nucifera]
Length=415

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 176/286 (62%), Gaps = 24/286 (8%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGI--AGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            W+RG+T+GRG F +VSLA+ R          P M VK       D+L  E+ VL +L GC
Sbjct  22   WLRGKTIGRGGFSRVSLAMTRRVNTRRCNLPPIMAVKWAEILQSDTLQEEREVLADLDGC  81

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++ CFGD  +F N E  +N+LLE+ S G+LA  IK+S N  L E E++RY+K++L GL
Sbjct  82   PHIVHCFGDEVTFGNNELYFNLLLEYGSGGSLAQHIKRS-NGGLPESEVKRYTKSILEGL  140

Query  514  GYIHKVGYVHCDIKLQNILLCENGE------------------VKIADFGLAKRNGGKNL  639
             YIH  GYVHCDIK  NI+L  +                    VKIADFGLAK+   K L
Sbjct  141  VYIHSRGYVHCDIKPANIILVPSSTFAFSLSSRKRTTRSYCYVVKIADFGLAKKVQQKKL  200

Query  640  GCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIG  810
                RGTP+Y+SPE+V  G Q   ADIWALGC VAEM  G PA      S+V  +L +I 
Sbjct  201  KSGWRGTPLYLSPEVVRDGIQEAPADIWALGCTVAEMITGKPALSCKVGSDVNCILFQIS  260

Query  811  VGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGE  948
             G  +PE+P ++SD+GKDFL  CF+K+   RWTA+MLLNHPFI+G+
Sbjct  261  SGFSLPEVPSEMSDEGKDFLNMCFMKNAELRWTAKMLLNHPFIAGD  306



>ref|XP_009604127.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana tomentosiformis]
Length=430

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 174/283 (61%), Gaps = 16/283 (6%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLA-VPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELR  327
            + W RG  +G+GSFG V LA +  +    G  P  M VKS   S   S+  E+ VL+ ++
Sbjct  38   VSWYRGAMLGKGSFGHVYLAKLKNTRSKNGYLPSVMAVKSAEVSISGSIQKEREVLNNIK  97

Query  328  GCQEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
             C  +IRC+GD  +  ENG  +YN+LLE+ S G LA++IKK  N  L E E+R Y++++L
Sbjct  98   ACPYIIRCYGDETTTGENGMMVYNLLLEYGSGGTLAERIKKLGNKGLPEFEVRSYTRSML  157

Query  505  RGLGYIHKVGYVHCDIKLQNILLCENG-------EVKIADFGLAKRNG---GKNLGCELR  654
            +GL YIH +GYVHCD+K  NILL  N          KI D GLAKR      + L    R
Sbjct  158  KGLNYIHAIGYVHCDMKPDNILLVLNSSKGSNEFRAKIGDLGLAKRENQSKKRRLETYWR  217

Query  655  GTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEI  825
            GTPMY+SPE V    Q   ADIWALGC V EM  G P W   E     ++L +IG G E+
Sbjct  218  GTPMYLSPEAVAENVQESPADIWALGCIVLEMLTGKPPWNQKEDMDAEDVLKKIGEGHEL  277

Query  826  PEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDD  954
            P+IPG+LS + K FL+ CF+++PR RWTAEMLLNHPF+ G  D
Sbjct  278  PKIPGELSKEAKGFLKGCFVRNPRYRWTAEMLLNHPFVEGLSD  320



>ref|XP_006341415.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum tuberosum]
Length=405

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 182/289 (63%), Gaps = 21/289 (7%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGA--APPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            W RG  VG+GSFG V LA  ++  +  +   P M VKS   S   S+  EK VL+ ++GC
Sbjct  12   WYRGAMVGKGSFGCVYLATLKNPKLNYSYFPPAMAVKSAEVSVSGSIQKEKEVLNNIKGC  71

Query  334  QEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              +IRCFGD  +  +NG  +YN+LLE+ S G LA++I KS    LSE E+R +++++LRG
Sbjct  72   PYIIRCFGDETTTGQNGAMVYNLLLEYGSGGTLAERINKS---GLSEFEVRNHTRSMLRG  128

Query  511  LGYIHKVGYVHCDIKLQNILLCENG-------EVKIADFGLAKRNG---GKNLGCELRGT  660
            L  IH +GYVHCD+K +N+LL  N        +VKI D GLAKR      + L    RGT
Sbjct  129  LLCIHTIGYVHCDMKPENVLLVPNSSKGSTEFKVKIGDLGLAKRENQSKKRRLEPYWRGT  188

Query  661  PMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAE---LLMRIGVGEEIPE  831
            PMY+SPE V    Q   ADIWALGC V EM  G P W   +  +   +L +IG G+E+P+
Sbjct  189  PMYLSPEAVADNVQECPADIWALGCIVLEMLTGKPPWDRDDDMDAEDVLRKIGGGKELPK  248

Query  832  IPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGATVSL  972
            IPG LS D KDFL+ CF+++PR RWTAEMLLNHPF+ G  ED+G    L
Sbjct  249  IPGNLSKDAKDFLKGCFVRNPRYRWTAEMLLNHPFVDGLVEDEGVEQPL  297



>ref|XP_011020573.1| PREDICTED: protein kinase byr2-like [Populus euphratica]
Length=391

 Score =   247 bits (631),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 142/298 (48%), Positives = 183/298 (61%), Gaps = 20/298 (7%)
 Frame = +1

Query  112  ELQNSTICSTRRGAMDWVRGETVGRGSFGKVSLAV---PRSHGIAGAAPP-MVVKSCGAS  279
            E + S  C+   G + W RG  +GRG FG V LA    P+S    G  PP M VKS   S
Sbjct  9    EEEESMKCNNNNGGVAWSRGPLIGRGGFGSVYLASLKNPKSRN--GYYPPVMAVKSAEVS  66

Query  280  CFDSLLNEKAVLDELRGCQEVIRCFGD-GYSFENGEKLYNVLLEFASQGALADKIKKSEN  456
               SL  EK V + L GC  +I+CFG+   S ++GE  YNVLLE+AS G LA  IKKS+ 
Sbjct  67   ASCSLQKEKEVFNCLNGCPFIIKCFGEETTSNKDGEMFYNVLLEYASGGNLACLIKKSDG  126

Query  457  HRLSEMEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCEN----GE--VKIADFGLA-  615
              L E++++R+++++L G+ YIH  GYVHCD+K +NILL  N    GE   K+ DFGLA 
Sbjct  127  VGLPELDVKRHTRSILEGICYIHSRGYVHCDLKPENILLVSNSAKAGEFVAKVGDFGLAK  186

Query  616  ---KRNGGKNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS--  780
               KRN    +   LRGT +YM+PE V    Q P  DIWALGC V EM  G PAW     
Sbjct  187  KSEKRNKKMKIDPYLRGTALYMAPETVANHVQEPPCDIWALGCVVLEMLTGKPAWDLKPH  246

Query  781  -EVAELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGED  951
                ELL +IG G E+P+IP ++S D KDFL++CF+ +P  R+TAEMLL+ PF+SG D
Sbjct  247  VTTEELLRKIGDGYELPKIPSQISKDAKDFLKRCFVANPMFRFTAEMLLDEPFVSGVD  304



>gb|KCW54944.1| hypothetical protein EUGRSUZ_I00918 [Eucalyptus grandis]
Length=336

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 205/380 (54%), Gaps = 76/380 (20%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDWVRG+ +G G F  + LA P     +G  P M VKSC  +   SL +E+ VL EL  C
Sbjct  1     MDWVRGKEIGHGGFATIHLATPAETCPSGLPPLMAVKSCDEALSSSLRHERRVLSELGEC  60

Query  334   QEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               ++RCFG   + E +GE+LYNVLLE+A+ G+LAD +K S    LSE EIRR+++++L G
Sbjct  61    PRIVRCFGHSLTSERSGEELYNVLLEYAAGGSLADSMK-SRGKLLSEPEIRRHTRSILEG  119

Query  511   LGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKR------NGGKNLGCELRGTPM  666
             L ++H  G+VHCD+KLQNIL+  +G  EVKIADFGLAKR       GGK  G E RGTPM
Sbjct  120   LEFVHSKGFVHCDVKLQNILVFPSGGEEVKIADFGLAKRAGERLAKGGKQGGVEWRGTPM  179

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEIPEIP  837
             YM+PE V   E  P AD+WALGCAV EMA G P W     S    L++RIGVG+EIPEIP
Sbjct  180   YMAPESVKHNEYEPPADVWALGCAVVEMATGRPPWGSRAESNAYALMIRIGVGDEIPEIP  239

Query  838   GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapsp  1017
                 +  ++ +  C +         E     P                            
Sbjct  240   ----EGDEEVVRDCGV--------VEFADASP----------------------------  259

Query  1018  spRCPFDFPDWVS-------------------ESDHLQSSITSLPPPESEYSPA-DRLQG  1137
               RC FDF DWVS                   +SD L ++  +     S+ S A DR+  
Sbjct  260   --RCHFDFQDWVSTQCSRTSWESGSVSPSSEMDSDPLFATEHAALEISSDSSRAMDRIGQ  317

Query  1138  IVSHQSPNWSQDSDEWVNVR  1197
             + SH+ PNW + S+ W+ VR
Sbjct  318   LASHERPNW-EHSEGWLTVR  336



>ref|XP_004235890.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum lycopersicum]
Length=405

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 180/285 (63%), Gaps = 21/285 (7%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGA--APPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            W RG  VG+GSFG V LA  ++  +  +   P M VKS   S   S+  EK VL+ ++GC
Sbjct  12   WYRGAMVGKGSFGCVYLATLKNPKLNYSYFPPVMAVKSAEVSVSGSIQKEKEVLNNIKGC  71

Query  334  QEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              +IRC+GD  +  +NG  +YN+LLE+ S G LA++I KS    LSE+E+R +++++LRG
Sbjct  72   PYIIRCYGDETTTGQNGAMVYNLLLEYGSGGTLAERINKS---GLSELEVRNHTRSMLRG  128

Query  511  LGYIHKVGYVHCDIKLQNILLCENG-------EVKIADFGLAKRNG---GKNLGCELRGT  660
            L  IH  GYVHCD+K +N+LL  N        +VKI D GLAKR      + L    RGT
Sbjct  129  LLCIHTNGYVHCDMKPENVLLVPNSSNGSTEFKVKIGDLGLAKRENQSKKRRLEPYWRGT  188

Query  661  PMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPE  831
            PMY+SPE V    Q   ADIWALGC V EM  G P W   +     ++L +IG G+E+P+
Sbjct  189  PMYLSPEAVADNVQDCPADIWALGCIVLEMLTGKPPWDRDDEMDAEDVLKKIGGGKELPK  248

Query  832  IPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGA  960
            IPG LS D KDFL+ CF+++PR RWTAEMLLNH F+ G  ED+G 
Sbjct  249  IPGNLSKDAKDFLKGCFVRNPRYRWTAEMLLNHAFVDGLVEDEGV  293



>ref|XP_009626328.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nicotiana tomentosiformis]
Length=323

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/286 (47%), Positives = 181/286 (63%), Gaps = 14/286 (5%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
            W RG+T+GRGSFG V+ A   +  I      + VKS   S   SL  E+ +L E + C  
Sbjct  11   WTRGKTIGRGSFGIVTSATTTNFSI-DIPSTIAVKSALFSRSKSLQKERELLHEFQDCDH  69

Query  340  VIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGY  519
            VIRCFG   + E+G+ LYN+LLE+AS G+LAD+I ++  H L + E+++Y+K++L GL +
Sbjct  70   VIRCFGANVTEEDGKILYNMLLEYASAGSLADRIGQNSRHGLQDFEVKQYAKSILLGLSH  129

Query  520  IHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNGG---KNLGCELRGTPMYMSPEMV  687
            IH  G+VH DIK  NILL    +V KIADFG AK+ GG   +     L+GTPMYM+PE V
Sbjct  130  IHGRGFVHRDIKPDNILLVGTDKVAKIADFGFAKKVGGVKSQKRKHGLKGTPMYMAPESV  189

Query  688  NGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGK-LSDD  855
               E GP ADIWA GC V EM  G   W  SE   V  LL +IG+G   P++  K LS +
Sbjct  190  LDNEYGPEADIWAFGCTVFEMVTGKTVWDCSEADNVVYLLCKIGMGS--PDLQNKRLSKE  247

Query  856  GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHRE  993
             +DFL+KC +K+PR RWTA+MLL HPF+S  ++   V +R  T ++
Sbjct  248  AEDFLKKCLVKEPRSRWTADMLLKHPFLSSNNN---VVVREQTRKK  290



>ref|XP_011073306.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Sesamum indicum]
Length=427

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 174/294 (59%), Gaps = 19/294 (6%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAV---PRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRG  330
            W+RG  +G+G FG V LA    PRS   +   P M VKS   S   S+  E+ VL  L+G
Sbjct  23   WIRGSMIGKGGFGCVYLATLRNPRSK-YSCLPPVMAVKSAEVSVSGSIQKEREVLSNLKG  81

Query  331  CQEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
            C  +IRCFG+  +  +NG  +YN+LLE+ S G LAD+IKKS    L E E+R Y+K++LR
Sbjct  82   CCNIIRCFGEETTVGDNGVMVYNLLLEYGSGGTLADRIKKSGGDGLPEFEVRVYAKSILR  141

Query  508  GLGYIHKVGYVHCDIKLQNILLCENG--------EVKIADFGLAKR---NGGKNLGCELR  654
            GL YIH  GYVHCD+K  NILL  N           KI DFGLAKR   +  + L    R
Sbjct  142  GLNYIHGNGYVHCDLKPDNILLVRNAAREGSGEFRAKIGDFGLAKRAKQSKKRKLEAYWR  201

Query  655  GTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVGEEI  825
            GTPMY+SPE V    Q    D+WALGC V EM  G P W   K  +  E+L +IG G E+
Sbjct  202  GTPMYLSPEAVIDNVQDAPCDVWALGCIVLEMLTGKPPWDGNKELKAEEVLSKIGAGHEL  261

Query  826  PEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTH  987
            P+IP  +S + +DFL+ CF++    R T+EMLLNHPF+ G DD   V+   D  
Sbjct  262  PKIPNGISKEARDFLKGCFVRKSMYRLTSEMLLNHPFVEGLDDDDAVAEMEDVE  315



>ref|XP_006356256.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum tuberosum]
Length=436

 Score =   244 bits (622),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 172/284 (61%), Gaps = 18/284 (6%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDELR  327
            + W RG  +G+GSFG V LA  ++        P  M VKS   S   S+  E+ VL  ++
Sbjct  26   VSWYRGAMLGKGSFGYVYLANLKNPNSKNRYLPSVMAVKSAEVSVSGSIQKEREVLSNIK  85

Query  328  GCQEVIRCFGD-GYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
            GC  VIRCFGD   S  NG   YN+LLE+ S G LA++I    N  L+E E+R Y++++L
Sbjct  86   GCPYVIRCFGDETTSGNNGVMAYNLLLEYGSGGTLAERIN---NRGLAEFEVRLYTRSML  142

Query  505  RGLGYIHKVGYVHCDIKLQNILLCENG-------EVKIADFGLAKR-NGGKNLGCE--LR  654
            RGL +IH +GYVHCD+K +N+LL  +          KI D GLAKR N  K    E   R
Sbjct  143  RGLNHIHAIGYVHCDMKPENVLLVPSSSKGSVEFRAKIGDLGLAKRENQSKKRRLEPYWR  202

Query  655  GTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEI  834
            GTPMY+SPE V    Q   ADIWALGC V EM  G P W   +  ++L +IG G E+PEI
Sbjct  203  GTPMYLSPEAVADNVQESPADIWALGCIVLEMLTGKPPWNRKDAEDVLRKIGEGHELPEI  262

Query  835  PGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG--EDDGA  960
            PG LS + KDFL+ CF++ P  RWTAEMLL HPF+ G  +DDG 
Sbjct  263  PGDLSKEAKDFLKGCFVRKPTYRWTAEMLLIHPFVEGLSDDDGV  306



>ref|XP_009613015.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nicotiana tomentosiformis]
Length=303

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 180/286 (63%), Gaps = 14/286 (5%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
            W RG+T+GRGSFG V+ A   +  I      + VKS   S   SL  E+ +L E + C  
Sbjct  11   WTRGKTIGRGSFGIVTSATTTNFSI-DIPSTIAVKSVLFSRSKSLQKERELLHEFQDCDH  69

Query  340  VIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGY  519
            VIRCFG   + E+G+ LYN+LLE+AS G+LAD+I ++    L + E+++Y+K++L GL +
Sbjct  70   VIRCFGANVTEEDGKILYNILLEYASAGSLADQIGQNSRQGLQDFEVKQYAKSILLGLSH  129

Query  520  IHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNGG---KNLGCELRGTPMYMSPEMV  687
            IH  G+VH DIK  NILL    +V KIADFG AK+ GG   +     L+GTPMYM+PE V
Sbjct  130  IHGRGFVHRDIKPDNILLVGTDKVAKIADFGFAKKVGGVKSQKRKHGLKGTPMYMAPESV  189

Query  688  NGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGK-LSDD  855
               E GP AD+WA GC V EM  G   W  SE   V  LL +IG+G   P++  K LS +
Sbjct  190  LDNEYGPEADVWAFGCTVFEMVTGKTVWDCSEADNVVYLLCKIGMGS--PDLQNKRLSKE  247

Query  856  GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHRE  993
             +DFL+KC +K+PR RWTA+MLL HPF+S  ++   V +R  T ++
Sbjct  248  AEDFLKKCLVKEPRSRWTADMLLKHPFLSSNNN---VVVREQTRKK  290



>ref|XP_010273708.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Nelumbo nucifera]
Length=445

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/291 (47%), Positives = 178/291 (61%), Gaps = 28/291 (10%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLA-VPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRGC  333
            W +GET+GRGSFG VSLA   R +      PP M VK    S   SL  EK VL  L  C
Sbjct  23   WTKGETIGRGSFGTVSLARAKRRNTRQSYFPPVMAVKWAEVSRSCSLQKEKEVLANLGRC  82

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSE-NHRLSEMEIRRYSKALLRG  510
              ++ CFGD  + ENGE +YN+LLE+ S G LAD+IKK++ +  L E +++RY++++L G
Sbjct  83   PHILHCFGDEITTENGEMIYNMLLEYGSGGTLADQIKKAKASGGLPESDVKRYTRSILEG  142

Query  511  LGYIHKVGYVHCDIKLQNILLCE-------------------NGEVKIADFGLAKR---N  624
            L +IH  GYVHCDIK +NILL                     +  VKI DFGLAK+   N
Sbjct  143  LNHIHARGYVHCDIKPENILLMSPPASPCCSSRKRKRKSRGGDYVVKIGDFGLAKKVYQN  202

Query  625  GGKNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAEL  795
              K L    RGTP+YMSPE +    Q P +DIWALGC V EM  G P W      +V + 
Sbjct  203  KRKLLEPCWRGTPLYMSPESIIDNIQEPPSDIWALGCLVVEMVSGKPVWDSEPDVDVDDF  262

Query  796  LMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGE  948
            L +I +G E+P IP ++S +GKDFL++CF++  + RWTA+MLL HPFI+GE
Sbjct  263  LSQICLGRELPRIPSEMSKEGKDFLKRCFVRTAKYRWTADMLLLHPFIAGE  313



>ref|XP_002303860.2| hypothetical protein POPTR_0003s18240g [Populus trichocarpa]
 gb|EEE78839.2| hypothetical protein POPTR_0003s18240g [Populus trichocarpa]
Length=378

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 139/290 (48%), Positives = 178/290 (61%), Gaps = 20/290 (7%)
 Frame = +1

Query  136  STRRGAMDWVRGETVGRGSFGKVSLAV---PRSHGIAGAAPP-MVVKSCGASCFDSLLNE  303
            +   G + W RG  +G+G FG V LA    P+S    G  PP M VKS   S   SL  E
Sbjct  4    NNNNGGVAWSRGPLIGKGGFGSVYLASLKNPKSRN--GYYPPVMAVKSAEVSASCSLQKE  61

Query  304  KAVLDELRGCQEVIRCFGD-GYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEI  480
            K V + L GC  +I+CFG+   S ++GE  YNVLLE+AS G LA  IKKS+   L E+++
Sbjct  62   KEVFNCLNGCPFIIKCFGEETTSNKDGEMFYNVLLEYASGGNLACLIKKSDGVGLPELDV  121

Query  481  RRYSKALLRGLGYIHKVGYVHCDIKLQNILLCEN----GE--VKIADFGLA----KRNGG  630
            +RY++++L G+ YIH  GYVHCD+K +NILL  N    GE   KI DFGLA    KRN  
Sbjct  122  KRYTRSILEGICYIHSRGYVHCDLKPENILLVSNRAKAGEFVAKIGDFGLAKKSEKRNKK  181

Query  631  KNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAELLM  801
              +   LRGT +YM+PE V    Q    DIWALGC V EM  G PAW         ELL 
Sbjct  182  MKIDPYLRGTALYMAPETVANHVQESPCDIWALGCVVLEMLTGKPAWDLKPHVTTEELLR  241

Query  802  RIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGED  951
            +IG G E+P+IP ++S D KDFL++CF+ +P  R+TAEMLL+ PF+SG D
Sbjct  242  KIGDGYELPKIPSQISKDAKDFLKRCFVANPMFRFTAEMLLDEPFMSGVD  291



>ref|XP_010040778.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like, 
partial [Eucalyptus grandis]
Length=339

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 152/325 (47%), Positives = 191/325 (59%), Gaps = 41/325 (13%)
 Frame = +1

Query  313   LDELRGCQEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRY  489
             L EL  C  ++RCF    + E +GE+LYNVLLE+A+ G+LAD +K S    L E E+RR+
Sbjct  6     LSELGDCPRIVRCFDHSLTSERSGEELYNVLLEYAAGGSLADSMK-SRGKPLLEPEMRRH  64

Query  490   SKALLRGLGYIHKVGYVHCDIKLQNILLCENG--EVKIADFGLAKR------NGGKNLGC  645
             ++++L G  ++H  G+VHCD+KLQNIL+  +G  EVKIADFGLAKR       GGK  G 
Sbjct  65    TRSILEGPEFVHSKGFVHCDVKLQNILVFPSGGEEVKIADFGLAKRAGERLAKGGKLGGV  124

Query  646   ELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW---KFSEVAELLMRIGVG  816
             E RGTPMYM+PE VN  E    +DIWALGCAV EMA G PAW     S    L++RI VG
Sbjct  125   EWRGTPMYMAPESVNRNEYELPSDIWALGCAVVEMATGRPAWGSRAASNAYALMIRIWVG  184

Query  817   EEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREa  996
             +EIPEIP  LS+ GK FL +CF K+P KRWTA MLL HPF++ +          D   E 
Sbjct  185   DEIPEIPEGLSEQGKYFLMECFAKNPEKRWTARMLLKHPFLALDRRINDKEFVKDCGVE-  243

Query  997   sapapspspRCPFDFPDWVSESDHLQSSITSL------PPPESEYSPA------------  1122
                 P  SPRC FDF  W    D +Q S TS       P  E +  P+            
Sbjct  244   ---FPDFSPRCHFDFQVW----DSMQCSRTSWESGSLSPSSEMDSDPSVVGELSSDSSSV  296

Query  1123  -DRLQGIVSHQSPNWSQDSDEWVNV  1194
               R+  +VS + PNW  DS+ WV V
Sbjct  297   IHRIGQLVSPERPNWI-DSEGWVTV  320



>ref|XP_009602038.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana tomentosiformis]
Length=327

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 131/286 (46%), Positives = 182/286 (64%), Gaps = 14/286 (5%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
            W RG+T+GRGSFG V+ A   +  +      + VKS   S   SL  E+ +L E + C  
Sbjct  10   WTRGKTIGRGSFGIVTSATTTNSSV-DIPSTIAVKSALFSHSKSLQKERELLHEFQDCDH  68

Query  340  VIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGY  519
            VIRCFG   + E+G+ LYN+LLE+AS G+LAD+I ++    L + E+++++K+LL G+ +
Sbjct  69   VIRCFGADVTEEDGKILYNMLLEYASGGSLADRIGQNSRKGLQDFEVKQHAKSLLLGISH  128

Query  520  IHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNGG---KNLGCELRGTPMYMSPEMV  687
            IH  G+VH DIK  NILL    +V KIADFG AK+ GG   +     L+GTP+YM+PE+V
Sbjct  129  IHGRGFVHLDIKPDNILLVGTEKVAKIADFGFAKKVGGVKSQKRKHGLKGTPLYMAPELV  188

Query  688  NGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGK-LSDD  855
               E GP ADIWA GC V EM  G   W  SE   V  LL +IG+G   P++  K LS +
Sbjct  189  LDNEYGPEADIWAFGCTVFEMVTGKTMWDCSEANDVVYLLCKIGMGS--PDLQNKRLSKE  246

Query  856  GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHRE  993
             +DFL+KC +K+PR RWTA+MLL HPF+S +D+   V +R  T ++
Sbjct  247  AEDFLKKCLVKEPRSRWTADMLLKHPFLSSDDN---VVVRERTRKK  289



>ref|XP_008782769.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Phoenix dactylifera]
Length=246

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 159/234 (68%), Gaps = 5/234 (2%)
 Frame = +1

Query  253  MVVKSCGASCFDSLLNEKAVLDELRGCQEVIRCFGDGYSFEN-GEKLYNVLLEFASQGAL  429
            M VKS   S    L +EK +LD L+ C E+I C GD    ++ GE  Y++ LE A+ G+L
Sbjct  1    MAVKSAPVSKSSILKDEKEILDLLQDCPEIIGCLGDDIKLDDDGEATYSLFLELANFGSL  60

Query  430  ADKIKKSENHRLSEMEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFG  609
             D I +S +   SE E+RR ++++LRGL +IH  GYVHCDIK  NIL+  +GEVKIADFG
Sbjct  61   FD-ILRSSHGPFSESEVRRCARSILRGLTHIHAKGYVHCDIKPHNILVSGSGEVKIADFG  119

Query  610  LAKRNGGKNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---  780
            LAKR   ++ G  +RGTP+Y++PE V   E  P +DIW+LGC + E+  G PA  F    
Sbjct  120  LAKRAAERSQGIFIRGTPLYVAPEGVARNEYEPPSDIWSLGCTLIELVTGKPARSFPVDF  179

Query  781  EVAELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS  942
            E+  +L RIG G+ +PEIP  LS++GKDFL KC +KDP+KRWTAEMLL+HPF S
Sbjct  180  ELPAVLFRIGRGDVLPEIPESLSEEGKDFLNKCLVKDPKKRWTAEMLLDHPFAS  233



>ref|XP_004241675.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=426

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/287 (47%), Positives = 172/287 (60%), Gaps = 18/287 (6%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDELR  327
            + W RG  +G+GSFG V LA  ++        P  M VKS   S   S+  E+ VL  ++
Sbjct  22   VSWYRGAMLGKGSFGYVYLANLKNPKSKNRYLPSVMAVKSAEVSVSGSIQKEREVLSNIK  81

Query  328  GCQEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKK--SENHRLSEMEIRRYSKA  498
            GC  VIRCFGD  +   NG   YN+LLE+ S G LA +I K  + N  L+E E+R Y+++
Sbjct  82   GCPYVIRCFGDETTNGNNGVMAYNLLLEYGSGGTLAQRINKLGNGNRGLAEFEVRLYTRS  141

Query  499  LLRGLGYIHKVGYVHCDIKLQNILLCENG-------EVKIADFGLAKR-NGGKNLGCE--  648
            +LRGL +IH +GYVHCD+K +N+LL  +          KI D GLAKR N  K    E  
Sbjct  142  MLRGLNHIHAIGYVHCDMKPENVLLVPSSSKGSVEFRAKIGDLGLAKRENQSKKRRLEPY  201

Query  649  LRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIP  828
             RGTPMY+SPE V    Q   ADIWALGC V EM  G P W   +  ++L +IG G E+P
Sbjct  202  WRGTPMYLSPEAVADNVQESPADIWALGCIVLEMLTGKPPWDRKDAEDVLKKIGEGHELP  261

Query  829  EIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG---EDDGA  960
             IPG LS + KDFL+ CF++ P  RWTAEMLL HPF+ G   +DDG 
Sbjct  262  TIPGDLSKEAKDFLKGCFVRKPTYRWTAEMLLIHPFVEGLSDDDDGV  308



>ref|XP_010273738.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nelumbo nucifera]
Length=307

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 175/285 (61%), Gaps = 23/285 (8%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGI--AGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            W+RG+T+GRG F +VSLA+ +          P M VK       D+L  E+ VL +L GC
Sbjct  22   WLRGKTIGRGGFSRVSLAMTKRVNTRRCNLPPIMAVKWAEIFQSDTLQEEREVLADLDGC  81

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++ CFGD  +F N E  +N+LLE+ S G+LA  IK+S N  L E E++RY+K++L GL
Sbjct  82   PHIVHCFGDEVTFGNNELYFNLLLEYGSVGSLAQHIKRS-NDGLPESEVKRYTKSILEGL  140

Query  514  GYIHKVGYVHCDIKLQNILLCENGE-----------------VKIADFGLAKRNGGKNLG  642
             YIH  GYVHCDIK  NI+L  +                   VKIADFGLAK+   K L 
Sbjct  141  VYIHSRGYVHCDIKPANIILVPSSTFAFLSSRKRKPRSYCYVVKIADFGLAKKAQQKKLK  200

Query  643  CELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGV  813
               RGTP+Y+SPE+V  G Q   ADIWALGC VAEM  G PA      S+V  +L +I  
Sbjct  201  RGWRGTPLYLSPEVVRDGIQEAPADIWALGCTVAEMITGKPALSCKVGSDVNCVLFQISS  260

Query  814  GEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGE  948
            G  +PE+P ++ D+GKDFL  CF+K+   RWTA+MLLNHPFI+G+
Sbjct  261  GFSLPEVPSEMPDEGKDFLNMCFVKNAELRWTAKMLLNHPFIAGD  305



>gb|EYU24575.1| hypothetical protein MIMGU_mgv1a008079mg [Erythranthe guttata]
Length=385

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 174/281 (62%), Gaps = 18/281 (6%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAV---PRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDEL  324
            + W RG  +G+GSFG+V LA    PRS   +     M VKS   S   S+ NE+ VL+ +
Sbjct  9    VSWYRGSMIGKGSFGRVYLATLKKPRSK-YSYYPSLMAVKSAEVSASGSIQNEREVLNAV  67

Query  325  RGCQEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSE---NHRLSEMEIRRYS  492
            +GC  +I+CFGD  +  +NG  +YN+LLE+ S G LA+KIK S       LSE E++R++
Sbjct  68   KGCPNIIKCFGDETTTGQNGAVVYNLLLEYGSAGTLAEKIKNSNAGGGGGLSEFEVKRFT  127

Query  493  KALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN------LGCELR  654
            K++L GL +IH  GYVHCDIK  NILL  +   KIADFGL+KR   K       +    R
Sbjct  128  KSILTGLNHIHVSGYVHCDIKPDNILLFSDFRAKIADFGLSKRVAVKQSKKRKLMEPYWR  187

Query  655  GTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVA----ELLMRIGVGEE  822
            GTPMY+SPE V    Q P +DIWALGC V EM  G P W+  +      E++ +IG G E
Sbjct  188  GTPMYLSPEAVIDKIQDPPSDIWALGCIVLEMLTGKPVWEDEKKELTNDEIIAKIGAGRE  247

Query  823  IPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG  945
            +P+IP  +S + +DFL+ CF++    R TAEMLLNHPF+ G
Sbjct  248  LPKIPIGVSKEARDFLKGCFVRKSMFRLTAEMLLNHPFVEG  288



>ref|XP_011034576.1| PREDICTED: protein kinase byr2-like [Populus euphratica]
Length=395

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 182/294 (62%), Gaps = 16/294 (5%)
 Frame = +1

Query  118  QNSTICSTRRGAMDWVRGETVGRGSFGKVSLAVPRSHGI-AGAAPP-MVVKSCGASCFDS  291
            ++S   S   G + W RG  +G+G FG V LA  ++  +  G  PP M VKS   S   S
Sbjct  14   EDSMKYSNNNGGVAWSRGPLLGKGGFGSVYLASLKNPKLRNGYYPPVMAVKSAEVSASCS  73

Query  292  LLNEKAVLDELRGCQEVIRCFGDGYSFENG-EKLYNVLLEFASQGALADKIKKSENHRLS  468
            L  EK V + L GC  +I+CFG+  + + G E  YNVLLE+AS G LA  IKKS+   L 
Sbjct  74   LQKEKEVFNCLNGCPFIIKCFGEETTRDGGGEMFYNVLLEYASGGTLAGLIKKSDGVGLP  133

Query  469  EMEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCEN----GE--VKIADFGLA----K  618
            E++++RY++++L G+ YIH  GYVHCD+K +NILL  +    GE   KI DFGLA    K
Sbjct  134  ELDVKRYTRSILEGINYIHSHGYVHCDLKPENILLVSSSTKAGEFVAKIGDFGLAKKSEK  193

Query  619  RNGGKNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVA  789
            RN  + +   LRGT +YM+PE V    Q P  DIWALGC V EM  G  AW       V 
Sbjct  194  RNKKRKIDPYLRGTTLYMAPETVANHVQEPPCDIWALGCVVLEMLTGKQAWDVKPDVTVD  253

Query  790  ELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGED  951
            EL+ +IG G E+P++P ++S D KDFL++CF+ +P  R+TAEMLL+ PF+SG D
Sbjct  254  ELMRKIGDGYELPKMPSEVSKDAKDFLKRCFVANPMFRFTAEMLLDEPFVSGVD  307



>gb|EYU27064.1| hypothetical protein MIMGU_mgv1a024020mg, partial [Erythranthe 
guttata]
Length=284

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/279 (43%), Positives = 165/279 (59%), Gaps = 16/279 (6%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLA--VPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            W RGE +G GSFG VS+A    R    +G    M VKS   S   SL  EK +LD+  GC
Sbjct  4    WTRGEKLGEGSFGFVSIARSTSRHQQASGLPALMAVKSAKESDSKSLSKEKDLLDKFNGC  63

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++RCF + Y+ ENG++LYN+LLE+AS G L D+I       + E  +  Y+K++L  L
Sbjct  64   ASILRCFREDYTTENGQQLYNILLEYASGGCLIDRIATGRK-VMPEKMVSHYTKSILTAL  122

Query  514  GYIHKVGYVHCDIKLQNILLCENG--------EVKIADFGLAKRNGGKNLGCELRGTPMY  669
             +IHK+GYVHCD+K  NILL ++         E K+ADFG       +    + RGT +Y
Sbjct  123  SHIHKLGYVHCDVKPHNILLFKHTHDDGDWEEEAKLADFGSCVIFADEGNNSDFRGTVLY  182

Query  670  MSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPG  840
             +PE ++  +  P +D+W+LGC V  M  G   W F +     ++L +IG  + IPEIP 
Sbjct  183  AAPESISRQKYVPESDVWSLGCTVLHMLTGNSPWTFDKHVTAKDVLFKIGCSDAIPEIPT  242

Query  841  --KLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGED  951
              K+S D  DFLE+CF+KDP  RWTA+MLLNHP+I   +
Sbjct  243  TKKISKDAHDFLERCFVKDPTARWTADMLLNHPYIKNNN  281



>ref|XP_009801510.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nicotiana sylvestris]
Length=305

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 173/275 (63%), Gaps = 15/275 (5%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
            W RG+T+GRGSFG V+ A   +  I      + VKS   S   SL  E+ +L E + C  
Sbjct  11   WTRGKTIGRGSFGIVTSATTTNFSI-DIPSTIAVKSALFSRSKSLQKERDLLHEFQDCDH  69

Query  340  VIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGY  519
            VIRCFG   + E+G+ LYN+LLE+AS G+LAD+I ++    L + E+++Y+K++L GL +
Sbjct  70   VIRCFGADVTEEDGKILYNMLLEYASGGSLADRIGQNSRQGLQDFEVKQYAKSILLGLSH  129

Query  520  IHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNGG-----KNLGCELRGTPMYMSPE  681
            IH  G+VH DIK  NILL    +V KIADFG AK+ GG     K  G  L+GTPMYM+PE
Sbjct  130  IHGRGFVHRDIKPDNILLVGTEKVAKIADFGSAKKVGGVKSQKKKHG--LKGTPMYMAPE  187

Query  682  MVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGK-LS  849
             V   E GP ADIWA GC V EM  G   W  SE   V  LL +IG+G   P++  K LS
Sbjct  188  SVLDNEYGPEADIWAFGCTVFEMVTGKTVWDCSEANNVVYLLCKIGMGS--PDLQNKRLS  245

Query  850  DDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDD  954
               +DFL KC +K+PR RWTA+MLL HPF+  +D+
Sbjct  246  KVAEDFLRKCLVKEPRSRWTADMLLKHPFLLSDDN  280



>ref|XP_010275095.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nelumbo nucifera]
Length=325

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 174/278 (63%), Gaps = 17/278 (6%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
            W+RG+T+GRGS+  VSLA    H +    P + VKS   S   S+  E+ +L +L+ C +
Sbjct  6    WIRGKTIGRGSYSVVSLAETNHHLLP---PVIAVKSSDYSMSGSIQEERKILTQLQDCPQ  62

Query  340  VIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGY  519
            VI C+GD  + E+G  +YN+ LE+AS G+L D+I +S    L E E+RRY++++LRGL +
Sbjct  63   VIHCYGDDVTVEDGFIIYNLWLEYASGGSLHDRIVRS-GGGLPESEVRRYTRSILRGLSH  121

Query  520  IHKVGYVHCDIKLQNILLC------ENGEVKIADFGLAKRNGGKNL----GCELRGTPMY  669
            IHK G+VHCD+K +N+LL           VKIAD GL+KR G   L    G  LR TP+Y
Sbjct  122  IHKCGFVHCDLKPENLLLVPSSSSKGRSSVKIADLGLSKRVGEDMLCREDGMLLRTTPLY  181

Query  670  MSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF---SEVAELLMRIGVGEEIPEIPG  840
             +PE +      P +DIW+LGC V  M  G PAW F   ++V   L +IG    +PEIP 
Sbjct  182  AAPESIKCCLYEPCSDIWSLGCTVIMMITGKPAWDFPPEADVDLFLNKIGNNPVVPEIPE  241

Query  841  KLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDD  954
            KLS +GKDFL  C I+D   RWTA+MLL HPF+S +D+
Sbjct  242  KLSIEGKDFLNLCLIRDETLRWTADMLLLHPFVSVDDE  279



>ref|XP_006368487.1| hypothetical protein POPTR_0001s03390g [Populus trichocarpa]
 gb|ERP65056.1| hypothetical protein POPTR_0001s03390g [Populus trichocarpa]
Length=395

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 180/296 (61%), Gaps = 20/296 (7%)
 Frame = +1

Query  118  QNSTICSTRRGAMDWVRGETVGRGSFGKV---SLAVPRSHGIAGAAPP-MVVKSCGASCF  285
            + S   S   G + W RG  +G+G FG V   SL  P+S    G  PP M VKS   S  
Sbjct  14   EESMKYSNNNGGVAWSRGPLLGKGGFGSVYLASLKSPKSRN--GYYPPVMAVKSAEVSAS  71

Query  286  DSLLNEKAVLDELRGCQEVIRCFGDGYSFENG-EKLYNVLLEFASQGALADKIKKSENHR  462
             SL  EK V + L GC  +I+CFG+  + + G E  YNVLLE+AS G LA  IKKS+   
Sbjct  72   CSLQKEKEVFNCLNGCPFIIKCFGEETTRDGGGEMFYNVLLEYASGGTLAGLIKKSDGVG  131

Query  463  LSEMEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCEN----GE--VKIADFGLA---  615
            L E++++RY++++L G+ YIH  GYVHCD+K +NILL  +    GE   KI DFGLA   
Sbjct  132  LPELDVKRYTRSILEGIHYIHSHGYVHCDLKPENILLVSSSTKAGEFVAKIGDFGLAKKS  191

Query  616  -KRNGGKNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---E  783
             KRN  + +   LRGT +YM+PE V    Q P  DIWALGC V EM  G  AW       
Sbjct  192  EKRNKKRKIDPYLRGTTLYMAPETVANHVQEPPCDIWALGCVVLEMLTGKQAWDVKPDVT  251

Query  784  VAELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGED  951
            + EL  +IG G E+P++P ++S D KDFL++CF+ +P  R+TAEMLL+ PF+SG D
Sbjct  252  IEELKRKIGDGYELPKMPSEVSKDAKDFLKRCFVANPMFRFTAEMLLDEPFVSGVD  307



>gb|EYU27067.1| hypothetical protein MIMGU_mgv1a022903mg [Erythranthe guttata]
Length=320

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 166/275 (60%), Gaps = 16/275 (6%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRS-HGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELRGC  333
            W RGE +G GSFG VS+A   S H  A   P  M VKS   S   SL  EK +LD+  GC
Sbjct  4    WTRGEKLGEGSFGFVSIARSTSPHQQASGLPALMAVKSAKESDSKSLSREKDLLDKFNGC  63

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++RCF + Y+ ENG++LYN+LLE+AS G L D++       + E  +  Y+K++L  L
Sbjct  64   ASILRCFREDYTTENGQQLYNILLEYASGGCLIDRMATGRK-VMPEKMVSHYTKSILTAL  122

Query  514  GYIHKVGYVHCDIKLQNILLCENG--------EVKIADFGLAKRNGGKNLGCELRGTPMY  669
             +IHK+GYVHCD+K  NILL ++         E K+ADFG   R   +    + RGT +Y
Sbjct  123  SHIHKLGYVHCDVKPHNILLFKHTHDDGDWEEEAKLADFGSCVRFADEGNNGDFRGTVLY  182

Query  670  MSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPG  840
             +PE ++     P +D+W+LGC V  M  G   W F +     ++L +IG  + IPEIP 
Sbjct  183  AAPESISRQIYVPESDVWSLGCTVLHMLTGNSPWTFDKHVTAKDVLFKIGCSDAIPEIPT  242

Query  841  --KLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFI  939
              K+S + +DFL++CFIKDP  RWTA+MLLNHPFI
Sbjct  243  TKKISKEAQDFLKRCFIKDPTARWTADMLLNHPFI  277



>ref|XP_006437583.1| hypothetical protein CICLE_v10033465mg [Citrus clementina]
 gb|ESR50823.1| hypothetical protein CICLE_v10033465mg [Citrus clementina]
Length=362

 Score =   230 bits (587),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 179/301 (59%), Gaps = 12/301 (4%)
 Frame = +1

Query  160   WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
             W RG  +G+GSFG V +A P+S+  +   P M VKS   S   SL  EK V D L GC  
Sbjct  8     WFRGRVIGQGSFGCVFIAKPKSNS-SFLPPLMAVKSAEVSASASLQKEKEVFDNLNGCPF  66

Query  340   VIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
             V+ CFG+  +  ENGE  YN+LLE+A+ G L D I+K   + L E ++RR+++ +L G+G
Sbjct  67    VLECFGEEITMGENGEMAYNLLLEYAAGGTLGDLIEKCNGNGLPEKDVRRFTRCILEGIG  126

Query  517   YIHKVGYVHCDIKLQNILLC--ENGE--VKIADFGLAKRN---GGKNLGCELRGTPMYMS  675
             +IH  GYVHCD+K  NILL   ++G+   KIAD G+AKR+     +     +RGTP+Y++
Sbjct  127   HIHDSGYVHCDVKPDNILLVATQSGKFVAKIADLGVAKRSRHCKRQKFDPSMRGTPLYLA  186

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKL  846
             PE V    Q   +DIWALGC V EM  G  AW   E   + +L   IG    +PEIP ++
Sbjct  187   PETVVQHMQEAPSDIWALGCVVLEMLSGRQAWIVKEDCSIDQLFSIIGDEHSLPEIPSRV  246

Query  847   SDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspR  1026
             S + +DFL +CF++ P  R+TAEMLL+ PF+ G D+     L  D  +E    + + +  
Sbjct  247   SKEARDFLRRCFVRKPAFRFTAEMLLDDPFVKGFDEELFRELEGDYSQEQVTLSNADAES  306

Query  1027  C  1029
             C
Sbjct  307   C  307



>ref|XP_009783074.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana sylvestris]
Length=333

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 189/325 (58%), Gaps = 25/325 (8%)
 Frame = +1

Query  151   AMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRG  330
             A+ W RG+T+GRGSFG V+LA   +  +      + +KS   S   SL  E+ +L E + 
Sbjct  7     AVMWTRGKTIGRGSFGIVTLATTTNSSV-DIPSTIAIKSALFSRSKSLQKERELLHEFQD  65

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
             C +VIRCFG   + E G+ LYN+LLE+AS G+LAD+I ++    L + E+++Y+K++L G
Sbjct  66    CDQVIRCFGADVTEEGGKMLYNMLLEYASGGSLADRIGQNSGQWLGDFEVKQYAKSILLG  125

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNG-GKNLGCELRGTPMYMSPEM  684
             L  IH  G+VH DIK  NILL    +V KIADFG AK+ G  +     L+GT MYM+PE 
Sbjct  126   LSDIHGRGFVHLDIKPDNILLVGTEKVAKIADFGFAKKVGKSQKRKRGLKGTRMYMAPES  185

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPG-KLSD  852
             V   E GP ADIWA GC V EM  G   W  SE   +  LL +IG+G   P++   +LS 
Sbjct  186   VLDNEYGPEADIWAFGCTVFEMITGKTVWDCSEADDIVYLLCKIGMGS--PDLQNERLSK  243

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
             + +DFL+KC +K+PR RWTA+MLL HPF+  ++    V +R  T ++            P
Sbjct  244   EAEDFLKKCLVKEPRSRWTADMLLKHPFLLSDN----VVVREQTRKKELN---------P  290

Query  1033  FDFPDWVSESDHLQSSI---TSLPP  1098
               F +   ESD L       T L P
Sbjct  291   LLFIEIARESDPLTDDFCNSTKLKP  315



>ref|XP_008781652.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Phoenix dactylifera]
Length=276

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 160/242 (66%), Gaps = 8/242 (3%)
 Frame = +1

Query  253  MVVKSCGASCFDSLLNEKAVLDELRGCQEVIRCFGDGYSFEN-GEKLYNVLLEFASQGAL  429
            M VKS   S    L +EK +LD L+ C E+I C GD    ++ GE  Y++ LE A+ G+L
Sbjct  1    MAVKSAPVSNSSILKHEKVILDLLQDCPEIIGCLGDDIKPDDDGEATYSLFLELATFGSL  60

Query  430  ADKIKKSENHRLSEMEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFG  609
             D ++ S     SE E+R  +K++LR L +IH  GYVHCDIK  NIL+  +GEVKIADFG
Sbjct  61   FDVLRSSHG-PFSESEVRHCTKSILRALAHIHAKGYVHCDIKPHNILVSGSGEVKIADFG  119

Query  610  LAKRNGGKNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---  780
            LAKR   ++ G  +RGTP+Y++PE V   E  P +DIW+LGC + E+  G PA  F    
Sbjct  120  LAKRAKERSRGFFIRGTPLYVAPEGVARNEYEPPSDIWSLGCTLIELVTGKPARSFPADL  179

Query  781  EVAELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG---ED  951
            E+  +L RIG G+ +PEIP  LS++GKDFL++C +KDP+ RWTAEMLL+HPF  G   E+
Sbjct  180  ELPAVLFRIGRGDVLPEIPESLSEEGKDFLKRCLVKDPKNRWTAEMLLDHPFALGYGEEE  239

Query  952  DG  957
            DG
Sbjct  240  DG  241



>ref|XP_006484585.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Citrus sinensis]
 gb|KDO52744.1| hypothetical protein CISIN_1g039291mg [Citrus sinensis]
Length=362

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 124/285 (44%), Positives = 173/285 (61%), Gaps = 12/285 (4%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
            W RG  +G+GSFG V +A P+S+  +   P M VKS   S   SL  EK V D L GC  
Sbjct  8    WFRGRVIGQGSFGCVFIAKPKSNS-SFLPPLMAVKSAEVSASASLQKEKEVFDNLNGCPF  66

Query  340  VIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
            V+ CFG+  +  ENGE  YN+LLE+A+ G L D I+K   + L E ++R +++ +L G+G
Sbjct  67   VLECFGEEITMGENGEMAYNLLLEYAAGGTLGDLIEKCNGNGLPEKDVRHFTRCILEGIG  126

Query  517  YIHKVGYVHCDIKLQNILLC--ENGE--VKIADFGLAKRN---GGKNLGCELRGTPMYMS  675
            +IH  GYVHCD+K  NILL   ++G+   KIAD G+AKR+     +     +RGTP+Y++
Sbjct  127  HIHDSGYVHCDVKPDNILLVATQSGKFVAKIADLGVAKRSRHCKRQKFDPSMRGTPLYLA  186

Query  676  PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEIPEIPGKL  846
            PE V    Q   +DIWALGC V EM  G  AW   E   + +L   IG    +PEIP ++
Sbjct  187  PETVVQHMQEAPSDIWALGCVVLEMLSGRQAWVVKEDCSIDQLFSIIGDEHSLPEIPSRV  246

Query  847  SDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRND  981
            S + +DFL +CF++ P  R+TAEMLL+ PF+ G D+  +  L  D
Sbjct  247  SKEARDFLRRCFVRKPAFRFTAEMLLDDPFVKGVDEELSRELEGD  291



>emb|CDP04579.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 171/284 (60%), Gaps = 21/284 (7%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAV---PRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRG  330
            W RG  +G+GSFG V LA    PRS   +     M VKS   S   S+  E+ VL  ++G
Sbjct  12   WKRGAMLGKGSFGSVYLATLKKPRSK-YSCLPSVMAVKSAEVSVSGSIQKEREVLSNVKG  70

Query  331  CQEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
            C  +I+CFG+  +   NG  ++N+LLE+ S G LA+KIKKS  + L E E+R Y++++L+
Sbjct  71   CPNIIQCFGEETTTGVNGVMVFNLLLEYGSGGTLAEKIKKSGGNGLPEFEVRCYTRSILK  130

Query  508  GLGYIHKVGYVHCDIKLQNILLCENG--------EVKIADFGLAKRN---GGKNLGCELR  654
            GL +IH++GYVHCD+K +NILL  N           KI DFGLAKR      + L    R
Sbjct  131  GLNFIHEIGYVHCDLKPENILLVPNNAGGGRAGFRAKIGDFGLAKRVKQCKKRKLEPYWR  190

Query  655  GTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE---VAELLMRIGVGEEI  825
            GTP Y+SPE+V  G Q   +DIWALGC V EM  G P W   E     ++L RI    E+
Sbjct  191  GTPTYLSPEVVGDGVQEQPSDIWALGCIVLEMLTGKPPWDAKEEQNAEDILKRI--KNEL  248

Query  826  PEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDG  957
            P+IP +LS + KDFL+ CF+K    R TAEMLLNH F+ G  DG
Sbjct  249  PQIPSELSKEAKDFLKGCFVKKAMYRLTAEMLLNHAFMEGLVDG  292



>ref|XP_011082542.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Sesamum indicum]
Length=407

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 169/288 (59%), Gaps = 20/288 (7%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAV---PRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRG  330
            W+RG  +GRG FG V LA    PRS   +     M VKS   S   S+  E+ VL  ++G
Sbjct  11   WLRGSMIGRGGFGFVYLATLKNPRSK-YSYFPSVMAVKSAEVSVSGSIQKEREVLSNVKG  69

Query  331  CQEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
            C ++IRCFG+  +   NG  +YN+LLE+ S G LAD+IKK+    L E E + +++ +LR
Sbjct  70   CSDIIRCFGEETTMGGNGAMVYNLLLEYGSGGTLADRIKKAGGGGLPEFEAKVFARCILR  129

Query  508  GLGYIHKVGYVHCDIKLQNILLCENG--------EVKIADFGLAKR---NGGKNLGCELR  654
            GL +IH  GYVHCD+K  NILL  +           KI DFGLAKR   +  + L     
Sbjct  130  GLNHIHGKGYVHCDLKPDNILLVPDARNKGFTEFRAKIGDFGLAKRAKQSKKRKLEPYWG  189

Query  655  GTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW----KFSEVAELLMRIGVGEE  822
            GTPMY+SPE V    Q P  DIWALGC V EM  G P W    K  +  E+L +IG G  
Sbjct  190  GTPMYLSPEAVMDNVQEPPCDIWALGCVVLEMLTGKPPWDNDQKELDAEEILRKIGEGRV  249

Query  823  IPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATV  966
            +P++P  +S + KDFL++CF++    R TAEMLLNHPF+ G +D   V
Sbjct  250  LPKVPDGISKEAKDFLKRCFVRKSMYRLTAEMLLNHPFVGGLNDDDVV  297



>ref|XP_001768190.1| predicted protein [Physcomitrella patens]
 gb|EDQ67063.1| predicted protein [Physcomitrella patens]
Length=275

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 168/276 (61%), Gaps = 13/276 (5%)
 Frame = +1

Query  148  GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVK---SCGASCFDSLLNEKAVLD  318
             A  W+RG+ +G G+FG V+LA+ R +G   A   + V    S       ++ NE  +L+
Sbjct  2    AAQSWIRGKLLGAGTFGSVNLAINRENGEVFAVKSVQVTERDSRSEVAVRAIENEIDILE  61

Query  319  ELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSEN-HRLSEMEIRRYSK  495
            +L   + V+RC G  ++ E+G+ + NV LE+   G L D +K+  N   L+E  +R+Y++
Sbjct  62   KLDS-KYVVRCLGSDWTEESGQLMRNVFLEYMPDGCLTDFVKQFANCGALNEHLLRKYTR  120

Query  496  ALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK------NLGCELRG  657
            +++ G+ Y+H  G VHCDIK +NIL+  NG VK+ DFG +KR GG       N    + G
Sbjct  121  SIVEGIDYLHSNGIVHCDIKGKNILI-GNGSVKLTDFGSSKRVGGAMESDVMNCSATVNG  179

Query  658  TPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEI  834
            TP++M+PE+VN  EQGPA+DIW+LGC V EMA G   W  F+     L  IG  +E+PE+
Sbjct  180  TPLWMAPEVVNQVEQGPASDIWSLGCTVVEMATGRAPWSNFANHYAALYHIGCTDELPEV  239

Query  835  PGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS  942
            P  LS +  DFL  CF ++P KRWT+  LL HPF++
Sbjct  240  PASLSAEAHDFLSHCFQREPSKRWTSTQLLQHPFLT  275



>ref|XP_009405196.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=453

 Score =   223 bits (567),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 185/349 (53%), Gaps = 25/349 (7%)
 Frame = +1

Query  160   WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
             W RG  +GRGS   VSLA     G   A     VK         L  E+ +L  LR    
Sbjct  6     WRRGRVIGRGSSATVSLATALDSGAVFA-----VKCAELGRSAILQREQRILSSLRS-PY  59

Query  340   VIRCFGDGYSFE--NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             V+ C G   S     G   YN+ LE+A +G+L+D+I K +  RL E  IR YS  +LRGL
Sbjct  60    VVSCLGFDISSHGSTGGLYYNLFLEYAPRGSLSDEIGK-QGGRLDEAAIRCYSCEILRGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H  G VHCD+K +N+L+  +G  KIAD G A+    ++    LRGTPM+M+PE+  G
Sbjct  119   VYLHSQGVVHCDVKGRNVLVGTDGHAKIADLGCARLIAQEDEE-GLRGTPMFMAPEVARG  177

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQGP AD+WALGC + EMA G PAW   S+    + R+    ++P  P  LS +GKDFL
Sbjct  178   EEQGPPADVWALGCTIIEMATGGPAWPGVSDPIAAIHRVAFSPDVPAFPSWLSGEGKDFL  237

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
              KC  +DPR+RWTAE LL H F++      T   + DT R         SP+   D   W
Sbjct  238   SKCLKRDPRERWTAEQLLQHEFVAS--SSITSPSKPDTDRR------WVSPKSTLDLAFW  289

Query  1051  VSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
              S  D  +      P     + P+ R+Q +VS  SP W+ D D WV VR
Sbjct  290   ESLPDQDEE-----PSQHPFFDPSARIQQLVSSSSPTWTWD-DNWVAVR  332



>gb|KHN40490.1| MAP kinase kinase kinase mkh1 [Glycine soja]
Length=290

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 164/282 (58%), Gaps = 17/282 (6%)
 Frame = +1

Query  136  STRRGAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVL  315
            S      +W + + +G GS+G VSLAV  +   A     + VK+      DSL  E+ +L
Sbjct  9    SDHEAVTEWEKLKILGEGSYGTVSLAVLTAPEEAKGEL-IAVKTSKPHGLDSLQKEETIL  67

Query  316  DELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSK  495
            D   GC+E++RC    ++ ENG  +YN+L+EFA  G+L D I+K     LSE ++R YS+
Sbjct  68   DSFFGCKEILRCIWSLFTLENGRFVYNLLMEFAPCGSLGDLIRKKP---LSESQVRVYSR  124

Query  496  ALLRGLGYIHKVGYVHCDIKLQNILLCENGE-------VKIADFGLAKRNG----GKNLG  642
             LL+GL  +H+ G VHCD+K  NILL  +GE       +KIADFGL++            
Sbjct  125  MLLKGLSLVHRFGVVHCDLKPDNILLFPSGEENDVDYQLKIADFGLSRTKDEVFDADFWK  184

Query  643  CELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGE  819
             + RG+P YMSPE V G  + P  DIW+LGC V EM  G PAW       +L+ ++   +
Sbjct  185  IKFRGSPFYMSPESVMGRIETPL-DIWSLGCLVIEMMTGFPAWNHIPTTRDLMFKLAFLK  243

Query  820  EIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG  945
            E P +P  LS   +DFL KCF+KD  +RWTA MLL+HPFIS 
Sbjct  244  EAPPLPSGLSSLCQDFLNKCFVKDSAQRWTANMLLDHPFISA  285



>ref|XP_006603574.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=290

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 164/282 (58%), Gaps = 17/282 (6%)
 Frame = +1

Query  136  STRRGAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVL  315
            S      +W + + +G GS+G VSLAV  +   A     + VK+      DSL  E+ +L
Sbjct  9    SDHEAVTEWEKLKILGEGSYGTVSLAVLTAPEEAKGEL-IAVKTSKPHGLDSLQKEETIL  67

Query  316  DELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSK  495
            D   GC+E++RC    ++ ENG  +YN+L+EFA  G+L D I+K     LSE ++R YS+
Sbjct  68   DSFFGCKEILRCIWSLFTMENGRFVYNLLMEFAPCGSLGDLIRKKP---LSESQVRVYSR  124

Query  496  ALLRGLGYIHKVGYVHCDIKLQNILLCENGE-------VKIADFGLAKRNG----GKNLG  642
             LL+GL  +H+ G VHCD+K  NILL  +GE       +KIADFGL++            
Sbjct  125  MLLKGLSLVHRFGVVHCDLKPDNILLFPSGEENDVDYQLKIADFGLSRTKDEVFDADFWK  184

Query  643  CELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGE  819
             + RG+P YMSPE V G  + P  DIW+LGC V EM  G PAW       +L+ ++   +
Sbjct  185  IKFRGSPFYMSPESVMGRIETPL-DIWSLGCMVIEMMTGFPAWNHIPTTRDLMFKLAFLK  243

Query  820  EIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISG  945
            E P +P  LS   +DFL KCF+KD  +RWTA MLL+HPFIS 
Sbjct  244  EAPPLPSGLSSLCQDFLNKCFVKDSAQRWTANMLLDHPFISA  285



>ref|XP_008441103.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis melo]
Length=463

 Score =   221 bits (562),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 193/351 (55%), Gaps = 29/351 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+RG T+GRGS   VS+A     G       M VK+   S  D L  E+ +L +L  C
Sbjct  1     MEWIRGRTLGRGSSAAVSVATDLRSGQV-----MAVKTVEFSRLDFLKREQRILSQL-NC  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               VI   G   + ENG  + N+L+EFA  G++ D ++K+   RL E   + Y++ +L GL
Sbjct  55    SRVIGYKGFDVTLENGNLMCNLLMEFAPGGSILDTMEKA-GGRLDEATAQFYTREILSGL  113

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H  G VHCDIK  NIL+ E+G +KIADFG A+R      G  L GTP++M+PE+  G
Sbjct  114   HYVHSNGVVHCDIKCCNILVGEDG-IKIADFGCARRVEDV-FGGNLAGTPIFMAPEVARG  171

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              +QG AAD+W++GCAV +M  G   W   S+    + RIG G+++PEIP  +S+ GKDFL
Sbjct  172   EKQGFAADVWSVGCAVIQMVTGRAPWANLSDPLAAIYRIGSGDDLPEIPRNMSEQGKDFL  231

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
              +C I+DP +RW+   LL HPF+  +      + R  T                    D 
Sbjct  232   RRCLIRDPEERWSVNELLKHPFVQEQKSNPKQNSRTPTSILEQG------------IWDT  279

Query  1051  VSESDHLQSSITSLPPPESEYSPADRLQGI--VSHQSPNWSQDSDEWVNVR  1197
             V++ + ++S I     P+   +P  R+Q +  VS   PNW  D D W+ VR
Sbjct  280   VNDPETVESPIR----PKIHRTPLQRIQQLNEVSTNGPNWECDED-WITVR  325



>gb|EYU21752.1| hypothetical protein MIMGU_mgv1a021677mg [Erythranthe guttata]
Length=345

 Score =   217 bits (552),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/280 (44%), Positives = 166/280 (59%), Gaps = 11/280 (4%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPR--SHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            W RG  +G+G FG V LA  +  +   +   P M VKS   S   S+  EK VL  L+GC
Sbjct  12   WFRGSIIGKGGFGSVYLATLKNPTSKYSCFPPLMAVKSAEVSASGSIQKEKEVLTNLKGC  71

Query  334  QEVIRCFGDGYSF-ENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
              +I+CFG+  +   NG   YN+LLE+ S G L+D+I+KS    L+E E R Y++++LRG
Sbjct  72   PYLIKCFGEETTIGSNGVMAYNLLLEYGSGGTLSDRIEKSGGGGLAECEARVYTRSILRG  131

Query  511  LGYIHKVGYVHCDIKLQNILLCENG----EVKIADFGLAKR----NGGKNLGCELRGTPM  666
            L +IH  GYVHCD+K +NILL  N       KI DFGLAKR       K L    RGTPM
Sbjct  132  LNHIHGNGYVHCDLKPENILLVPNSGAGIRAKIGDFGLAKRERNSKKSKILEPYWRGTPM  191

Query  667  YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKL  846
            Y+SPE V    Q   +DIWALGC V  M  G   W+  +  E++ +IG    +P+IP +L
Sbjct  192  YLSPEAVVDKVQESPSDIWALGCIVLYMLTGNLPWEGKKSEEIIRKIGTRGRLPKIPNEL  251

Query  847  SDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATV  966
            S + KDFL+ CF++    R T+EMLL+HPF+   ++G  V
Sbjct  252  SKEAKDFLKGCFVRRSVFRHTSEMLLHHPFVEVLENGDAV  291



>emb|CDP14935.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   218 bits (556),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 128/287 (45%), Positives = 168/287 (59%), Gaps = 24/287 (8%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLA--VPRSH------GIAGAAPPMV-VKSCGASCFDSLLNEKAV  312
            W+RG+T+G GSFG VS+A  +P S        +    PP++ VKS   SC +SL  E+ +
Sbjct  2    WIRGKTLGSGSFGFVSIAKTIPSSFPDDEEDQLFFDLPPIIAVKSAEFSCSESLQRERLL  61

Query  313  LDELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYS  492
            L E + C ++I C+G   S E+G  LYN+LLEFAS G+LAD +  S+ + L E E+++++
Sbjct  62   LHEFQNCPQIIHCYGADVSEEDGHLLYNMLLEFASGGSLADYVHGSQ-YGLLEGEVKQFT  120

Query  493  KALLRGLGYIHKVGYVHCDIKLQNILLCENGE----VKIADFGLA----KRNGGKNLGCE  648
            +++L GL YIH  GY HCDIK  NILL ++ E     K++DFGLA    +R  G+     
Sbjct  121  RSVLLGLSYIHAEGYAHCDIKPANILLVDDEEGNRTAKVSDFGLATKVSERRTGRKRKKG  180

Query  649  LRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS------EVAELLMRIG  810
             RGT  YM PE V  GE     DIWALGC V EM    PAW F                 
Sbjct  181  NRGTLFYMDPESVMLGECDSKVDIWALGCTVIEMFTKKPAWDFDFDQCTDLDDFDEFFDR  240

Query  811  VGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGED  951
            +  E  EIP  LS D +DFL KC IK+P  RWTA+MLL HPF+SG D
Sbjct  241  IKNEEVEIPRGLSKDAQDFLAKCLIKNPGLRWTADMLLRHPFVSGLD  287



>ref|XP_004244346.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum lycopersicum]
Length=437

 Score =   219 bits (559),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 195/356 (55%), Gaps = 39/356 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+RG  +GRGS   VSLA   S G+  A     VKS   SC   L  E +++ +L   
Sbjct  1     MEWIRGPIIGRGSSATVSLATDSS-GVVFA-----VKSTEQSC---LQREYSLVSQLNS-  50

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +++CFG    FE  E++YN+ +E+   G L+D IK+ +   L+E  I+ Y++ +L+GL
Sbjct  51    PFLVKCFG----FEQNEQVYNMFMEYVQGGTLSDLIKR-QGGSLNECMIKLYAQQILQGL  105

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK-RNGGKNLGCELRGTPMYMSPEMVN  690
              Y+H +G VHCD+K QNIL+CENG VKIAD G AK    GKN G    GTP +M+PE+  
Sbjct  106   DYLHSIGIVHCDVKGQNILICENGNVKIADLGCAKLMKDGKNSG--FSGTPAFMAPEVAR  163

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
               EQG AADIWA GC + EMA G   W + ++    L RIG   ++P+ P  +S D  +F
Sbjct  164   SEEQGFAADIWAFGCTIIEMATGLVPWCEINDPVSALYRIGYSGDMPQFPNNMSKDATEF  223

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L KC +K P +RWTA+ LL HPF+   +  +      +  R++            F+   
Sbjct  224   LGKCLMKCPNQRWTAKQLLQHPFLQSVETNSWK--FEELKRDSPTSILDQGFWNSFE---  278

Query  1048  WVSESDHLQSSITSLPPPESEYSPADRL------QGIVSHQSPNWSQDSDEWVNVR  1197
              V ES   +S+ T         S ADR+      +GI     PNW +D D WV VR
Sbjct  279   -VMESSSFESTNTI-------DSAADRIRQLIGTEGISCSLMPNWIEDED-WVTVR  325



>ref|XP_009383559.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=451

 Score =   219 bits (559),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 189/364 (52%), Gaps = 49/364 (13%)
 Frame = +1

Query  160   WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
             W RG+ +GRGS   VSLA   + G   A     VKS   S    L  E+ +L  L     
Sbjct  6     WHRGQVIGRGSSATVSLATALTSGEVFA-----VKSAELSRSAILQREQRILCSLDS-PY  59

Query  340   VIRCFGDGYSFE--NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             VI CFG   S    +G   Y++ +E+A  G+L+D+I +    RL E+ IR ++  +LRGL
Sbjct  60    VISCFGFDLSLPTPSGGLYYDLFMEYAPGGSLSDEIAR-RGGRLDEVAIRTHACDVLRGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCE-----LRGTPMYMSP  678
              Y+H  G VHCD+K +NIL+  +G  KIAD G A R  G     E     LRGTPM+M+P
Sbjct  119   AYLHSRGVVHCDVKGRNILIGSDGRAKIADLGCASRIRGDEEEVEGDCQRLRGTPMFMAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDD  855
             E+  G EQGPAAD+WALGC + EMA G P W   S+    + RI   +E P  P  LS +
Sbjct  179   EVARGEEQGPAADLWALGCTIIEMATGRPPWPDVSDPVIAIHRIAFSQETPRFPSWLSGE  238

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPF  1035
             GKDFL KC  +DPR+RWTAE LL+H F++                            CP 
Sbjct  239   GKDFLSKCLRRDPRERWTAEQLLHHEFVASSS-----------------------KHCPR  275

Query  1036  DFPD----WVSESDHL-QSSITSLPPPESEY-----SPADRLQGIVSHQSPNWSQDSDEW  1185
               PD    WVS    L Q+S  SLP  + E       P+ R+Q +V    PNW+ + + W
Sbjct  276   SKPDADRSWVSPKSTLDQASWESLPEQDEETVEHLDDPSARIQPLVCSCGPNWTWE-ENW  334

Query  1186  VNVR  1197
               VR
Sbjct  335   STVR  338



>ref|XP_009132644.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
Length=451

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 191/351 (54%), Gaps = 27/351 (8%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W+RG  +GRGS   VSLA      I  +     VKS   S    L  E+ +L  L    
Sbjct  5     NWIRGPIIGRGSTATVSLA------ITNSGEFFAVKSTELSSSAVLQREQTILSSLNSPY  58

Query  337   EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
              V+   G   + EN + +YN+L+E+   G++ D IK S   +L E EIR Y++ +L+GL 
Sbjct  59    -VVNYIGSNTTTENNKLMYNLLMEYVPGGSIHDLIKNS-GGKLPEPEIRFYTRQILKGLM  116

Query  517   YIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNGG  696
             Y+H  G VHCD+K  N+++ E    KIAD G AK  G  +L  E  GTP +MSPE+  G 
Sbjct  117   YLHGRGIVHCDLKSDNVMIGEET-AKIADLGCAKMAGNGSL--EFSGTPAFMSPEVARGE  173

Query  697   EQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLE  873
             EQG  AD+WALGC V EMA G+  W + ++V   + +IG   E PE+P  LS+ GKDFL 
Sbjct  174   EQGFPADVWALGCVVIEMATGSSPWPELNDVVAAIYKIGFTGESPEVPEVLSEKGKDFLR  233

Query  874   KCFIKDPRKRWTAEMLLNHPFISGEDDGAT---VSLRNDTHREasapapspspRCPFDFP  1044
             KC ++DP++RWTAE LL HPF+  ED   T     L+N  +  ++         C     
Sbjct  234   KCLVRDPKQRWTAEELLQHPFLEEEDQSQTQFGSCLKN--YSPSTVLDQGFWNSCE----  287

Query  1045  DWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
                S S  +Q+  +SL     E S  DR++ +V  ++P  +   D W+ VR
Sbjct  288   --TSRSRFIQADSSSL----WESSATDRIKKLVGDENPGETTAEDGWIEVR  332



>ref|XP_004134977.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis sativus]
Length=396

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/352 (38%), Positives = 193/352 (55%), Gaps = 30/352 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+RG T+GRGS   VS+A     G       M VKS   S  D L  E+ +L +L  C
Sbjct  1     MEWIRGRTIGRGSSAAVSVATDIRFGQV-----MAVKSVEFSHLDFLKREQRILSQL-NC  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               VI   G   + ENG  + N+L+EFA  G++ D ++K+   RL E   + Y++ +L GL
Sbjct  55    SRVIGYKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKA-GGRLDEATAQFYTREVLSGL  113

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H  G VHCDIK  NIL+ E+G +KIADFG A+R    + G  L GTP++M+PE+  G
Sbjct  114   QYVHSNGVVHCDIKCCNILMGEDG-IKIADFGCARRVEEVS-GGNLAGTPIFMAPEVARG  171

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              +QG AAD+W++GCAV +M  G   W   S+    + RIG G+++PEIP  +S+ GKDFL
Sbjct  172   EKQGFAADVWSVGCAVIQMVTGRVPWANLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFL  231

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
              +C I+DP +RW+   LL HPF+  +      + R  T                 D   W
Sbjct  232   RRCLIRDPEERWSVNELLKHPFVQEQKSHPKQNSRTPTS--------------ILDQGIW  277

Query  1051  VSESDHLQSSITSLPPPESEYSPADRLQGIVSHQS---PNWSQDSDEWVNVR  1197
              + +D    ++ S   P+ + +P  R+Q +    +   PNW  D D W+ VR
Sbjct  278   DTVND--PETVESPIRPKIQRTPLQRIQQLNEVSTIGIPNWECDED-WITVR  326



>ref|XP_006283707.1| hypothetical protein CARUB_v10004778mg [Capsella rubella]
 gb|EOA16605.1| hypothetical protein CARUB_v10004778mg [Capsella rubella]
Length=454

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 162/270 (60%), Gaps = 15/270 (6%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            M+W RG  +GRGS   VSLA+     I        VKS   S    L  E+++L  L   
Sbjct  3    MNWTRGPIIGRGSTATVSLAISYFGEI------FAVKSAELSSSTFLQKEQSILSTL-SS  55

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              +++  G G + E+G  LYN+L+E+ S G+L D IK S   +L E EI  Y++ +L GL
Sbjct  56   PHILKYIGSGLTLESGVMLYNILMEYVSGGSLHDLIKSS-GGKLPEPEISSYTRQILNGL  114

Query  514  GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             Y+H+ G VHCD+K QN+L+ ENG +KIADFG AK     +      GTP +M+PE+  G
Sbjct  115  VYLHERGIVHCDLKSQNVLVEENGVLKIADFGCAKSVAKSDFA----GTPAFMAPEVARG  170

Query  694  GEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
             EQ   AD+WALGC V EM  G+  W   ++V   + +IG+  E PEIP K+S+  KDFL
Sbjct  171  EEQSFPADVWALGCTVIEMMTGSSPWPGLNDVVAAMYKIGLSGESPEIPVKISEKAKDFL  230

Query  871  EKCFIKDPRKRWTAEMLLNHPFISGEDDGA  960
              CF KDP++RWT + LL HPF+  +DDG+
Sbjct  231  MNCFKKDPKQRWTVQELLKHPFL--DDDGS  258



>gb|KGN49092.1| hypothetical protein Csa_6G513560 [Cucumis sativus]
Length=402

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 133/352 (38%), Positives = 193/352 (55%), Gaps = 30/352 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W+RG T+GRGS   VS+A     G       M VKS   S  D L  E+ +L +L  C
Sbjct  1     MEWIRGRTIGRGSSAAVSVATDIRFGQV-----MAVKSVEFSHLDFLKREQRILSQL-NC  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               VI   G   + ENG  + N+L+EFA  G++ D ++K+   RL E   + Y++ +L GL
Sbjct  55    SRVIGYKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKA-GGRLDEATAQFYTREVLSGL  113

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H  G VHCDIK  NIL+ E+G +KIADFG A+R    + G  L GTP++M+PE+  G
Sbjct  114   QYVHSNGVVHCDIKCCNILMGEDG-IKIADFGCARRVEEVS-GGNLAGTPIFMAPEVARG  171

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              +QG AAD+W++GCAV +M  G   W   S+    + RIG G+++PEIP  +S+ GKDFL
Sbjct  172   EKQGFAADVWSVGCAVIQMVTGRVPWANLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFL  231

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
              +C I+DP +RW+   LL HPF+  +      + R  T                 D   W
Sbjct  232   RRCLIRDPEERWSVNELLKHPFVQEQKSHPKQNSRTPTS--------------ILDQGIW  277

Query  1051  VSESDHLQSSITSLPPPESEYSPADRLQGIVSHQS---PNWSQDSDEWVNVR  1197
              + +D    ++ S   P+ + +P  R+Q +    +   PNW  D D W+ VR
Sbjct  278   DTVND--PETVESPIRPKIQRTPLQRIQQLNEVSTIGIPNWECDED-WITVR  326



>ref|XP_009614381.1| PREDICTED: mitogen-activated protein kinase kinase kinase A {ECO:0000303|PubMed:9832508}-like 
[Nicotiana tomentosiformis]
Length=471

 Score =   218 bits (554),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 137/371 (37%), Positives = 199/371 (54%), Gaps = 31/371 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W RG  +GRGS   VSLA         A     VKS   SC + L  E +++ +L   
Sbjct  1     MEWTRGPIIGRGSSATVSLAT------NSAGELFAVKSIELSCSNMLQREYSLISQLNS-  53

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +++CFG   + E  + +YN+ +E+   G L+D IKK +   L+E  I+  ++ +L+GL
Sbjct  54    PFLVKCFGFDITSEKNKAMYNMFMEYIPGGTLSDLIKK-QGGSLNESVIKSCAQQILQGL  112

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN-LGCELRGTPMYMSPEMVN  690
              Y+H +G VHCDIK QNIL+ ++G +KIAD G  K  G +N +   + GTP +M+PE+  
Sbjct  113   DYLHSIGLVHCDIKGQNILIGQDG-IKIADLGCGKLLGDENAVNSGISGTPAFMAPEVAR  171

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
             G EQ  AADIWA GC + EMA G+P W    +    L RIG   ++P+ P  LS D ++F
Sbjct  172   GEEQKFAADIWAFGCTIIEMATGSPPWTDMKDPVSALYRIGYSGDVPQFPNYLSTDAREF  231

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L KC  KDP++RWTA+ LL HPF+  +  G+      +  R +            F+   
Sbjct  232   LAKCLKKDPKERWTAKQLLQHPFL--QSIGSNCLKVEELKRGSPTSILDQGFWNSFE---  286

Query  1048  WVSESDHLQSSITSLPPPESEYSPADRL------QGIVSHQSPNWSQDSDEWVNVR*CQM  1209
              V ES  L+SSIT         SPADR+      +GI     P+W ++ + WV VR    
Sbjct  287   -VMESSSLESSITV-------DSPADRIKRLIGDEGISGFLKPDWVEE-ESWVTVRGSDT  337

Query  1210  STVNLQKLQSC  1242
                +L   Q+C
Sbjct  338   EGSSLISEQNC  348



>ref|XP_006346260.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum tuberosum]
Length=459

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 139/379 (37%), Positives = 207/379 (55%), Gaps = 40/379 (11%)
 Frame = +1

Query  151   AMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRG  330
             +M+W+RG  +GRGS   VSLA   S G+  A     VKS   SC   L  E +++ +L  
Sbjct  9     SMEWIRGPIIGRGSSATVSLAT-NSSGVLFA-----VKSTEQSC---LQREYSLISQLNS  59

Query  331   CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
                +++C G   ++E  +++YN+ +E+   G L+D IKK +   L E  I+ Y++ +L+G
Sbjct  60    -PFLVKCLGFDIAYEQNKEVYNMFMEYVQGGTLSDLIKK-QGGSLDESMIKLYAQQILQG  117

Query  511   LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK-RNGGKNLGCELRGTPMYMSPEMV  687
             L Y+H +G VHCD+K QNIL+ ENG++KIAD G AK     KN G    GTP +M+PE+ 
Sbjct  118   LDYLHSIGIVHCDVKGQNILIGENGDIKIADLGCAKLLRDEKNSG--FSGTPAFMAPEVA  175

Query  688   NGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
              G EQG AADIWA GC + EMA G+  W +  +    L RIG   ++P+ P  LS+D ++
Sbjct  176   RGEEQGFAADIWAFGCTIIEMATGSVPWSEIKDPVSALFRIGYSGDLPQFPNNLSNDARE  235

Query  865   FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             FL  C +K P +RWTA+ LL HPF+   +  +      +  R++            F+  
Sbjct  236   FLSNCLMKCPNERWTAKQLLQHPFLQSVESNSWN--FEELKRDSPTSILDQGFWNSFE--  291

Query  1045  DWVSESDHLQSSITSLPPPESEYSPADRLQ------GIVSHQSPNWSQDSDEWVNVR*C-  1203
               V+ES  L+S+ T         S  DR++      GI     PNW ++ D WV VR C 
Sbjct  292   --VTESSSLESTNTV-------DSATDRIRQLIGNVGISCSLMPNWVEEED-WVTVR-CN  340

Query  1204  ---QMSTVNLQKLQSCNDF  1251
                + S ++ Q  +  +DF
Sbjct  341   DTEENSIISEQNCEMIDDF  359



>ref|XP_009793037.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Nicotiana 
sylvestris]
Length=489

 Score =   217 bits (553),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/372 (37%), Positives = 200/372 (54%), Gaps = 33/372 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W RG  +GRGS   VSLA   S  +        VKS   SC + L  E +++ +L   
Sbjct  1     MEWTRGPIIGRGSSATVSLATNSSGEL------FAVKSTELSCSNILQREYSLISQLNS-  53

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               ++ CFG   + E  +  YN+ +E+   G L+D IKK +   L+E  I+ Y++ +L+GL
Sbjct  54    PFLVNCFGFDITSEQNKTTYNMFMEYIPGGTLSDLIKK-QGGSLNESVIKSYAQQILQGL  112

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCE-LRGTPMYMSPEMVN  690
              Y+H +G VHCDIK QNIL+ ++G +KIAD G  K    +N     + GTP +MSPE+  
Sbjct  113   DYLHSIGVVHCDIKGQNILIGQDG-IKIADLGCGKFVRDENSANSGISGTPAFMSPEVAR  171

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
             G EQ   ADIWA GC + EMA G+P W    +    L RIG   ++P+ P  LS+D ++F
Sbjct  172   GEEQRFTADIWAFGCTIIEMATGSPPWTDMKDPVSALYRIGYSGDVPQFPNSLSNDAREF  231

Query  868   LEKCFIKDPRKRWTAEMLLNHPFI-SGEDDGATVSLRNDTHREasapapspspRCPFDFP  1044
             L KC IKDP++RWTA+ LL HPF+ S E +   V    +  R++            F+  
Sbjct  232   LAKCLIKDPKERWTAKQLLQHPFLQSLESNSWKV---ENLKRDSPTSVLDQGFWNSFE--  286

Query  1045  DWVSESDHLQSSITSLPPPESEYSPADRL------QGIVSHQSPNWSQDSDEWVNVR*CQ  1206
               V ES  L+SSIT         SPADR+      +GI     P+W ++ + WV VR   
Sbjct  287   --VMESSSLESSITV-------DSPADRITRLIGDEGISCTLKPDWVEE-EGWVTVRCSD  336

Query  1207  MSTVNLQKLQSC  1242
                 ++   Q+C
Sbjct  337   TEESSIISEQNC  348



>ref|XP_006367880.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum tuberosum]
Length=301

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 165/284 (58%), Gaps = 19/284 (7%)
 Frame = +1

Query  148  GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELR  327
             ++ W RG T+G+G+ G V+LA   ++        + VKS   SC  SL  E+  L+E +
Sbjct  2    ASIRWSRGRTIGKGAEGIVTLATTHNNF------SIAVKSSLFSCSKSLQKEREFLNEFQ  55

Query  328  GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
             C ++IRCFG   + E+   LYN+LLE+A  G LA +I K     L + E+++YSK++L 
Sbjct  56   DCSQIIRCFGADVTEEDNNILYNILLEYAIGGNLAHRIGKKSG--LPDFEVKKYSKSILL  113

Query  508  GLGYIHKVGYVHCDIKLQNILLC-ENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEM  684
            GL  +H  G+VH DIK  NILL       KIADFG A + G  N   +LRGTPMYM+PE 
Sbjct  114  GLRVVHGRGFVHGDIKPHNILLVGTEKTAKIADFGFASKVGIGNKKRKLRGTPMYMAPES  173

Query  685  VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAE-LLMRIGVGEEIPEIPG-KLSDDG  858
            V   E G  ADIWA GC V EM  G   W  + + + L +   +G + PE+   KLS   
Sbjct  174  VLDDEYGTPADIWAFGCTVFEMITGKKVWDCTGINDPLHLLCKIGMQSPELHDEKLSKQA  233

Query  859  KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHR  990
            +DFL KC  +DP  RWTA++LLNHPF+S ++        ND H+
Sbjct  234  EDFLNKCVDRDPHSRWTADLLLNHPFLSSDN--------NDVHQ  269



>ref|XP_007145474.1| hypothetical protein PHAVU_007G242000g [Phaseolus vulgaris]
 gb|ESW17468.1| hypothetical protein PHAVU_007G242000g [Phaseolus vulgaris]
Length=298

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/279 (44%), Positives = 167/279 (60%), Gaps = 23/279 (8%)
 Frame = +1

Query  157  DWVRGETVGRGSFGKVSLA---VPRSHGIAGAAPPMVVKSCG--ASCFDSLLNEKAVLDE  321
            +W     +G+GS+  V LA   +P+ H    AA    VK+    +  FDSL  EK +L+ 
Sbjct  3    EWKNLRVLGKGSYAVVYLAGVILPKEHKWRFAA----VKTSNRYSFSFDSLQKEKRILEL  58

Query  322  LRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKAL  501
             +GCQE+I+ +   YS E    + N+ +EFA  G+  D I+K     L E E+  Y+  L
Sbjct  59   FKGCQEIIQYYFCQYSLEESSVICNLFMEFAPHGSFGDLIRKKA---LEEKEVIIYTHML  115

Query  502  LRGLGYIHKVGYVHCDIKLQNILLCENG------EVKIADFGLAKRNGGKN--LG-CELR  654
            L+GL  IH+ G VHCD+K  NILL  +       ++KIADFGL+K  G  N  LG    R
Sbjct  116  LKGLCCIHREGVVHCDLKPDNILLFPSSDAHAKYQLKIADFGLSKTRGETNDDLGKIRFR  175

Query  655  GTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPE  831
            GTP YMSPE V G  + P  DIW+LGC V EM  G+PAW       +L+ ++G  +E P+
Sbjct  176  GTPFYMSPESVVGFMEAPL-DIWSLGCIVIEMITGSPAWCDIQSQQKLIWKLGFLQEAPK  234

Query  832  IPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGE  948
            IP +L+ D K+FL KCF+KDP++RWTA+MLL+HPFI  E
Sbjct  235  IPNELNWDCKNFLSKCFVKDPKERWTAKMLLDHPFIQKE  273



>ref|XP_010536673.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Tarenaya hassleriana]
Length=444

 Score =   216 bits (550),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 136/362 (38%), Positives = 189/362 (52%), Gaps = 40/362 (11%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W RG T+GRGS   VSLAV  S  +        V+S   S    L  E+++L EL    
Sbjct  3     EWTRGPTIGRGSTAAVSLAVSSSGRL------FAVQSVELSSSAILQREQSLLSEL-SSP  55

Query  337   EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
              ++   G   + EN   LYN+++E+ S G L D IKK    +LSE  IR Y++ +L+GL 
Sbjct  56    HIVEFIGSVSTRENDRLLYNIVMEYLSGGTLQDLIKK-HGGKLSEPAIRSYTRQILKGLS  114

Query  517   YIHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             Y+H  G VHCD+K QN+L+ EN  V KIAD G A          +  GTP +M+PE+  G
Sbjct  115   YLHGKGIVHCDVKSQNVLIGENAAVAKIADLGCANTVEHGGATSDFSGTPAFMAPEVARG  174

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQG AAD+WALGC V EMA G+  W +  +V   + +IG   E PEIPG LS+  KDFL
Sbjct  175   EEQGFAADVWALGCTVIEMATGSSPWPELDDVVAAMYKIGFSGESPEIPGGLSEKAKDFL  234

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
               C  ++ ++RWT + LL HPF+  +D             E+     S SP    D   W
Sbjct  235   RNCLRRESKERWTVQELLQHPFLDEQD-------------ESRNTMSSSSPSTVLDQDFW  281

Query  1051  VSESDHLQSSITSLPPPESEY----------SPADRLQGIVS---HQSPNWSQDSDEWVN  1191
                 D  ++S + L   E+E           SPAD+++ +        P+W  D D+W+ 
Sbjct  282   ----DSYETSKSQLVQTENEDPFADHTSSWGSPADQIKKLAGDGFSGVPDWDSDEDDWIQ  337

Query  1192  VR  1197
             VR
Sbjct  338   VR  339



>ref|XP_006367881.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum tuberosum]
Length=301

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 166/284 (58%), Gaps = 19/284 (7%)
 Frame = +1

Query  148  GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELR  327
             ++ W RG T+G+G+ G V+LA   ++        + VKS   SC  SL  E+  L+E +
Sbjct  2    ASIRWSRGRTIGKGAEGIVTLATTHNNF------SIAVKSSLFSCSKSLQKEREFLNEFQ  55

Query  328  GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
             C ++IRCFG   + E+   LYN+LLE+A  G LA +I K     L + E+++YSK++L 
Sbjct  56   DCSQIIRCFGADVTEEDNNILYNILLEYAIGGNLAHRIGKKSG--LPDFEVKKYSKSILL  113

Query  508  GLGYIHKVGYVHCDIKLQNILLC-ENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEM  684
            GL  +H  G+VH DIK  NILL       KIADFG A + G ++   +LRGTPMYM+PE 
Sbjct  114  GLRVVHGRGFVHGDIKPHNILLVGTEKTAKIADFGFASKVGIESKKRQLRGTPMYMAPES  173

Query  685  VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAE-LLMRIGVGEEIPEIPG-KLSDDG  858
            V   E G  ADIWA GC V EM  G   W  + + + L +   +G + PE+   KLS   
Sbjct  174  VLDDEYGTPADIWAFGCTVFEMITGKKVWDCTGINDPLHLLCKIGMQSPELHDEKLSKQA  233

Query  859  KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHR  990
            +DFL KC  +DP  RWTA++LLNHPF+S ++        ND H+
Sbjct  234  EDFLNKCVDRDPHSRWTADLLLNHPFLSSDN--------NDVHQ  269



>ref|XP_002869589.1| hypothetical protein ARALYDRAFT_492112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45848.1| hypothetical protein ARALYDRAFT_492112 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/357 (37%), Positives = 194/357 (54%), Gaps = 28/357 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             ++W RG+ +GRGS   VS+A+  S  I        VKS   S    L  E++ L  L   
Sbjct  3     INWKRGQIIGRGSTATVSVAISSSGEI------FAVKSADLSSSSFLQKEQSFLSTL-SS  55

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +++  G G ++EN   +YN+L+E+ S G+L D IK S   +L E EIR +++ +L GL
Sbjct  56    PHIVKYIGSGLTYENDRLVYNILMEYVSGGSLHDLIKNS-GGKLPEPEIRSHTRQILNGL  114

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H+ G VHCD+K QN+L+ ENG +KIAD G AK  G         GTP +M+PE+  G
Sbjct  115   VYLHERGIVHCDLKSQNVLVEENGVLKIADMGCAKSVGKSGFS----GTPAFMAPEVARG  170

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQ   AD+WALGC V EM  G+  W + ++V   + +IG   E PEIPG +S+  KDFL
Sbjct  171   EEQRFPADVWALGCTVIEMMTGSNPWPELNDVVAAMYKIGFSGESPEIPGWISEKAKDFL  230

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVS-LRNDTHREasapapspspRCPFDFPD  1047
               C  +DP++RWT E LL H F++ E++  T   L+N T   ++         C      
Sbjct  231   NNCLKEDPKQRWTVEELLKHSFLNDEEESQTSDCLKNKTSSPSTVLDQRFWDSCE-----  285

Query  1048  WVSESDHLQSSITSLP---PPESEYSPADRLQGIVSHQS---PNW-SQDSDEWVNVR  1197
               +   HL S     P     ES  SPA R++ +   +    P+W +++ D W+ VR
Sbjct  286   --TSKTHLISMDHEDPFADYSESWGSPAKRIEKLAGDEFLSLPDWVTEEDDGWIQVR  340



>ref|XP_010099184.1| Mitogen-activated protein kinase kinase kinase 2 [Morus notabilis]
 gb|EXB77056.1| Mitogen-activated protein kinase kinase kinase 2 [Morus notabilis]
Length=443

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 189/354 (53%), Gaps = 27/354 (8%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW RG T+GRGS   VS+A  R     G+     VKS   S  ++L  E+ +L  L  C
Sbjct  1     MDWTRGRTIGRGSSAAVSVATAR-----GSGEIFAVKSIQLSRSETLQREQKILSSLN-C  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +I   G G S ENGE LYN+ +EFA  G+L+D+I++S    L++  IR  +K +L GL
Sbjct  55    PHIIGYRGFGVSSENGELLYNLFMEFAPGGSLSDQIRRS-GGSLNDAVIRSCTKEILLGL  113

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H VG  HCD+K +N+L+   G +KIAD G AK  G   +G    GTP+YM+PE+  G
Sbjct  114   EYLHSVGIAHCDVKARNVLVTGEG-LKIADLGCAKLAGDVAIG----GTPVYMAPEVARG  168

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWKFSEV--AELLMRIGVGEEIPEIPGKLSDDGKDF  867
              +QG AAD+WALGC V EMA G   W   +V     L +IG   + PEIP  +S  G+DF
Sbjct  169   EQQGFAADVWALGCTVIEMATGRAPWAGCDVNPVSALFKIGFSGDGPEIPSFVSKQGRDF  228

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L KC  +DP +RW+A  LL HPF+         S R+   +E    +             
Sbjct  229   LGKCLKRDPSERWSASELLKHPFLE--------SSRDFVAKEVGFGSSGLDSPRSVLDSG  280

Query  1048  WVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSP----NWSQDSDEWVNVR  1197
             ++   +H +S   S  P  S      RL G  +  SP    +W+ D D WV VR
Sbjct  281   FLDSMEHGKSGHESSSPTNSPAERIRRLSGDSTTSSPLGFGDWASDED-WVTVR  333



>ref|XP_010445108.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Camelina 
sativa]
Length=442

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 136/356 (38%), Positives = 193/356 (54%), Gaps = 26/356 (7%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W RG  +GRGS   VS+A+  S  I        VKS   S    L  E+++L  L   
Sbjct  3     MNWTRGPIIGRGSTATVSIAISNSGEI------FAVKSAELSSSTFLQKEESILSTLSS-  55

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +++  G G + EN E +YN+L+E+ S G+L D IK +   +L E  IR Y++ +L GL
Sbjct  56    PHIVKYIGSGLTRENDESVYNILMEYVSGGSLHDLIKNT-GGKLPEPAIRSYTRQILNGL  114

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H+ G VHCD+K QN+L+ ENG +KIAD G AK+ G      E  GTP +M+PE+  G
Sbjct  115   MYLHERGIVHCDLKSQNVLVEENGVLKIADMGCAKKVGES----EFSGTPAFMAPEVARG  170

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQ   AD+W LGC V EM  G+  W + ++V   + +IG   E PEIP  +S+  KDFL
Sbjct  171   EEQRFPADVWGLGCTVIEMMTGSSPWPELNDVVAAMYKIGFSGESPEIPVCVSEKAKDFL  230

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
               CF KD ++RWT   LL HPF+  E+  ++  L   T   ++         C     + 
Sbjct  231   MNCFKKDTKQRWTVHELLKHPFLDDEESQSSECLNKKTSSPSTVLDQRFWDSC-----EE  285

Query  1051  VSESDHLQSSITSLP---PPESEYSPADRLQGIVSHQS---PNWSQDSD-EWVNVR  1197
             VS+S HL S     P     ES  SPADR++ +   +    P+W ++ D  W  VR
Sbjct  286   VSKS-HLISMDHEDPFAGYTESWDSPADRIKKLAGDEFLSLPDWDREDDGGWCQVR  340



>ref|XP_010926215.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Elaeis guineensis]
Length=503

 Score =   216 bits (550),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/362 (39%), Positives = 193/362 (53%), Gaps = 31/362 (9%)
 Frame = +1

Query  148   GAMDWVRGETVGRGSFGKVSLA-VPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDEL  324
             G   W RG T+GRGS   VSLA VP S  +        VKS   S    L  E+ +L  L
Sbjct  2     GMNQWCRGRTIGRGSSATVSLATVPVSGEV------FAVKSAELSRAGLLQREQRILSNL  55

Query  325   RGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
                  V+   G   + E     YN+ +E+A++G+L+D+IKK +  RL E  IR YS  +L
Sbjct  56    NS-PHVVSYLGFDVTSEKNGLYYNLFMEYAARGSLSDEIKK-QGGRLDEPTIRSYSYQIL  113

Query  505   RGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK------NLGCELRGTPM  666
              GL Y+H     HCD+K QN+L+  +G   IAD G A+   G       + G +LRGTPM
Sbjct  114   LGLDYLHSSRIAHCDVKGQNVLIGSDGRAMIADLGCARWVAGDKDGYDDDNGLQLRGTPM  173

Query  667   YMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGK  843
             +M+PE+  G EQG  ADIWALGC + EMA G   W + S+    L RI    ++PE+P  
Sbjct  174   FMAPEVARGEEQGIPADIWALGCTIVEMATGQAPWPEVSDPIAALHRIAFSSDVPELPSW  233

Query  844   LSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspsp  1023
             +SD+GKDFL++C  +DP++RWTAE LL HPF++     A     +D+ R+        SP
Sbjct  234   ISDEGKDFLDRCLRRDPKERWTAEQLLKHPFVAS---SANCLSNSDSTRK------WISP  284

Query  1024  RCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIV----SHQSPNWSQDSDEWVN  1191
             +   D   W S SD  +          S   P DR+Q +V    +   PNW+ D D W+ 
Sbjct  285   KSTLDQAFWESFSDEYEEEEEEE-EGNSSNDPLDRIQLLVGGGGTVSGPNWTWD-DTWMT  342

Query  1192  VR  1197
             +R
Sbjct  343   IR  344



>ref|XP_002512746.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
 gb|EEF49249.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
Length=369

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 176/290 (61%), Gaps = 15/290 (5%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLA-VPRSHGIAGAAPP-MVVKSCGASCFDSLLNEKAVLDELR  327
            + W RG+ +G G F  V LA + +++      PP M VKS   S  +SL NEK V + L 
Sbjct  15   VSWWRGKLLGEGGFASVYLAKLKKNYCRNKVYPPLMAVKSAEFSESNSLQNEKEVFNNLC  74

Query  328  GCQEVIRCFGDGYSFE-NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
             C  +++C+G+  +F+ NG   YNVLLE+AS G LA  IK+S    L E +++RY++ +L
Sbjct  75   TCPYILKCYGEETTFDKNGYLSYNVLLEYASGGTLAALIKQSGGCGLPESDVKRYTRCIL  134

Query  505  RGLGYIHKVGYVHCDIKLQNILLC---ENGEV-KIADFGLAKRNGGKNLGCELR-----G  657
            +G+ YIH+  YVHCD+K +N+LL     +G V KIADFGLAK+    N   ++      G
Sbjct  135  QGIDYIHRHSYVHCDLKPENVLLVAIENDGFVPKIADFGLAKKVLKNNKRRKMTDSFIGG  194

Query  658  TPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVA---ELLMRIGVGEEIP  828
            T +YM+PE +    Q    DIWALGC V EM  G   W     A   EL+ RIG   E+P
Sbjct  195  TVLYMAPETLIDHIQESPCDIWALGCIVFEMLTGKRVWDSKPEAATEELIKRIGDRFELP  254

Query  829  EIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRN  978
             IP ++S DGKDFL++C +K P  R+T+EMLL+HPF+SG DD  +   ++
Sbjct  255  VIPSEISQDGKDFLKRCLVKKPAFRFTSEMLLDHPFMSGLDDSKSSDFKD  304



>ref|XP_010436369.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=437

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 140/360 (39%), Positives = 192/360 (53%), Gaps = 31/360 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             M+W RG  +GRGS   VS+A+  S  I        VKS   S    L  E+++L  L   
Sbjct  3     MNWTRGPIIGRGSTATVSIAISNSGEI------FAVKSAELSSSTFLQKEESILSTLSS-  55

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               +++  G G + EN   +YN+L+E+ S G+L D IKKS   +L E  IR Y++ +L GL
Sbjct  56    PHIVKYIGSGLTRENDRLVYNILMEYVSGGSLHDLIKKS-GGKLPEPAIRSYTRQILNGL  114

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              YIH+ G VHCD+K QN+L+ ENG +KIAD G AK  G      E  GTP +M+PE+  G
Sbjct  115   MYIHERGIVHCDLKSQNLLVEENGVLKIADMGCAKTVGES----EFSGTPAFMAPEVARG  170

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQ   AD+WALGC V EM  G+  W + ++V   + +IG   E PEIP  +S+  KDFL
Sbjct  171   EEQRFPADVWALGCTVMEMMTGSSPWPELNDVVAAMYKIGFSGESPEIPVCVSEKAKDFL  230

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLR----NDTHREasapapspspRCPFD  1038
               CF KD ++RWT   LL HPF+  +DD  + S      N T   ++         C   
Sbjct  231   MSCFKKDTKQRWTVHELLKHPFLDNDDDKESQSSECLCLNKTSSPSTVLDKHFWDSCE--  288

Query  1039  FPDWVSESDHLQSSITSLP---PPESEYSPADRLQGIVSHQS---PNW-SQDSDEWVNVR  1197
                 VS+  HL S     P     ES  SPADR++ +    +   P+W ++D   W  VR
Sbjct  289   ----VSKC-HLISMDHDNPFAGYSESCDSPADRIEKLAGDDNSSLPDWDTEDDGGWYKVR  343



>ref|XP_008782219.1| PREDICTED: serine/threonine-protein kinase 4-like [Phoenix dactylifera]
Length=551

 Score =   216 bits (550),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 189/361 (52%), Gaps = 32/361 (9%)
 Frame = +1

Query  148   GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELR  327
             G ++W RG T+GRGS   VSLA      +  +     VKS   +    L  E+ +L  L 
Sbjct  2     GMVEWCRGRTIGRGSSATVSLAT-----VPASGEVFAVKSAEIARAGLLQREQRILSNLN  56

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
                 V+   G   + E     YN+  E+A++G+L+D+IKK +   L E  IR YS  +LR
Sbjct  57    S-PHVVSYLGCDVTSEKNGVYYNLFTEYAARGSLSDEIKK-QGGCLDEPTIRSYSYHILR  114

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNL------GCELRGTPMY  669
             GL Y+H     HCD+K QN+L+  +G   IAD G A+R  G         G +LRGTPM+
Sbjct  115   GLAYLHSSRIAHCDVKGQNVLIGSDGRAIIADLGCARRVAGDEDDYDDDDGLQLRGTPMF  174

Query  670   MSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKL  846
             M+PE+  G EQG  ADIWALGC + EMA G   W + S+    L RI    ++PE+P  +
Sbjct  175   MAPEVARGEEQGIPADIWALGCTIVEMATGHAPWPEVSDPIAALHRIAFSSDVPELPSWI  234

Query  847   SDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspR  1026
             SD+GKDF +KC  +DP++RWTAE LLNHPF++        S  N  H+  S  +      
Sbjct  235   SDEGKDFSDKCLRRDPKERWTAEQLLNHPFVA--------SSANSIHKRISPKSTLDQA-  285

Query  1027  CPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSH----QSPNWSQDSDEWVNV  1194
                 F D +S+    +          S   P+ R+Q +V       SPNW+ D D W+ +
Sbjct  286   ----FWDSLSDEYEEEEEEDEEEDGNSSDDPSKRIQLLVGGGTVVGSPNWTWD-DSWMTI  340

Query  1195  R  1197
             R
Sbjct  341   R  341



>ref|XP_010545229.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Tarenaya hassleriana]
Length=471

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/355 (38%), Positives = 193/355 (54%), Gaps = 22/355 (6%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W RG T+GRGS   VS+AV  S  I        VK+   S    L  E+++L EL    
Sbjct  31    EWTRGPTIGRGSTATVSIAVASSGRI------FAVKTVELSSSAILQREQSLLSEL-SSP  83

Query  337   EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
              V++  G   + EN   LYN+L+E+   G L D IKK    +L E EIR +++ +L+GL 
Sbjct  84    HVVKFIGSVSTRENNIFLYNILMEYVGGGTLHDLIKK-RGGKLPEPEIRSFTRQILKGLS  142

Query  517   YIHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             Y+H  G VHCD+K QN+L+ ENG V KI+D G AK      +  E  GTP +M+PE+  G
Sbjct  143   YLHSRGIVHCDVKSQNVLIGENGVVAKISDLGCAKTVENGGVTSEFSGTPAFMAPEVARG  202

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQG AAD+WALGC V EMA G+  W   ++V   + +IG   E PEIPG LS+  KDFL
Sbjct  203   EEQGFAADVWALGCTVIEMATGSSPWPGLNDVVAAMYKIGFSGESPEIPGWLSEKAKDFL  262

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGAT-VSLRNDTHREasapapspspRCPFDFPD  1047
               C  ++  +RW     L HPF+  +D+  T ++ R  T   + +          F+   
Sbjct  263   RNCLRREASERWAVHEFLQHPFLDEQDESRTCLNTRMTTSSSSPSTVLDQYFWDSFE---  319

Query  1048  WVSESDHLQSSITSLPPPESEY--SPADRLQGIVS---HQSPNWSQDSDEWVNVR  1197
              +S+S  +Q+      P  S Y  SPADR++ +        P+W  D+D+W+ +R
Sbjct  320   -LSKSLLIQTEHEDPFPDPSSYRDSPADRIKKLAGDGFSGVPDW--DTDDWIQLR  371



>ref|XP_009421493.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Musa acuminata subsp. malaccensis]
Length=432

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 142/356 (40%), Positives = 188/356 (53%), Gaps = 35/356 (10%)
 Frame = +1

Query  160   WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
             W RG  +GRGS   V LA     G   A     VKS   S    L  E+ +L  L G   
Sbjct  6     WRRGRVIGRGSSATVLLATDLDSGEVFA-----VKSVELSRSAVLQREQRILSSL-GSPY  59

Query  340   VIRCFGDGYSFEN--GEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             V+ CFG   S     G   YN+ +E+A +G+L+D+I +    RL E  IR Y+  +LRGL
Sbjct  60    VVSCFGFDVSSHRLAGGLYYNLFMEYAPRGSLSDEIVR-HGGRLDEAAIRSYTYQILRGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK------RNGGKNLGCELRGTPMYMS  675
              YIH  G VHCD+K +N+L+  +G  KIAD G A       R GG+  G  LRGTPM+M+
Sbjct  119   AYIHSEGVVHCDVKGRNVLIGSDGRAKIADLGCASLIDEDDRGGGECRG--LRGTPMFMA  176

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSD  852
             PE+  G EQGP AD+WALGC V EMA G P W        ++ RI     +P+ P  LS 
Sbjct  177   PEVARGEEQGPPADVWALGCTVIEMATGCPPWPDVPNAIGVVHRIAFSRVVPDFPSWLSA  236

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
             +GKDFL KC  +DP +RWTAE LL H F++        S R +   +  +     SP+  
Sbjct  237   EGKDFLSKCLKRDPSERWTAEQLLRHEFVA--------SSRTNPSSKPDSDRFWASPKST  288

Query  1033  FDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIV-SHQSPNWSQDSDEWVNVR  1197
              D   W S S+      ++  P   E  P+ R+Q ++ S  SPNW+ D + WV VR
Sbjct  289   LDQAFWESFSEQ-----SAEHPSHDE--PSARIQHLISSSSSPNWTWD-ENWVAVR  336



>gb|AAR87851.1| fertilization-related kinase 2 [Solanum chacoense]
Length=304

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 165/284 (58%), Gaps = 19/284 (7%)
 Frame = +1

Query  148  GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELR  327
             ++ W RG T+G+G+ G V+LA   ++        + VKS   SC  SL  E+  L+E +
Sbjct  2    ASIRWSRGRTIGKGAEGTVTLATTHNNF------SIAVKSSLFSCSKSLQKEREFLNEFQ  55

Query  328  GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
             C ++IRCFG   + E+   LYN+LLE+A  G+LA +I K     L + E+++YSK +L 
Sbjct  56   DCSQIIRCFGADVTEEDNNILYNILLEYAIGGSLAHRIGKKSG--LPDFEVKKYSKPILL  113

Query  508  GLGYIHKVGYVHCDIKLQNILLC-ENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEM  684
            GL  +H  G+VH DIK  NILL       KIADFG A + G  +   +LRGTPMYM+PE 
Sbjct  114  GLRVVHGKGFVHGDIKPHNILLVGTEKRAKIADFGFASKVGIGSKKRKLRGTPMYMAPES  173

Query  685  VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAE-LLMRIGVGEEIPEI-PGKLSDDG  858
            V   E G  ADIWA GC V EM  G   W  + + + L +   +G + P++   K+S   
Sbjct  174  VLDDEYGTPADIWAFGCTVFEMITGKKVWDCTGINDPLHLLCKIGMQSPDLHDDKMSKQA  233

Query  859  KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHR  990
            +DFL KC  +DP  RWTA++LLNHPF+S ++        ND H+
Sbjct  234  EDFLNKCVDRDPHSRWTADLLLNHPFLSSDN--------NDVHQ  269



>emb|CDY17301.1| BnaA10g09350D [Brassica napus]
Length=431

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/355 (39%), Positives = 189/355 (53%), Gaps = 39/355 (11%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W+RG T+GRGS   VSLA+  S  +        VKS   S    L  E++VL +L    
Sbjct  5     NWIRGPTIGRGSTATVSLAITNSGEL------FAVKSAELSSSAVLQREQSVLSKLSS-P  57

Query  337   EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
              V++  G   + ENG+ +YN+L+E+ S G++ D IKKS   +L E EIR Y++ +L+GL 
Sbjct  58    YVVKYIGSNVTTENGQPMYNLLMEYVSGGSIHDLIKKS-GGKLPEPEIRFYTRQILKGLM  116

Query  517   YIHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             Y+H  G VHCD+K QN+++   GE  KIAD G AK  G ++L  E  GTP +MSPE+  G
Sbjct  117   YLHGQGIVHCDLKSQNVMV--GGETAKIADLGCAKMAGNESL--EFSGTPAFMSPEVARG  172

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQ   AD+WALGC V EMA G   W + ++V   + +IG   E PEIP  LS+ GKDFL
Sbjct  173   EEQSFPADVWALGCMVIEMATGLSPWPELNDVVGAIYKIGFTGESPEIPECLSEKGKDFL  232

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVS---LRNDTHREasapapspspRCPFDF  1041
               C  +DP++RW  E LL HPF+  ED    +S   L + +           S      F
Sbjct  233   TNCLRRDPKQRWAVEELLQHPFLDEEDKTQILSCCCLNSSSPSTVLDQGFWDSYPFANSF  292

Query  1042  PDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQS---PNWSQDSDEWVNVR  1197
               W S                   S ADR++ +V  ++   P W    D W+ VR
Sbjct  293   NMWDS-------------------SAADRIKKLVGDENSGVPEWLTAEDGWIEVR  328



>ref|XP_008784479.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Phoenix dactylifera]
Length=498

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/366 (36%), Positives = 188/366 (51%), Gaps = 45/366 (12%)
 Frame = +1

Query  148   GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELR  327
             G  +W RG T+GRGS   VSLA      I  +     VKS   S    L  E+ +L  L 
Sbjct  2     GKGEWYRGRTIGRGSSATVSLAT-----ITASGEVFAVKSAELSRAGLLRREQRILANL-  55

Query  328   GCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
                 V+   G   + E     YN+ +E+A++G+L+D+I+K +  RL E  IR YS  +LR
Sbjct  56    SYPHVVSYLGFDITSETNGVYYNLFMEYAARGSLSDEIEK-QGGRLDEPTIRSYSCQILR  114

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKN-LGC-ELRGTPMYMSPE  681
             GL Y+H     HCD+K +N+L+  +G   IAD G A+    ++  GC +LRGTPMYM+PE
Sbjct  115   GLAYLHSNSIAHCDVKGRNVLIGSDGRAMIADLGCARWMADEDGRGCLQLRGTPMYMAPE  174

Query  682   MVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDG  858
                G EQG  AD+WALGC V EMA G   W +FS+    L RI    ++PE+P  +SD+G
Sbjct  175   AARGEEQGTPADVWALGCTVVEMATGRAPWPEFSDPIAALHRIAFSTDVPELPSWISDEG  234

Query  859   KDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFD  1038
             KDFL++C  +DP +RWTAE LL HPF++   +    S  N T                  
Sbjct  235   KDFLDRCLRRDPNERWTAEQLLKHPFVASSANCLPSS--NST------------------  274

Query  1039  FPDWVSESDHLQSSI---------TSLPPPESEYSPADRLQGIVSHQS----PNWSQDSD  1179
              P W+S    L  +                 S   P+ R+Q + +  +    P+W+ D D
Sbjct  275   -PKWISPKSTLDQAFWESISDEEEEVDKVENSSNDPSQRIQHLATAAAVVGVPDWTWD-D  332

Query  1180  EWVNVR  1197
              W+ +R
Sbjct  333   SWMTIR  338



>ref|XP_004289177.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Fragaria vesca subsp. vesca]
Length=415

 Score =   212 bits (539),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/353 (38%), Positives = 190/353 (54%), Gaps = 19/353 (5%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW RG+T+GRGS   VSLA          +    VKS   S  + L  E+ +L  L  C
Sbjct  1     MDWTRGQTIGRGSSAVVSLAT------GSCSKVFAVKSAELSQSEFLQREQKILSTL-SC  53

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               V+   G   + EN + +YN+ +E+ + G + D I+     +L E  +R Y++ + +GL
Sbjct  54    PHVVSYLGHDITRENNKLMYNIFMEYVAGGTIIDAIRNC-GGQLEESAVRFYTREIAKGL  112

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H VG VHCDIK +NIL+ E G +KIADFG A+          + GTPM+MSPE+  G
Sbjct  113   AYLHSVGLVHCDIKGRNILVGEEG-LKIADFGCARWADPAAEAVPIGGTPMFMSPEVARG  171

Query  694   GEQGPAADIWALGCAVAEMA-GGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
              EQG   D+WALGC V EMA GG+  W   ++   LL RI    E PEIP  LSD  +DF
Sbjct  172   EEQGFPCDVWALGCTVIEMATGGSVPWPNAADPVTLLYRIAYSGESPEIPSFLSDQARDF  231

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             L KCF++DP++RWT   LL HPF++   +   ++  + T +   + + S SP    D   
Sbjct  232   LGKCFMRDPKERWTVTQLLKHPFLA---ETMIINSASTTKQVQESTSTSFSPTSILDQGI  288

Query  1048  W--VSESDHLQSSITSLPPPESEYSPADRLQGI-VSHQSPNWSQDSDEWVNVR  1197
             W  + ES  L + +    P      P DR++ + +    P WS D   W+ VR
Sbjct  289   WNSLQESQTLGNLVDH--PSVENSCPDDRIRRLSLFSGMPRWSSDEGYWIAVR  339



>ref|XP_002321133.2| kinase family protein [Populus trichocarpa]
 gb|EEE99448.2| kinase family protein [Populus trichocarpa]
Length=348

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 192/350 (55%), Gaps = 22/350 (6%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW RG T+GRGS   VS+A     G   A     VKS   S    L  E+ +L  +   
Sbjct  1     MDWTRGHTIGRGSTATVSVATSIQSGDVFA-----VKSVELSQSGFLQREQKILSSIIS-  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               ++   G   + +N + +YN+ LE+   G+L++ I   +  RL E  IR ++  +L+GL
Sbjct  55    PFIVSYKGCDVTRKNNKVMYNLFLEYMPNGSLSNAIHAHDGGRLDESLIRIFTYQILQGL  114

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H  G VHCDIK  NIL+ ++G  KIADFG AKR   +     + GTPM+M+PE+  G
Sbjct  115   DYLHLNGLVHCDIKSSNILVAQSG-AKIADFGCAKRVEQQG---PIAGTPMFMAPEVARG  170

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQG A+DIWALGC + EMA G   W   S+   ++ R G    +PE P  LS+  +DFL
Sbjct  171   EEQGFASDIWALGCTIIEMASGGTPWHNVSDPVSIIYRAGYSGHLPEFPCCLSEQARDFL  230

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
             +KC  +DP++RWTA  LL HPF+ GE         N    E++  + SP+        + 
Sbjct  231   DKCLRRDPKERWTASQLLEHPFLVGE--------LNKQIEESNPTSTSPTSILDQGIWNS  282

Query  1051  VSESDHLQSSITSLPPPESEYSPADRLQGI-VSHQSPNWSQDSDEWVNVR  1197
             + ES+ L+S +  L P  SE S ++R++G+ +   +P+W  D   W+  R
Sbjct  283   LDESESLESLV--LVPSGSESSASERIRGLSLLSGAPSWDCDDQNWITAR  330



>ref|XP_004170035.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis sativus]
Length=304

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/263 (44%), Positives = 162/263 (62%), Gaps = 10/263 (4%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            M+W+RG T+GRGS   VS+A     G       M VKS   S  D L  E+ +L +L  C
Sbjct  1    MEWIRGRTIGRGSSAAVSVATDIRSGQV-----MAVKSVEFSHLDFLKREQRILSQL-NC  54

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              VI   G   + ENG  + N+L+EFA  G++ D ++K+   RL E   + Y++ +L GL
Sbjct  55   SRVIGYKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKA-GGRLDEATAQFYTREVLSGL  113

Query  514  GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             Y+H  G VHCDIK  NIL+ E+G +KIADFG A+R    + G  L GTP++M+PE+  G
Sbjct  114  QYVHSNGVVHCDIKCCNILMGEDG-IKIADFGCARRVEEVS-GGNLAGTPIFMAPEVARG  171

Query  694  GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
             +QG AAD+W++GCAV +M  G   W   S+    + RIG G+++PEIP  +S+ GKDFL
Sbjct  172  EKQGFAADVWSVGCAVIQMVTGRVPWANLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFL  231

Query  871  EKCFIKDPRKRWTAEMLLNHPFI  939
             +C I+DP +RW+   LL HPF+
Sbjct  232  RRCLIRDPEERWSVNELLKHPFV  254



>gb|EEE56860.1| hypothetical protein OsJ_06484 [Oryza sativa Japonica Group]
Length=393

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 188/355 (53%), Gaps = 32/355 (9%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W RG  +GRG+   VS+A  R  G   A   + V   GA     L  E+ +L  L    
Sbjct  6     EWRRGPVIGRGATATVSIATDRRTGGVFAVKSVDVARAGA-----LRREQGMLSAL-ASP  59

Query  337   EVIRCFGDGYSFE---NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              V+ C G G S     +G   Y++ LE+A  G+LAD+IK+    R  E  IR     +LR
Sbjct  60    FVVPCVGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRC-GGRCEEPLIRSRVGDVLR  118

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNL---GCELRGTPMYMSP  678
             GL Y+H  G  HCD+K +N+L+  +G   +ADFG A+    ++    G  +RGTPM+++P
Sbjct  119   GLAYVHAAGIAHCDVKGRNVLVGADGRAMLADFGCARWMAAEDCNAGGVTIRGTPMFLAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMA-GGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDD  855
             E   G  QG AADIWALGC V EMA GGAP  +F++    L  +    ++PE P   S +
Sbjct  179   EAARGEAQGTAADIWALGCTVIEMATGGAPWPRFADPVAALHHVAHSVDVPESPAWFSAE  238

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPF  1035
             GKDFL +C I+DP KRWTAE LL HPF++        S  +D+  +A       SP+   
Sbjct  239   GKDFLARCLIRDPAKRWTAEQLLEHPFVA--------SAASDSTSKAVQIEQRVSPKSIL  290

Query  1036  DFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQS--PNWSQDSDEWVNV  1194
             D   W S S    +++          +PADRL+ + +  S  P+W+   D+W+ V
Sbjct  291   DQCLWESTSTDSDATVA--------LAPADRLRALSAGASVAPDWTWSMDDWIAV  337



>ref|XP_009121273.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Brassica rapa]
Length=441

 Score =   212 bits (539),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 195/356 (55%), Gaps = 31/356 (9%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W+RG T+GRGS   VSLA+  S  +        VKS   S    L  E++VL +L    
Sbjct  5     NWIRGPTIGRGSTATVSLAITNSGEL------FAVKSAELSSSAVLQREQSVLSKLSS-P  57

Query  337   EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
              V++  G   + ENG+ +YN+L+E+ S G++ D IKKS   +L E EIR Y++ +L+GL 
Sbjct  58    YVVKYIGSNVTTENGQPMYNLLMEYVSGGSIHDLIKKS-GGKLPEPEIRFYTRQILKGLM  116

Query  517   YIHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             Y+H  G VHCD+K QN+++   GE  KIAD G AK  G ++L  E  GTP +MSPE+  G
Sbjct  117   YLHGQGIVHCDLKSQNVMV--GGETAKIADLGCAKMAGNESL--EFSGTPAFMSPEVARG  172

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQ   AD+WALGC V EMA G   W + ++V   + +IG   E PEIP  LS+ GKDFL
Sbjct  173   EEQSFPADVWALGCMVIEMATGLSPWPELNDVVGAIYKIGFTGESPEIPECLSEKGKDFL  232

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
               C  +DP++RW  E LL HPF+  ED    +S              S SP    D   W
Sbjct  233   TNCLRRDPKQRWAVEELLQHPFLDEEDKTQILSC---------CCLNSSSPSTVLDQGFW  283

Query  1051  VSESDHLQSSITSLPPPES----EYSPADRLQGIVSHQS---PNWSQDSDEWVNVR  1197
              S  +  +S +   P   S    + S ADR++ +V  ++   P W    D W+ VR
Sbjct  284   DS-CETSRSRLIQDPFANSFNMWDSSAADRIKKLVGDENSGVPEWLTAEDGWIEVR  338



>ref|XP_010644538.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Vitis 
vinifera]
Length=437

 Score =   212 bits (539),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 137/358 (38%), Positives = 192/358 (54%), Gaps = 35/358 (10%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW RG T+GRG+   +SLA+  + G   A     VKS   S    L  E++ L +L   
Sbjct  1     MDWTRGPTIGRGASATISLAIVSTSGELFA-----VKSTELSRSKLLQREQSFLSQL-SS  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             + +++  G   + E    LYNV +E+   GAL+D+I++  N RL E  IR Y++ ++ GL
Sbjct  55    ERIVKYLGSNTTCEGDTMLYNVFMEYVPGGALSDEIRRRGN-RLDEDWIRLYTRQIVLGL  113

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+   G VHCDIK +N+L+ E+G V IAD G AK   G   G    GTP++M+PE+  G
Sbjct  114   EYLQFNGLVHCDIKSENVLIREDGAV-IADLGCAKSVHGNGGGSVFSGTPVFMAPEVARG  172

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQG  AD+WALGC V EMA G   W +  +    L RIG   ++PE P  LS++G+DFL
Sbjct  173   EEQGFPADVWALGCTVIEMATGRNPWPEVDDPVSALYRIGFSGDVPEFPMWLSENGRDFL  232

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
             +KC  ++PR+RWTA+ LL HPF+                   S        + P    D 
Sbjct  233   DKCLRRNPRERWTAKELLEHPFL----------------EPNSKQLKEFPVKSPTSVLDD  276

Query  1051  VSESDHLQSSITS---LPPPESEYSPADRLQ----GIVSHQS--PNWSQDSDEWVNVR  1197
                 D L++ +T    +    S  SPA+R+Q    G +S  S  PNW+ D D WV VR
Sbjct  277   QGFWDSLEAPVTPSVLMHIGSSSNSPAERIQRLNEGALSSGSNLPNWTWDED-WVTVR  333



>ref|XP_009394082.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Musa acuminata subsp. malaccensis]
Length=407

 Score =   210 bits (535),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 157/268 (59%), Gaps = 21/268 (8%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
            W RG  VGRG+   VS+A   S G   A     VKS   S    L  E+ +L  L     
Sbjct  6    WRRGRIVGRGASATVSVAASLSSGEIFA-----VKSAELSSSGDLQREQRILSSLDS-PY  59

Query  340  VIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGY  519
            V+  FG    FE G   Y++ +E+A  G+++D+IKK    RL E+ IR Y+  LLRGL Y
Sbjct  60   VVSYFG----FEVG-LCYDLFMEYAPGGSMSDEIKK-RGGRLDELNIRSYTCDLLRGLAY  113

Query  520  IHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR------NGGKNLGCELRGTPMYMSPE  681
            +H  G VHCD+K QN+L+C  G  KIADFG A+R      +GG  +  + RGTPM+M+PE
Sbjct  114  LHSNGVVHCDLKSQNVLICSGGRAKIADFGCARRADEEDKDGGGRV--QPRGTPMFMAPE  171

Query  682  MVNGGEQGPAADIWALGCAVAEMAGGAPAWKF-SEVAELLMRIGVGEEIPEIPGKLSDDG  858
            +  G EQ   AD+WALGC V EMA G P W   S+    L RI     +PE P  LS+DG
Sbjct  172  VARGEEQSAPADVWALGCTVIEMATGQPPWPHASDPVSALHRIAFSAAVPEFPCWLSEDG  231

Query  859  KDFLEKCFIKDPRKRWTAEMLLNHPFIS  942
             DFL +C  +DPR+RW+AE LL HPF++
Sbjct  232  NDFLSRCLRRDPRERWSAEQLLRHPFVA  259



>ref|XP_001755952.1| predicted protein [Physcomitrella patens]
 gb|EDQ79237.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 109/275 (40%), Positives = 163/275 (59%), Gaps = 13/275 (5%)
 Frame = +1

Query  148  GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGA---SCFDSLLNEKAVLD  318
             +  W+RG  +G G+FG V+LA+ R +G   A   + VK   A   +   ++ NE  +L 
Sbjct  2    ASQSWIRGNLLGAGAFGSVNLAINRENGEVFAVKSVQVKVRYAGSEAAVRAIENEIDMLQ  61

Query  319  ELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKK-SENHRLSEMEIRRYSK  495
             L   + V+RC G  ++ E G+ + N+ LE+  +G L D +K+ + +  L E  +R Y++
Sbjct  62   RLDS-KYVVRCLGSDWTEEGGQLMRNLFLEYMPEGCLTDFVKQFTSSGALDEQLLRTYTR  120

Query  496  ALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK------NLGCELRG  657
            +++ G+ Y+H  G VHCDIK +NIL+  NG VK+ DFG +KR G K      N   ++ G
Sbjct  121  SIVEGIDYLHSNGIVHCDIKGKNILI-GNGNVKLTDFGSSKRVGAKVESDVMNCAAKVNG  179

Query  658  TPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEI  834
            TP++M+PE+V   EQGP +DIW+LGC V EMA G   W  F+     L  IG  +++PE+
Sbjct  180  TPLWMAPEVVRQVEQGPPSDIWSLGCTVVEMATGRAPWSHFANHFAALYHIGCTDQLPEV  239

Query  835  PGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFI  939
            P  LS +  DFL  CF +D  KRWT+  LL HPF+
Sbjct  240  PASLSAEAHDFLSHCFQRDSSKRWTSAQLLQHPFL  274



>gb|EYU33654.1| hypothetical protein MIMGU_mgv1a021391mg [Erythranthe guttata]
Length=343

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 118/264 (45%), Positives = 152/264 (58%), Gaps = 10/264 (4%)
 Frame = +1

Query  151  AMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRG  330
            A  W RG T+GRGS   VSLA       AG      VKS   S   SL  E  ++ +L  
Sbjct  2    AAAWTRGPTIGRGSSASVSLAT-----TAGGEVFAAVKSTDLSSSASLQKEGILISQLS-  55

Query  331  CQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRG  510
               +++C G   + E    +YN+ LE+   G L+D+IKK +   L E  I +++  +L G
Sbjct  56   SPYIVKCLGSDITCEESGHVYNLFLEYLPGGTLSDRIKK-QGGSLDETAIGKHAHGILMG  114

Query  511  LGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
            L Y+H  G VHCDIK +NILL ENG VKIADFG AKR    + G    GTP YM+PE   
Sbjct  115  LNYLHTKGLVHCDIKGENILLGENGSVKIADFGCAKRV--GSGGSGFSGTPAYMAPETAR  172

Query  691  GGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
            G EQG AAD+WALGC V EMA G+  W +  + A  L R+G   ++PE P   S   +DF
Sbjct  173  GEEQGFAADVWALGCTVVEMATGSHPWPEMKDPAAALYRVGFSGDVPETPAWFSGQARDF  232

Query  868  LEKCFIKDPRKRWTAEMLLNHPFI  939
            L+ C  +DPR+RWTA  LL HPF+
Sbjct  233  LDNCLTRDPRERWTAAELLRHPFM  256



>emb|CDY19916.1| BnaC09g31820D [Brassica napus]
Length=446

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/356 (38%), Positives = 188/356 (53%), Gaps = 41/356 (12%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W+RG T+GRGS   VSLA+  S  +        VKS   S    L  E++ L +L    
Sbjct  5     NWIRGPTIGRGSTATVSLAITNSGEL------FAVKSAELSSSAVLQREQSGLSKL-SSP  57

Query  337   EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
              V++  G   + ENG+ +YN+L+E+ S G++ D IK+S   +L E EIR Y++ +L+GL 
Sbjct  58    YVVKYIGSSVTTENGKPMYNLLMEYVSGGSIHDLIKRS-GGKLPEPEIRSYTRQILKGLM  116

Query  517   YIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNGG  696
             Y+H  G VHCD+K QN+++ E+   KIAD G +K  G  +L  E  GTP +MSPE+  G 
Sbjct  117   YLHDQGIVHCDLKSQNVMVGED-TAKIADLGCSKMAGNGSL--EFSGTPAFMSPEVARGE  173

Query  697   EQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLE  873
             EQ   AD+WALGC V EMA G   W + ++V   + +IG   E PEIP  LS+ GKDFL 
Sbjct  174   EQSFPADVWALGCMVIEMATGLSPWPELNDVVGAIYKIGFTGESPEIPECLSEKGKDFLR  233

Query  874   KCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDWV  1053
              C  +DP++RW  E LL HPF+  ED    +S                  RC  +     
Sbjct  234   NCLRRDPKQRWAVEELLQHPFLDVEDKSQILS------------------RCCLNSS---  272

Query  1054  SESDHLQSSITSLPPPESEY-----SPADRLQGIVSHQS---PNWSQDSDEWVNVR  1197
             S S  L        P  + Y     S ADR+  +V  ++   P W    D W+ VR
Sbjct  273   SPSTVLDQGFWDSYPFANSYDLWDSSAADRINKLVGDENSGEPEWLTADDGWIEVR  328



>ref|XP_007026132.1| Mitogen-activated protein kinase kinase kinase 15, putative [Theobroma 
cacao]
 gb|EOY28754.1| Mitogen-activated protein kinase kinase kinase 15, putative [Theobroma 
cacao]
Length=482

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/264 (45%), Positives = 157/264 (59%), Gaps = 10/264 (4%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            M+W RG T+GRGS   VS+A     G   A     VKSC  S  +SL  E+ +L  L  C
Sbjct  1    MEWTRGRTIGRGSTATVSIATADQSGDVFA-----VKSCELSQSESLRREQRILSTL-SC  54

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              V+ C G   S ENG  +YN+LLE+A  G + D I+K +  RL E  +R Y++ +L+GL
Sbjct  55   PRVLACKGCDISSENGMLVYNLLLEYAPGGTITDAIQK-QGGRLDEAMVRSYTRGILQGL  113

Query  514  GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR-NGGKNLGCELRGTPMYMSPEMVN  690
             ++H  G VHCDIK +N+L+ ++G VKIAD G A+R +        + GTP+YM+PE+  
Sbjct  114  EFLHSSGIVHCDIKGRNVLVTDDG-VKIADLGCARRADVVPGAAWSVAGTPVYMAPEVAR  172

Query  691  GGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
            G +QG  AD+WALGC V EMA G   W    +    L RIG   ++PEIP  LS   KDF
Sbjct  173  GEQQGFPADVWALGCTVIEMATGRAPWPDVGDPVSALYRIGFSRDMPEIPSDLSKQAKDF  232

Query  868  LEKCFIKDPRKRWTAEMLLNHPFI  939
            L KC  +DP +RWTA  LL H F+
Sbjct  233  LSKCLRRDPVERWTATQLLAHDFV  256



>ref|XP_002267176.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Vitis 
vinifera]
 emb|CBI23749.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 162/268 (60%), Gaps = 13/268 (5%)
 Frame = +1

Query  163  VRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQEV  342
            V+G  +GRG  G+V  A   +H        + VKS  +S    L  EK +L EL+ C E+
Sbjct  7    VKGNLLGRGRHGRVYSAFSFNH----TPHHLAVKSAFSSHSSLLAKEKRILSELQHCPEI  62

Query  343  IRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLGYI  522
            + C+GD  + E G + YN+ LE+A  G+L+D I+ S    L E  ++ Y++ +L+GL +I
Sbjct  63   VHCYGDDSTMEEGVETYNLFLEYAPGGSLSDLIRNSGG-TLPESNVQLYTRMILKGLCHI  121

Query  523  HKVGYVHCDIKLQNILL--CENG--EVKIADFGLAKRNGGKNLGC--ELRGTPMYMSPEM  684
            H+ GYVHCDIK  N+L+   E+G  +VKIADFGLAKR G +      +  GTP YMSPE 
Sbjct  122  HEKGYVHCDIKPSNMLIFPLEDGGNKVKIADFGLAKRIGEERALQLPQFSGTPAYMSPES  181

Query  685  VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
            V  GE  P  D+W+LG  V EM  G   W+     +LL  I  GE  PEIP  +S++GKD
Sbjct  182  VLYGEDEPPLDVWSLGITVVEMLTGKLVWRRLGKEDLLFSIVFGE--PEIPESVSEEGKD  239

Query  865  FLEKCFIKDPRKRWTAEMLLNHPFISGE  948
            FL  CF ++ ++RWTA MLLNHPF + E
Sbjct  240  FLRMCFRREAKERWTARMLLNHPFTTEE  267



>ref|XP_009403739.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 191/364 (52%), Gaps = 45/364 (12%)
 Frame = +1

Query  148   GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELR  327
             G   W RG  +GRG+   VSLA     G   A     VKS   S    L  E+ +L  L 
Sbjct  2     GISGWRRGRIIGRGTSATVSLATSVPSGEVFA-----VKSSELSRSWLLQREQRILSAL-  55

Query  328   GCQEVIRCFG-DGYSFENGEKL-YNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKAL  501
                 V+  FG D  +   G  L YN+ +E+A +G+L+D+I+K +  RL E+ IR Y+  +
Sbjct  56    DSPFVVSYFGFDVAAQTPGAGLCYNLFMEYAPRGSLSDEIRK-QGGRLDELAIRSYACDI  114

Query  502   LRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK--RNGGKNLGCELRGTPMYMS  675
             L GL Y+H  G VHCD+K QN+L+C  G  K+ADFG A+      ++    +RGTPM+M+
Sbjct  115   LGGLAYLHSNGVVHCDLKSQNVLICSGGRAKVADFGCARSAEEEDEDERGWMRGTPMFMA  174

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF-SEVAELLMRIGVGEEIPEIPGKLSD  852
             PE+  G EQ   ADIWALGC V EMA G P W   S+    L +I    ++PE P  +S+
Sbjct  175   PEVARGEEQSAPADIWALGCTVIEMATGRPPWPLVSDALSALHQIAFSTDVPEFPRWISE  234

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
             +G+DFL +C  +DP +RWTAE LL HPF+      A   + N                 P
Sbjct  235   EGRDFLSRCLRRDPLERWTAEQLLQHPFV------AASRVAN-----------------P  271

Query  1033  FDFPDWVSESDHL-QSSITSLPPP--------ESEYSPADRLQGIVSHQSPNWSQDSDEW  1185
                 DW+S    L Q+ + SL           ++E  P +R+Q ++   +PNW+ D + W
Sbjct  272   PSKSDWISPKSTLDQAFLQSLSDDDDDGQVLDQTEEDPFERMQSLIGDAAPNWTWD-ENW  330

Query  1186  VNVR  1197
             V VR
Sbjct  331   VTVR  334



>ref|XP_010090302.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB39272.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=330

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 169/297 (57%), Gaps = 16/297 (5%)
 Frame = +1

Query  115  LQNSTICSTRRGAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSL  294
              +  +C      + W R + +G G + KV LA+   H        + VK+    C  +L
Sbjct  2    FTDDVLCCPWSRRLTWHRVKILGHGCYAKVYLALYTDHD--EFYEEIAVKTAKLECAFTL  59

Query  295  LNEKAVLDELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEM  474
              E  +L++   C E++RC G   + E G + +N+LLE+A  G L D I++S +  L   
Sbjct  60   QKETRILEDFYNCPEIVRCLGHEVTVEGGVQFHNLLLEYAPLGTLFDLIQRSGDFILPR-  118

Query  475  EIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCENG----EVKIADFGLAKRN----GG  630
            +IR Y+  +L+GL  +H  GYVHCD+K +NIL+  +     ++KIADFGL+K        
Sbjct  119  DIRIYTWVILKGLCCMHAKGYVHCDLKPENILVFRSQDHGYQLKIADFGLSKEPRDTLSK  178

Query  631  KNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWK----FSEVAELL  798
            + L    RGTP+YMSPE V  GE  PA DIW+LGC V +M  G PAW+    +S   +++
Sbjct  179  RLLKYRFRGTPLYMSPESVALGEIKPALDIWSLGCVVLQMITGKPAWQYGAEYSNPKDIV  238

Query  799  MRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVS  969
              +   ++ P IP  L++ GKDFL KCF +D  KRW+A+MLL+HP++S E  G  V+
Sbjct  239  YLLAFTKKTPRIPDYLAEIGKDFLRKCFERDHHKRWSAQMLLDHPYVS-EASGLPVT  294



>ref|XP_007212556.1| hypothetical protein PRUPE_ppa015439mg, partial [Prunus persica]
 gb|EMJ13755.1| hypothetical protein PRUPE_ppa015439mg, partial [Prunus persica]
Length=339

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 157/264 (59%), Gaps = 10/264 (4%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            MDW RG T+G GS   VS+A  +SHG   +     VKS   S   SL  E+ +L  L   
Sbjct  1    MDWTRGPTIGHGSSATVSIA--KSHG---SGEVFAVKSAKLSQSHSLQMEQTILSTLSSA  55

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
            Q ++   G   S ENG   YN+ LE+A  G L+D I++ +   L+E  IR Y++ +L GL
Sbjct  56   Q-IVSYKGCNTSTENGTVFYNIFLEYAPGGTLSDAIRR-QGGCLNEAAIRSYTRQILLGL  113

Query  514  GYIHKVGYVHCDIKLQNILLCENG-EVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             ++H     HCDIK QN+L+  NG EVK+AD G AKR    + G  + GTP+YM+PE+  
Sbjct  114  HHLHSNQIAHCDIKGQNVLVTNNGAEVKLADLGCAKRVNFAH-GLPIGGTPVYMAPEVAR  172

Query  691  GGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
            G +QG AAD+WALGC V EMA G   W   S+    + RIG   E+PEIP  LS  G+DF
Sbjct  173  GEQQGLAADVWALGCTVIEMATGRAPWPCVSDPVSAMYRIGFSGEVPEIPSSLSKQGRDF  232

Query  868  LEKCFIKDPRKRWTAEMLLNHPFI  939
            + KC ++DP +RW+A  LL H F+
Sbjct  233  VTKCLMRDPMERWSAGELLKHEFL  256



>ref|XP_001760609.1| predicted protein [Physcomitrella patens]
 gb|EDQ74684.1| predicted protein [Physcomitrella patens]
Length=277

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 165/279 (59%), Gaps = 20/279 (7%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKS----CGASC-FDSLLNEKAVLDEL  324
            W+RG  +G G+FGKV+LAV R  G   A   + V+      GA     +L NE  +L  L
Sbjct  1    WIRGNLIGAGAFGKVNLAVNREDGEVFAVKSVRVEEGSGDAGAQVSLQALENEIEILQSL  60

Query  325  RGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKK---SENHRLSEMEIRRYSK  495
               + V+RC G  ++ E G+ + N  LE+  +G L D +++   + +  L E  IR Y++
Sbjct  61   E-SKFVVRCLGSDWTEEGGKLMRNAYLEYMPEGCLTDFVRQFAGAGSEPLDEHLIRTYTR  119

Query  496  ALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGC---------E  648
            +++ G+ Y+H+ G VHCDIK +NIL+  NG VK+ DFG AKR G +   C          
Sbjct  120  SIVEGVDYLHRQGIVHCDIKGKNILVG-NGSVKLTDFGSAKRVGAEGRVCGNGSGGSLGR  178

Query  649  LRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEI  825
            L GTP++M+PE+V   EQG A+DIW+LGC V EMA G   W   +     + +IG  +EI
Sbjct  179  LNGTPLWMAPEVVRQDEQGLASDIWSLGCTVLEMATGKAPWSHLANPFVAMFQIGYKDEI  238

Query  826  PEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS  942
            P +P  LS + KDFL +CF +DPRKRWT+  LL HPF++
Sbjct  239  PAVPASLSSEAKDFLRRCFERDPRKRWTSGELLEHPFLT  277



>dbj|BAD15943.1| protein kinase-like [Oryza sativa Japonica Group]
 dbj|BAD28858.1| protein kinase-like [Oryza sativa Japonica Group]
Length=453

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 188/355 (53%), Gaps = 32/355 (9%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W RG  +GRG+   VS+A  R  G   A   + V   GA     L  E+ +L  L    
Sbjct  6     EWRRGPVIGRGATATVSIATDRRTGGVFAVKSVDVARAGA-----LRREQGMLSAL-ASP  59

Query  337   EVIRCFGDGYSFE---NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              V+ C G G S     +G   Y++ LE+A  G+LAD+IK+    R  E  IR     +LR
Sbjct  60    FVVPCVGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRC-GGRCEEPLIRSRVGDVLR  118

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNL---GCELRGTPMYMSP  678
             GL Y+H  G  HCD+K +N+L+  +G   +ADFG A+    ++    G  +RGTPM+++P
Sbjct  119   GLAYVHAAGIAHCDVKGRNVLVGADGRAMLADFGCARWMAAEDCNAGGVTIRGTPMFLAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMA-GGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDD  855
             E   G  QG AADIWALGC V EMA GGAP  +F++    L  +    ++PE P   S +
Sbjct  179   EAARGEAQGTAADIWALGCTVIEMATGGAPWPRFADPVAALHHVAHSVDVPESPAWFSAE  238

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPF  1035
             GKDFL +C I+DP KRWTAE LL HPF++        S  +D+  +A       SP+   
Sbjct  239   GKDFLARCLIRDPAKRWTAEQLLEHPFVA--------SAASDSTSKAVQIEQRVSPKSIL  290

Query  1036  DFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQS--PNWSQDSDEWVNV  1194
             D   W S S    +++          +PADRL+ + +  S  P+W+   D+W+ V
Sbjct  291   DQCLWESTSTDSDATVA--------LAPADRLRALSAGASVAPDWTWSMDDWIAV  337



>ref|NP_001046691.2| Os02g0322400 [Oryza sativa Japonica Group]
 dbj|BAF08605.2| Os02g0322400 [Oryza sativa Japonica Group]
Length=425

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/355 (37%), Positives = 188/355 (53%), Gaps = 32/355 (9%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W RG  +GRG+   VS+A  R  G         VKS   +   +L  E+ +L  L    
Sbjct  6     EWRRGPVIGRGATATVSIATDRRTGGV-----FAVKSVDVARAGALRREQGMLSAL-ASP  59

Query  337   EVIRCFGDGYSFE---NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              V+ C G G S     +G   Y++ LE+A  G+LAD+IK+    R  E  IR     +LR
Sbjct  60    FVVPCVGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRC-GGRCEEPLIRSRVGDVLR  118

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNL---GCELRGTPMYMSP  678
             GL Y+H  G  HCD+K +N+L+  +G   +ADFG A+    ++    G  +RGTPM+++P
Sbjct  119   GLAYVHAAGIAHCDVKGRNVLVGADGRAMLADFGCARWMAAEDCNAGGVTIRGTPMFLAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMA-GGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDD  855
             E   G  QG AADIWALGC V EMA GGAP  +F++    L  +    ++PE P   S +
Sbjct  179   EAARGEAQGTAADIWALGCTVIEMATGGAPWPRFADPVAALHHVAHSVDVPESPAWFSAE  238

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPF  1035
             GKDFL +C I+DP KRWTAE LL HPF++        S  +D+  +A       SP+   
Sbjct  239   GKDFLARCLIRDPAKRWTAEQLLEHPFVA--------SAASDSTSKAVQIEQRVSPKSIL  290

Query  1036  DFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQS--PNWSQDSDEWVNV  1194
             D   W S S    +++          +PADRL+ + +  S  P+W+   D+W+ V
Sbjct  291   DQCLWESTSTDSDATVA--------LAPADRLRALSAGASVAPDWTWSMDDWIAV  337



>emb|CDY36728.1| BnaA03g11580D [Brassica napus]
Length=458

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 136/358 (38%), Positives = 190/358 (53%), Gaps = 34/358 (9%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W+RG  +GRGS   VSLA+  S           VKS   S    L  E+ +L  L    
Sbjct  5     NWIRGPIIGRGSTATVSLAITNS------GEFFAVKSTELSSSAVLQREQTILSSLNSPY  58

Query  337   EVIRCFGDGYSFENG-------EKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSK  495
              V+   G   + EN        E L N+L+E+   G++ D IK S   +L E EIR Y++
Sbjct  59    -VVNYIGSNTTTENNKLILSIIELLNNLLMEYVPGGSIHDLIKNS-GGKLPEPEIRFYTR  116

Query  496   ALLRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMS  675
              +L+GL Y+H  G VHCD+K  N+++ E    KIAD G AK  G  +L  E  GTP +MS
Sbjct  117   QILKGLMYLHGRGIVHCDLKSDNVMIGEET-AKIADLGCAKMAGNGSL--EFSGTPAFMS  173

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSD  852
             PE+  G EQG  AD+WALGC V EMA G+  W + ++V   + +IG   E PE+P  LS+
Sbjct  174   PEVARGEEQGFPADVWALGCVVIEMATGSSPWPELNDVVAAIYKIGFTGESPEVPEVLSE  233

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGAT---VSLRNDTHREasapapspsp  1023
              GKDFL KC ++DP++RWTAE LL HPF+  ED   T     L+N  +  ++        
Sbjct  234   KGKDFLRKCLVRDPKQRWTAEELLQHPFLEEEDQSQTQFGSCLKN--YSPSTVLDQGFWN  291

Query  1024  RCPFDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
              C        S S  +Q+  +SL     E S  DR++ +V  ++P  +   D W+ VR
Sbjct  292   SCE------TSRSRFIQADSSSL----WESSATDRIKKLVGDENPGETTAEDGWIEVR  339



>ref|XP_008224751.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Prunus mume]
Length=435

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 158/264 (60%), Gaps = 10/264 (4%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            MDW RG T+G GS   VS+A  +SHG   +     VKS   S   SL  E+ +L  L   
Sbjct  1    MDWTRGPTIGHGSSATVSIA--KSHG---SGEVFAVKSAKLSQSHSLQMEQTILSTLSSA  55

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
            Q ++   G   S ENG   YN+ LE+A  G L+D I+ S+  RL+E  IR Y++ +L GL
Sbjct  56   Q-IVSYKGCNTSTENGTVFYNLFLEYAPGGTLSDAIR-SQGGRLNEAAIRSYTRQILLGL  113

Query  514  GYIHKVGYVHCDIKLQNILLCENG-EVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVN  690
             ++H     HCDIK QN+L+  NG +VK+AD G AKR    + G  + GTP+YM+PE+  
Sbjct  114  HHLHSNQIAHCDIKGQNVLVTNNGADVKLADLGCAKRVNFDH-GLPIGGTPVYMAPEVAR  172

Query  691  GGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
            G +QG AAD+WALGC V EMA G   W   S+    + +IG   E+PEIP  LS  G+DF
Sbjct  173  GEQQGLAADVWALGCTVIEMATGRATWPCVSDPVSAMYKIGFSGEVPEIPSSLSKKGRDF  232

Query  868  LEKCFIKDPRKRWTAEMLLNHPFI  939
            + KC ++DP +RW+A  LL H F+
Sbjct  233  VTKCLMRDPMERWSAGELLKHGFL  256



>ref|XP_010451165.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Camelina sativa]
Length=447

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/266 (43%), Positives = 158/266 (59%), Gaps = 12/266 (5%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            M+W RG  +GRGS   VS+A+  S  I        VKS   S    L  E+++L  L   
Sbjct  3    MNWTRGPIIGRGSTATVSIAISNSGEI------FAVKSSELSSSTFLQKEQSILSTLSS-  55

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              +++  G G + E    +YN+L+E+ S G+L D IK S   +L E  IR Y++ +L GL
Sbjct  56   PHIVKYIGSGLTREKDGLVYNILMEYVSGGSLHDLIKNS-GGKLPEPAIRSYTRQILNGL  114

Query  514  GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             Y+H+ G VHCD+K QN+L+ ENG +KIAD G AK  GG++   E  GTP +M+PE+  G
Sbjct  115  MYLHERGIVHCDLKSQNVLVEENGVLKIADMGCAKTVGGES---EFSGTPAFMAPEVARG  171

Query  694  GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
             EQ   AD+W LGC V EM  G+  W + ++V   + +IG   E PEIP  +S+  KDFL
Sbjct  172  EEQRFPADVWGLGCTVMEMMTGSSPWPELNDVVAAMYKIGFSGESPEIPVCVSEKAKDFL  231

Query  871  EKCFIKDPRKRWTAEMLLNHPFISGE  948
              CF KDP++RWT + LL HPF+  E
Sbjct  232  VSCFEKDPKQRWTVQELLKHPFLDNE  257



>ref|XP_009629290.1| PREDICTED: serine/threonine-protein kinase 17A-like [Nicotiana 
tomentosiformis]
Length=321

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 163/275 (59%), Gaps = 17/275 (6%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRS---HGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDEL  324
            W RG+TVG+GSFG VSLA   +   H + G   P  + VKSC  S    L  E   L   
Sbjct  12   WKRGKTVGKGSFGIVSLASTSNLHDHLLNGVPLPFQIAVKSCKFSGSRYLRAESEFLRMF  71

Query  325  RGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHR--LSEMEIRRYSKA  498
            +    VIR FG   + ENG  LYN+LLE+AS G+LAD++    N R  L+E E+++++K 
Sbjct  72   QESPYVIRSFGVNVTQENGVILYNLLLEYASGGSLADRLDADMNSRKGLAEFEVQKHTKN  131

Query  499  LLRGLGYIHKVGYVHCDIKLQNILLCENGEV-KIADFGLAKR-NGGKNLGCELRGTPMYM  672
            +L GL ++H  G +HCDIK  NIL+     + KIADFGLA      + +   +RGT  YM
Sbjct  132  VLLGLSHVHSKGVIHCDIKPHNILVVGTDRIAKIADFGLAMTLEESRKIKHGIRGTYRYM  191

Query  673  SPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSE-----VAELLMRIGVGEEIPEIP  837
            +PE V   E G   DIWALGC V E+  G P W+ S       A++L +I    E P+  
Sbjct  192  APESVIYHEYGTEVDIWALGCTVYELLTGTPLWETSSDINDVNADVLYKIEF--EKPKFQ  249

Query  838  -GKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFI  939
              KLS + +DFL++C +K+PR RWTAEMLLNHPF+
Sbjct  250  NAKLSKEAQDFLKRCLVKNPRSRWTAEMLLNHPFL  284



>gb|EEC73042.1| hypothetical protein OsI_06987 [Oryza sativa Indica Group]
Length=448

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 131/355 (37%), Positives = 188/355 (53%), Gaps = 32/355 (9%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W RG  +GRG+   VS+A  R  G         VKS   +   +L  E+ +L  L    
Sbjct  6     EWRRGPVIGRGATATVSIATDRRTGGV-----FAVKSVDVARAGALRREQGMLSAL-ASP  59

Query  337   EVIRCFGDGYSFE---NGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
              V+ C G G S     +G   Y++ LE+A  G+LAD+IK+    R  E  IR     +LR
Sbjct  60    FVVPCVGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRC-GGRCEEPLIRSRVGDVLR  118

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNL---GCELRGTPMYMSP  678
             GL Y+H  G  HCD+K +N+L+  +G   +ADFG A+    ++    G  +RGTPM+++P
Sbjct  119   GLAYVHAAGIAHCDVKGRNVLVGADGRAMLADFGCARWMAAEDCNAGGVTIRGTPMFLAP  178

Query  679   EMVNGGEQGPAADIWALGCAVAEMA-GGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDD  855
             E   G  QG AADIWALGC V EMA GGAP  +F++    L  +    ++PE P   S +
Sbjct  179   EAARGEAQGTAADIWALGCTVIEMATGGAPWPRFADPVAALHHVAHSVDVPESPAWFSAE  238

Query  856   GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPF  1035
             GKDFL +C I+DP KRWTAE LL HPF++        S  +D+  +A       SP+   
Sbjct  239   GKDFLARCLIRDPAKRWTAEQLLEHPFVA--------SAASDSTSKAVQIEQRVSPKSIL  290

Query  1036  DFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQS--PNWSQDSDEWVNV  1194
             D   W S S    +++          +PADRL+ + +  S  P+W+   D+W+ V
Sbjct  291   DQCLWESTSTDSDATVA--------LAPADRLRALSAGASVAPDWTWSMDDWIAV  337



>ref|XP_008238330.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Prunus mume]
Length=376

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 167/277 (60%), Gaps = 10/277 (4%)
 Frame = +1

Query  157  DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDELRG  330
            +WVRG  +G+G FG V LA  +   +     P  M VKS   +    L++E+++L E RG
Sbjct  29   EWVRGRILGQGGFGSVYLASVKKPKLGSEGFPAIMAVKSALMAKSFELVSERSLLGEFRG  88

Query  331  CQEVIRCFGDGYSFENGEKL-YNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
            C  VI C+G+ ++   G  L YNV LE+A  G + D IK+S    L E+++R+Y++++L+
Sbjct  89   CPFVIDCYGEDFTAGIGYNLVYNVFLEYADGGTIGDLIKQSGGSGLCELQVRKYTESILK  148

Query  508  GLGYIHKVGYVHCDIKLQNILLCENGE---VKIADFGLAKRNGGKNLGCELRGTPMYMSP  678
            G+ YIH  G+VHCD+K +NILL  +G     KI D GLAKR  G+      RGT MY+SP
Sbjct  149  GIQYIHGRGFVHCDLKPENILLVTSGSGFVPKIGDLGLAKRAAGER---SCRGTAMYLSP  205

Query  679  EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELL-MRIGVGEEIPEIPGKLSDD  855
            E V    Q   +DIWALGC V +M  G   W      +L  ++  +   +P++PG LS+D
Sbjct  206  ETVLDSIQEKPSDIWALGCVVLKMLTGRHPWDAKAGVKLHDLKPLIASGVPKVPGGLSED  265

Query  856  GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATV  966
             +DFL+ CF ++P +R TA  LL+HPF++  D+ A V
Sbjct  266  ARDFLKNCFARNPSQRLTAAKLLDHPFVTKVDEIAQV  302



>ref|XP_009403738.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Musa acuminata subsp. malaccensis]
Length=455

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 135/366 (37%), Positives = 191/366 (52%), Gaps = 47/366 (13%)
 Frame = +1

Query  148   GAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELR  327
             G   W RG  +GRG+   VSLA   S G   A     VKS   S    L  E+ +L  L 
Sbjct  2     GISGWRRGRIIGRGTSATVSLATSVSSGDVFA-----VKSSELSRSWLLQREQRILSAL-  55

Query  328   GCQEVIRCFG-DGYSFENGEKL-YNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKAL  501
                 V+  FG D  +   G  L YN+ +E+A++G+L+D+I+K +  RL E+ IR Y+  +
Sbjct  56    DSPFVVSYFGFDVAAQTPGAGLCYNLFMEYAARGSLSDEIRK-QGGRLDELAIRSYACDI  114

Query  502   LRGLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK--RNGGKNLGCELRGTPMYMS  675
             L GL Y+H  G  HCD+K QN+L+C  G  K+ADFG A+      ++    +RGTPM+M+
Sbjct  115   LGGLAYLHSNGVFHCDLKSQNVLICSGGRAKVADFGCARSAEEEDEDERGWMRGTPMFMA  174

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF-SEVAELLMRIGVGEEIPEIPGKLSD  852
             PE+  G EQ   ADIWALGC V EMA G P W   S+    L +I    ++PE P  +S+
Sbjct  175   PEVARGEEQSAPADIWALGCTVIEMATGRPPWPLVSDALSALHQIAFATDVPEFPRWISE  234

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
             +G+DFL +C  +DP +RWTAE LL HPF+      A   + N                 P
Sbjct  235   EGRDFLSRCLRRDPLERWTAEQLLQHPFV------AASRVAN-----------------P  271

Query  1033  FDFPDWVSESDHL-QSSITSLPPP----------ESEYSPADRLQGIVSHQSPNWSQDSD  1179
                 DW+S    L Q+ + SL             ++E  P +R+Q ++   +PNW+ D +
Sbjct  272   PSKSDWISPKSTLDQAFLQSLSDDDDDDDGQVLDQTEEDPFERMQSLIGDAAPNWTWD-E  330

Query  1180  EWVNVR  1197
              W  VR
Sbjct  331   TWATVR  336



>ref|XP_009404796.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=442

 Score =   209 bits (532),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 131/349 (38%), Positives = 184/349 (53%), Gaps = 24/349 (7%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSC-GASCFDSLLNEKAVLDELRGC  333
             +W RG  +GRG+   VSLA   + G   A     + S  G     S L+   V+  L   
Sbjct  5     EWRRGRIIGRGASATVSLATSMASGQVFAVKSSELCSLRGEQRLLSALDSPFVVSYL--G  62

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              +V      G  F      YN+ +E+A  G+L+D IK+ ++ RL E+ IR Y   +L GL
Sbjct  63    FDVTPPHAPGAGFH-----YNLFMEYAPGGSLSDAIKR-QSGRLDELAIRSYLHDILSGL  116

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H  G VHCD+K QN+L+C +G  KIADFG A++  G     + RGTPM+M+PE+  G
Sbjct  117   VYLHSNGLVHCDLKSQNVLICSDGRAKIADFGCARKVDGDEERHQPRGTPMFMAPEVARG  176

Query  694   GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQ   AD+WALGC   EMA G P W   S+    L RI    ++PE P  +S +GKDFL
Sbjct  177   EEQSAPADVWALGCTTIEMATGRPPWPNMSDPVSALHRIAFSADVPEFPSWISAEGKDFL  236

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
              +C  +DPR+RWTAE LL HPF++          R D+           SPR   D   W
Sbjct  237   SRCLRRDPRERWTAEQLLRHPFVA----ACFACPRPDS----GTNYDRVSPRSTLDQAFW  288

Query  1051  VSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
              S +D    ++      E    P++R+Q ++   +P+W+ + D WV VR
Sbjct  289   ESLADEGDEAVG-----EPSEDPSERMQCLIGGGAPSWTWN-DGWVTVR  331



>ref|XP_006582632.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=295

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 117/275 (43%), Positives = 161/275 (59%), Gaps = 22/275 (8%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLA---VPRSHGIAGAAPPMVVKSCGASCFD--SLLNEKAVLDEL  324
            W +   +G+GS+  V LA   +P+       A    VKS     F   S+  EK +LD  
Sbjct  4    WKKLAILGKGSYATVYLATVALPQECNEKVVA----VKSSSPFSFSIASMQKEKRILDSF  59

Query  325  RGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
             GC+E+++C+ D ++ E     YN+ +E A  G+L   + K     +S+ E+R Y++ LL
Sbjct  60   LGCKEILQCYFDQFTVERNYVTYNLFMECAPYGSLLGLVNK--KGPISDSEVRVYTRMLL  117

Query  505  RGLGYIHKVGYVHCDIKLQNILLCENG------EVKIADFGLAKRNGGKNL---GCELRG  657
            +GL  IH+ G VHCD+K  NILL  +       ++KIADFGL+K     N      + RG
Sbjct  118  KGLSCIHRKGVVHCDLKPDNILLFPSSDDHARYQLKIADFGLSKTREDANAEYGKVKFRG  177

Query  658  TPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEI  834
            TP YMSPE V  G+  PA DIW+LGC V EM  G  AWK      E++ ++ V +E PEI
Sbjct  178  TPFYMSPESV-VGQIEPALDIWSLGCIVIEMITGFRAWKNLRTQKEIMFKLVVLQEAPEI  236

Query  835  PGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFI  939
            P +LS D K+FL KCF+KDPR+RWTA MLLNHPF+
Sbjct  237  PNELSWDCKNFLSKCFVKDPRQRWTATMLLNHPFL  271



>ref|XP_010916795.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Elaeis guineensis]
Length=508

 Score =   211 bits (536),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 157/265 (59%), Gaps = 10/265 (4%)
 Frame = +1

Query  157  DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
            +W RG T+GRGS   VSLA   + G   A     VKS   S    L  E+ +L  L    
Sbjct  5    EWYRGRTIGRGSSATVSLATTSASGEVFA-----VKSAELSRAGLLQREQRILANL-SSP  58

Query  337  EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
             V+   G   + E     YN+ +E+A++G+L+D+IKK E  RL E+ IR YS  +L GL 
Sbjct  59   HVVSYLGFDITSETNGVYYNLFMEYAARGSLSDEIKK-EGGRLDELAIRSYSCQILHGLA  117

Query  517  YIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK-RNGGKNLGC-ELRGTPMYMSPEMVN  690
            Y+H     HCD+K QN+L+  +G   IAD G A+      +  C +LRGTPMYM+PE   
Sbjct  118  YLHSNSIAHCDVKGQNVLIGSDGRAMIADLGCARWMADDHSRDCLQLRGTPMYMAPEAAR  177

Query  691  GGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
            G EQG  AD+WALGC V EMA G   W + S+    L RI    ++PE+P  +SD+GKDF
Sbjct  178  GEEQGTPADVWALGCTVVEMATGRAPWPEVSDPIAALHRIAFSTDVPELPSWISDEGKDF  237

Query  868  LEKCFIKDPRKRWTAEMLLNHPFIS  942
            L+KCF +DP +RW+AE LL HPF++
Sbjct  238  LDKCFRRDPDERWSAEQLLKHPFVA  262



>ref|XP_009394653.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=388

 Score =   207 bits (527),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 187/358 (52%), Gaps = 41/358 (11%)
 Frame = +1

Query  160   WVRGETVGRGSFGKVSLAV--PRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             W RG+T+GRGS   VSLA   P  H  A       VKS   S    L  E+A+L  L   
Sbjct  6     WRRGQTIGRGSTATVSLAAASPSGHLFA-------VKSAELSLSAHLQREQAILSSLHH-  57

Query  334   QEVIRCFGDGYSFEN--GEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
               ++ C G   + E       YN+ LE+A  G+L+D + K    RL E  IR Y+  +LR
Sbjct  58    PNIVSCLGFDVAAEAPCAPLSYNLFLEYAPLGSLSDCMMK-HGGRLEEAAIRSYTGGMLR  116

Query  508   GLGYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGK-NLGCELRGTPMYMSPEM  684
             GL Y+H   + HCD+K QN+L+  +G  KIAD G A+   G  + G  + GTPM+M+PE+
Sbjct  117   GLAYLHAKSFAHCDVKSQNVLIWPDGRAKIADLGCARSIAGDGDAGQPIAGTPMFMAPEV  176

Query  685   VNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGK  861
               G EQG  AD+WALGC V EMA G P W    +    L RIG   ++P+ P  LSD+ K
Sbjct  177   ARGEEQGAPADVWALGCTVIEMATGRPPWPDVVDPVAALHRIGFTCDVPKRPTWLSDEAK  236

Query  862   DFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDF  1041
             DFL+KC  +D R+RW AE LL HPF++     +T S  +++  +                
Sbjct  237   DFLDKCLRRDARERWPAEQLLEHPFVAKP---STTSCLSESALDQ---------------  278

Query  1042  PDWVSESDHLQS----SITSLPPPESEYSPADRLQGIVSHQSP--NWSQDSDEWVNVR  1197
              +W+S    L+     S+      + E    +R+Q + +   P  NW+QD D+W+ VR
Sbjct  279   -EWISPKSTLEQVLWDSVADEEEEDEEMEAEERIQQLATSGFPTANWAQD-DDWITVR  334



>ref|XP_007032910.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
 gb|EOY03836.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
Length=304

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/291 (36%), Positives = 167/291 (57%), Gaps = 15/291 (5%)
 Frame = +1

Query  136  STRRGAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVL  315
            +T   +M+W++ +T+G+GSF  V L  P +           +KSC      SL  E+ +L
Sbjct  10   ATNHLSMEWIKLKTLGKGSFAIVHLVKPTNS--VSDDQVFAMKSCLYQLSSSLQKEQKIL  67

Query  316  DELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSK  495
                 C+ +++C+GD  SFE G  +YN+ LE+A  G+L D I      ++ E + R Y++
Sbjct  68   KRFFPCRNIVQCYGDMLSFEQGAVVYNLFLEYAPGGSLLDLINNKYGGKVPECDARCYAR  127

Query  496  ALLRGLGYIHKVGYVHCDIKLQNILLCENGE------VKIADFGLAKRNGGK-------N  636
             L+ G+  IH+ GYVHCD+K  N+L+  + E      +KIADFGLA++ G +        
Sbjct  128  ILVEGVRDIHERGYVHCDLKPGNVLVYPSDEYGSVSSLKIADFGLAEQPGERVDEPGVDP  187

Query  637  LGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVG  816
               +  GT +YM PE +N  +   + DIW+LGC V +M  G   W++ ++ +L +++G  
Sbjct  188  WMLKFPGTAVYMPPEGINYKKISASMDIWSLGCIVLQMVTGKLPWEYEDLTDLAIQLGSR  247

Query  817  EEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVS  969
               P+IP  +S  G+DFL KCF++DP +RWTA+MLL+HPF+  +     +S
Sbjct  248  RYSPKIPENMSSTGQDFLSKCFVRDPSERWTADMLLSHPFVLPDRPSVAIS  298



>emb|CDY69540.1| BnaCnng64060D [Brassica napus]
Length=451

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/355 (38%), Positives = 189/355 (53%), Gaps = 35/355 (10%)
 Frame = +1

Query  157   DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQ  336
             +W+RG  +GRGS   VSLA+  S           VKS   S    L  E+ +L  L    
Sbjct  5     NWIRGPIIGRGSTATVSLAITNS------GEFFAVKSAELSSSAFLQREQTILSSLNSPY  58

Query  337   EVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGLG  516
              V++  G   + EN + +YN+L+E+   G++ D IK S   +L E EIR Y++ +L+GL 
Sbjct  59    -VVKYIGFNTTTENNKLMYNLLMEYIPGGSIHDLIKNS-GGKLPEPEIRFYTRQILKGLM  116

Query  517   YIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNGG  696
             Y+ + G VHCD+K  N+++ E    KIAD G AK  G  +L  E  GTP +MSPE+  G 
Sbjct  117   YLQEQGIVHCDLKSDNVMIGEET-AKIADLGCAKMAGNGSL--EFSGTPAFMSPEVARGE  173

Query  697   EQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLE  873
             EQ   AD+WALGC V EMA G+  W + ++V   + +IG   E PEIP  LS+ G+DFL 
Sbjct  174   EQSFQADVWALGCVVIEMATGSSPWPELNDVVAAIYKIGFTGESPEIPEVLSEKGRDFLR  233

Query  874   KCFIKDPRKRWTAEMLLNHPFISGEDDGAT---VSLRNDTHREasapapspspRCPFDFP  1044
             KC ++DP++RW  E LL HPF+  ED   T     L+N             SP    D  
Sbjct  234   KCMVRDPKQRWDVEELLQHPFLEEEDQSQTQFGCGLKN------------YSPSTVLDQG  281

Query  1045  DWVSESDHLQSSITSLPPPES----EYSPADRLQGIVSHQSPNWSQDSDEWVNVR  1197
              W    D  ++S T L   +S    E S  DR++ +V  ++P  +   D W+ VR
Sbjct  282   FW----DSCETSRTRLIQADSSSLWESSATDRIKKLVGDENPGETTAEDGWIEVR  332



>ref|XP_006389580.1| hypothetical protein POPTR_0021s00300g, partial [Populus trichocarpa]
 gb|ERP48494.1| hypothetical protein POPTR_0021s00300g, partial [Populus trichocarpa]
Length=364

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 138/376 (37%), Positives = 194/376 (52%), Gaps = 34/376 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW RG+T+G GS   VS+A     G   A     VKS      +SL  E+++L  L+ C
Sbjct  1     MDWTRGQTIGHGSSATVSMAKANRSGQVFA-----VKSAELLKSESLQREQSILSTLK-C  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              +++   G   + ENG+  YN+ LE+ S G L D I++     L E  IR Y++ +L GL
Sbjct  55    PQIVVYKGCDITNENGKLFYNLFLEYISGGTLIDAIREG-GGCLDEAMIRLYARTILLGL  113

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR----NGGKNLGCE--LRGTPMYMS  675
              Y+H  G VHCDIK  NIL+  +G  KIAD G AKR    +GG  L     + GTP+YM+
Sbjct  114   EYLHCNGIVHCDIKGHNILVTGDG-AKIADLGCAKRVDEVSGGTALKTTAPIAGTPLYMA  172

Query  676   PEMVNGGEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSD  852
             PE+  G  QG  ADIW++GC V EMA G   W   S+    L +IG    +PEIP  +S 
Sbjct  173   PEVARGEHQGFPADIWSVGCTVVEMATGQAPWVNVSDPVSALYQIGFSGNVPEIPSFMSK  232

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
               KDFL KC  +DP +RW+A  LL H FI+ E + A   + + T+ +           C 
Sbjct  233   QAKDFLSKCLKRDPGERWSASELLKHDFITEEPNSALKEIISSTNVDTPT--------CV  284

Query  1033  FDFPDWVSESDHLQSSITSLPPPESEYSPADRLQGIVS--HQSPNWSQDSDEWVNVR*CQ  1206
              D   W  +S     +   L       SP +R++ +     + PNWS D D W+ VR   
Sbjct  285   LDQVLW--DSIEELETTWDLSQESHSVSPVERIKQLTEGHGEVPNWSWD-DTWITVR---  338

Query  1207  MSTVNLQKLQSCNDFF  1254
                 N Q++  C++ +
Sbjct  339   ---SNEQEMVPCSEDY  351



>ref|XP_004242223.1| PREDICTED: serine/threonine-protein kinase ppk11-like [Solanum 
lycopersicum]
Length=357

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 161/275 (59%), Gaps = 8/275 (3%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVV--KSCGASCFDSLLNEKAVLDELRGC  333
            W RG T+G+G FG VSLA   +    G   P ++  KSC  +   SL  E  +L   +  
Sbjct  6    WKRGTTLGQGGFGVVSLASTSNALFRGVTLPSLIALKSCNYTASQSLKQEVEILRMFKHS  65

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              ++ CFG   SFE+   LYN+LLE+AS G+LAD+++   +  LSE E+++++K +L GL
Sbjct  66   PYIVHCFGANVSFEDNVNLYNLLLEYASGGSLADRLQNCNS--LSEFEVKKHTKNVLIGL  123

Query  514  GYIHKVGYVHCDIKLQNILLC-ENGEVKIADFGLA--KRNGGKNLGCELRGTPMYMSPEM  684
              IH  G +HCDIK  NILL   +   KIADFGL+     G       +RGT  YM+PE 
Sbjct  124  SCIHNKGIIHCDIKPGNILLVGADKTAKIADFGLSITLEQGMNQKQGIIRGTERYMAPES  183

Query  685  VNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKD  864
            V   E  P  DIWALGC V E+  G P W+ ++  ++L +I   E   + P KLS++ ++
Sbjct  184  VINTEYTPKVDIWALGCTVYELITGTPLWEDADGDDVLDKIEFEEPKLQNP-KLSNEARN  242

Query  865  FLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVS  969
            FLEKC +K+P  RWTA+MLLNH F+      A ++
Sbjct  243  FLEKCLVKNPSTRWTADMLLNHTFLQNLSKVANIA  277



>gb|KFK43030.1| hypothetical protein AALP_AA1G069700 [Arabis alpina]
Length=388

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/262 (39%), Positives = 157/262 (60%), Gaps = 8/262 (3%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
            WVRG  +GRGSFG V+ A+ +++G   A   + + +C  +  +SL NE +VL  L+    
Sbjct  5    WVRGTCIGRGSFGTVNTAINKTNGEVFAVKSVDLATCLPTQTESLENEISVLKSLKPHSY  64

Query  340  VIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLS-EMEIRRYSKALLRGLG  516
            ++   GD +S E      N+ LE+  +G +A       NH ++ E  +RRY+  L+  L 
Sbjct  65   IVTFLGDSFSKEETTTFRNLHLEYLQEGDVA------ANHVIADETLLRRYTACLVSALS  118

Query  517  YIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNGG  696
            ++H  GYVHCD+K +N+LL  +  +K+ADFG A R G        RG+P++M+PE++   
Sbjct  119  HVHSQGYVHCDVKARNVLLNRSSGIKLADFGSAIRTGNSPATVAPRGSPLWMAPEVIRRE  178

Query  697  EQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFLEK  876
             QGP +D+W++GC V EM  G PAW+   + + L RI   +E+P  P  LS++G DFL+K
Sbjct  179  YQGPESDVWSIGCTVIEMVTGKPAWEDKGI-DSLSRISFSDELPVFPVTLSENGCDFLDK  237

Query  877  CFIKDPRKRWTAEMLLNHPFIS  942
            C  +D  +RW+ + LL HPF+S
Sbjct  238  CLKRDRNQRWSCDQLLQHPFLS  259



>gb|KDP32595.1| hypothetical protein JCGZ_13145 [Jatropha curcas]
Length=305

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 158/277 (57%), Gaps = 12/277 (4%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDELR  327
            + WVR   +G+G FG V  A  +      +  P  M VKS       SL  EK V  +L 
Sbjct  29   VSWVRLFLLGKGGFGSVFYAERKEPLKQDSDLPFQMAVKSAKMDRSSSLQYEKQVFSDLG  88

Query  328  GCQEVIRCFGDGYS-FENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALL  504
                V+RC+GD  +   NGEK+YN+LLEF S  +L++ I+ S    L E+ ++ Y++ +L
Sbjct  89   TSPYVVRCYGDEVTEISNGEKIYNLLLEFCSGLSLSEHIRLSGG-GLPEIVVQNYTRDIL  147

Query  505  RGLGYIHKVGYVHCDIKLQNILLCE-------NGEVKIADFGLAKRNGGKNLGCE-LRGT  660
            RGL YIH  GYVHCDIK  NILL         N   KIADFGLA    GK   C  LRGT
Sbjct  148  RGLNYIHSHGYVHCDIKPGNILLVPGSGEMGGNYMAKIADFGLAMAVQGKETECSGLRGT  207

Query  661  PMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVGEEIPEIPG  840
             MYMSPE+V   +   +ADIWALGC V EM    P W +S+ A +L  IG  + +P IP 
Sbjct  208  SMYMSPELVKDRKLDYSADIWALGCVVLEMLTAKPVWDYSDTAHMLFVIGYTDRVPAIPD  267

Query  841  KLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGED  951
             +S++  DFL  CF +   +R +A+ LL HPF+S +D
Sbjct  268  HVSEEATDFLSWCFDRRVGQRLSADRLLEHPFVSMDD  304



>ref|XP_011095801.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Sesamum 
indicum]
Length=441

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 162/264 (61%), Gaps = 12/264 (5%)
 Frame = +1

Query  154  MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
            M+W RG T+GRGS   VSLA       AG    +   S  +SC   L NE+ ++ +L   
Sbjct  1    MEWRRGPTIGRGSSAVVSLAT----TAAGCVFAVKSASFSSSCL--LQNEQCLMSQLSS-  53

Query  334  QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
              V++CFG   S+E+ +++YN+ LE+ + G L+D I+ S+   L E  IR Y+  +L+GL
Sbjct  54   PFVVKCFGSDVSWEDNKRVYNLFLEYVAGGTLSDLIR-SQGGCLDENVIRFYTHQMLQGL  112

Query  514  GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
             Y+H  G VHCD+K QN+L+ ++G +KIADFG AK +G         GTP YM+PE+  G
Sbjct  113  NYLHLKGVVHCDVKGQNVLIGDDG-LKIADFGCAKWSGSAVPA--FAGTPAYMAPEVARG  169

Query  694  GEQGPAADIWALGCAVAEMAGGAPAW-KFSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
             EQ  AAD+WA+GC V EMA G+  W +  + A  L R+    ++PE P   SD  KDFL
Sbjct  170  EEQSFAADVWAMGCTVIEMATGSNPWPEMKDPASALYRVAYSGDVPEFPIWFSDCAKDFL  229

Query  871  EKCFIKDPRKRWTAEMLLNHPFIS  942
             KC ++DP++RWTA  LL HPF++
Sbjct  230  SKCLMRDPKERWTAAELLQHPFLN  253



>gb|KDP41958.1| hypothetical protein JCGZ_26976 [Jatropha curcas]
Length=376

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/293 (40%), Positives = 169/293 (58%), Gaps = 13/293 (4%)
 Frame = +1

Query  115  LQNSTICSTRRGAMDWVRGETVGRGSFGKVSLA-VPRSHGIAGAAPP-MVVKSCGASCFD  288
            ++   +     G + W RG  +GRG FG V LA + +S       P  M VK    S  +
Sbjct  1    MKRKAVYDCEEGGVLWQRGPLLGRGGFGCVYLAELKKSKSRTSLYPQLMAVKCAEFSVSN  60

Query  289  SLLNEKAVLDELRGCQEVIRCFGD-GYSFENGEKLYNVLLEFASQGALADKIKKSENHRL  465
            SL  EK V D+L     V++C+G+   +  +GE +YN+LLE+AS G L+  IK S+  RL
Sbjct  61   SLQKEKQVFDDLCDSPYVLKCYGEETTTASSGEMIYNLLLEYASGGTLSSLIKGSDGGRL  120

Query  466  SEMEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCENGEV----KIADFGLAK---RN  624
            +E  ++RY+K +L+G+ YIH+  YVHCD+K  N+LL  +       KI DFGL++   RN
Sbjct  121  AEPIVKRYTKCILKGIDYIHRNSYVHCDLKPDNVLLVSSESSDFVPKIGDFGLSRKCQRN  180

Query  625  GGKNLGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFS---EVAEL  795
              +     + GT  YM+PE +    Q  ++DIWALGC V EM  G   W         E+
Sbjct  181  KRRKFDYGIGGTAPYMAPETLTDNIQEASSDIWALGCIVLEMFTGKKVWDSKGNMGTDEI  240

Query  796  LMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDD  954
            + +I    E+PEIP ++S  GKDFL+ C +K+P  R+TAEMLLNHPF+S  D+
Sbjct  241  IQKIADRYELPEIPNEISKAGKDFLKACLVKNPMFRFTAEMLLNHPFVSEFDE  293



>ref|XP_009418854.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=424

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 190/354 (54%), Gaps = 29/354 (8%)
 Frame = +1

Query  160   WVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGCQE  339
             W RG T+GRGS   V LA     G   A     VKS   S   SL  E+ +L  L     
Sbjct  6     WCRGRTIGRGSTATVFLATAFPSGYLFA-----VKSADLSLHASLQREQGILSSLHH-PN  59

Query  340   VIRCFGDGYSFEN--GEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
             ++ C G   + E+  G+  YN+ LE+A  G+L++ I K    RL E  IR Y+  +LRGL
Sbjct  60    IVSCLGFDVTAESSGGQLSYNLFLEYAPLGSLSECIVK-HGDRLEEGVIRSYTGDILRGL  118

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCE-LRGTPMYMSPEMVN  690
              Y+H     HCD+K +N+L+  +G  K+AD G A+   G +     + GTPM+M+PE+  
Sbjct  119   AYLHAKSIAHCDVKSRNVLIWPDGRAKVADLGCARPTTGDDGTVRPIAGTPMFMAPEVAR  178

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWKFSEV-AELLMRIGVGEEIPEIPGKLSDDGKDF  867
             G EQG  ADIWALGC V EMA G P W   +V A  L RIG   ++P+ PG LS++ KDF
Sbjct  179   GEEQGAPADIWALGCTVVEMASGLPPWPDVDVPAAALHRIGFTTDVPKCPGWLSEEAKDF  238

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHR--EasapapspspRCPFDF  1041
             L+KC  +D R+RWTA+ LL HPF++          R+  +R  E+ +     SPR   + 
Sbjct  239   LDKCLRRDARERWTADQLLQHPFLAK---------RSPPNRFTESDSSQVKVSPRSTLEQ  289

Query  1042  PDWVSESDHLQSSITSLPPPESEYSPADRLQGIVSHQSP--NWSQDSDEWVNVR  1197
               W S +D  +     +       SP +R++ ++S   P  NW+ D D W+ VR
Sbjct  290   SLWDSVADEEE----EVEMDRQFDSPEERIRQLISGGFPAANWTCD-DNWITVR  338



>ref|XP_009796297.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Nicotiana sylvestris]
Length=412

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 138/358 (39%), Positives = 195/358 (54%), Gaps = 32/358 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW RG  +G GS   VS+A  R      ++    VKS   S    L  E+ VL  L   
Sbjct  1     MDWTRGHIIGHGSSAAVSVAKSR-----WSSEIFAVKSVELSQSQFLQKEQKVLSAL-SS  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               ++   G   + EN   ++N+++E+ S+G +AD+I+K+   R++E  I  Y+K +L GL
Sbjct  55    PYIVSYKGYDVTKENNTVMFNLMMEYMSEGTIADEIRKN-GGRINEPVIGYYTKQILLGL  113

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAK------RNGGKNLGCELRGTPMYMS  675
              Y+H  G VHCDIK QNILL + G  KIADFG A+      R+GG +    + GTPMYM+
Sbjct  114   EYLHSRGVVHCDIKGQNILLGKTG-AKIADFGCARWVDTAERDGGAS-AQPIGGTPMYMA  171

Query  676   PEMVNGGEQGPAADIWALGCAVAEMA-GGAPAWKFSEVAELLMRIGVGEEIPEIPGKLSD  852
             PE+  G EQG AADIW LGC + EMA GG+P    +  A LL +I    + PEIP  LS 
Sbjct  172   PEVARGEEQGFAADIWGLGCTIIEMATGGSPWTNVTNSASLLYKIAFSGQSPEIPKFLSL  231

Query  853   DGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCP  1032
               KDFL KCF +D ++RWTA+ LL HPF           L   ++ +    + + SP   
Sbjct  232   QAKDFLSKCFRRDQKERWTAKQLLKHPF-----------LEEISNFKEIQDSITSSPTSI  280

Query  1033  FDFPDW--VSESDHLQSSITSLPPPESEYSPADRLQGI-VSHQSPNWSQDSDEWVNVR  1197
              D   W  V E++ + S  T++    S  SP  R++ + ++ + PNW  D + W  VR
Sbjct  281   LDQDIWNSVEETETMDS--TTIQLETSIDSPLQRVRKLGLNSRKPNWRWDDEIWTTVR  336



>ref|XP_010244478.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nelumbo nucifera]
Length=439

 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/370 (37%), Positives = 188/370 (51%), Gaps = 42/370 (11%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW RG T+GRGS   VSLA       +G      VKS   S  + L  E+ +L  +R C
Sbjct  1     MDWTRGRTLGRGSSATVSLATAVR---SGETEIFAVKSVELSRSEFLQREQRILSSIR-C  56

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               ++   G   + ENG+ LYN+ +E+   G+L D I+K +  RL E  IR + + +L G+
Sbjct  57    SRIVGYRGCDITSENGQLLYNLFMEYVPGGSLTDAIQK-QGGRLDESAIRLHLRQILGGI  115

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKRNGGKNLGCELRGTPMYMSPEMVNG  693
              Y+H  G VHCDIK +N+L+ ++G  KIAD G A+     +    + GTP++M+PE+  G
Sbjct  116   HYLHTSGLVHCDIKGRNVLIGKDG-AKIADLGCARWVDQVSESMSIAGTPVFMAPEVARG  174

Query  694   GEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDFL  870
              EQG  AD+WA+GC V EMA G   W   S+    L RI   E+ PE+P  LS+  KDFL
Sbjct  175   DEQGFPADVWAIGCTVIEMATGRLPWSDASDPVSALYRIAFTEDTPELPNCLSEQAKDFL  234

Query  871   EKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPDW  1050
              KC  +DP+ RWT   LL HPF+     G                    + + P    D 
Sbjct  235   SKCLRRDPKDRWTISQLLKHPFVDEPSSGLN-------------QIQDSASKSPTSILD-  280

Query  1051  VSESDHLQSSITSLPPPE------SEYSPADRLQ---GIVSHQS----PNWSQDSDEWVN  1191
                    Q+   SL  PE      S  SPA+R+Q   G +S  S    P+WS D + W+ 
Sbjct  281   -------QAFWDSLEEPETPRSLRSLNSPAERIQQLCGNISSSSSPRLPDWSWD-NSWIT  332

Query  1192  VR*CQMSTVN  1221
             VR    +T N
Sbjct  333   VRSNSTTTTN  342



>ref|XP_007210946.1| hypothetical protein PRUPE_ppa024142mg [Prunus persica]
 gb|EMJ12145.1| hypothetical protein PRUPE_ppa024142mg [Prunus persica]
Length=376

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 166/277 (60%), Gaps = 10/277 (4%)
 Frame = +1

Query  157  DWVRGETVGRGSFGKVSLAVPRSHGIAGAAPP--MVVKSCGASCFDSLLNEKAVLDELRG  330
            +WVRG  +G+G FG V LA  +   +     P  M VKS   +    L++E+++L E RG
Sbjct  29   EWVRGRILGQGGFGSVYLASVKKPKLGREGFPAIMAVKSALMAKSFELVSERSLLGEFRG  88

Query  331  CQEVIRCFGDGYSFENGEKL-YNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLR  507
            C  VI C+G+ ++   G  L YNV LE+A  G + D IK+S    L E+++R+Y++++L+
Sbjct  89   CPFVIDCYGEDFTAGIGYNLVYNVFLEYADGGTIGDLIKQSGGSGLCELQVRKYTESILK  148

Query  508  GLGYIHKVGYVHCDIKLQNILLCENGE---VKIADFGLAKRNGGKNLGCELRGTPMYMSP  678
            G+ YIH+ G+VHCD+K +NILL  +G     KI D GLAKR  G+      RGT MY+SP
Sbjct  149  GIQYIHERGFVHCDLKPENILLVTSGSGFVPKIGDLGLAKRAAGER---SCRGTAMYLSP  205

Query  679  EMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELL-MRIGVGEEIPEIPGKLSDD  855
            E V    Q   +DIWALGC V +M  G   W      +L  ++  +   +P++PG LS D
Sbjct  206  ETVLDSIQEKPSDIWALGCVVLKMLTGRHPWDAKAGLKLHDLKPLIASGVPKVPGGLSKD  265

Query  856  GKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDDGATV  966
             +DFL+ CF ++P +R TA  LL HPF++  D+ A V
Sbjct  266  ARDFLKNCFARNPSQRLTAAKLLEHPFVTKVDEIAQV  302



>ref|XP_002267449.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Vitis vinifera]
Length=383

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 161/296 (54%), Gaps = 36/296 (12%)
 Frame = +1

Query  160  WVRGETVGRGSFGKVSLAVPRSHGIA---------------GAAPPMVVKSCGASCFDSL  294
            W R   +G+GSFG VS A  R+  I                       VKS   S   SL
Sbjct  82   WTRKHNLGKGSFGFVSFATSRAPIIVCHDDDDGGGGGGGSDSVLTNFAVKSAEVSMSSSL  141

Query  295  LNEKAVLDELRGCQEVIRCFGDGYS---FENGEKLYNVLLEFASQGALADKIKKSENHRL  465
              E  +L +L+    V++  GD  +   F+N    YN+L+EF   G+LA  IKK  N  L
Sbjct  142  RRETKILWDLKLSPHVVQSHGDEMTQSRFDN-RTYYNILMEFCEGGSLAKWIKKLGNPGL  200

Query  466  SEMEIRRYSKALLRGLGYIHKVGYVHCDIKLQNILLCENGE---VKIADFGLAKRNGGKN  636
            SE  +R +++ ++ GL ++H  GYVHCDIK  NILL  +G+    KIADFGLAKR     
Sbjct  201  SEYHVRLFARDMVLGLVHVHSRGYVHCDIKPSNILLARDGDGYTAKIADFGLAKRVAAHP  260

Query  637  LGCE-------LRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKF------  777
             G E       +RGT  YM+PE V+   Q   ADIWALGC V EM  G P W        
Sbjct  261  NGEEDDDELGAVRGTYRYMAPETVSHRVQDQYADIWALGCTVLEMMTGKPLWDSQADLSH  320

Query  778  -SEVAELLMRIGVGEEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFIS  942
             S++ ++L RIG   E PE+P  +S DGKDFLE+C ++  R RW+AEML++HPF+S
Sbjct  321  DSQIKDILQRIGNSPEWPELPSDISRDGKDFLERCLVRSLRSRWSAEMLIHHPFLS  376



>ref|XP_009790439.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Nicotiana sylvestris]
Length=385

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 135/355 (38%), Positives = 188/355 (53%), Gaps = 31/355 (9%)
 Frame = +1

Query  154   MDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMVVKSCGASCFDSLLNEKAVLDELRGC  333
             MDW+RG T+G GS   VS+AV R  G         VKS   S  + L  E+ +L  L   
Sbjct  1     MDWIRGATIGHGSSAAVSIAVSRCSG-----EIFAVKSVELSQSECLQKEQKILSTLSS-  54

Query  334   QEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHRLSEMEIRRYSKALLRGL  513
               ++   G   + EN E + N+++E+   G L  +I + +  RL+E  I  ++K +++GL
Sbjct  55    PYIVGYKGYDVTGENNEDMLNLMMEYMPGGTLTHEIGR-QGGRLNEQLIGYFTKQIIQGL  113

Query  514   GYIHKVGYVHCDIKLQNILLCENGEVKIADFGLAKR-NGGKNLGCELRGTPMYMSPEMVN  690
              Y+H  G VHCDIK +NILLCE G  KIADFG A+  +  K  G    GTPM+M+PE+  
Sbjct  114   DYLHSKGLVHCDIKGRNILLCETG-AKIADFGCARSVDQAKWNG----GTPMFMAPEVAR  168

Query  691   GGEQGPAADIWALGCAVAEMAGGAPAWK-FSEVAELLMRIGVGEEIPEIPGKLSDDGKDF  867
             G EQG AADIWALGC + EMA GA  W   S  A LL  I    + PEIP  LS   +DF
Sbjct  169   GEEQGFAADIWALGCTIIEMATGASPWTTVSNPASLLYHIAFSGQNPEIPEFLSSKTRDF  228

Query  868   LEKCFIKDPRKRWTAEMLLNHPFISGEDDGATVSLRNDTHREasapapspspRCPFDFPD  1047
             + KC  +DP++RW+A+ LL+HPF+   D  + V     T    S            D   
Sbjct  229   VSKCLTRDPKQRWSAKQLLSHPFLEESDSNSKVDEEFITSSPTSI----------LDQRI  278

Query  1048  WVS--ESDHLQSSITSLPPPESEYSPADRLQGIVSHQ-SPNWSQDSDEWVNVR*C  1203
             W S  ES+ + +S  ++   +   SP  R+  + +    P W  D + W+ VR C
Sbjct  279   WNSAEESETVNNSTQTISSMD---SPLQRVTKLCTQSGKPEWRWD-ESWITVRNC  329



>ref|XP_006367818.1| PREDICTED: mitogen-activated protein kinase kinase kinase 4-like 
[Solanum tuberosum]
Length=327

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 168/286 (59%), Gaps = 28/286 (10%)
 Frame = +1

Query  142  RRGAMDWVRGETVGRGSFGKVSLAVPRSHGIAGAAPPMV-----VKSCGASCFDSLLNEK  306
            ++    W RG T+G+GS+G VSLA            PM+     VKSC  +   SL NE+
Sbjct  4    KQAKFKWQRGRTLGKGSYGFVSLAS------IDTPSPMIPSLIAVKSCMLNRSQSLRNER  57

Query  307  AVLDELRGCQEVIRCFGDGYSFENGEKLYNVLLEFASQGALADKIKKSENHR-LSEMEIR  483
              L     C ++IRCFG   ++E+   LYN+LLEFAS G+LAD+I    N R L E +++
Sbjct  58   EFLRMFEDCPQIIRCFGFNVTYEDDLYLYNLLLEFASAGSLADRI----NERGLPEFQVQ  113

Query  484  RYSKALLRGLGYIHKVGYVHCDIKLQNILLCENGE------VKIADFGLA---KRNGGKN  636
            +++K +L GL  IHK G +HCDIK QNILL  +G        KIADFGL+   ++N  +N
Sbjct  114  KHTKNILLGLSLIHKKGIIHCDIKPQNILLTTDGADGMAEVAKIADFGLSITLEQNRKEN  173

Query  637  LGCELRGTPMYMSPEMVNGGEQGPAADIWALGCAVAEMAGGAPAWKFSEVAELLMRIGVG  816
            +G   RGT  YM+PE +   +  P  DIW+LGC V EM  G P W+ S   ++L RI   
Sbjct  174  MGH--RGTKRYMAPEALIKEKYYPGVDIWSLGCTVYEMITGKPLWESSNSDQMLDRIKYK  231

Query  817  EEIPEIPGKLSDDGKDFLEKCFIKDPRKRWTAEMLLNHPFISGEDD  954
            E   E P KLS + KDFL  C +++P  RW+A+MLLNH F+   DD
Sbjct  232  EPNIENP-KLSTEAKDFLNNCLVRNPSARWSADMLLNHSFLKSVDD  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3994635736224