BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16032_g2_i1 len=614 path=[1829:0-613]

Length=614
                                                                      Score     E

emb|CAC24711.1|  cytochrome P450                                        238   8e-72   Solanum tuberosum [potatoes]
ref|XP_004237369.1|  PREDICTED: premnaspirodiene oxygenase              237   1e-71   
ref|XP_009609720.1|  PREDICTED: premnaspirodiene oxygenase              233   2e-71   
sp|A6YIH8.1|C7D55_HYOMU  RecName: Full=Premnaspirodiene oxygenase...    236   3e-71   Hyoscyamus muticus
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like         234   1e-70   
dbj|BAN58140.1|  putative premaspirodiene oxygenase                     233   7e-70   
ref|XP_009758268.1|  PREDICTED: premnaspirodiene oxygenase              230   9e-69   
gb|ABC69405.1|  CYP71D51v3                                              230   9e-69   Nicotiana tabacum [American tobacco]
ref|XP_006350395.1|  PREDICTED: premnaspirodiene oxygenase-like         228   4e-68   
gb|ABC69403.1|  CYP71D51v1                                              227   8e-68   Nicotiana tabacum [American tobacco]
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...    225   2e-67   
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...    224   7e-67   
ref|XP_009776870.1|  PREDICTED: premnaspirodiene oxygenase-like         220   1e-66   
gb|AHH25653.1|  cytochrome P450 CYP71D                                  224   1e-66   
ref|XP_009612417.1|  PREDICTED: premnaspirodiene oxygenase-like         224   1e-66   
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like         223   3e-66   
ref|XP_009772400.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    215   6e-66   
ref|XP_004228510.1|  PREDICTED: premnaspirodiene oxygenase-like         222   6e-66   
ref|XP_006350417.1|  PREDICTED: cytochrome P450 71D7-like               221   1e-65   
ref|XP_009794007.1|  PREDICTED: premnaspirodiene oxygenase-like         220   2e-65   
ref|XP_004245943.1|  PREDICTED: premnaspirodiene oxygenase-like         219   5e-65   
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like         219   1e-64   
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like         218   1e-64   
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like         218   2e-64   
ref|XP_006350393.1|  PREDICTED: cytochrome P450 71D7-like               218   3e-64   
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7             218   3e-64   Solanum chacoense
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like         217   5e-64   
ref|XP_009625417.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxylase    216   1e-63   
ref|XP_009794009.1|  PREDICTED: premnaspirodiene oxygenase-like         215   2e-63   
ref|XP_006339043.1|  PREDICTED: premnaspirodiene oxygenase-like         216   2e-63   
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like         215   3e-63   
sp|Q94FM7.2|C71DK_TOBAC  RecName: Full=5-epiaristolochene 1,3-dih...    213   2e-62   Nicotiana tabacum [American tobacco]
ref|XP_009771988.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    213   2e-62   
ref|XP_009801864.1|  PREDICTED: LOW QUALITY PROTEIN: 5-epiaristol...    213   2e-62   
gb|ABC69421.1|  CYP71D20v2                                              213   2e-62   Nicotiana tabacum [American tobacco]
gb|AIZ01224.1|  epi-aristolochene dihydroxylase                         211   3e-62   
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like         212   6e-62   
ref|XP_006349766.1|  PREDICTED: premnaspirodiene oxygenase-like         207   1e-61   
ref|XP_004228511.1|  PREDICTED: premnaspirodiene oxygenase-like         209   5e-61   
ref|XP_004249520.2|  PREDICTED: premnaspirodiene oxygenase-like         209   1e-60   
emb|CDP07887.1|  unnamed protein product                                207   2e-60   
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like         207   3e-60   
ref|XP_004249519.1|  PREDICTED: premnaspirodiene oxygenase-like         207   4e-60   
ref|XP_009612725.1|  PREDICTED: premnaspirodiene oxygenase-like         206   5e-60   
ref|XP_006365912.1|  PREDICTED: premnaspirodiene oxygenase-like         206   7e-60   
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like         206   1e-59   
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like         205   2e-59   
ref|XP_004228509.1|  PREDICTED: premnaspirodiene oxygenase-like         204   3e-59   
ref|XP_009623937.1|  PREDICTED: premnaspirodiene oxygenase-like i...    199   4e-59   
ref|XP_006367730.1|  PREDICTED: premnaspirodiene oxygenase-like         199   6e-59   
ref|XP_004233564.1|  PREDICTED: premnaspirodiene oxygenase-like         204   7e-59   
ref|XP_006361940.1|  PREDICTED: premnaspirodiene oxygenase-like         203   8e-59   
ref|XP_006352953.1|  PREDICTED: premnaspirodiene oxygenase-like         203   9e-59   
ref|XP_009765480.1|  PREDICTED: premnaspirodiene oxygenase-like         203   1e-58   
gb|ABC69397.1|  CYP71D48v1                                              203   1e-58   Nicotiana tabacum [American tobacco]
ref|XP_006365979.1|  PREDICTED: premnaspirodiene oxygenase-like         203   1e-58   
ref|XP_004249812.1|  PREDICTED: premnaspirodiene oxygenase-like         203   2e-58   
ref|XP_006355983.1|  PREDICTED: premnaspirodiene oxygenase-like         202   2e-58   
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like         202   2e-58   
ref|XP_009770332.1|  PREDICTED: premnaspirodiene oxygenase-like         202   2e-58   
ref|XP_004250027.1|  PREDICTED: cytochrome P450 71D7                    202   3e-58   
ref|XP_009623936.1|  PREDICTED: premnaspirodiene oxygenase-like i...    202   3e-58   
ref|XP_006350394.1|  PREDICTED: cytochrome P450 71D6-like               201   5e-58   
gb|AAD47832.1|  cytochrome P450                                         201   5e-58   Nicotiana tabacum [American tobacco]
ref|XP_006339045.1|  PREDICTED: premnaspirodiene oxygenase-like         201   7e-58   
gb|ABC69396.1|  CYP71D48v2                                              201   8e-58   Nicotiana tabacum [American tobacco]
ref|XP_006339044.1|  PREDICTED: premnaspirodiene oxygenase-like         201   1e-57   
ref|XP_006341699.1|  PREDICTED: premnaspirodiene oxygenase-like         200   2e-57   
ref|XP_006365938.1|  PREDICTED: premnaspirodiene oxygenase-like         200   2e-57   
ref|XP_009611155.1|  PREDICTED: premnaspirodiene oxygenase-like         199   2e-57   
gb|ABC69395.1|  CYP71D47v2                                              200   2e-57   Nicotiana tabacum [American tobacco]
gb|ABC69394.1|  CYP71D47v1                                              200   2e-57   Nicotiana tabacum [American tobacco]
ref|XP_009623934.1|  PREDICTED: premnaspirodiene oxygenase-like         200   2e-57   
emb|CDP08465.1|  unnamed protein product                                199   3e-57   
ref|XP_006341698.1|  PREDICTED: premnaspirodiene oxygenase-like         199   4e-57   
sp|P93530.1|C71D6_SOLCH  RecName: Full=Cytochrome P450 71D6             199   4e-57   Solanum chacoense
ref|XP_004242036.1|  PREDICTED: premnaspirodiene oxygenase-like         198   6e-57   
ref|XP_009608635.1|  PREDICTED: premnaspirodiene oxygenase-like         198   8e-57   
ref|XP_009766832.1|  PREDICTED: premnaspirodiene oxygenase-like         198   1e-56   
ref|XP_006339046.1|  PREDICTED: premnaspirodiene oxygenase-like         198   1e-56   
gb|AAF27282.1|AF122821_1  cytochrome P450                               197   2e-56   Capsicum annuum
ref|XP_004241764.1|  PREDICTED: premnaspirodiene oxygenase-like         197   2e-56   
ref|XP_004243471.1|  PREDICTED: premnaspirodiene oxygenase-like         197   3e-56   
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like         194   2e-55   
ref|XP_004242298.1|  PREDICTED: premnaspirodiene oxygenase-like         190   3e-55   
emb|CDP20259.1|  unnamed protein product                                194   4e-55   
ref|XP_009606841.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    191   4e-55   
ref|XP_009609826.1|  PREDICTED: premnaspirodiene oxygenase-like         188   5e-55   
dbj|BAC53923.1|  cytochrome P450                                        192   9e-55   Petunia x hybrida [garden petunia]
ref|XP_009617877.1|  PREDICTED: premnaspirodiene oxygenase-like         191   3e-54   
ref|XP_009788504.1|  PREDICTED: premnaspirodiene oxygenase-like         186   6e-54   
gb|AAK62343.2|  elicitor-inducible cytochrome P450                      189   1e-53   Nicotiana tabacum [American tobacco]
ref|XP_011081935.1|  PREDICTED: cytochrome P450 71D95-like              189   2e-53   
ref|XP_011081934.1|  PREDICTED: cytochrome P450 71D95-like              189   2e-53   
ref|XP_009803661.1|  PREDICTED: premnaspirodiene oxygenase-like         182   3e-53   
ref|XP_006355212.1|  PREDICTED: premnaspirodiene oxygenase-like         185   8e-52   
ref|XP_004246079.1|  PREDICTED: cytochrome P450 71D7-like               184   1e-51   
ref|XP_011082249.1|  PREDICTED: premnaspirodiene oxygenase-like         185   1e-51   
gb|KDP39257.1|  hypothetical protein JCGZ_01014                         183   2e-51   
ref|XP_004242219.2|  PREDICTED: cytochrome P450 71D7-like               184   2e-51   
dbj|BAM68819.1|  putative cytochrome P450 monooxygenase CYP71AV1        183   3e-51   
emb|CDP07882.1|  unnamed protein product                                184   3e-51   
ref|XP_009622900.1|  PREDICTED: cytochrome P450 71D7-like               183   3e-51   
gb|ABC69399.1|  CYP71D49v1                                              183   3e-51   Nicotiana tabacum [American tobacco]
dbj|BAM68816.1|  putative cytochrome P450 monooxygenase CYP71AV1        183   4e-51   
sp|D5JBX1.1|GAO_BARSP  RecName: Full=Germacrene A oxidase; Short=...    182   5e-51   
ref|XP_006359503.1|  PREDICTED: premnaspirodiene oxygenase-like         183   5e-51   
gb|ABC69398.1|  CYP71D5v3                                               182   7e-51   Nicotiana tabacum [American tobacco]
ref|XP_009764618.1|  PREDICTED: cytochrome P450 71D7-like isoform X1    182   7e-51   
gb|ABC69402.1|  CYP71D5v2                                               182   8e-51   Nicotiana tabacum [American tobacco]
emb|CDP07881.1|  unnamed protein product                                185   1e-50   
ref|XP_009794456.1|  PREDICTED: premnaspirodiene oxygenase-like         182   1e-50   
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like         182   1e-50   
emb|CDP18841.1|  unnamed protein product                                182   1e-50   
gb|AJD25162.1|  cytochrome P450 CYP71D374                               181   3e-50   
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         181   4e-50   
ref|XP_009765945.1|  PREDICTED: premnaspirodiene oxygenase-like         177   4e-50   
gb|ABC69400.1|  CYP71D49v3                                              180   4e-50   Nicotiana tabacum [American tobacco]
gb|AGN04217.1|  cytochrome P450                                         180   5e-50   
ref|XP_009619325.1|  PREDICTED: premnaspirodiene oxygenase-like         180   8e-50   
emb|CDP07879.1|  unnamed protein product                                179   1e-49   
ref|XP_006367128.1|  PREDICTED: premnaspirodiene oxygenase-like i...    177   1e-49   
ref|XP_003611883.1|  Cytochrome P450                                    179   2e-49   
ref|XP_011073878.1|  PREDICTED: premnaspirodiene oxygenase-like         179   2e-49   
emb|CDP07872.1|  unnamed protein product                                178   3e-49   
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    178   3e-49   
ref|XP_006365962.1|  PREDICTED: cytochrome P450 71D7-like               178   3e-49   
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg                177   1e-48   
sp|D5JBW9.1|GAO_SAUCO  RecName: Full=Germacrene A oxidase; Short=...    176   1e-48   
gb|EYU31465.1|  hypothetical protein MIMGU_mgv1a004885mg                176   1e-48   
emb|CDP10756.1|  unnamed protein product                                176   2e-48   
ref|XP_009587552.1|  PREDICTED: premnaspirodiene oxygenase-like         176   2e-48   
ref|XP_011082254.1|  PREDICTED: premnaspirodiene oxygenase              176   2e-48   
emb|CDP10758.1|  unnamed protein product                                176   2e-48   
ref|XP_003611886.1|  Cytochrome P450                                    176   3e-48   
gb|AHN62855.1|  germacrene A oxidase                                    175   3e-48   
dbj|BAM68812.1|  cytochrome P450 monooxygenase CYP71AV10                175   3e-48   
sp|D5JBW8.1|GAO_CICIN  RecName: Full=Germacrene A oxidase; Short=...    175   3e-48   
sp|D5J9U8.1|GAO_LACSA  RecName: Full=Germacrene A oxidase; Short=...    175   3e-48   
ref|XP_006357930.1|  PREDICTED: cytochrome P450 71D7-like               175   3e-48   
gb|AIS36971.1|  (-)-limonene 3-hydroxylase-like cytochrome p450-d...    175   3e-48   
ref|XP_006367966.1|  PREDICTED: premnaspirodiene oxygenase-like         175   4e-48   
gb|EYU21978.1|  hypothetical protein MIMGU_mgv1a004623mg                175   4e-48   
ref|XP_009803037.1|  PREDICTED: premnaspirodiene oxygenase-like         175   4e-48   
sp|Q9XHE7.1|C71DD_MENPI  RecName: Full=Cytochrome P450 71D13; Alt...    175   4e-48   Mentha x piperita
emb|CDP18847.1|  unnamed protein product                                175   5e-48   
ref|XP_006367127.1|  PREDICTED: premnaspirodiene oxygenase-like i...    174   6e-48   
gb|AGO03789.1|  germacrene A oxidase                                    174   6e-48   
emb|CDP10755.1|  unnamed protein product                                173   7e-48   
gb|KDP39283.1|  hypothetical protein JCGZ_01040                         171   8e-48   
sp|E1B2Z9.1|C7AV8_CICIN  RecName: Full=Cytochrome P450 71AV8; Alt...    174   8e-48   
ref|XP_003537455.1|  PREDICTED: cytochrome P450 71D8-like               174   1e-47   
ref|XP_002522721.1|  cytochrome P450, putative                          174   1e-47   Ricinus communis
gb|KHN03535.1|  Cytochrome P450 71D8                                    172   1e-47   
sp|O81974.1|C71D8_SOYBN  RecName: Full=Cytochrome P450 71D8; AltN...    174   1e-47   Glycine max [soybeans]
gb|ADD84654.1|  CYP71D175                                               174   1e-47   Scoparia dulcis [escobilla]
gb|AIA09035.1|  germacrene A oxidase                                    173   1e-47   
gb|KDP39016.1|  hypothetical protein JCGZ_00773                         173   1e-47   
dbj|BAM68817.1|  putative cytochrome P450 monooxygenase CYP71AV1        173   2e-47   
gb|AIA09036.1|  germacrene A oxidase                                    173   2e-47   
gb|ABG49365.1|  P450 monooxygenase                                      173   2e-47   Artemisia annua [sweet Annie]
ref|XP_007154033.1|  hypothetical protein PHAVU_003G085400g             173   2e-47   
dbj|BAM68808.1|  cytochrome P450 monooxygenase CYP71AV1                 173   2e-47   
gb|AFO64615.1|  cytochrome P450 mono-oxygenase                          172   2e-47   
gb|ABE57266.1|  amorpha-4,11-diene monooxygenase                        172   2e-47   Artemisia annua [sweet Annie]
gb|ABC41927.1|  amorpha-4,11-diene monooxygenase                        172   2e-47   Artemisia annua [sweet Annie]
dbj|BAM68810.1|  putative CYP71AV1 ortholog                             172   3e-47   
gb|AFP19100.1|  amorphadiene oxidase                                    172   3e-47   
gb|AFK45297.1|  unknown                                                 172   3e-47   
gb|ABG91755.1|  amorpha-4,11-diene C-12 oxidase                         172   3e-47   Artemisia annua [sweet Annie]
gb|EYU21953.1|  hypothetical protein MIMGU_mgv1a025918mg                172   3e-47   
gb|KHN36162.1|  Cytochrome P450 71D8                                    172   3e-47   
sp|Q1PS23.1|AMO_ARTAN  RecName: Full=Amorpha-4,11-diene 12-monoox...    172   3e-47   Artemisia annua [sweet Annie]
gb|ABI31728.1|  amorpha-4,11-diene C-12 oxidase                         172   3e-47   Artemisia annua [sweet Annie]
ref|XP_004512033.1|  PREDICTED: cytochrome P450 71D8-like               172   4e-47   
ref|XP_004511998.1|  PREDICTED: cytochrome P450 71D8-like               172   5e-47   
ref|XP_010655881.1|  PREDICTED: cytochrome P450 71D10-like              172   6e-47   
gb|ABG49366.1|  P450 monooxygenase                                      171   7e-47   Artemisia annua [sweet Annie]
ref|XP_011081964.1|  PREDICTED: premnaspirodiene oxygenase-like         172   7e-47   
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like               172   7e-47   
dbj|BAM68815.1|  cytochrome P450 monooxygenase CYP71AV2                 171   9e-47   
emb|CDP17903.1|  unnamed protein product                                171   1e-46   
dbj|BAM68821.1|  putative cytochrome P450 monooxygenase CYP71AV11v2     171   1e-46   
ref|XP_003517259.1|  PREDICTED: cytochrome P450 71D8-like               171   1e-46   
dbj|BAM68809.1|  putative CYP71AV1 ortholog                             171   1e-46   
ref|XP_003537457.1|  PREDICTED: cytochrome P450 71D8-like               171   1e-46   
gb|KHN36164.1|  Cytochrome P450 71D8                                    171   1e-46   
dbj|BAM68818.1|  putative cytochrome P450 monooxygenase CYP71AV1        171   1e-46   
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               171   1e-46   
ref|XP_003550472.2|  PREDICTED: cytochrome P450 71D8-like               171   1e-46   
gb|KHN42275.1|  Cytochrome P450 71D8                                    171   2e-46   
gb|ABQ24001.1|  limonene hydroxylase                                    171   2e-46   Mentha arvensis [field mint]
gb|AJD25166.1|  cytochrome P450 CYP71D413                               171   2e-46   
gb|KDP39254.1|  hypothetical protein JCGZ_01011                         171   2e-46   
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g             171   2e-46   
ref|XP_003529672.2|  PREDICTED: cytochrome P450 71D8-like               171   2e-46   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              170   3e-46   
dbj|BAM68820.1|  putative cytochrome P450 monooxygenase CYP71AV11v1     169   4e-46   
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         169   4e-46   
gb|ACF74516.1|  amorpha-4,11-diene monooxygenase                        169   4e-46   Artemisia annua [sweet Annie]
gb|ADU25498.1|  cytochrome P450 monooxygenase                           169   4e-46   
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         169   7e-46   
emb|CBI39028.3|  unnamed protein product                                167   8e-46   
dbj|BAM68814.1|  putative cytochrome P450 monooxygenase CYP71AV11       169   8e-46   
dbj|BAM68813.1|  cytochrome P450 monooxygenase CYP71AV11                168   1e-45   
ref|XP_003611884.1|  Cytochrome P450                                    168   1e-45   
ref|XP_006346274.1|  PREDICTED: premnaspirodiene oxygenase-like         168   1e-45   
sp|Q6WKY9.1|C7D95_MENGR  RecName: Full=Cytochrome P450 71D95; Alt...    167   3e-45   Mentha x gracilis [ginger mint]
ref|XP_006364814.1|  PREDICTED: premnaspirodiene oxygenase-like         167   4e-45   
dbj|BAM68811.1|  putative CYP71AV1 ortholog                             167   4e-45   
sp|Q6IV13.1|C7D95_MENSP  RecName: Full=Cytochrome P450 71D95; Alt...    167   5e-45   Mentha spicata
gb|KDP39285.1|  hypothetical protein JCGZ_01042                         166   7e-45   
ref|XP_004231934.1|  PREDICTED: premnaspirodiene oxygenase-like         166   9e-45   
gb|ADA70806.1|  cytochrome P450 CYP71D177                               166   1e-44   Scoparia dulcis [escobilla]
dbj|BAJ39894.1|  P450 mono-oxygenase                                    165   2e-44   
emb|CDP07805.1|  unnamed protein product                                164   2e-44   
ref|XP_011047545.1|  PREDICTED: cytochrome P450 71D11-like isofor...    164   7e-44   
emb|CDP11810.1|  unnamed protein product                                162   7e-44   
sp|D5JBX0.1|GAO_HELAN  RecName: Full=Germacrene A oxidase; Short=...    163   1e-43   
ref|XP_011087047.1|  PREDICTED: premnaspirodiene oxygenase-like         163   1e-43   
ref|XP_011081932.1|  PREDICTED: cytochrome P450 71D95-like              163   1e-43   
ref|XP_004295868.1|  PREDICTED: cytochrome P450 71D11-like              163   1e-43   
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g             163   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_007146609.1|  hypothetical protein PHAVU_006G054600g             161   2e-43   
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   162   2e-43   
ref|XP_003610580.1|  Cytochrome P450                                    162   2e-43   
ref|XP_002522762.1|  cytochrome P450, putative                          162   3e-43   Ricinus communis
ref|XP_007020556.1|  Cytochrome P450 71D10, putative                    162   3e-43   
ref|XP_009385309.1|  PREDICTED: premnaspirodiene oxygenase-like         162   4e-43   
gb|KDP39288.1|  hypothetical protein JCGZ_01045                         161   4e-43   
ref|XP_011047544.1|  PREDICTED: cytochrome P450 71D11-like isofor...    161   4e-43   
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             161   5e-43   
gb|KDP39024.1|  hypothetical protein JCGZ_00781                         162   5e-43   
ref|XP_007020549.1|  Cytochrome P450                                    161   6e-43   
gb|KDP39022.1|  hypothetical protein JCGZ_00779                         160   6e-43   
ref|XP_006363816.1|  PREDICTED: premnaspirodiene oxygenase-like i...    160   8e-43   
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg             157   9e-43   
gb|AJD25165.1|  cytochrome P450 CYP71D412                               160   1e-42   
gb|KHN08403.1|  Cytochrome P450 71D8                                    159   1e-42   
gb|KDP39284.1|  hypothetical protein JCGZ_01041                         159   1e-42   
ref|XP_004512032.1|  PREDICTED: cytochrome P450 71D8-like               160   1e-42   
ref|XP_004501854.1|  PREDICTED: cytochrome P450 71A1-like               160   1e-42   
sp|Q9XHE6.1|C71DF_MENPI  RecName: Full=Cytochrome P450 71D15; Alt...    160   1e-42   Mentha x piperita
ref|XP_011014080.1|  PREDICTED: cytochrome P450 71D11-like              160   2e-42   
ref|XP_009419189.1|  PREDICTED: premnaspirodiene oxygenase-like         159   2e-42   
ref|XP_007099625.1|  Cytochrome P450 71D10, putative                    160   2e-42   
ref|XP_006427937.1|  hypothetical protein CICLE_v10025671mg             158   2e-42   
ref|XP_003520242.1|  PREDICTED: cytochrome P450 71D8-like               159   2e-42   
gb|KDP39088.1|  hypothetical protein JCGZ_00845                         159   2e-42   
ref|XP_003535170.1|  PREDICTED: cytochrome P450 71D8-like               159   3e-42   
ref|XP_003537212.1|  PREDICTED: cytochrome P450 71D8-like               159   3e-42   
ref|XP_006380104.1|  hypothetical protein POPTR_0008s21950g             159   3e-42   
emb|CDP11812.1|  unnamed protein product                                159   3e-42   
ref|XP_009385126.1|  PREDICTED: premnaspirodiene oxygenase-like         159   4e-42   
gb|KHN43881.1|  Cytochrome P450 71D10                                   157   4e-42   
gb|KDP39025.1|  hypothetical protein JCGZ_00782                         157   4e-42   
gb|KDP26294.1|  hypothetical protein JCGZ_22279                         159   5e-42   
ref|XP_008227173.1|  PREDICTED: cytochrome P450 71D9-like               158   5e-42   
ref|XP_004305992.1|  PREDICTED: cytochrome P450 71D11-like              158   6e-42   
gb|KDP23156.1|  hypothetical protein JCGZ_00355                         157   7e-42   
ref|XP_009587294.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    152   7e-42   
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             158   8e-42   
ref|XP_003535169.1|  PREDICTED: cytochrome P450 71D8-like               158   8e-42   
gb|ABO32531.1|  cytochrome P450-dependent monooxygenase-like protein    158   1e-41   Ammi majus [ameo mayor]
ref|XP_007146608.1|  hypothetical protein PHAVU_006G054500g             157   1e-41   
ref|XP_004247352.1|  PREDICTED: premnaspirodiene oxygenase-like         157   1e-41   
ref|XP_003535171.1|  PREDICTED: cytochrome P450 71D8-like               157   1e-41   
ref|XP_002310634.2|  hypothetical protein POPTR_0007s07300g             157   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             157   2e-41   
ref|XP_009616520.1|  PREDICTED: premnaspirodiene oxygenase-like         157   2e-41   
ref|XP_003600330.1|  Cytochrome P450                                    157   2e-41   
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             157   2e-41   
gb|ABR15423.1|  (-)P450 limonene-3-hydroxylase                          157   2e-41   
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             156   2e-41   
ref|XP_004511999.1|  PREDICTED: cytochrome P450 71D8-like               156   3e-41   
gb|AES70585.2|  cytochrome P450 family 71 protein                       157   3e-41   
gb|KEH34014.1|  cytochrome P450 family 71 protein                       156   3e-41   
ref|XP_006361719.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    155   3e-41   
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like               155   3e-41   
emb|CDP21437.1|  unnamed protein product                                156   3e-41   
ref|XP_009615716.1|  PREDICTED: premnaspirodiene oxygenase-like         156   4e-41   
ref|XP_004232610.1|  PREDICTED: premnaspirodiene oxygenase-like         156   4e-41   
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              156   5e-41   
gb|KDO62261.1|  hypothetical protein CISIN_1g012239mg                   155   5e-41   
ref|XP_006590052.1|  PREDICTED: cytochrome P450 71D8-like               155   5e-41   
ref|XP_006575708.1|  PREDICTED: cytochrome P450 71D10-like              156   5e-41   
ref|XP_006452555.1|  hypothetical protein CICLE_v10008411mg             154   6e-41   
ref|XP_002513339.1|  cytochrome P450, putative                          155   7e-41   
gb|KHN08718.1|  Cytochrome P450 71D8                                    155   7e-41   
ref|XP_008807778.1|  PREDICTED: premnaspirodiene oxygenase-like         155   7e-41   
gb|KEH25835.1|  cytochrome P450 family 71 protein                       155   7e-41   
ref|XP_011012702.1|  PREDICTED: cytochrome P450 71D11-like              155   9e-41   
gb|KCW68417.1|  hypothetical protein EUGRSUZ_F02067                     155   9e-41   
gb|KDP27295.1|  hypothetical protein JCGZ_20283                         155   1e-40   
gb|AES71399.2|  cytochrome P450 family 71 protein                       155   1e-40   
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              155   1e-40   
ref|XP_003537216.1|  PREDICTED: cytochrome P450 71D8-like               155   1e-40   
gb|KHN39921.1|  Cytochrome P450 71D8                                    155   1e-40   
gb|ACD42776.1|  cytochrome P450 71D1                                    155   1e-40   
gb|AAO32822.1|  cytochrome P450 71D1                                    154   1e-40   
ref|XP_006435925.1|  hypothetical protein CICLE_v10031280mg             155   1e-40   
ref|XP_010644548.1|  PREDICTED: premnaspirodiene oxygenase-like         154   1e-40   
gb|KDP42339.1|  hypothetical protein JCGZ_02812                         154   2e-40   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               154   2e-40   
ref|XP_008807779.1|  PREDICTED: premnaspirodiene oxygenase-like         154   2e-40   
ref|XP_003520239.1|  PREDICTED: cytochrome P450 71D8-like               154   2e-40   
gb|KDP39287.1|  hypothetical protein JCGZ_01044                         154   2e-40   
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             154   3e-40   
ref|XP_006351653.1|  PREDICTED: premnaspirodiene oxygenase-like         154   3e-40   
gb|KHG19088.1|  Premnaspirodiene oxygenase                              153   3e-40   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               154   3e-40   
ref|XP_007020557.1|  Cytochrome P450, putative                          154   3e-40   
emb|CDP20312.1|  unnamed protein product                                153   3e-40   
ref|XP_006474923.1|  PREDICTED: cytochrome P450 71D11-like              154   3e-40   
ref|XP_003535173.1|  PREDICTED: cytochrome P450 71D8-like               153   3e-40   
gb|KEH34023.1|  cytochrome P450 family 71 protein                       152   5e-40   
ref|XP_003532742.2|  PREDICTED: cytochrome P450 71D10                   153   5e-40   
ref|XP_008793722.1|  PREDICTED: cytochrome P450 71A1-like               153   5e-40   
ref|XP_006452551.1|  hypothetical protein CICLE_v10010293mg             153   5e-40   
gb|KHN36161.1|  Cytochrome P450 71D8                                    152   5e-40   
gb|AED99876.1|  cytochrome P450                                         153   6e-40   
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    153   6e-40   
ref|XP_009402815.1|  PREDICTED: premnaspirodiene oxygenase-like         152   7e-40   
ref|XP_003517257.1|  PREDICTED: cytochrome P450 71D8-like               152   7e-40   
ref|XP_003600334.1|  Cytochrome P450                                    153   8e-40   
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                   152   8e-40   
ref|XP_011002269.1|  PREDICTED: cytochrome P450 71D9-like               152   9e-40   
gb|EYU32748.1|  hypothetical protein MIMGU_mgv1a004746mg                152   1e-39   
emb|CBI39057.3|  unnamed protein product                                151   1e-39   
ref|XP_009410239.1|  PREDICTED: premnaspirodiene oxygenase-like         152   1e-39   
gb|KDP25063.1|  hypothetical protein JCGZ_22598                         152   1e-39   
gb|KCW68415.1|  hypothetical protein EUGRSUZ_F02064                     151   2e-39   
gb|AED99873.1|  cytochrome P450                                         152   2e-39   
gb|KHN12340.1|  Cytochrome P450 71D10                                   152   2e-39   
gb|EYU22011.1|  hypothetical protein MIMGU_mgv1a022953mg                148   2e-39   
ref|XP_010653207.1|  PREDICTED: cytochrome P450 71D9-like               151   2e-39   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             151   2e-39   
ref|XP_010907207.1|  PREDICTED: premnaspirodiene oxygenase-like         151   2e-39   
ref|XP_004304108.1|  PREDICTED: cytochrome P450 71D11-like              151   2e-39   
gb|EYU22017.1|  hypothetical protein MIMGU_mgv1a017655mg                151   2e-39   
ref|XP_009595834.1|  PREDICTED: premnaspirodiene oxygenase-like i...    151   2e-39   
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like               151   2e-39   
sp|G3GBK0.1|C7BL3_CICIN  RecName: Full=Costunolide synthase; Shor...    151   2e-39   
sp|F8S1I0.1|C7BL2_LACSA  RecName: Full=Costunolide synthase; Shor...    151   2e-39   
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              151   2e-39   
ref|XP_010061471.1|  PREDICTED: cytochrome P450 71D11-like              151   3e-39   
ref|XP_002513342.1|  cytochrome P450, putative                          151   3e-39   
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like               151   3e-39   
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             151   3e-39   
sp|H2DH20.1|C7D13_PANGI  RecName: Full=Cytochrome P450 CYP71D313        151   3e-39   
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         150   3e-39   
gb|AJD25152.1|  cytochrome P450 CYP71AP14                               151   3e-39   
gb|EYU39554.1|  hypothetical protein MIMGU_mgv1a004505mg                151   4e-39   
gb|KDP33179.1|  hypothetical protein JCGZ_13444                         147   4e-39   
ref|XP_006475119.1|  PREDICTED: premnaspirodiene oxygenase-like         150   4e-39   
ref|XP_009788454.1|  PREDICTED: cytochrome P450 71D8-like               150   4e-39   
ref|XP_004491491.1|  PREDICTED: premnaspirodiene oxygenase-like         150   4e-39   
gb|KDP36253.1|  hypothetical protein JCGZ_09818                         150   4e-39   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    150   4e-39   
gb|KHG15654.1|  Cytochrome P450                                         150   4e-39   
gb|KCW68416.1|  hypothetical protein EUGRSUZ_F02065                     150   5e-39   
ref|XP_007020553.1|  Cytochrome P450 71D10, putative                    150   5e-39   
ref|XP_010061472.1|  PREDICTED: cytochrome P450 71D11-like              150   5e-39   
ref|XP_008810543.1|  PREDICTED: premnaspirodiene oxygenase-like         149   6e-39   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             150   6e-39   
ref|XP_008385924.1|  PREDICTED: premnaspirodiene oxygenase-like         150   6e-39   
ref|XP_011038767.1|  PREDICTED: cytochrome P450 71D11-like              150   6e-39   
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g             150   6e-39   
ref|XP_008370832.1|  PREDICTED: premnaspirodiene oxygenase-like         149   6e-39   
ref|XP_002523467.1|  cytochrome P450, putative                          150   7e-39   
gb|EYU21952.1|  hypothetical protein MIMGU_mgv1a023648mg                147   7e-39   
gb|AIA09038.1|  costunolide synthase                                    150   7e-39   
ref|XP_007148448.1|  hypothetical protein PHAVU_006G209700g             150   7e-39   
ref|XP_009775980.1|  PREDICTED: premnaspirodiene oxygenase-like         149   9e-39   
gb|AHK60840.1|  CYP71BT1                                                149   9e-39   
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             149   1e-38   
ref|XP_002310060.1|  hypothetical protein POPTR_0007s07420g             149   1e-38   
gb|KDP26737.1|  hypothetical protein JCGZ_17895                         149   1e-38   
ref|XP_008387476.1|  PREDICTED: cytochrome P450 71A1-like               149   1e-38   
ref|XP_008345750.1|  PREDICTED: cytochrome P450 71D8-like               149   1e-38   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              149   1e-38   
ref|XP_003617704.1|  Cytochrome P450                                    149   1e-38   
gb|KDO62258.1|  hypothetical protein CISIN_1g0123662mg                  147   1e-38   
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             149   1e-38   
ref|XP_006388372.1|  hypothetical protein POPTR_0206s00240g             149   1e-38   
emb|CDP21848.1|  unnamed protein product                                148   1e-38   
ref|XP_010655870.1|  PREDICTED: cytochrome P450 71D10-like              149   1e-38   
ref|XP_009386890.1|  PREDICTED: premnaspirodiene oxygenase-like         149   2e-38   
ref|XP_009595835.1|  PREDICTED: premnaspirodiene oxygenase-like i...    149   2e-38   
gb|KHG00691.1|  Cytochrome P450                                         148   2e-38   
ref|XP_007153130.1|  hypothetical protein PHAVU_003G009200g             149   2e-38   
ref|XP_009402814.1|  PREDICTED: premnaspirodiene oxygenase-like         149   2e-38   
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like              149   2e-38   
gb|KDP39286.1|  hypothetical protein JCGZ_01043                         147   2e-38   
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              149   2e-38   
ref|XP_008350331.1|  PREDICTED: cytochrome P450 71A1-like               148   2e-38   
ref|XP_004299157.1|  PREDICTED: cytochrome P450 71A1-like               148   2e-38   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             148   2e-38   
emb|CAR92135.1|  5-epi-aristolochene-1,3-hydroxylase                    142   2e-38   
ref|XP_009795889.1|  PREDICTED: premnaspirodiene oxygenase-like         148   2e-38   
ref|XP_002513331.1|  cytochrome P450, putative                          148   3e-38   
gb|AIA09039.1|  costunolide synthase                                    148   3e-38   
ref|XP_008360773.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    148   3e-38   
gb|KHN42024.1|  Cytochrome P450 71D8                                    147   3e-38   
ref|XP_010105609.1|  Cytochrome P450 71A9                               145   3e-38   
ref|XP_003615865.1|  Cytochrome P450                                    148   3e-38   
gb|KHN48844.1|  Cytochrome P450 71D8                                    148   3e-38   
ref|XP_003617715.1|  Cytochrome P450                                    148   3e-38   
ref|XP_003636932.1|  Cytochrome P450                                    147   3e-38   
emb|CDP12691.1|  unnamed protein product                                148   4e-38   
gb|AED99871.1|  cytochrome P450                                         148   4e-38   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               147   4e-38   
gb|KDO38617.1|  hypothetical protein CISIN_1g045050mg                   148   4e-38   
gb|AES59944.2|  cytochrome P450 family 71 protein                       147   4e-38   
ref|XP_003636315.1|  Cytochrome P450                                    148   4e-38   
ref|XP_006848953.1|  hypothetical protein AMTR_s00166p00058240          145   4e-38   
ref|XP_003589693.1|  Cytochrome P450                                    147   4e-38   
gb|KDP25064.1|  hypothetical protein JCGZ_22599                         147   4e-38   
ref|XP_009357363.1|  PREDICTED: premnaspirodiene oxygenase-like         147   5e-38   
gb|KEH34016.1|  cytochrome P450 family 71 protein                       147   5e-38   
gb|KHG00772.1|  Cytochrome P450                                         147   5e-38   
gb|KDP42346.1|  hypothetical protein JCGZ_02819                         148   5e-38   
emb|CDP17725.1|  unnamed protein product                                148   5e-38   
dbj|BAP15885.1|  cytochrome P450 71AP13                                 147   5e-38   
ref|XP_007020552.1|  Cytochrome P450 71D10, putative                    147   5e-38   
ref|XP_008239357.1|  PREDICTED: cytochrome P450 71A1-like               147   5e-38   
ref|XP_004162132.1|  PREDICTED: cytochrome P450 71A1-like               147   5e-38   
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               147   5e-38   
ref|XP_003600339.1|  Cytochrome P450                                    147   6e-38   
emb|CDP11811.1|  unnamed protein product                                147   6e-38   
ref|XP_006364844.1|  PREDICTED: premnaspirodiene oxygenase-like         146   6e-38   
gb|KHM99472.1|  Cytochrome P450 71D11                                   147   7e-38   
gb|AGK82815.1|  cytochrome P450-2                                       147   7e-38   
gb|KEH25843.1|  cytochrome P450 family 71 protein                       147   7e-38   
ref|XP_004152580.1|  PREDICTED: cytochrome P450 71A1-like               147   7e-38   
ref|XP_006474922.1|  PREDICTED: cytochrome P450 71D11-like isofor...    147   7e-38   
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             147   8e-38   
gb|KHN33492.1|  Cytochrome P450 71D10-like protein                      147   8e-38   
ref|XP_008392973.1|  PREDICTED: cytochrome P450 71A1-like               145   9e-38   
gb|AGO03790.1|  costunolide                                             146   1e-37   
ref|XP_002311285.1|  hypothetical protein POPTR_0008s08180g             145   1e-37   
ref|XP_008794219.1|  PREDICTED: premnaspirodiene oxygenase-like         146   1e-37   
ref|XP_008791005.1|  PREDICTED: premnaspirodiene oxygenase-like         146   1e-37   
gb|EYU21982.1|  hypothetical protein MIMGU_mgv1a026917mg                146   1e-37   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              146   1e-37   
gb|AES70567.2|  cytochrome P450 family 71 protein                       146   1e-37   
gb|KDP42338.1|  hypothetical protein JCGZ_02811                         146   2e-37   
ref|XP_003600328.1|  Cytochrome P450                                    146   2e-37   
ref|XP_002532304.1|  cytochrome P450, putative                          146   2e-37   
ref|XP_011097781.1|  PREDICTED: premnaspirodiene oxygenase-like         146   2e-37   
gb|KEH34017.1|  cytochrome P450 family 71 protein                       146   2e-37   
ref|XP_002318090.2|  hypothetical protein POPTR_0012s09160g             146   2e-37   
gb|AGK82831.1|  cytochrome P450-2                                       146   2e-37   
gb|KDP29297.1|  hypothetical protein JCGZ_19400                         146   2e-37   
ref|XP_002514827.1|  cytochrome P450, putative                          145   2e-37   
ref|XP_002513345.1|  cytochrome P450, putative                          145   2e-37   
ref|XP_006856442.1|  hypothetical protein AMTR_s00047p00229040          145   3e-37   
ref|XP_006388081.1|  hypothetical protein POPTR_0357s00220g             145   3e-37   
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    145   3e-37   
ref|XP_006854378.1|  hypothetical protein AMTR_s00039p00170480          145   3e-37   
ref|XP_004304768.1|  PREDICTED: cytochrome P450 71D11-like              144   3e-37   
ref|XP_007037782.1|  Cytochrome P450 71A1                               145   3e-37   
emb|CDP12692.1|  unnamed protein product                                145   3e-37   
sp|O22307.1|C71DB_LOTJA  RecName: Full=Cytochrome P450 71D11            145   4e-37   
gb|EYU21980.1|  hypothetical protein MIMGU_mgv1a004765mg                145   4e-37   
gb|AAO32823.1|  cytochrome P450 71D2                                    144   4e-37   
ref|XP_004247351.1|  PREDICTED: premnaspirodiene oxygenase-like         145   4e-37   
gb|KHM99474.1|  Cytochrome P450 71D11                                   145   4e-37   
ref|XP_006369963.1|  hypothetical protein POPTR_0001s364101g            142   4e-37   
ref|XP_006377819.1|  hypothetical protein POPTR_0011s13430g             145   4e-37   
ref|XP_004157816.1|  PREDICTED: cytochrome P450 71A1-like               145   4e-37   
ref|XP_004152579.1|  PREDICTED: cytochrome P450 71A1-like               145   4e-37   
gb|AFK35275.1|  unknown                                                 142   5e-37   
gb|ADC94830.1|  (-)-limonene-7-hydroxylase                              144   5e-37   
gb|KEH19671.1|  cytochrome P450 family 71 protein                       145   5e-37   
gb|AGC29947.1|  CYP71BE30                                               145   5e-37   
gb|KEH34025.1|  cytochrome P450 family 71 protein                       145   5e-37   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               145   5e-37   
emb|CDP13734.1|  unnamed protein product                                147   5e-37   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               144   5e-37   
ref|XP_011077043.1|  PREDICTED: premnaspirodiene oxygenase-like         144   5e-37   
ref|XP_011040452.1|  PREDICTED: cytochrome P450 71A1-like               144   5e-37   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       144   5e-37   
ref|XP_010102938.1|  Cytochrome P450 71A1                               144   5e-37   
gb|AIM47558.1|  CYP726A4                                                144   6e-37   
ref|NP_001236165.1|  cytochrome P450 71D10                              144   6e-37   
ref|XP_010042386.1|  PREDICTED: cytochrome P450 71A1-like               143   6e-37   
gb|AGN04220.1|  cytochrome P450                                         144   6e-37   
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    144   6e-37   
ref|XP_003601148.1|  Cytochrome P450                                    140   6e-37   
gb|KDP30978.1|  hypothetical protein JCGZ_11354                         144   7e-37   
emb|CDP11809.1|  unnamed protein product                                144   7e-37   
gb|AGO03787.1|  cytochrome P450                                         144   8e-37   
emb|CDP13517.1|  unnamed protein product                                142   8e-37   
gb|EMT28727.1|  hypothetical protein F775_52237                         144   8e-37   
ref|XP_011040453.1|  PREDICTED: cytochrome P450 71A1-like               144   8e-37   
gb|AHN62856.1|  costunolide synthase                                    144   8e-37   
ref|XP_004157773.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    144   9e-37   
ref|XP_007033123.1|  Cytochrome P450 71D10, putative                    144   9e-37   
ref|XP_007033124.1|  Cytochrome P450 71D10, putative                    144   9e-37   



>emb|CAC24711.1| cytochrome P450 [Solanum tuberosum]
Length=502

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 158/206 (77%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+  +I+ YN SDIAFCPYGDYWRQMRKICV+ELL+ KNVRS+ SIR+DE
Sbjct  93   HDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKNVRSYGSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ ++RS+S  G+ V F ER+FL  +S+ CRSAFGKVF  +++F++ +KE+  L G 
Sbjct  153  VDRLVNFIRSSS--GEPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G K +I+ AH KVDAI+E++I EH++K   G  +G+   + L
Sbjct  211  FDVADIFPSLKFLH-VLSGMKGKIMNAHHKVDAIVEDVINEHKKKFAIGKTNGALGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVLIR M+ G L+ PI++DNIKAII
Sbjct  270  IDVLIRLMNDGGLQFPITNDNIKAII  295



>ref|XP_004237369.1| PREDICTED: premnaspirodiene oxygenase [Solanum lycopersicum]
Length=501

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 158/206 (77%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+  +I+ Y+ SDIAFCPYGDYWRQMRKICV+ELL+ KNVRS+SSIR+DE
Sbjct  93   HDIAFASRPKLLAPEIVCYSRSDIAFCPYGDYWRQMRKICVLELLSAKNVRSYSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ ++RS+S   + V F ER+FL  +S+ CRSAFGKVF  +++F++ +KE+  L G 
Sbjct  153  VDRLVNFIRSSSSFREPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G K +I+ AH KVDAI+E++I EH++ +  G  +G+   + L
Sbjct  213  FDVADIFPSLKFLH-VLSGMKGKIVNAHHKVDAIVEDVINEHKKNIAMGKTNGALGGEDL  271

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+ G L+ PI++DNIKAII
Sbjct  272  IDVLLRLMNDGGLQFPITNDNIKAII  297



>ref|XP_009609720.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana tomentosiformis]
Length=376

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 158/206 (77%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P L+  +I+ YN SD+AFCPYGDYWRQMRKICV+E+L+ KNVR++SSIR+DE
Sbjct  93   HDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKNVRTYSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL ++RS+S  G+ V   ER+FL  +S+ CRSAFG+VF  +++F++ +KE+  L G 
Sbjct  153  VLRLLNFIRSSS--GEPVNITERIFLFTSSMTCRSAFGQVFKEQDKFIQLIKEVILLAGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS++ LH +  G K +I+ AH KVDAI+EN+I +H++ L  G  +G+   + L
Sbjct  211  FDVADIFPSYKFLH-VLSGMKGKIMNAHHKVDAIVENVINKHKKNLAIGKTNGALGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+ G L+ PI++DNIKAII
Sbjct  270  IDVLLRLMNDGGLQFPITNDNIKAII  295



>sp|A6YIH8.1|C7D55_HYOMU RecName: Full=Premnaspirodiene oxygenase; Short=HPO; AltName: 
Full=Cytochrome P450 71D55 [Hyoscyamus muticus]
 gb|ABS00393.1| cytochrome P450 hydroxylase [Hyoscyamus muticus]
Length=502

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 158/206 (77%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+  +I+ YN SDIAFCPYGDYWRQMRKICV+E+L+ KNVRSFSSIR+DE
Sbjct  93   HDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ +VRS++   + V F ER+FL  +S+ CRSAFGKVF  +E F++ +KE+  L G 
Sbjct  153  VLRLVNFVRSST--SEPVNFTERLFLFTSSMTCRSAFGKVFKEQETFIQLIKEVIGLAGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G + +I+KAH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  211  FDVADIFPSLKFLH-VLTGMEGKIMKAHHKVDAIVEDVINEHKKNLAMGKTNGALGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+ G L+ PI++DNIKAII
Sbjct  270  IDVLLRLMNDGGLQFPITNDNIKAII  295



>ref|XP_006350396.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 158/206 (77%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+  +I+ YN SDIAFCPYGDYWRQMRKICV+ELL+ KNVRS+ SIR+DE
Sbjct  93   HDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKNVRSYGSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ ++RS+S  G+ V F ER+FL  +S+ CRSAFGKVF  +++F++ +KE+  L G 
Sbjct  153  VDRLVNFIRSSS--GEPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G K +I+ AH KVDAI+E++I EH++ +  G  +G+   + L
Sbjct  211  FDVADIFPSLKFLH-VLSGMKGKIMNAHDKVDAIVEDVINEHKKNIAMGKTNGALGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVLIR M+ G L+ PI+++NIKAII
Sbjct  270  IDVLIRLMNDGGLQFPITNNNIKAII  295



>dbj|BAN58140.1| putative premaspirodiene oxygenase [Hyoscyamus albus]
Length=502

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 157/206 (76%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+  +I+ YN SDIAFCPYGDYWRQMRKICV+E+L+ KNVRSFSSIR+DE
Sbjct  93   HDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ +VRS +   + V F ER+FL  +S+ CRSAFGKVF  +E F++ +KE+  L G 
Sbjct  153  VLRLVNFVRSCT--SKPVNFTERLFLFTSSMTCRSAFGKVFKEQETFIQLIKEVIGLAGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G + +I+KAH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  211  FDVADIFPSLKFLH-VLTGMEGKIMKAHHKVDAIVEDVINEHKKNLAMGKTNGALGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+ G L+ PI+++NIKAII
Sbjct  270  IDVLLRLMNDGGLQFPITNNNIKAII  295



>ref|XP_009758268.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana sylvestris]
 gb|ABC69404.1| CYP71D51v2 [Nicotiana tabacum]
 gb|AGK30193.1| cytochrome P450 CYP71D51 [Nicotiana tabacum]
Length=514

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 157/206 (76%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P L+  +I+ YN SD+AFCPYGDYWRQMRKICV+E+L+ KNVR+FSSIR++E
Sbjct  105  HDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKNVRTFSSIRRNE  164

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ ++RS+S  G+ +   ER+FL  +S+ CRSAFG+VF  +++F++ +KE+  L G 
Sbjct  165  VLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQLIKEVILLAGG  222

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G K +I+ AH KVDAI+EN+I EH++ L  G  +G+   + L
Sbjct  223  FDVADIFPSLKFLH-VLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKTNGALGGEDL  281

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+ G L+ PI++DNIKAII
Sbjct  282  IDVLLRLMNDGGLQFPITNDNIKAII  307



>gb|ABC69405.1| CYP71D51v3 [Nicotiana tabacum]
Length=514

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 157/206 (76%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P L+  +I+ YN SD+AFCPYGDYWRQMRKICV+E+L+ KNVR+FSSIR++E
Sbjct  105  HDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKNVRTFSSIRRNE  164

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ ++RS+S  G+ +   ER+FL  +S+ CRSAFG+VF  +++F++ +KE+  L G 
Sbjct  165  VLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQLIKEVILLAGG  222

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G K +I+ AH KVDAI+EN+I EH++ L  G  +G+   + L
Sbjct  223  FDVADIFPSLKFLH-VLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKTNGALGGEDL  281

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+ G L+ PI++DNIKAII
Sbjct  282  IDVLLRLMNDGGLQFPITNDNIKAII  307



>ref|XP_006350395.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 156/206 (76%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+  +I+ YN SDIAFCPYGDYWRQM KICV+ELL+ KNVRS+ SIR+DE
Sbjct  93   HDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMHKICVLELLSAKNVRSYGSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS+S  G+ V F ER+FL  +S+ CRSAFGKVF  +++F++ +KE+  L G 
Sbjct  153  VDRLVNLIRSSS--GEPVNFIERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS ++LH +  G K +I+ AH K+DAI+E++I EH++ +  G  +G+   + L
Sbjct  211  FDVADLFPSLKLLH-VLSGMKGKIMNAHHKIDAIVEDVINEHKKNIAMGKTNGALGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVLIR M+ G L+ PI++ NIKAII
Sbjct  270  IDVLIRLMNDGGLQFPITNVNIKAII  295



>gb|ABC69403.1| CYP71D51v1 [Nicotiana tabacum]
Length=514

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 156/206 (76%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P L+  +I+ YN SD+AFCPYGDYWRQMRKICV+E+L+ KNVR+FSSIR++E
Sbjct  105  HDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKNVRTFSSIRRNE  164

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ ++RS+S  G+ +   ER+FL  +S+ CRSAFG+VF  +++F++ +KE+  L G 
Sbjct  165  VLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQLIKEVILLAGG  222

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G K +I+ AH KVDAI+EN+I EH++ L  G  +G+   + L
Sbjct  223  FDVADIFPSLKFLH-VLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKTNGALGGEDL  281

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDV +R M+ G L+ PI++DNIKAII
Sbjct  282  IDVPLRLMNDGGLQFPITNDNIKAII  307



>ref|XP_009624011.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=458

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 152/206 (74%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+  +I+ YN SDIAF PYGDYWRQMRKICV+E+LN KNVRSFSSIR+DE
Sbjct  49   HDLAFASRPKLLAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVRSFSSIRRDE  108

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ + RS+S  G+ V F +R+ L  + IICRSAFG VF  ++EF++ +K ++ LL  
Sbjct  109  VFRLIEFFRSSS--GKPVNFTKRISLFTSFIICRSAFGTVFKEQDEFIQVMKNVTALLEG  166

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
             D AD+FPS + LH L  G + +++  H KVD+I++N+I EH++ L  G  +G    + L
Sbjct  167  LDVADIFPSLKFLHVL-TGKRAKVMNLHHKVDSIVDNVINEHKKNLATGKFNGQLGGEDL  225

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M  G+L+ PI++DNIKAII
Sbjct  226  IDVLLRLMKDGDLQFPITNDNIKAII  251



>ref|XP_009624010.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=502

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 152/206 (74%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+  +I+ YN SDIAF PYGDYWRQMRKICV+E+LN KNVRSFSSIR+DE
Sbjct  93   HDLAFASRPKLLAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ + RS+S  G+ V F +R+ L  + IICRSAFG VF  ++EF++ +K ++ LL  
Sbjct  153  VFRLIEFFRSSS--GKPVNFTKRISLFTSFIICRSAFGTVFKEQDEFIQVMKNVTALLEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
             D AD+FPS + LH L  G + +++  H KVD+I++N+I EH++ L  G  +G    + L
Sbjct  211  LDVADIFPSLKFLHVL-TGKRAKVMNLHHKVDSIVDNVINEHKKNLATGKFNGQLGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M  G+L+ PI++DNIKAII
Sbjct  270  IDVLLRLMKDGDLQFPITNDNIKAII  295



>ref|XP_009776870.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=349

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P LV  KI+FYN +DIAF PYG+YWRQMRKIC++ELL+ KNV+SF+SIRQDE
Sbjct  93   HDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+   G+ V   +R  L  +S+ CRSAFG+ +  ++EF   +K++S L+  
Sbjct  153  VHRMIEFFRSSP--GKPVNVTKRFALFTSSMTCRSAFGQEYKEQDEFARLVKKVSNLMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++ AH ++D I++NII EH++  K   ESG S+ +ID
Sbjct  211  FDVADIFPSLKFLH-VLTGMKAKVMDAHNELDEILDNIITEHKKVAKTNCESG-SEGIID  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  269  VLLRLMKEGGLQFPITNDNIKAII  292



>gb|AHH25653.1| cytochrome P450 CYP71D [Nicotiana tabacum]
Length=497

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 149/204 (73%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+ + ++I+FYNCSDIAFCPYGDYWRQMRKIC++ELL  KNVRSFSSIR+DE
Sbjct  93   HDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+    Q V   +R++   +S+ CRSAFGKVF  ++EF+  +K  + L+  
Sbjct  153  VHRMIEFFRSSI--DQQVNVTKRIYQFTSSMTCRSAFGKVFKEQDEFILLVKRNTALMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K R++  H K+DAI+ENII E R+K+  G   G    LID
Sbjct  211  FDVADIFPSKKFLH-VLSGKKARVMDVHHKIDAILENIINE-RKKIATGEVGGKG--LID  266

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  267  VLLRLMKEGGLQFPITNDNIKAII  290



>ref|XP_009612417.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 149/204 (73%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+ + ++I+FYNCSDIAFCPYGDYWRQMRKIC++ELL  KNVRSFSSIR+DE
Sbjct  93   HDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+    Q V   +R++   +S+ CRSAFGKVF  ++EF+  +K  + L+  
Sbjct  153  VHRMIEFFRSSI--DQQVNVTKRIYQFTSSMTCRSAFGKVFKEQDEFILLVKRNTALMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K R++  H K+DAI+ENII E R+K+  G   G    LID
Sbjct  211  FDVADIFPSKKFLH-VLSGKKARVMDVHHKIDAILENIINE-RKKIATGEVGGKG--LID  266

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  267  VLLRLMKEGGLQFPITNDNIKAII  290



>ref|XP_009772938.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 151/206 (73%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+  +I+ Y+ SD+AF PYGDYWRQMRKICV+E+L+ KNVRSFSSIR+DE
Sbjct  93   HDLAFASRPKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLSTKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ + RS+S  G+ V + +R+ L M+ IICRSAFG VF  ++EF++ +K ++ LL  
Sbjct  153  VFRLVEFFRSSS--GKPVNYTKRISLFMSFIICRSAFGTVFKEQDEFIQVMKNVTALLEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH +  G + + +  H KVDAI++N+I EH+E L  G  SG    + L
Sbjct  211  FDVADIFPSLKFLH-VVTGMRAKAMNLHHKVDAIVDNVINEHKENLATGKFSGQLGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M  G  + PI++DNIKAII
Sbjct  270  IDVLLRLMKDGGFQFPITNDNIKAII  295



>ref|XP_009772400.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like, partial 
[Nicotiana sylvestris]
Length=253

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P++V   II YN SDIAF PYGD+WRQMRKICVMELLN KNVRSFSSIR+DE
Sbjct  35   HDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDE  94

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS S  G+LV F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   
Sbjct  95   VVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEG  154

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD  D+FP+++ LH +  G K +++ AH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  155  FDVVDIFPTYKFLH-VLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGEDL  213

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+  +L+ PI++DNIKA++
Sbjct  214  IDVLLRLMNDTSLQFPITNDNIKAVV  239



>ref|XP_004228510.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 152/206 (74%), Gaps = 4/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P L+  +I+ YNC+DIAFCPYGDYWRQMRKICV+E+L+GKNVRSF SIRQDE
Sbjct  94   HDLAFASRPRLLAAEIVLYNCTDIAFCPYGDYWRQMRKICVLEVLSGKNVRSFGSIRQDE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+ + RS+S   + V   +R+ L  + IICRSAFG +F  ++EF++ +K ++ LL  
Sbjct  154  TIRLVEFFRSSS-SSEPVNVTKRISLFTSFIICRSAFGTIFKEQDEFIQVMKGVTSLLEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESG--SSDCL  79
            F+ AD+FPS + LH L  G K++ +  H KVD I+EN+I EH++ L NG  +G    + L
Sbjct  213  FNVADIFPSLKFLHVL-SGMKSKTMYLHHKVDTIVENVINEHKKNLVNGKTNGELGGEDL  271

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+ G+L+ PI++DNIKAI+
Sbjct  272  IDVLLRLMEDGDLQFPITNDNIKAIV  297



>ref|XP_006350417.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 152/206 (74%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P L+   II YN  DIAF PYG+YWRQMRKICVME+L  KNVRSFSSIR+DE
Sbjct  92   HDIAFASRPSLLATDIICYNRRDIAFIPYGEYWRQMRKICVMEVLGAKNVRSFSSIRRDE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++S+S  G+ V F E++    +S+ CRSAFG+V   +E F++ ++E+  L   
Sbjct  152  VVRLIDSIQSSSFSGEPVNFTEKIIWFTSSMTCRSAFGQVLKEQEVFIKLIREVISLTEG  211

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL--KNGSESGSSDCL  79
            FD AD+FPS++ LHG FGG K +++ AHRKVD+I+E++IKEH++ L  +   +S   + L
Sbjct  212  FDVADIFPSYKFLHG-FGGAKKQLLNAHRKVDSIVEDVIKEHKKNLATRKSDDSIGGEDL  270

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+R M+  +L+ PI++DNIKA+I
Sbjct  271  VDVLLRLMNDKSLQFPINNDNIKAVI  296



>ref|XP_009794007.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 146/204 (72%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+ +  +I+FYNCSDIAFCPYGDYWRQMRKICV+ELL  KNVRSFS+IRQDE
Sbjct  93   HDLAFASRPKFLATEIVFYNCSDIAFCPYGDYWRQMRKICVIELLTAKNVRSFSAIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS++   Q +   +R+    +S+ CRSAFGKV   ++EF+  +K  + L+  
Sbjct  153  VHRMIEFFRSST--DQQINVTKRICQFTSSMTCRSAFGKVIKEQDEFILLVKRNTALVEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K R++  H K+DAI+ENII E +E +  G   G    LID
Sbjct  211  FDVADIFPSLKFLH-VLSGKKARVMDVHHKIDAILENIINERKE-IATGELGGKG--LID  266

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  267  VLLRLMKEGGLQFPITNDNIKAII  290



>ref|XP_004245943.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=499

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 150/208 (72%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA +PEL+++ I+FYN +DI F  YGDYW+QMRKIC+ ELL+ K V+SFS IRQDE
Sbjct  93   HDLCFAARPELMSSDIVFYNQNDIVFAKYGDYWKQMRKICISELLSAKMVKSFSLIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H L+A +RST     +V   E++  L +S+ICRSAFGKV+  R+  +  ++E+  L G 
Sbjct  153  VHDLVASIRSTP--NVVVNISEKILRLTSSVICRSAFGKVWDDRDNLLMLMREVLSLSGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            FD AD+FPSW +LHG+ GG +NR+   H+K+D I+E II EH+E   NG    SE G  D
Sbjct  211  FDVADLFPSWTLLHGI-GGMRNRLKSLHQKIDVILEKIIHEHKENRANGKKGNSEFGGED  269

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R M++G L+ PI++D++KA++
Sbjct  270  -LIDVLLRVMENGELQFPITNDSVKAVV  296



>ref|XP_009598320.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=502

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 151/205 (74%), Gaps = 5/205 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+LV   I+ YN +DIAF PYGDYWRQMRKICVMELL+ KNVRSF+SIR+DE
Sbjct  93   HDLAFASRPKLVAVDIVGYNGTDIAFSPYGDYWRQMRKICVMELLSAKNVRSFNSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL+ + RS++  G+ V   +R+++  +S+I RSAFGKV   ++E +  +K++S L+G 
Sbjct  153  VCSLIEFFRSSA--GEPVNVTKRIYVFASSMIFRSAFGKVIKEQDECIRLIKDVSGLVGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS +VLH +  G K + +  H K+D IIEN+I EH++ L  G  +G   S+ L
Sbjct  211  FDVADIFPSQKVLH-VLSGKKGKTMYLHHKIDTIIENVINEHKQNLATGKFNGQLGSEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAI  4
            IDVL+R M  G+L+ PI+ DNIKAI
Sbjct  270  IDVLLRLMKDGSLQFPITTDNIKAI  294



>ref|XP_009769208.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P LV  KI+FYN +DIAF PYG+YWRQMRKIC++ELL+ KNV+SF+SIRQDE
Sbjct  93   HDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+   G+ V   +R  L  +S+ CRSAFG+ +  ++EF   +K++S L+  
Sbjct  153  VHRMIEFFRSSP--GKPVNVTKRFALFTSSMTCRSAFGQEYKEQDEFARLVKKVSNLMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++ AH ++D I++NII EH++  K   ESG S+ +ID
Sbjct  211  FDVADIFPSLKFLH-VLTGMKAKVMDAHNELDEILDNIITEHKKVAKTNCESG-SEGIID  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  269  VLLRLMKEGGLQFPITNDNIKAII  292



>ref|XP_009776868.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P LV  KI+FYN +DIAF PYG+YWRQMRKIC++ELL+ KNV+SF+SIRQDE
Sbjct  93   HDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+   G+ V   +R  L  +S+ CRSAFG+ +  ++EF   +K++S L+  
Sbjct  153  VHRMIEFFRSSP--GKPVNVTKRFALFTSSMTCRSAFGQEYKEQDEFARLVKKVSNLMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++ AH ++D I++NII EH++  K   ESG S+ +ID
Sbjct  211  FDVADIFPSLKFLH-VLTGMKAKVMDAHNELDEILDNIITEHKKVAKTNCESG-SEGIID  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  269  VLLRLMKEGGLQFPITNDNIKAII  292



>ref|XP_006350393.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 151/207 (73%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+   II YN  DIAF PYG+YWRQMRKIC+ME+L+ KNVRSFSSIR DE
Sbjct  92   HDIAFASRPKLLAMDIICYNRRDIAFSPYGEYWRQMRKICIMEVLSAKNVRSFSSIRHDE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++     G+LV F ER+    +S+ CRSAFG+V   +E F++ ++E+  L   
Sbjct  152  VVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKEQEVFIKLIREVISLAEG  211

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSDC  82
            FD AD+FPS++ LHG FGG K +++ AHRKVD+I+E++IKEH++ +   K+    G  D 
Sbjct  212  FDVADIFPSYKFLHG-FGGAKKKLLNAHRKVDSIVEDVIKEHKKNIATRKSDDAIGGED-  269

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R M+  +L+ PI++DNIKA+I
Sbjct  270  LVDVLLRLMNDKSLQFPINNDNIKAVI  296



>sp|P93531.1|C71D7_SOLCH RecName: Full=Cytochrome P450 71D7 [Solanum chacoense]
 gb|AAB61965.1| putative cytochrome P450 [Solanum chacoense]
Length=500

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 150/207 (72%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+   II YN  DIAF PYGDYWRQMRKIC+ME+L+ K+VRSFSSIR DE
Sbjct  92   HDIAFASRPKLLAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVLSAKSVRSFSSIRHDE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++     G+LV F ER+    +S+ CRSAFG+V   +E F++ ++E+  L   
Sbjct  152  VVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKEQEVFIKLIREVISLAEG  211

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSDC  82
            FD AD+FPS++ LHG FGG K +++ AHRKVD+I+E++IKEH++ L   K+    G  D 
Sbjct  212  FDVADIFPSYKFLHG-FGGAKQKLLNAHRKVDSIVEDVIKEHKKNLATRKSDDAIGGED-  269

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+D L+R M+  +L+ PI++DNIKA+I
Sbjct  270  LVDALVRLMNDKSLQFPINNDNIKAVI  296



>ref|XP_009796910.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 150/206 (73%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+  +I+ Y+ SD+AF PYGDYWRQMRKICV+E+L+ KNVRSFSSIR+DE
Sbjct  93   HDLAFASRPKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLSTKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+ + RS+S  G+ V F +R+ L M+ IICRSAFG VF  ++EF++ +K+++ LL  
Sbjct  153  VVRLIEFFRSSS--GKPVNFTKRISLFMSFIICRSAFGTVFKEQDEFIQVMKDVTALLEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS + LH L  G + + +  H KVD I++NII EH++ L  G  +G    + L
Sbjct  211  FDVADIFPSLKFLHVL-TGMRAKAMNLHHKVDDIVDNIINEHKKNLATGKFNGQLGGEDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R    G  + PI++DNIKAII
Sbjct  270  IDVLLRLKKDGGFQFPITNDNIKAII  295



>ref|XP_009625417.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase [Nicotiana tomentosiformis]
Length=504

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 152/206 (74%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P+++   II YN SDIAF PYGD+WRQMRKICVMELLN KNVRSFSSIR+DE
Sbjct  93   HDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS S  G+LV F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   
Sbjct  153  VVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDVFAKKIREVIGLAEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS++ LH +  G K +++ AH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  213  FDVADIFPSYKFLH-VLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATGKTNGALGGEDL  271

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+  +L+ PI++DNIKAII
Sbjct  272  IDVLLRLMNDTSLQFPITNDNIKAII  297



>ref|XP_009794009.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 149/204 (73%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+  +I+ YNCSDIAF PYGDYWRQMRKIC++ELL+ KNVRSFSSIR+DE
Sbjct  93   HDLAFASRPKLLAAEIVIYNCSDIAFSPYGDYWRQMRKICMIELLSAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS++  G+ V   +R++   +S+ CRSAFGKVF  ++E +  +K  + L+  
Sbjct  153  VHRMIEFFRSST--GKQVNVTKRIYQFASSMTCRSAFGKVFKEQDELILLVKRNTALVEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++  H K+DAI+ENII E +   K  ++  + + LID
Sbjct  211  FDVADIFPSLKFLH-VLSGMKTKVMDVHHKLDAILENIINERK---KIATDELADEGLID  266

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  267  VLLRLMKEGGLQFPITNDNIKAII  290



>ref|XP_006339043.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=509

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 153/207 (74%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L +   I Y  +DIAF PYG+YWRQMRK+CVMELL  KNVRSFSSIR+DE
Sbjct  99   HDLAFASRPKLASVDTICYKSTDIAFTPYGEYWRQMRKVCVMELLTAKNVRSFSSIRKDE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+ +++S++  G+ +   ER+    +SI C++AFG++   +E+F++ +KE+ EL G 
Sbjct  159  ASGLVQFIQSSTC-GEPINVTERILWYQSSITCKAAFGELLKDQEKFIQMVKEVMELAGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
            F+ AD+FPS ++L  +  G ++RI+K H+ VDAI+E++I EH++ + +G +   +   + 
Sbjct  218  FNLADIFPSIKILQ-VLSGVRSRILKVHKNVDAIVEDVINEHKKNIASGKKGNGAFGGED  276

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R M+SG L++PI++DNIKAI+
Sbjct  277  LVDVLLRLMESGELKIPITNDNIKAIM  303



>ref|XP_009612418.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 148/204 (73%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+  +I+ YNCSDIAFCPYGDYWRQMRKIC++ELL+ KNV+SFSSIR+DE
Sbjct  93   HDLAFASRPKLLAAEIVIYNCSDIAFCPYGDYWRQMRKICMIELLSAKNVKSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS++  G+ V   +R++   +S+ CRSAFGKVF  ++E +  +K  + L+  
Sbjct  153  VHGMIEFFRSST--GKQVNITKRIYQFASSMTCRSAFGKVFKEQDELILLVKRNTALVEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++  H K+D I+ENII E +   K  ++    + LID
Sbjct  211  FDVADIFPSLKFLH-VLSGMKAKVMDVHHKLDVILENIINERK---KIATDELGDEGLID  266

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  267  VLLRLMKEGGLQFPITNDNIKAII  290



>sp|Q94FM7.2|C71DK_TOBAC RecName: Full=5-epiaristolochene 1,3-dihydroxylase; Short=NtEAH; 
AltName: Full=Cytochrome P450 71D20 [Nicotiana tabacum]
 gb|AAK62342.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=504

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P++V   II YN SDIAF PYGD+WRQMRKICVMELLN KNVRSFSSIR+DE
Sbjct  93   HDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS S  G+LV F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   
Sbjct  153  VVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD  D+FP+++ LH +  G K +++ AH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  213  FDVVDIFPTYKFLH-VLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGEDL  271

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+  +L+ PI++DNIKA+I
Sbjct  272  IDVLLRLMNDTSLQFPITNDNIKAVI  297



>ref|XP_009771988.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Nicotiana 
sylvestris]
Length=504

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P+++   II YN SDIAF PYGD+WRQMRKICVMELLN KNVRSFSSIR+DE
Sbjct  93   HDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS S  G+LV F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   
Sbjct  153  VVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDVFAKKIREVIGLAEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD AD+FPS++ LH +  G K +++ AH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  213  FDVADIFPSYKFLH-VLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATGKTNGALGGEDL  271

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+  +L+ PI++D IKA+I
Sbjct  272  IDVLLRLMNDTSLQFPITNDKIKAVI  297



>ref|XP_009801864.1| PREDICTED: LOW QUALITY PROTEIN: 5-epiaristolochene 1,3-dihydroxylase-like 
[Nicotiana sylvestris]
Length=504

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P++V   II YN SDIAF PYGD+WRQMRKICVMELLN KNVRSFSSIR+DE
Sbjct  93   HDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS S  G+LV F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   
Sbjct  153  VVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD  D+FP+++ LH +  G K +++ AH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  213  FDVVDIFPTYKFLH-VLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGEDL  271

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+  +L+ PI++DNIKA++
Sbjct  272  IDVLLRLMNDTSLQFPITNDNIKAVV  297



>gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum]
Length=504

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P++V   II YN SDIAF PYGD+WRQMRKICVMELLN KNVRSFSSIR+DE
Sbjct  93   HDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS S  G+LV F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   
Sbjct  153  VVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD  D+FP+++ LH +  G K +++ AH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  213  FDVVDIFPTYKFLH-VLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGEDL  271

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+  +L+ PI++DNIKA++
Sbjct  272  IDVLLRLMNDTSLQFPITNDNIKAVV  297



>gb|AIZ01224.1| epi-aristolochene dihydroxylase, partial [Nicotiana benthamiana]
Length=438

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P++V   II YN SDIAF P+GD+WRQMRKICVMELLN KNVRSFSSIR+DE
Sbjct  49   HDVVFASRPKIVAMDIICYNQSDIAFSPHGDHWRQMRKICVMELLNAKNVRSFSSIRRDE  108

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS S  G+LV F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   
Sbjct  109  VVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEG  168

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCL  79
            FD  D+FP+++ LH +  G K +++ AH KVDAI+E++I EH++ L  G  +G+   + L
Sbjct  169  FDVVDIFPTYKFLH-VLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGEDL  227

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M+  +L+ PI++DNIKA+I
Sbjct  228  IDVLLRLMNDTSLQFPITNDNIKAVI  253



>ref|XP_009606204.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=527

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 149/206 (72%), Gaps = 6/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P L+  KI+ YN +DI F PYGDYWRQMRKIC++ELL+ KNVRSFSS+R+DE
Sbjct  119  HDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSAKNVRSFSSVRRDE  178

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  ++ Y RS+S  G+ V   +R+ L   S+ CRSAFG+ +  ++EF   +K++S L+  
Sbjct  179  VFHMIEYFRSSS--GKPVNVSKRISLFTTSMTCRSAFGQEYKEQDEFARLVKKVSSLMEG  236

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHRE--KLKNGSESGSSDCL  79
            FD AD+FPS + LH +  G K +++ AH ++DAI+ENII EH++    KN +E G  + L
Sbjct  237  FDVADIFPSLKFLH-VLSGMKAKVMDAHHELDAILENIINEHKKIATGKNNNELG-GEGL  294

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M  G L+ PI++DNIKAII
Sbjct  295  IDVLLRLMKEGGLQFPITNDNIKAII  320



>ref|XP_006349766.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=355

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 150/209 (72%), Gaps = 8/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+LV+  II Y  +DI F PYGDYWRQMRK+CV+ELL  KNVRSFSSIR+DE
Sbjct  26   HDLAFASRPKLVSLDIICYKSTDIVFSPYGDYWRQMRKVCVLELLTTKNVRSFSSIRRDE  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAF-GKVFTGREEFMEQLKEISELLG  256
               L+  ++S S  G+ +   ER+    +S+ C++AF  ++    E+F+E L+E+ EL G
Sbjct  86   ASRLVQLIQS-STRGEPINVTERILRYESSMTCKAAFRDQLLKDEEKFIEILRELVELAG  144

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSS  88
             F  AD+FPS ++LH +  G ++RI+K H+ VDAI+E++I +H++ + +G     E G  
Sbjct  145  GFSVADIFPSIKILH-VVSGLRSRILKLHKNVDAIVEDVINKHKKNIASGKKGNGEFGGE  203

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DVL+R M+SG L++PI++DNIKAI+
Sbjct  204  D-LVDVLLRLMESGELKIPITNDNIKAIM  231



>ref|XP_004228511.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=493

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 145/204 (71%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P L+  +I+ YN SDI F PYGDYWRQMRKIC+MELL+ KNV+SFSSIRQDE
Sbjct  95   HDIAFASRPMLIAAEIVCYNGSDIVFSPYGDYWRQMRKICIMELLSAKNVKSFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  ++ + RS+S  G+ V    R+F   +S+ CRSAFGKVF  ++E ++ +K++S L   
Sbjct  155  VLRMIEFFRSSS--GETVNATRRIFQFASSMTCRSAFGKVFKEQDELIQLVKKVSRLTEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G K++I+  H ++DAI+ENII EH    KN  E G  + L+ 
Sbjct  213  FDVADIFPSLKFLHVL-CGMKSKIMDVHHELDAILENIINEH----KNNGELG-GEGLVS  266

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
             L+R M  G L+ PI++DNIKAII
Sbjct  267  TLLRLMKEGGLQFPITNDNIKAII  290



>ref|XP_004249520.2| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=536

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 150/208 (72%), Gaps = 6/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L +  II Y  +DI F PYG+YWRQMRK+CVMELL  KNVRSFSSI  DE
Sbjct  125  HDLAFASRPKLASIDIICYKSTDIVFSPYGEYWRQMRKVCVMELLTAKNVRSFSSILHDE  184

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFG-KVFTGREEFMEQLKEISELLG  256
               L+ +++S++ HG+ +   ER+    +SI C++AFG ++   +E+F++ +K++ EL  
Sbjct  185  ASRLVQFIQSST-HGEPINITERILWYTSSITCKTAFGDQLLKDQEKFIQMVKKLVELAS  243

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---D  85
             F  AD+FPS ++L G+  G ++RI+K H+ VDAI+E++I EH++ L +G +   +   +
Sbjct  244  GFSLADIFPSIKIL-GVLTGARSRILKVHKNVDAIVEDVINEHKKNLASGKKGNGAFGGE  302

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVLIR M SG L++PI++DNIKAI+
Sbjct  303  NLVDVLIRLMGSGELKIPITNDNIKAIM  330



>emb|CDP07887.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 149/210 (71%), Gaps = 9/210 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA + E +T+KI+ YN SDIA CPYGDYWRQMRKIC +ELL+ KNVRSF SIRQDE
Sbjct  94   HDLAFANRAEFLTSKILMYNSSDIACCPYGDYWRQMRKICTLELLSAKNVRSFGSIRQDE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTG-REEFMEQLKEISELLG  256
               LLA V++ +  G+L+   E+++   +S++CR+AFGKV      EF++   E + L  
Sbjct  154  ASHLLASVQALAAAGKLINISEKLYSYTSSMVCRAAFGKVSKDLHREFLQLTSESAPLSS  213

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH-----REKLKNGSESGS  91
            +FD +D+FPS+++LH L    K++++K H K+D ++ NII +H     R  +  G ESG+
Sbjct  214  TFDISDLFPSFKILHPLLSV-KSQLVKIHLKMDKLLGNIIDQHVDNRARTNMATG-ESGN  271

Query  90   SDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
             D LIDVL+R  +SG+L+ PI+++NIKAI+
Sbjct  272  ED-LIDVLLRVKESGDLQFPITNNNIKAIV  300



>ref|XP_009765039.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=501

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 148/206 (72%), Gaps = 6/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P L+  KI+ YN +DI F PYGDYWRQMRKIC++ELL+ KNVRSFSS+R+DE
Sbjct  93   HDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSAKNVRSFSSVRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  ++ + RS+S  G+ V   +R+ +  +S+ CRSAFG+ +  ++EF   +K++S L+  
Sbjct  153  VFRMIEFFRSSS--GKPVNVTKRISVFTSSMTCRSAFGQEYKEQDEFARLVKKVSSLMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHRE--KLKNGSESGSSDCL  79
            FD AD+FPS + LH +  G K +++ AH ++DAI+E II EH++    KN  E G  + L
Sbjct  211  FDIADIFPSLKFLH-VLSGMKAKVMDAHHELDAILEKIINEHKKIATGKNNDELG-GEGL  268

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            IDVL+R M  G L+ PI++DNIKAII
Sbjct  269  IDVLLRLMKEGGLQFPITNDNIKAII  294



>ref|XP_004249519.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=510

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 153/207 (74%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+LV+  II Y  +DIAFC YGDYWRQMRKICV+EL   KNVRSFSSIR++E
Sbjct  99   HDLAFASRPKLVSLDIILYKSTDIAFCSYGDYWRQMRKICVLELFTAKNVRSFSSIRREE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+ ++RS++  G+ +   +++    +SI C++AFG++   +E+F+  ++E++EL G 
Sbjct  159  GSNLVQFIRSST-RGEPINVTKQISWYESSITCKAAFGELLKDQEKFIGIVRELAELTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSDC  82
            F  A++FPS ++LH +  G ++RI+K H  VDAI+E+II +H+  +   K G+ +   + 
Sbjct  218  FSVANIFPSIKILH-VLSGVRSRILKVHENVDAIVEDIISDHKRNIASGKRGNGAFGGED  276

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R M+SG L++PI++DNIKAI+
Sbjct  277  LVDVLLRLMESGALKIPITNDNIKAIM  303



>ref|XP_009612725.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=503

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 150/208 (72%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+LV   II Y+ +DIAF PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +++Y+R+T      V   +++F   +S+ICRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSKMVSYIRTTPNLP--VNLTDKIFWFTSSVICRSALGKICGDQDKLIIFMREIISLAGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD FP+W+++H +  G+K++++KAHRK+D I+EN++ EH++   +G     E G  D
Sbjct  213  FSIADFFPTWKMIHDI-DGSKSKLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++PI+ DNIK+I+
Sbjct  272  -LIDVLLRVRESGEIQIPITDDNIKSIL  298



>ref|XP_006365912.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=512

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 144/208 (69%), Gaps = 6/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D+ FAT+P+ +T  IIFYN SDIA CPYGDYWR MRKICV+ELL+ K V+SF+SIRQ+E
Sbjct  101  QDVRFATRPQSMTGSIIFYNYSDIALCPYGDYWRNMRKICVLELLSAKMVKSFNSIRQEE  160

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ + +++    LV    ++F    S+ CRSAFGKV   +++ +  +KE   L   
Sbjct  161  MSSLVSSIINSTPDESLVNLSNKIFWFTGSVTCRSAFGKVVHDQDKLIMLVKEAVSLSSG  220

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSSD  85
            FD  D+FPS + LHG+  G K+R++KAH KVD I+E +I EH E   NG+    ESG+ D
Sbjct  221  FDLTDLFPSHKWLHGI-SGMKSRLLKAHEKVDVILEKLINEHCENRANGNKGNGESGAED  279

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R M+SG   +PI++ NIKA+I
Sbjct  280  -LIDVLLRVMESGEFGMPITNQNIKAVI  306



>ref|XP_009793271.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 144/204 (71%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P LV  KI+ YNC DIAF PYG+YWRQMRKIC++ELL+ KNV+SF+SIRQDE
Sbjct  93   HDLAFANRPLLVAAKIVSYNCMDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+   G+ V   +R+ L   S+ CRSAFG+ +  ++EF+E +K++S L+  
Sbjct  153  VHRMIEFFRSSP--GKPVNVTKRISLFTNSMTCRSAFGQEYKKQDEFVELVKKVSHLIEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++  H ++DAI+ENII EH+ K          + +I 
Sbjct  211  FDVADIFPSLKFLH-VLTGMKAKVMNIHNEIDAILENIINEHK-KTSKSDGESGGEGIIG  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  269  VLLRLMKEGGLQFPITNDNIKAII  292



>ref|XP_009619866.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P LV  KI+ YN +DI F PYG+YWRQMRKIC++ELL+ KNV+SF+SIRQDE
Sbjct  93   HDLAFASRPLLVAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+   G+ V   +R  L  +S+ CRSAFG+    ++EF+  +K++S L+  
Sbjct  153  VHRMIEFFRSSP--GKPVNVTKRFALFTSSMTCRSAFGQEHKEQDEFVRLVKKVSNLMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD A++FPS   LH +  G K +++  H ++D I+ENII EH++  K   ESG  + ++D
Sbjct  211  FDVANIFPSLNFLH-VLTGMKAKVMNVHHELDEILENIITEHKKVAKTICESG-GEGIVD  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAI+
Sbjct  269  VLLRLMKEGGLQFPITNDNIKAIV  292



>ref|XP_004228509.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=495

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 140/204 (69%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+L+  +I+FY  +DI F PYGDYWRQMRKIC++E L+ KNV+SF+SIRQDE
Sbjct  93   HDLAFAFRPKLLVGEILFYKGTDIVFSPYGDYWRQMRKICLLEFLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+S  G+ +   +R++   +S+ CRS FGKVF  + + ME  KE S  L  
Sbjct  153  VHHMIEFFRSSS--GETINVTKRIYQFSSSMTCRSVFGKVFKEQNKLMELAKEASRFLKG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G K +I+ AH ++DAI+ENII EH    KN  E G    L+ 
Sbjct  211  FDVADIFPSLKFLHVL-CGMKGKIMDAHHELDAILENIINEH----KNNGELGGEGLLV-  264

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
             L+  M  G L+ PI++DNIKAII
Sbjct  265  ALLSLMKEGGLQFPITNDNIKAII  288



>ref|XP_009623937.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 141/206 (68%), Gaps = 7/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             DL FAT+PE ++  IIFYN +DI  CPYG+YWR MRK+CV+ELL+ K V+SF+SIRQ+E
Sbjct  100  QDLRFATRPEFMSGDIIFYNYTDIGTCPYGEYWRNMRKVCVLELLSAKMVKSFNSIRQEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ + ST     L+   ++MF   +S+ CRSAFGKV   +++ +  +K+++ L G 
Sbjct  160  MSSLISSINSTP-DDSLINLSDKMFWFTSSVTCRSAFGKVIHDQDKLIMLVKDVTLLAGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL----KNGSESGSSD  85
            FD AD+FPS + LH +  G K++++K H K+D I+ENII EHR       K   ESG  D
Sbjct  219  FDLADLFPSRKWLHEI-SGLKSKMLKVHTKIDVILENIINEHRNNRTIGKKGNGESGGED  277

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKA  7
             LIDVL+R M+SG L  PI++ NIK 
Sbjct  278  -LIDVLLRVMESGELGTPITNKNIKG  302



>ref|XP_006367730.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=314

 Score =   199 bits (505),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 142/204 (70%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+  +I+FYN +DI F PYGDYWRQMRKIC++ELL+ KNV+SF+SIRQDE
Sbjct  93   HDLAFASRPKLLAAEILFYNGTDIVFSPYGDYWRQMRKICLLELLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  ++ + RS+   G+ V   ++ +   +S+ CR+AFGKV   ++E +  +K+ S L+  
Sbjct  153  VLRMIDFFRSSI--GETVNATKKFYQFSSSMTCRAAFGKVLKEQDELILLVKKASHLMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS +  H L  G K +I+ AH ++DAI+ENII EH    KN  E G  + L+ 
Sbjct  211  FDVADIFPSLKFFH-LLCGMKGKIMDAHHELDAILENIINEH----KNNGELG-GEGLVA  264

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
             L+R M  G  + PI++DNIKAII
Sbjct  265  TLLRLMKEGGFQFPITNDNIKAII  288



>ref|XP_004233564.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 147/208 (71%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FAT+P+LV   I+ Y+ SDIAF PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLVFATRPKLVVADIVHYDSSDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +++ +R T  +   V   +++F   +S+ CRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSKMVSSIR-TMPNNHPVNLTDKIFWFTSSVTCRSALGKICCDQDKLIIFMREIISLAGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD FP+W++LH + GG+K R++KAHRK+D I+EN++ EH++   +G     E G  D
Sbjct  214  FSVADFFPTWKMLHDV-GGSKTRLLKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGED  272

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++PI+ DNIK+I+
Sbjct  273  -LIDVLLRVRESGEVQIPITDDNIKSIL  299



>ref|XP_006361940.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 147/208 (71%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FAT+P+LV   I+ Y+ +DIAF PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLVFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +++ +R T  +   V   +++F   +S+ CRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSKMVSSIR-TMPNNLPVNLTDKIFWFTSSVTCRSALGKICCDQDKLIIFMREIISLAGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD FP+W++LH + GG+K R++KAHRK+D I+EN++ EH++   +G     E G  D
Sbjct  214  FSVADFFPTWKMLHDV-GGSKTRLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGED  272

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++PI+ DNIKAI+
Sbjct  273  -LIDVLLRVRESGEVQIPITDDNIKAIL  299



>ref|XP_006352953.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 145/207 (70%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL+FA +P+LV + I+FY  +DIAF  YGDYW+QMRKIC  ELL+ K V+SFS IRQDE
Sbjct  96   HDLSFAARPKLVASDIVFYRQNDIAFAEYGDYWKQMRKICTSELLSSKIVKSFSLIRQDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H+L+A + S      +V   E++  L +S+ICRSAFGKV+  R+  +  ++E+  LL  
Sbjct  156  VHNLVASICSMP--NVVVNMSEKVLQLTSSVICRSAFGKVWDDRDNLLMIMRELLALLAG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
            FD  D+FPSW++LH +  G +NR++  H K+D I+ENII +H++   NG +  +    + 
Sbjct  214  FDVVDLFPSWKLLHKI-SGKRNRLMNMHYKLDVILENIINDHKQSKANGGKGNNEFEGEN  272

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            LIDVL+R M++  L+ P+++DNIKA+I
Sbjct  273  LIDVLLRVMENDELQFPMTNDNIKAVI  299



>ref|XP_009765480.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=511

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 148/207 (71%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+  +IIFY  +DIAF  YGDYWRQMRK+ V+ELL+ KNVRSF+SIR+DE
Sbjct  100  HDLAFASRPKLLALEIIFYKSTDIAFSAYGDYWRQMRKVAVLELLSAKNVRSFTSIRRDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  +RS S   + +   ER+    +S+ C++AFG++   +++F+  ++E++EL G 
Sbjct  160  ASRLIQIIRS-SPTDEPINVTERILWYESSMTCKAAFGELLKDQKKFILIVRELTELSGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
            F  AD+FPS ++LH L  G K RI+  H++VDAI+E++I EH + L NG     +   + 
Sbjct  219  FSVADIFPSIKILH-LLSGMKGRILNTHKRVDAIVEDVINEHIKNLANGKAGNGALGGED  277

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  +SG L++PI++DNIKA++
Sbjct  278  LVDVLLRLKESGELQIPITNDNIKAVM  304



>gb|ABC69397.1| CYP71D48v1 [Nicotiana tabacum]
Length=504

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 149/208 (72%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+LV   II Y+ +DIAF PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +++ +R+T      V   +++F   +S+ICRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSKMVSSIRTTPNLP--VNLTDKIFWFTSSVICRSALGKICGDQDKLIIFMREIISLAGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD FP+W+++H +  G+K++++KAHRK+D I+EN++ EH++   +G     E G  D
Sbjct  213  FSIADFFPTWKMIHDI-DGSKSKLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++PI+ DNIK+I+
Sbjct  272  -LIDVLLRVRESGEVQIPITDDNIKSIL  298



>ref|XP_006365979.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=521

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 144/209 (69%), Gaps = 7/209 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H+LAFATKP+L +  I  YN  DIAF PYGD WRQMR ICV ELL+ K V+SFSSI++DE
Sbjct  108  HELAFATKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELLSTKMVKSFSSIQKDE  167

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I  LL+ +RST+G   LV   E +     S+ CRSAFGKV+T +++ +  L+++ + LG 
Sbjct  168  IMRLLSSIRSTNG-SHLVNLTELILRYTNSVTCRSAFGKVYTNQDQLINLLRDVLDTLGG  226

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK-----NGSESGSS  88
            FD AD+FPSW++LH +  G K++++K H+KVD  +ENI+ EH +        NG +    
Sbjct  227  FDVADLFPSWKLLHKM-SGVKSKLLKMHKKVDEALENIVNEHIKNRSLGCKGNGEKLVGG  285

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            + L+DVL+R  ++G L+ PI+ D+IKAII
Sbjct  286  EDLVDVLLRVKENGELQFPITSDHIKAII  314



>ref|XP_004249812.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
 ref|XP_010312277.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=511

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 148/207 (71%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++ +++   II Y  +DI FC YGDYWRQMRK+CV+ELL  KNVRSFSSIR+DE
Sbjct  99   HDLAFASRHKILAFDIILYKSTDIGFCSYGDYWRQMRKVCVLELLTTKNVRSFSSIRRDE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+ ++RS++  G+ +   ER+    +SI C++AFG++   +E+F+  L+E +E+ G 
Sbjct  159  ASRLVQFIRSSTC-GEPINVTERISWYQSSITCKTAFGELLKDQEKFLGILREFTEVAGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
            F  AD+FPS ++L  +  G K+RI+K H+ VD I+E++I EH++ L +G +   +   + 
Sbjct  218  FSTADIFPSIKILQ-VLSGLKSRILKFHKNVDVIVEDVINEHKKNLASGKKGNGAFGGEN  276

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  +SG L++PI++DNIKAII
Sbjct  277  LVDVLLRLKESGELKIPITNDNIKAII  303



>ref|XP_006355983.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Solanum 
tuberosum]
Length=514

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 150/210 (71%), Gaps = 9/210 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+ V+  IIFYN  DI F  YGDYWRQMRKIC++ELL+ K V+SFS IRQDE
Sbjct  100  HDLAFADRPQFVSTNIIFYNNKDIVFSQYGDYWRQMRKICMVELLSVKMVKSFSGIRQDE  159

Query  432  IHSLLAYVRSTSGHGQ-LVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLG  256
            + SL++ + ST G    L+   E++F  + S+ CRSAFGK+  G++EF+  +KE+    G
Sbjct  160  LSSLISSICSTRGGATVLINMSEKVFRFINSVTCRSAFGKICKGKDEFITLMKEVLFFAG  219

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHRE-----KLKNGSESGS  91
             FD AD+FPSW++LH +  G K+R++ AH+KVDAI+ENII EH E     K +NG E G 
Sbjct  220  GFDVADLFPSWKLLHNI-SGVKSRLMNAHQKVDAIMENIINEHIENKAIGKKRNG-EFGD  277

Query  90   SDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
             D L+DVL+R  ++  L+ PI++D+IKA+I
Sbjct  278  ED-LVDVLLRIKENSQLQFPITNDHIKAVI  306



>ref|XP_009780029.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 144/204 (71%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P LV  KI+ YN +DIAF PYG+YWRQMRKIC++ELL+ K V+SF+SIRQDE
Sbjct  93   HDLAFANRPLLVAAKIVCYNGTDIAFSPYGNYWRQMRKICLLELLSAKTVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+S  G+ V   +R+ L   S+ CRSAFG+ +  ++EF+E +K++S L+  
Sbjct  153  VHRMIEFFRSSS--GKPVNVTKRIALFTNSMTCRSAFGQEYKKQDEFVELVKKVSHLIEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++  H ++DAI+ENII EH+ K          + +I 
Sbjct  211  FDVADIFPSLKFLH-VLTGMKAKVMNIHNEIDAILENIINEHK-KTSKSDGESGGEGIIG  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  269  VLLRLMKEGGLQFPITNDNIKAII  292



>ref|XP_009770332.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=523

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 145/208 (70%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             DL FAT+PE +   IIFYN +DI  CPYGD+WR MRK+C++ELL+ K V+SF+SIRQ E
Sbjct  114  QDLRFATRPEFMAGDIIFYNYTDIITCPYGDHWRNMRKVCIVELLSAKMVKSFNSIRQAE  173

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ V S      L+   ++MF   +S+ CRSAFGKV   +++ +  +K+IS L   
Sbjct  174  MSSLISSVNSMPD-DSLINLSDKMFWFTSSVTCRSAFGKVIHDQDKLIMLVKDISSLAAG  232

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            FD AD+FPS + LH +  G K++++K H+KVDAI+ENI+ EH+E   NG     E+G  D
Sbjct  233  FDLADMFPSRKWLHKI-TGLKSKMLKVHKKVDAILENILNEHQESRANGKKSNGETGGED  291

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R M+SG L  PI+++NIK++I
Sbjct  292  -LIDVLLRVMESGELGTPITNENIKSVI  318



>ref|XP_004250027.1| PREDICTED: cytochrome P450 71D7 [Solanum lycopersicum]
Length=508

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 145/212 (68%), Gaps = 9/212 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+L+   II YN  DIAF PYGDYW+QMRKI VMELLN KNVRSFSSIR DE
Sbjct  94   HDLAFASRPKLLVMDIITYNSRDIAFSPYGDYWKQMRKISVMELLNAKNVRSFSSIRHDE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS+S  G+ V F ER+    +S++CRSAFGK+   ++ F++ ++++  L   
Sbjct  154  VVHLIDSIRSSSSSGEPVNFSERVLWFASSMLCRSAFGKLPKDQDIFIKLVRQVLRLSNQ  213

Query  252  -FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDC--  82
             FD AD+FPS++ LHGL GG K +I+  H K+D+I+E++I EH++   N   +   D   
Sbjct  214  GFDMADIFPSYKFLHGL-GGLKKKILDVHYKIDSIVEDVINEHKKSFANHKRTSDDDALG  272

Query  81   -----LIDVLIRQMDSGNLRVPISHDNIKAII  1
                 LIDVL+R M   +L+ PI++  IKAII
Sbjct  273  GGDEDLIDVLLRLMKDKSLQFPINNHTIKAII  304



>ref|XP_009623936.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 143/208 (69%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             DL FAT+PE ++  IIFYN +DI  CPYG+YWR MRK+CV+ELL+ K V+SF+SIRQ+E
Sbjct  100  QDLRFATRPEFMSGDIIFYNYTDIGTCPYGEYWRNMRKVCVLELLSAKMVKSFNSIRQEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ + ST     L+   ++MF   +S+ CRSAFGKV   +++ +  +K+++ L G 
Sbjct  160  MSSLISSINSTP-DDSLINLSDKMFWFTSSVTCRSAFGKVIHDQDKLIMLVKDVTLLAGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL----KNGSESGSSD  85
            FD AD+FPS + LH +  G K++++K H K+D I+ENII EHR       K   ESG  D
Sbjct  219  FDLADLFPSRKWLHEI-SGLKSKMLKVHTKIDVILENIINEHRNNRTIGKKGNGESGGED  277

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R M+SG L  PI++ NIK +I
Sbjct  278  -LIDVLLRVMESGELGTPITNKNIKGVI  304



>ref|XP_006350394.1| PREDICTED: cytochrome P450 71D6-like [Solanum tuberosum]
Length=501

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 149/207 (72%), Gaps = 4/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+   II Y+  DIAF PYG+YW+QMRKICVME+L+ K+VRSFSSIR DE
Sbjct  92   HDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVMEVLSAKSVRSFSSIRCDE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++S+S  G+LV   ER+    +S+ CRSAFG+V   ++ F++ ++E+  L   
Sbjct  152  VVRLIDSIQSSSSSGELVNLTERVIWFTSSMTCRSAFGQVPKEQDMFIKLIREVISLAEG  211

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSDC  82
            FD AD+FPS++ LH +FG  K +++  HRKVDAI+E++I EH++     KN   +   + 
Sbjct  212  FDVADIFPSYKFLH-VFGRAKRKLLNVHRKVDAIVEDVINEHKKNFSTRKNDDHALGGED  270

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R M+  +L+ PI++DNIKAII
Sbjct  271  LVDVLLRLMNDKSLQFPINNDNIKAII  297



>gb|AAD47832.1| cytochrome P450 [Nicotiana tabacum]
Length=499

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 142/204 (70%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P LV  KI  YNC DIA  PYG+YWRQMRKIC++ELL+ KNV+SF+SIRQDE
Sbjct  93   HDLAFANRPLLVAAKIFSYNCMDIALSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+   G+ V   +R+ L   S+ CRSAFG+ +  ++EF++ +K++S L+  
Sbjct  153  VHRMIKFFRSSP--GKPVNVTKRISLFTNSMTCRSAFGQEYKEQDEFVQLVKKVSNLIEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++  H ++DAI+ENII EH+ K          + +I 
Sbjct  211  FDVADIFPSLKFLH-VLTGMKAKVMNTHNELDAILENIINEHK-KTSKSDGESGGEGIIG  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAII
Sbjct  269  VLLRLMKEGGLQFPITNDNIKAII  292



>ref|XP_006339045.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 149/207 (72%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+LV+  +I YN +DI F PYGDYWRQMRKIC +EL + KNVRSFSSIR++E
Sbjct  99   HDLAFASRPKLVSLDVICYNSTDIVFSPYGDYWRQMRKICFLELFSAKNVRSFSSIRREE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              SL+ ++ S S  G+ +   ER+    +S  C++AFG++   +E+F+  ++E++EL G 
Sbjct  159  ASSLVQFIGS-SPRGETINVTERISWYESSNTCKAAFGELLKDQEKFIGIVRELAELTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
            F  A++FPS ++LH +  G ++RI+K H+ VD I+E+II EH++ + +G +   +   + 
Sbjct  218  FSVANIFPSIKILH-VLSGLRSRIMKVHKNVDVIVEDIINEHKKNIASGKKGNGAFGGED  276

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  +SG L+ PI++DNIKAI+
Sbjct  277  LVDVLLRLRESGELKTPITNDNIKAIM  303



>gb|ABC69396.1| CYP71D48v2 [Nicotiana tabacum]
Length=503

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+LV   II Y+ +DIA  PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLAFATRPKLVVADIIHYDSTDIALSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +++ +R+T      V   +++F   +S+ICRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSKMVSSIRTTPNLP--VNLTDKIFWFTSSVICRSALGKICGDQDKLIIFMREIISLAGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD FP+W+++H +  G+K++++KAHRK+D I+EN++ EH++   +G     E G  D
Sbjct  213  FSIADFFPTWKMIHDI-DGSKSKLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++PI+ DNIK+I+
Sbjct  272  -LIDVLLRVRESGEVQIPITDDNIKSIL  298



>ref|XP_006339044.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 148/207 (71%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+LV+  IIFY  +DIAF  YG+YWRQMRKICV+EL   KNVRSFSSIR+DE
Sbjct  99   HDLAFASRPKLVSLDIIFYKSTDIAFSSYGEYWRQMRKICVLELFTAKNVRSFSSIRRDE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              SL+ ++RS++  G+ +   E++    +S   R+AFGK+   +E+F+  +KE+ EL   
Sbjct  159  ASSLVQFIRSST-RGEPINVTEQISWYESSNTSRAAFGKLLKDQEKFIGLVKELVELASG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
            F  AD FPS ++LH +  G ++RI+K H+ VDAI+E++I EH++ + +G +   +   + 
Sbjct  218  FSVADFFPSIKILH-VLSGVRSRILKVHKNVDAIVEDVINEHKKNIASGKKGNGAFGGED  276

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  +S  L++PI++DNIKAI+
Sbjct  277  LVDVLLRLKESRELKIPITNDNIKAIM  303



>ref|XP_006341699.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=501

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 140/207 (68%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             DL FAT+P+L+  +II YN SDI  CPYGDYWR MRK+C +ELL+ K VRSF SIRQ E
Sbjct  93   QDLHFATRPQLLFGEIIMYNHSDIGTCPYGDYWRNMRKVCTLELLSTKMVRSFDSIRQAE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ + S      L+   +++F     + CRSAFGK+  G+++ +  LK+I+ L G 
Sbjct  153  MSSLISSINSMP--DSLINLTDKIFWFTGPVTCRSAFGKIIHGQDKLIMLLKDITLLAGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH---REKLKNGSESGSSDC  82
            FD  DVFPS + LHG+  G K++I+K H ++DAI+ENII EH   R   K G+     + 
Sbjct  211  FDLTDVFPSRKWLHGI-CGLKSKILKVHNEMDAILENIINEHCRNRANGKKGNSESEGED  269

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            LIDVL+R M+SG L  PI+++NIKA+I
Sbjct  270  LIDVLLRVMESGELGTPITNNNIKAVI  296



>ref|XP_006365938.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=514

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 140/208 (67%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD AFA +P+L +  IIFYN  DIAF PYGDYWRQMRKIC +EL + K ++ FS+IR+DE
Sbjct  103  HDHAFACRPQLTSTNIIFYNSIDIAFSPYGDYWRQMRKICTLELFSIKMIKLFSAIREDE  162

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ +RS    G  V   +++FL    IICRSAFGKV   R EF+  LKE+  L   
Sbjct  163  LTSLISSIRSM--RGSPVNMTKKIFLFTNCIICRSAFGKVCKDRGEFLTTLKEVLLLAAG  220

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD++PSW++LH L  G K R++ AH+KVDA++E I+ EH E    G     E G  D
Sbjct  221  FFMADLYPSWKLLHNL-RGEKTRMVNAHKKVDAVMEEILNEHIENKAAGKKGNGEFGDED  279

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R  ++  L+ PI++D+IKA+I
Sbjct  280  -LVDVLLRVKENAELQYPITNDHIKAVI  306



>ref|XP_009611155.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 143/204 (70%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P L+  KI+ YN +DI F PYG+YWRQMRKIC++ELL+ KNV+SF+SIRQDE
Sbjct  93   HDLAFASRPLLLAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +H ++ + RS+   G+ V   +R  L  +S+ CRSAFG+    ++EF+  +K++S  +  
Sbjct  153  VHRMIEFFRSSP--GKPVNVTKRFALFTSSMTCRSAFGQEHKEKDEFVRLVKKVSNYMEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G K +++ AH ++D I ENII E ++  K   ES   + ++D
Sbjct  211  FDVADIFPSLKFLH-VVTGLKAKVMDAHHELDEIFENIISERKKVAKTNCES-RGEGIVD  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R M  G L+ PI++DNIKAI+
Sbjct  269  VLLRLMKEGGLQFPITNDNIKAIV  292



>gb|ABC69395.1| CYP71D47v2 [Nicotiana tabacum]
Length=503

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+LV   II Y+ +DIAF PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLAFATRPKLVAADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +L+ +R+T      V   +++F   +S+ CRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSKMLSSIRTTP--NLTVNLTDKIFWFTSSVTCRSALGKICGDQDKLIIFMREIISLAGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD FP+W+++H +  G+K++++KAHRK+D I+ N++ EH++   +G     E G  D
Sbjct  213  FSIADFFPTWKMIHDI-DGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++PI++DNIK+I+
Sbjct  272  -LIDVLLRVRESGEVQIPITNDNIKSIL  298



>gb|ABC69394.1| CYP71D47v1 [Nicotiana tabacum]
Length=503

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+LV   II Y+ +DIAF PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +L+ +R+T      V   +++F   +S+ CRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSKMLSSIRTTP--NLTVNLTDKIFWFTSSVTCRSALGKICGDQDKLIIFMREIISLAGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD FP+W+++H +  G+K++++KAHRK+D I+ N++ EH++   +G     E G  D
Sbjct  213  FSIADFFPTWKMIHDI-DGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++PI++DNIK+I+
Sbjct  272  -LIDVLLRVRESGEVQIPITNDNIKSIL  298



>ref|XP_009623934.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 141/208 (68%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             DL FAT+PE ++  IIFYN +DI  CPYGD+WR MRK+C++ELL+ K V+SF+SIRQ E
Sbjct  100  QDLRFATRPEFMSGDIIFYNYTDIITCPYGDHWRNMRKVCIVELLSAKMVKSFNSIRQAE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ + S      L+   ++MF   +S+ CRSAFGKV   + + +  +K+I+ L   
Sbjct  160  MSSLISSINSMP-DDSLINLSDKMFWFTSSVTCRSAFGKVIHDQHKLIMLVKDIASLAAG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            FD AD+FPS + LH +  G K++++K H KVDAI+ENII EHRE   NG     E+G  D
Sbjct  219  FDLADMFPSRKWLHKI-TGLKSKMLKVHTKVDAILENIINEHRESRTNGKKGNGETGGED  277

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R M+SG L  P++  NIK +I
Sbjct  278  -LIDVLLRVMESGELGTPLTKKNIKGVI  304



>emb|CDP08465.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 152/209 (73%), Gaps = 9/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL+FAT+PEL+  KII Y+  DIAF PYGDYWRQMRKI V+ELL+ K+VRSF +IRQDE
Sbjct  100  HDLSFATRPELLAFKIICYDTKDIAFSPYGDYWRQMRKISVLELLSAKSVRSFENIRQDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGRE-EFMEQLKEISELLG  256
            +  L+  +R  +  G+ V   E++F   +S++CR+AFG+V    + EF++ +K+++ L G
Sbjct  160  VLHLVEAIRPLA--GKKVNLTEQVFSYASSMVCRAAFGQVSKEDQYEFVQLMKQVAALAG  217

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH-REKLKNG---SESGSS  88
             FD AD+FPS+++LH L  G K +++K H K+D+I E +I+EH + + +N    ++S   
Sbjct  218  GFDIADLFPSYKILHVL-TGMKPKLLKIHHKMDSIFEKLIEEHIKNQTRNKKLVADSNQE  276

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D LIDVL+R  DSGNL+ PI+++NIKAII
Sbjct  277  D-LIDVLLRIRDSGNLQFPITNNNIKAII  304



>ref|XP_006341698.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 145/208 (70%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             DL FAT+P+L+  +II YN SDI  CPYGDYWR MRK+C++ELL+ K V+SF SIRQ E
Sbjct  96   QDLNFATRPQLMVGEIIMYNYSDIGTCPYGDYWRSMRKVCILELLSTKMVKSFDSIRQAE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ + S      L+   +++F    S+ CRSAFGK+  G+++ +  +K+I+ L G+
Sbjct  156  MSSLISSINSMP--DSLINLSDKIFWFTGSVTCRSAFGKIINGQDKLIMLIKDITLLAGA  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
             + AD+FPS + LH ++ G K++I+K H++ D I+ENII EH++   NG    SE G  D
Sbjct  214  TELADLFPSRKWLHQIY-GLKSKILKVHKEADVILENIINEHQKNRANGKKGNSEYGGED  272

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R M+SG L  PI+++NIKA+I
Sbjct  273  -LVDVLLRVMESGELGTPITNNNIKAVI  299



>sp|P93530.1|C71D6_SOLCH RecName: Full=Cytochrome P450 71D6 [Solanum chacoense]
 gb|AAB61964.1| putative cytochrome P450 [Solanum chacoense]
Length=501

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 149/207 (72%), Gaps = 4/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA++P+L+   II Y+  DIAF PYG+YW+QMRKICV E+L+ K+VRSFSSIR DE
Sbjct  92   HDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVLSAKSVRSFSSIRCDE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++S+S  G+LV F ER+    +S+ CRSAFG++   ++ F++ ++E+  L   
Sbjct  152  VVRLIDSIQSSSSSGELVNFKERVIWFTSSMTCRSAFGQLPKEQDMFIKLIREVIRLAEG  211

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSDC  82
            FD AD+FPS++ LH +FG  K +++  HRKVDAI+E++I EH++     KN   +   + 
Sbjct  212  FDVADIFPSYKFLH-VFGRAKRKLLNVHRKVDAIVEDVINEHKKNFATRKNDDHALGGEN  270

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            LIDVL++ M+  +L+ PI++DNIKAII
Sbjct  271  LIDVLLKLMNDKSLQFPINNDNIKAII  297



>ref|XP_004242036.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 144/208 (69%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+LV+  IIFYN  D+AF  YGDYWRQMRKIC++ELL+ K V+SFS IRQDE
Sbjct  91   HDLAFADRPQLVSTNIIFYNNKDVAFSQYGDYWRQMRKICIVELLSTKMVKSFSGIRQDE  150

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ +RST   G  +   E++F     + CRSAFGK+   R EF+  LK+I    G 
Sbjct  151  LSSLISSIRST--RGTTINMTEKVFQFTNCVTCRSAFGKICKDRNEFVALLKKILVFAGG  208

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD AD+FPSW++LH +  G K+R++KAH+K+DAI+ENII EH E      K   E G  D
Sbjct  209  FDLADLFPSWKLLHNI-SGVKSRLVKAHQKIDAIMENIINEHIENKVAGKKGNGEFGDED  267

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DV +R  ++  L+ PI+ ++IKA+I
Sbjct  268  -LVDVFLRVKENAELQFPITKEHIKAVI  294



>ref|XP_009608635.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=511

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 145/208 (70%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA + +L ++ IIFYN  DI F  Y DYWRQMRKIC++ELL+ K V+SFS+IRQDE
Sbjct  100  HDLAFANRAQLTSSNIIFYNNKDIVFSQYSDYWRQMRKICILELLSTKMVKSFSAIRQDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ +RS    G  V   E++F L  SI  R+AFG VF  R EFM+ +KE+ EL G 
Sbjct  160  LSSLISSIRSM--RGSPVNLTEKIFQLTNSITGRAAFGNVFKDRHEFMKLMKEVLELAGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSSD  85
            FD AD+FPSW++LH +  G K+R++ AHRKVD I+E+I+ EH E    G+    E G  D
Sbjct  218  FDVADLFPSWKLLHKM-SGVKSRLVNAHRKVDEIMEDILNEHIENKAAGNKGIGEFGGED  276

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DV +R  ++  L+ PI++DNIKA+I
Sbjct  277  -LVDVFLRIKENAELQFPITNDNIKAVI  303



>ref|XP_009766832.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=503

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 147/208 (71%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+LV   II Y+ +DIAF PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +++ +R+T      V   +++F   +S+ CRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSKMVSSIRTTP--NLTVNLTDKIFWFTSSVTCRSALGKICGDQDKLIIFMREIISLAGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F  AD FP+W+++H +  G+K++++KAHRK+D I+ N++ EH++   +G     E G  D
Sbjct  213  FSIADFFPTWKMIHDI-DGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++PI+ DNIK+I+
Sbjct  272  -LIDVLLRVRESGEVQIPITDDNIKSIL  298



>ref|XP_006339046.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 146/207 (71%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++ +L+   II Y  +DIAF PYGDYWRQM K+CV+ELL  KNVRSFSSIR+DE
Sbjct  99   HDLAFASRSKLLALDIICYKSTDIAFSPYGDYWRQMCKVCVLELLTTKNVRSFSSIRRDE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+ ++RS++   + +   ER+    +SI C++AFG++   +E+F+  L+E+ E+ G 
Sbjct  159  ASHLVQFIRSST-RDEPINVTERILWYQSSITCKTAFGELLKDQEKFLGILRELMEVAGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
            F  AD+FPS ++L  +  G K++I+K H+  D I+E++I EH++ + +G +   +   + 
Sbjct  218  FSLADIFPSIKILQ-VLSGLKSKILKVHKNADVIVEDVINEHKKNIASGKKGNGAFGGEN  276

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  +SG L++PI++DNIKAII
Sbjct  277  LVDVLLRLKESGELKIPITNDNIKAII  303



>gb|AAF27282.1|AF122821_1 cytochrome P450 [Capsicum annuum]
Length=502

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 146/208 (70%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+LV   I+ Y+ +DIAF PYG+YWRQ+RKIC++ELL+ K V+ FSSIRQDE
Sbjct  95   HDLAFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  +++ +R+       V   +++F   +S+ CRSA GK+   +++ +  ++EI  L G 
Sbjct  155  LSMMVSSIRTMPNFP--VNLTDKIFWFTSSVTCRSALGKICRDQDKLIIFMREIISLTGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSSD  85
            F  AD FP+W++LH + GG+K R++KAHRK+D I+E+++ EH++   +G     E G  D
Sbjct  213  FSIADFFPTWKMLHDV-GGSKTRLLKAHRKIDEILEHVVNEHKQNRADGQKGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG +++ I+ DNIK+I+
Sbjct  272  -LIDVLLRVRESGEVQISITDDNIKSIL  298



>ref|XP_004241764.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=513

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 140/209 (67%), Gaps = 7/209 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H+LAFATKP+L +  I  YN  DIAF PYGD WRQMR ICV ELL  K V+SFSSIR+DE
Sbjct  100  HELAFATKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELLGTKTVKSFSSIRKDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I  LL+ +RST+G  +LV   E +     S+ CRSAFGKV T +   +  L+++ + LG 
Sbjct  160  ITRLLSSIRSTNG-TRLVNLTELILRYTNSVTCRSAFGKVCTNQHHLINLLRDVLDTLGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK-----NGSESGSS  88
            FD +D+FPSW++LH +  G K+ +++ H+KVD  +ENI+ EH +        NG +    
Sbjct  219  FDVSDLFPSWKLLHKM-SGVKSELLRMHKKVDEALENIVNEHIKNRALGCKGNGDKLIGG  277

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            + L+DVL+R  ++G L+ PI+ D+IKAII
Sbjct  278  EDLVDVLLRIKENGELQFPITSDHIKAII  306



>ref|XP_004243471.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 139/208 (67%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++PE +  KII YNC DIAF PYGDYWR MRK+ V+ELL+ K V+SFS IRQDE
Sbjct  91   HDLAFASRPETMMGKIICYNCKDIAFSPYGDYWRHMRKLTVLELLSAKMVKSFSPIRQDE  150

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +LL+ +RS +     +   E++   M +  CRSAFG V   + E +  + +   L G 
Sbjct  151  LSNLLSSIRSMNLDSP-INLVEKLLWFMNAATCRSAFGNVCKDQRELITLIHQAQSLSGG  209

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F+ AD+FPS + LHG+  G +++++ A  K+D +++NII  HRE   NG     ESG+ D
Sbjct  210  FELADLFPSKKYLHGI-SGMESKLMNARYKIDQVLDNIINVHRENRANGKSCNGESGAED  268

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDV +R M+SG   VP+++DNIKA+I
Sbjct  269  -LIDVFLRVMESGQFPVPLTNDNIKAVI  295



>ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=517

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 142/220 (65%), Gaps = 19/220 (9%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  FA +PE +  KI++YN  DIAF PYGDYWRQMRKIC++ELLN KNVRSFSSIR DE
Sbjct  96   HDPNFADRPEAIAMKIMWYNYIDIAFSPYGDYWRQMRKICIIELLNAKNVRSFSSIRNDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +R +S  G+ V   E++F L +SI CR+AFGKV    +  ++ LKE  ++ G 
Sbjct  156  VSRLIKSIRLSS--GEPVNLTEKIFSLTSSITCRAAFGKVCKDSDALIKLLKEGIQMAGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL-----KNGSESGSS  88
            F+ AD+FPS ++++ L   +K R++   RK+D I+++IIKEH+E L     +NG   G  
Sbjct  214  FEIADLFPSSKIINAL-SWSKLRLVMMRRKLDVILDDIIKEHKENLAKMARENGDGEGKE  272

Query  87   DC-----------LIDVLIRQMDSGNLRVPISHDNIKAII  1
                         L+DV +R  +SG L  PI +DNIKA+I
Sbjct  273  SARRGNGEFGNEDLVDVFLRIQESGELEFPIGNDNIKAVI  312



>ref|XP_004242298.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=348

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 142/209 (68%), Gaps = 10/209 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAF  +P+L +  IIFYN  DIAF  YGDYWRQMRKIC +ELL+ K V+S+ +IR+DE
Sbjct  94   HDLAFVNRPQLTSTSIIFYNNKDIAFSQYGDYWRQMRKICTLELLSTKMVKSYGAIREDE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ +RST G+   +   + +FL   SIICRSAFGK+   REEF+  LKE+  L   
Sbjct  154  LSSLISSIRSTMGNT--INMTQIIFLFSNSIICRSAFGKICKNREEFLTILKEVLLLGAG  211

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHRE-----KLKNGSESGSS  88
            F   D+FPSWR++H L  G K R++ AH KVD ++E I+ EH E     K+ NG E G  
Sbjct  212  FFVGDLFPSWRLIHNL-RGEKTRMVNAHNKVDVVMEEILNEHIENKAAGKMGNG-EFGDE  269

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DV +R  ++  L+ PI+++NIKA+I
Sbjct  270  D-LVDVFLRVKENAELQFPIANENIKAVI  297



>emb|CDP20259.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 142/210 (68%), Gaps = 8/210 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +PE++  KII Y+ S IAFCPYG+YWRQMRKIC +ELL+ K VRSF SIRQDE
Sbjct  97   HDLAFADRPEVLVGKIICYDYSSIAFCPYGEYWRQMRKICTLELLSAKMVRSFGSIRQDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQL-KEISELLG  256
            +  LL+ +R+++G G+ +   E +    +S++CRSAFGK+F  +   + QL KE+     
Sbjct  157  VLHLLSSIRASTGGGKPINLTEEVSSFTSSMVCRSAFGKMFGEKNTILIQLVKEVLSRTS  216

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSS  88
             FD +D+FPS ++LH L    K  ++K H K+D I++NII EH   L  G     ESG  
Sbjct  217  GFDISDLFPSQKILHHL-SWMKPTLLKVHHKIDVILDNIINEHIRNLARGKGGNGESGQE  275

Query  87   DCLIDVLIRQMDS-GNLRVPISHDNIKAII  1
            D LID+L+R  +S G+LR PI++  +KAI+
Sbjct  276  D-LIDILLRIKESGGDLRFPITNKIVKAIM  304



>ref|XP_009606841.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like, partial 
[Nicotiana tomentosiformis]
Length=399

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -3

Query  555  NCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEIHSLLAYVRSTSGHGQLVK  376
            N  DIAF PYGD WRQMRKICVMELLN KNVRSFSSIR+DE+  L+  +RS+S  G+LV 
Sbjct  6    NLXDIAFSPYGDQWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDSIRSSSSSGELVN  65

Query  375  FPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSFDFADVFPSWRVLHGLFGG  196
            F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   FD  D+FPS++ LH +  G
Sbjct  66   FTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEGFDVVDIFPSYKFLH-VLSG  124

Query  195  NKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDCLIDVLIRQMDSGNLRVPISH  22
             K +++ AH KVDAI+E++I EH++ L  G  +G+   + LIDVL+R  +  +L+ PI++
Sbjct  125  MKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGEDLIDVLLRLKNDTSLQFPITN  184

Query  21   DNIKAII  1
            +NIKA+I
Sbjct  185  NNIKAVI  191



>ref|XP_009609826.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Nicotiana 
tomentosiformis]
Length=304

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 142/209 (68%), Gaps = 10/209 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++PE++  KII Y+C DIAF PYGDYWR MRK+  +ELL+ K V+SFS IRQDE
Sbjct  90   HDLAFASRPEIMMGKIICYDCKDIAFSPYGDYWRHMRKLSTLELLSAKMVKSFSPIRQDE  149

Query  432  IHSLLAYVRSTSGHGQL-VKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLG  256
            + SLL+ + S    G L +   E++   M +  CRSAFGKV   ++E +  +++   L G
Sbjct  150  LSSLLSSIESM---GNLPINLVEKLLWFMNAATCRSAFGKVCKDQKELITLIQQAESLSG  206

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSS  88
             F+ AD+FPS + LHG+  G ++++++A  K+D +++NII  HRE   NG+    ESG+ 
Sbjct  207  GFELADLFPSKKFLHGI-SGMRSKLMEARNKIDVVLDNIINVHRENRANGNSCNGESGTV  265

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D  IDV +R M+SG L  PI +DNIKA+I
Sbjct  266  D-FIDVFLRVMESGELPFPIENDNIKAVI  293



>dbj|BAC53923.1| cytochrome P450 [Petunia x hybrida]
Length=502

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 142/208 (68%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+L   +II Y  +DIAF PYG+YWRQ+RKICVMELL+ K V SFSSIR+DE
Sbjct  95   HDLAFATRPKLTFAEIIKYGSTDIAFSPYGEYWRQIRKICVMELLSAKMVNSFSSIREDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + ++++++R        V   E++    +S++CRSA GK+   + + +  ++EI  L  S
Sbjct  155  LSNMISWIRLRPNIP--VNLTEKVKWFTSSVVCRSALGKICKDQNKLIILMREILSLAIS  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
             +FAD FP W+ LH L GG+K R++K H K+D I+++I+ EH++   NG     E G  D
Sbjct  213  VNFADFFPRWKFLHDL-GGSKTRLLKEHHKIDEILQDIVNEHKQNRVNGKMGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG  ++PI+ DNIKA+I
Sbjct  272  -LIDVLLRVRESGQHQLPITDDNIKAVI  298



>ref|XP_009617877.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 146/214 (68%), Gaps = 15/214 (7%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D+AF  +PEL++ KI+ YN SDIAF PYG+YWRQMRK+C +ELL+ KNV+SF+SIR++E
Sbjct  97   QDIAFTNRPELLSVKILCYNYSDIAFAPYGNYWRQMRKLCTLELLSAKNVQSFASIREEE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREE---FMEQLKEISEL  262
               L+ YV+S SG    +   E+++ L  ++ICR+AFGK    +EE   FM  +KE+S +
Sbjct  157  AFDLVEYVKSKSGST--INLTEKLYALTNAVICRAAFGK--RRKEESAYFMSLIKEVSLM  212

Query  261  LGSFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL------KNG-S  103
            +   D ++VFPS + LH +  G K +++K H+K+D +++ II+EH+E L      KNG  
Sbjct  213  VTGLDISEVFPSLKFLHAI-TGTKAKLVKLHKKLDKVLDMIIEEHKENLQLVSLKKNGEE  271

Query  102  ESGSSDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            ES   + L+++L+R  +SG L  P + DNIKA+I
Sbjct  272  ESIRKEDLVNLLLRLQESGTLEFPFTADNIKAVI  305



>ref|XP_009788504.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=321

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 133/209 (64%), Gaps = 7/209 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P   +  I  YNC DIAF PYGD WRQMRKICVMELL  K V+SF SIR+DE
Sbjct  98   HDLAFATRPVFTSINISSYNCKDIAFAPYGDNWRQMRKICVMELLTVKMVKSFCSIRKDE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +RS +G    V   + +     S+ICRSAFG     ++E ++ L E+ E +G 
Sbjct  158  LSRLLSSIRSVNGRSA-VNLTQIVLRFTNSVICRSAFGNACKNQDELIKLLSEVLESVGG  216

Query  252  F-DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSS  88
              D  D  PSW++L     G K+R IK H++ DA +E+II EH +    GS    E G  
Sbjct  217  LVDVGDFIPSWKLLIHKMSGAKSRFIKLHKRADAALEDIINEHIKNRAAGSKGNGEFGGE  276

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DVL+R  D+G L+ PI++D+IKA+I
Sbjct  277  D-LVDVLLRIKDNGELQFPITNDHIKAVI  304



>gb|AAK62343.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=473

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 128/174 (74%), Gaps = 1/174 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P++V   II YN SDIAF PYGD+WRQMRKICVMELLN KNVRSFSSIR+DE
Sbjct  93   HDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +RS S  G+LV F +R+    +S+ CRSAFG+V  G++ F ++++E+  L   
Sbjct  153  VVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDVFAKKIREVIGLAEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS  91
            FD AD+FPS++ LH +  G K +++ AH KVDAI+E++I EH++ L  G  +G+
Sbjct  213  FDVADIFPSYKFLH-VLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATGKTNGA  265



>ref|XP_011081935.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=506

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 141/204 (69%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D A A +PE + +KI++Y+ +DIAF  Y +YWRQMRKIC++ELL+ KNV+SF SIRQDE
Sbjct  104  QDPACADRPESIGSKIMWYDYTDIAFSAYNEYWRQMRKICILELLSAKNVKSFGSIRQDE  163

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++S+S  GQ +   E++F   +SI CR+AFGKV   R+  +  LK+   + G 
Sbjct  164  VSRLMKSLQSSS--GQAINLTEKVFAFTSSITCRAAFGKVMRDRDVLIAMLKKAVTMAGG  221

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ AD+FPS ++LH +   NK ++++  RK+D I++ I++EH  KLK   E G  D ++D
Sbjct  222  FELADLFPSSKLLH-VLSWNKYKLLRMRRKLDTILDAILEEH--KLKQSGEFGGED-IVD  277

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   +G L+ PI++DNIKA+I
Sbjct  278  VLLRMQKTGELQFPITNDNIKAVI  301



>ref|XP_011081934.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=501

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 141/204 (69%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D A A +PE + +KI++Y+ +DIAF  Y +YWRQMRKIC++ELL+ KNV+SF SIRQDE
Sbjct  99   QDPACADRPESIGSKIMWYDYTDIAFSAYNEYWRQMRKICILELLSAKNVKSFGSIRQDE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++S+S  GQ +   E++F   +SI CR+AFGKV   R+  +  LK+   + G 
Sbjct  159  VSRLMKSLQSSS--GQAINLTEKVFAFTSSITCRAAFGKVMRDRDVLIAMLKKAVTMAGG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ AD+FPS ++LH +   NK ++++  RK+D I++ I++EH  KLK   E G  D ++D
Sbjct  217  FELADLFPSSKLLH-VLSWNKYKLLRMRRKLDTILDAILEEH--KLKQSGEFGGED-IVD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   +G L+ PI++DN+KA+I
Sbjct  273  VLLRMQKTGELQFPITNDNVKAVI  296



>ref|XP_009803661.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Nicotiana 
sylvestris]
Length=237

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 142/211 (67%), Gaps = 12/211 (6%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D+AF  +PEL++ KI+ YN SDIAF PYG+YWRQMRK+C  ELL+ KNV+SF+SIR++E
Sbjct  26   QDIAFNYRPELLSVKILCYNYSDIAFAPYGNYWRQMRKLCTFELLSAKNVQSFASIREEE  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFT-GREEFMEQLKEISELLG  256
              +L+ YV+S SG+   +   E+M+ L  ++IC +AFGK    G   FM  +KE S ++ 
Sbjct  86   AFNLVEYVKSKSGYT--INLTEKMYALTNAVICSAAFGKRRKDGSAYFMSLIKEASLMVT  143

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL------KNG-SES  97
              D ++VFPS + LH +  G K +++K H+K+D +++ II+EH+EKL      K+G  ES
Sbjct  144  GLDISEVFPSLKFLHAI-TGTKAKLMKLHKKLDKVLDMIIEEHKEKLQLVSMKKDGEEES  202

Query  96   GSSDCLIDVL-IRQMDSGNLRVPISHDNIKA  7
               + L+++L +R  +S  L +P + DNIKA
Sbjct  203  IRKEDLVNLLYLRLQESDTLELPFTADNIKA  233



>ref|XP_006355212.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=504

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 134/208 (64%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+ + + I+FY   DI+F PYGDYWRQMRK+   ELL+ K ++S++ IR+DE
Sbjct  95   HDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLSNKMLKSYNMIRKDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +R ++G    V   E++    + + CR AFGK+   R+E +  ++EI  L G 
Sbjct  155  LSKLLSSIRLSTGSA--VNITEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D+FPSW++LH +    K R+   H K D I+ENII EH+E     +K  +E G  D
Sbjct  213  FDVCDLFPSWKLLHNM-SNMKARLTNVHHKYDQIMENIINEHKENHAAGIKGNNEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +ID L+R  ++  L+ PI +DN+KA+I
Sbjct  272  -MIDALLRVKENNELQFPIENDNMKAVI  298



>ref|XP_004246079.1| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 132/208 (63%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P+ + + I+FY   DI+F PYGDYWRQMRK+   ELLN K V+S++ IR+DE
Sbjct  95   HDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLNNKMVKSYNMIRKDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +R  +G    V   E++    + + CR AFGK+   R+E +  ++EI  L G 
Sbjct  155  LSKLLSSIRLATGSA--VNITEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D+FPSW++L  +    K R+   H K D I+ENII EH++     +K  +E G  D
Sbjct  213  FDVCDLFPSWKLLQNM-SNMKARLTNVHHKYDQIMENIINEHKQNHAAGIKGNNEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +ID L+R  ++  L+ PI +DN+KA+I
Sbjct  272  -MIDALLRAKENNELQFPIENDNMKAVI  298



>ref|XP_011082249.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=530

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 139/207 (67%), Gaps = 8/207 (4%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D A A +P+ + ++I++YN  DIAF PYG+YWRQMRKIC++ELL+ KNVRSF  IR+DE 
Sbjct  123  DPACADRPQSLASQIMWYNYIDIAFSPYGEYWRQMRKICILELLSVKNVRSFDYIRKDEA  182

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              L+  +R++S  G+ +   ++ FL  ++I CR+AFGKV   RE  +  LKE   L G F
Sbjct  183  SRLVESIRASS--GRPINLTDKTFLFTSAITCRAAFGKVLKDRETLISLLKEAVVLAGGF  240

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL----KNGSESGSSDC  82
            D AD+FPS ++L+ +   NK +++K   K+DAI++ +I EH++ L    K   E GS D 
Sbjct  241  DMADLFPSLKILN-IINWNKYKLLKMRSKMDAILDRLIDEHKDNLATSKKGNGEMGSED-  298

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R   SG    PI+++NIKA++
Sbjct  299  LVDVLLRLKQSGEFEFPIANNNIKAVL  325



>gb|KDP39257.1| hypothetical protein JCGZ_01014 [Jatropha curcas]
Length=485

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 135/206 (66%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L+   II YN +DIAF PY DYWRQ+RKIC++ELL+ K V+SF  IR++E
Sbjct  75   HDIVFAQRPFLLAASIISYNFTDIAFSPYADYWRQLRKICILELLSAKRVQSFRFIREEE  134

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  + S+S  G+   F  ++F L   I  R+ FG+    +EEF+  ++EI+E+ G 
Sbjct  135  VSNLITAISSSS--GKAFNFSRKLFSLTYGIAARATFGEKCEDQEEFIPIVEEITEVAGG  192

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG--SESGSSDCL  79
            F  AD+FPS + LH +  G ++R+I+  ++ D +I NII +HR K K G     G  D L
Sbjct  193  FSLADLFPSVKFLHSI-SGMRSRLIRLQKEADRVIGNIIDDHRAKNKTGKVGGEGQDDDL  251

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+R  + GNL  P++ DNIKA+I
Sbjct  252  VDVLLRLQEHGNLEFPLTTDNIKAVI  277



>ref|XP_004242219.2| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 139/207 (67%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+  +  I+ YN  DIAF  YGDYW+QMRKIC+MELL+ K V+SFSSIR+DE
Sbjct  92   HDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSAKMVKSFSSIRKDE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + S+L+ + S  G  + V   E +    +S+ CR  FGK+   R+E +  +K+   L+G 
Sbjct  152  LSSVLSSIDSVRGCCE-VNMTEIIVRFTSSVTCRLVFGKLCRDRDELINLMKDALFLVGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH---REKLKNGSESGSSDC  82
            FD  D FPSW++L+ +  G K++++K H+KVD+++E I+ EH   RE    G+ +   + 
Sbjct  211  FDIGDFFPSWKLLYKM-SGAKSKLVKMHQKVDSVLERIVNEHIKNREAGIKGNGAHGGED  269

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DV +R  ++  L+ PI++D+IKA+I
Sbjct  270  LVDVFLRIKENDQLQFPITNDHIKAVI  296



>dbj|BAM68819.1| putative cytochrome P450 monooxygenase CYP71AV1 [Artemisia chamaemelifolia]
Length=495

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 138/204 (68%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DIA  PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  99   YDITFAYRPETLTGEIVAYHNTDIALSPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+CR+AFGK    +EEF E  KEI++  G 
Sbjct  159  CWNLVQQIKA-SGSGRPVNLSENVFKLIATILCRAAFGKRIKDQEEFTEIAKEIAKQAGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I N++ EH       + S +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSIHKKLDNLINNLVAEH----TINTSSKANETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     PI+ DN+KAII
Sbjct  273  VLLRLKDSAEF--PITFDNVKAII  294



>emb|CDP07882.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 141/207 (68%), Gaps = 4/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL+FA + E++ +KII YN SDI FCPYGDY RQ+RKIC +ELL+ K V+SF SIRQDE
Sbjct  94   HDLSFANRSEILLSKIIMYNSSDIGFCPYGDYLRQVRKICALELLSAKKVQSFGSIRQDE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTG-REEFMEQLKEISELLG  256
               L+  +R+ +  G+++ F +++     S +CR+AFGKV      +F++ + EI  L  
Sbjct  154  ALHLVKSIRNLADAGEVIHFTDKVHSYTCSTVCRAAFGKVSKDVHSKFLQLMCEIVPLSS  213

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS--SDC  82
            +FD +D+ PS+++LH L    K +++K H K+D ++ NII +H   L+    +G   ++ 
Sbjct  214  TFDISDLLPSFKMLHPLLSV-KRQLVKIHLKMDRLLVNIIDQHTNNLQRNMSTGEYGNED  272

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            LIDVL+R   SG+L++PI++DNIKAI+
Sbjct  273  LIDVLLRVKHSGDLQIPITNDNIKAIV  299



>ref|XP_009622900.1| PREDICTED: cytochrome P450 71D7-like [Nicotiana tomentosiformis]
 gb|ABC69401.1| CYP71D49v2 [Nicotiana tabacum]
Length=505

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 133/208 (64%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P  +++ I+FY   DI+F PYGDYWRQMRKI   ELL+ K ++SFS+IR+DE
Sbjct  95   HDLAFATRPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIRKDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +R  +     V   E++    + + CR AFGK+   R+E +  ++EI  L G 
Sbjct  155  LSKLLSSIRLATA-SSAVNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D+FPSW++LH +    K R+   H K + I+ENII EH+E     +K  +E G  D
Sbjct  214  FDVCDLFPSWKLLHNM-SNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFGGED  272

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +ID L+R  ++  L+ PI +DN+KA+I
Sbjct  273  -MIDALLRVKENNELQFPIENDNMKAVI  299



>gb|ABC69399.1| CYP71D49v1 [Nicotiana tabacum]
Length=505

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 133/208 (64%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P  +++ I+FY   DI+F PYGDYWRQMRKI   ELL+ K ++SFS+IR+DE
Sbjct  95   HDLAFATRPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIRKDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +R  +     V   E++    + + CR AFGK+   R+E +  ++EI  L G 
Sbjct  155  LSKLLSSIRLATA-SSAVNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D+FPSW++LH +    K R+   H K + I+ENII EH+E     +K  +E G  D
Sbjct  214  FDVCDLFPSWKLLHNM-SNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFGGED  272

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +ID L+R  ++  L+ PI +DN+KA+I
Sbjct  273  -MIDALLRVKENNELQFPIENDNMKAVI  299



>dbj|BAM68816.1| putative cytochrome P450 monooxygenase CYP71AV1 [Artemisia schmidtiana]
Length=496

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 139/204 (68%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FAT+P+ +T +II Y+ +DI F PYG+YWRQ+RK+C +ELL+ K V+S+ S+R++E
Sbjct  100  HDITFATRPDTLTGEIIAYHNTDIIFAPYGEYWRQVRKLCTLELLSAKKVKSYKSLREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+CR+AFGK    ++ F E +KE+S+  G 
Sbjct  160  CWNLVQEIKA-SGSGRPVNLSENIFKLIATILCRAAFGKGIKDQKAFTENMKEMSKETGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I N++ EH  K    + S + + L+D
Sbjct  219  FDVADIFPSKKFLHHL-SGKRARLTSIHKKLDNVINNVVAEHTVK----ASSKTEETLLD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS   +  ++ DN+KAII
Sbjct  274  VLLRLKDSAEFQ--LTADNVKAII  295



>sp|D5JBX1.1|GAO_BARSP RecName: Full=Germacrene A oxidase; Short=BsGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Barnadesia spinosa]
 gb|ADF43083.1| germacrene A oxidase [Barnadesia spinosa]
Length=496

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 137/205 (67%), Gaps = 10/205 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVAYHNTDIVLSPYGEYWRQLRKLCTLELLSAKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  VRS SG G  V   E +F L+A+I+ R+AFGK    + EF E +KEI  L G 
Sbjct  152  CWNLVKEVRS-SGSGSPVDLSESIFKLIATILSRAAFGKGIKDQREFTEIVKEILRLTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS-DCLI  76
            FD AD+FPS ++LH L  G + ++   H K+D++I NI+ EH      GS + SS + L+
Sbjct  211  FDVADIFPSKKILHHL-SGKRAKLTNIHNKLDSLINNIVSEH-----PGSRTSSSQESLL  264

Query  75   DVLIRQMDSGNLRVPISHDNIKAII  1
            DVL+R  DS  L  P++ DN+KA+I
Sbjct  265  DVLLRLKDSAEL--PLTSDNVKAVI  287



>ref|XP_006359503.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 135/208 (65%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++   +  KI+ YN +DIAF PYGDYWR MRK+ V+ELL+ K V+SFSSIR DE
Sbjct  95   HDLAFASRSVTMLGKILCYNSTDIAFSPYGDYWRHMRKLSVLELLSAKMVKSFSSIRHDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +LL+ + S  G    +   E++F  M +  CRS FGK    + E +  ++    L   
Sbjct  155  LSNLLSSIDSMVGSP--INLSEKLFWFMNASTCRSTFGKTCKNQNELVTLIQRAMSLSSG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            F+ AD+FPS   LHG+  G +++++KA  KVD +++NII  HRE   NG     ESG+ D
Sbjct  213  FELADLFPSKTFLHGI-SGMESKLMKARNKVDILLDNIINVHRENHTNGKNYNGESGTED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDV +R M+SG  + P+++DNIKA+I
Sbjct  272  -LIDVFLRVMESGEFQFPLTNDNIKAVI  298



>gb|ABC69398.1| CYP71D5v3 [Nicotiana tabacum]
Length=504

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 133/208 (64%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P  +++ I+FY   DI+F P+GDYWRQMRKI   ELL+ K ++S+S IR+DE
Sbjct  95   HDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIRKDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +R  +G    V   E++    + + CR AFGK+   R+E +  ++EI  L G 
Sbjct  155  LSKLLSSIRLETGSA--VNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILTLSGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D+FPSW++LH +    K R+   H K D ++ENII EH+E     +K  +E G  D
Sbjct  213  FDVGDLFPSWKLLHNM-SNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +ID L+R  ++  L+ PI +DN+KA+I
Sbjct  272  -MIDALLRAKENNELQFPIENDNMKAVI  298



>ref|XP_009764618.1| PREDICTED: cytochrome P450 71D7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009764619.1| PREDICTED: cytochrome P450 71D7-like isoform X2 [Nicotiana sylvestris]
Length=504

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 133/208 (64%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P  +++ I+FY   DI+F P+GDYWRQMRKI   ELL+ K ++S+S IR+DE
Sbjct  95   HDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIRKDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +R  +G    V   E++    + + CR AFGK+   R+E +  ++EI  L G 
Sbjct  155  LSKLLSSIRLETGSA--VNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILTLSGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D+FPSW++LH +    K R+   H K D ++ENII EH+E     +K  +E G  D
Sbjct  213  FDVGDLFPSWKLLHNM-SNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +ID L+R  ++  L+ PI +DN+KA+I
Sbjct  272  -MIDALLRAKENNELQFPIENDNMKAVI  298



>gb|ABC69402.1| CYP71D5v2 [Nicotiana tabacum]
Length=504

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 133/208 (64%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P  +++ I+FY   DI+F P+GDYWRQMRKI   ELL+ K ++S+S IR+DE
Sbjct  95   HDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIRKDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +R  +G    V   E++    + + CR AFGK+   R+E +  ++EI  L G 
Sbjct  155  LSKLLSSIRLETGSA--VNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILTLSGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D+FPSW++LH +    K R+   H K D ++ENII EH+E     +K  +E G  D
Sbjct  213  FDVGDLFPSWKLLHNM-SNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +ID L+R  ++  L+ PI +DN+KA+I
Sbjct  272  -MIDALLRAKENNELQFPIENDNMKAVI  298



>emb|CDP07881.1| unnamed protein product [Coffea canephora]
Length=844

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 141/210 (67%), Gaps = 9/210 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++ E++  KI  YNCSD+   PYG+YWRQMRKIC +ELL+ K VRSF S+R+DE
Sbjct  433  HDLAFASRAEILVTKIGRYNCSDVVSSPYGEYWRQMRKICTLELLSAKRVRSFGSVRKDE  492

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFT-GREEFMEQLKEISELLG  256
               L++ +++  G G+ +   E + L  +S++CR+AFGKV    +  F++ +KE   L  
Sbjct  493  AFHLISSIKALVGTGEQINLSELVSLYTSSVLCRAAFGKVSKDDQNAFLQLIKESLLLSS  552

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH-----REKLKNGSESGS  91
            +FDF+D+FPS ++LH L    K++++  H  +D +++ II +H     R KL +G ES  
Sbjct  553  AFDFSDLFPSLKILHPLLSV-KSKMVHVHHMIDMMLDGIIDQHIDDQGRPKLASG-ESYQ  610

Query  90   SDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
             D LIDVL+R  D  NL+VPI+ DNIKA++
Sbjct  611  ED-LIDVLLRVKDGDNLQVPITKDNIKAVL  639


 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 133/209 (64%), Gaps = 7/209 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA + E +  KI+ YNCSDI   PYG+YWRQMRKIC +ELL+ KNVRSF  IR DE
Sbjct  49   HDLDFANRAEFLACKIVCYNCSDIVCAPYGEYWRQMRKICTLELLSTKNVRSFGCIRLDE  108

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGRE-EFMEQLKEISELLG  256
               L++ +++ +  G+L+   + +    +S++  +AF KV    +  F+  L  +  L  
Sbjct  109  AKHLISSIQAHAAAGELINLTDHLSTYTSSMVLTAAFRKVSKVHQMTFLRLLNMVRRLGR  168

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSS  88
            +   +D+FPS+R+LH L    K +++K H+++D I + II EH E LK       ESG+ 
Sbjct  169  AVTVSDLFPSYRILHPL-SRVKPKLMKVHQRIDKIFDTIIAEHVENLKRTKRGMGESGNE  227

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DVL+R  +SG+L  P++++NIKA++
Sbjct  228  D-LVDVLLRVKESGDLTFPVTNNNIKAVL  255



>ref|XP_009794456.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 138/209 (66%), Gaps = 10/209 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++PE++  KII Y+C DIAF PYGDYWR MRK+  +ELL+ K V+SFS IR+DE
Sbjct  90   HDLAFASRPEIMMGKIICYDCKDIAFSPYGDYWRHMRKLSTLELLSAKMVKSFSPIRRDE  149

Query  432  IHSLLAYVRSTSGHGQL-VKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLG  256
            + SLL+ + S    G L +   E++   M +  CRSAFGKV   ++E +  +     L G
Sbjct  150  LSSLLSSIESM---GDLPINLVEKLLWFMNAATCRSAFGKVCKDQKELITLIHRAQSLSG  206

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSS  88
             F+ AD+FPS + LHG+  G ++++++A  K+D +++NII  HRE   NG     ESG+ 
Sbjct  207  GFELADLFPSKKFLHGI-SGMRSKLMEARNKIDVVLDNIINVHRENRANGKCCNGESGAE  265

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D  IDV  R M+SG L  P+ +DNIKA+I
Sbjct  266  D-FIDVFQRVMESGELPFPLENDNIKAVI  293



>ref|XP_006345633.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 137/204 (67%), Gaps = 5/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA +P+L   KI+FY+C DIAF PYGDYW+Q+RKICVMELL+ KN+ SF  +  DE
Sbjct  97   HDLTFANRPQLSVAKIMFYDCQDIAFSPYGDYWKQIRKICVMELLSTKNITSFFPMMVDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
             + L+  +++ S     +   E+M+LL ++IICR++ G+    +E  +  +K+++   G 
Sbjct  157  TYLLVNSIKAMSERP--INISEKMYLLTSAIICRASIGRTCKDQESVIMLMKQVASFAGV  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+  D+FPS ++LH + G N+ ++++ HRKVD ++E II EH E  +  +E    D L+D
Sbjct  215  FNVVDLFPSLKILHFISGTNR-KLLQLHRKVDPVLERIINEH-ETEQLATEHVGED-LVD  271

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  ++   ++PI+ +NIKAII
Sbjct  272  VLLRLQNNNEFQIPITRNNIKAII  295



>emb|CDP18841.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 135/209 (65%), Gaps = 8/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  F  +PE++  KII Y+ S IAF  YGDYWRQMRKIC ME+L+ K+VRSF SIRQDE
Sbjct  97   HDHVFVDRPEILVGKIICYDSSSIAFSQYGDYWRQMRKICAMEVLSAKSVRSFGSIRQDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L++ +R ++  GQ +   E +    +S+ICR+A GKVF  R   +E +KE+      
Sbjct  157  VLHLISSIRGSTIGGQPINLTEEISSFTSSMICRAACGKVFRERITLIELMKEVLSRTSG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH-----REKLKNGSESGSS  88
            FD +D+FPS ++LH L    K  + K H K+D I+E++I EH     R K  NG E G  
Sbjct  217  FDISDLFPSKKILHHL-SSMKPTLQKLHHKIDVILESVINEHIENLARSKTVNG-EFGQE  274

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D LIDVL+R  +SG+L+ PI++  IKAI+
Sbjct  275  D-LIDVLLRIKESGDLQFPITNKTIKAIM  302



>gb|AJD25162.1| cytochrome P450 CYP71D374 [Salvia miltiorrhiza]
Length=502

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 135/204 (66%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D A A +PE + +KI++Y+ +DIAF  Y +YWRQMRKIC++ELL+ KNV+SF  IR+DE
Sbjct  100  QDPACADRPESIASKILWYDYTDIAFSAYNEYWRQMRKICIVELLSSKNVKSFGHIRRDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  +  +SG+   +   +++F   ++I CR+AFGKV T R+  +   KE   + G 
Sbjct  160  SSRLMKSLECSSGNA--IDLTDKIFTFTSTITCRAAFGKVMTDRDGLIALFKEAVAMAGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ AD+FPSW++L+ +   +K R+ +   K+DAI++ II EH  KLK   E G  D ++D
Sbjct  218  FELADLFPSWKLLN-VLSWSKYRLWRMRGKLDAILDGIIDEH--KLKQSGEFGGED-IVD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VLIR   +G L+ PI+ DNIKA+I
Sbjct  274  VLIRMQQTGELKFPITTDNIKAVI  297



>ref|XP_006341719.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 131/204 (64%), Gaps = 2/204 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA +P+++   II YN + I F PYGD+WRQ+RKICV ELLN K V+SF S+RQ+E
Sbjct  97   HDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLNVKRVQSFESLRQEE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  + S +  G  +   + +F L  +II R+AFG+    ++EF+  L++I +L G 
Sbjct  157  VKDLIKTI-SLNPAGTTINLSQMIFTLTNNIIARAAFGRKLENQDEFIATLRKIVDLAGG  215

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD  D FPS + LH L G  K  + K H ++D I+E++++EH+   K        + L+D
Sbjct  216  FDLPDTFPSLKFLHPLTGA-KAAMEKIHHQIDKILESVLQEHKAARKLAINREDKEDLVD  274

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  +SG+L VPI+ D IKA+I
Sbjct  275  VLLRVQESGDLEVPITTDTIKAVI  298



>ref|XP_009765945.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=359

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 136/208 (65%), Gaps = 12/208 (6%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H+ AFA KP+L +  II YN  DI F PYGD WRQMR +CV ELL+ K V+SFSSIR DE
Sbjct  95   HEHAFAVKPQLTSINIITYNGKDIEFAPYGDNWRQMRNLCVTELLSAKMVKSFSSIRNDE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I SL++ V S   +G +    E++     S+ CRSAFGKV   +++ +  L+E+ + L  
Sbjct  155  ILSLVSSVHSM--NGSVANITEKILRFTNSVSCRSAFGKVDKYQDKLINLLREVLDSLEG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
             D AD+FPSWR+L+ +  G K+R++K H+KVDA +ENII EH  K     K   E G  D
Sbjct  213  LDVADLFPSWRLLYKM-SGVKSRLLKLHQKVDAALENIINEHIMKRALGCKGNGEFGGED  271

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R  ++    +PI++D+IKA+I
Sbjct  272  -LVDVLLRIKET----IPITNDHIKAVI  294



>gb|ABC69400.1| CYP71D49v3 [Nicotiana tabacum]
Length=505

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFAT+P  +++ I+FY   DI+F PYGDYWRQMRKI   ELL+ K ++SFS+IR+D 
Sbjct  95   HDLAFATRPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIRKDG  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL+ +R  +     V   E++    + + CR AFGK+   R+E +  ++EI  L G 
Sbjct  155  LSKLLSSIRLATA-SSAVNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D+FPSW++LH +    K R+   H K + I+ENII EH+E     +K  +E G  D
Sbjct  214  FDVCDLFPSWKLLHNM-SNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFGGED  272

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +ID L+R  ++  L+ PI +DN+KA+I
Sbjct  273  -MIDALLRVKENNELQFPIENDNMKAVI  299



>gb|AGN04217.1| cytochrome P450 [Salvia miltiorrhiza]
Length=502

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 135/204 (66%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D A A +PE + +KI++Y+ +DIAF  Y +YWRQMRKIC++ELL+ KNV+SF  IR+DE
Sbjct  100  QDPACADRPESIASKILWYDYTDIAFSAYNEYWRQMRKICIVELLSSKNVKSFGHIRRDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  +  +SG+   +   +++F   ++I CR+AFGKV T R+  +   KE   + G 
Sbjct  160  SSRLMKNLECSSGNA--IDLTDKIFTFTSTITCRAAFGKVMTDRDGLIALFKEAVAMAGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ AD+FPSW++L+ +   +K R+ +   K+DAI++ II EH  KLK   E G  D ++D
Sbjct  218  FELADLFPSWKLLN-VLSWSKYRLWRMRGKLDAILDGIIDEH--KLKQSGEFGGED-IVD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VLIR   +G L+ PI+ DNIKA+I
Sbjct  274  VLIRMQQTGELKFPITTDNIKAVI  297



>ref|XP_009619325.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 138/208 (66%), Gaps = 10/208 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+L ++ IIFYN  D+ F  YGDYWRQMRKIC++ELL+ K V+SFS IR+ E
Sbjct  101  HDLAFANRPQLTSSTIIFYNNIDMVFSQYGDYWRQMRKICIVELLSSKMVKSFSGIREKE  160

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL++ +RS +     V   E++F+   S+ CRSAFGK+   R EF   LKE+  L G 
Sbjct  161  LSSLISSIRSMTE----VNITEKIFMFTNSVTCRSAFGKICKDRGEFRTLLKEVLLLAGG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSSD  85
            F  AD+FP W++LH L  G ++R++ AHRKVD I+ENII EH      G+    E G  D
Sbjct  217  FFVADLFPCWKLLHNL-SGMESRLVNAHRKVDEIMENIINEHIANRAAGNKRNGEFGDED  275

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DV +R  +   L  PI++D+IKA++
Sbjct  276  -LVDVFLRIKEKDQLHFPITNDHIKAML  302



>emb|CDP07879.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 139/210 (66%), Gaps = 9/210 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA + E ++ KI+ Y+CSDIA C YGDYWRQMRKIC +ELL+ K+VRSF S+RQDE
Sbjct  94   HDLAFADRAEFLSGKIMCYDCSDIACCRYGDYWRQMRKICTLELLSAKSVRSFVSVRQDE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFT-GREEFMEQLKEISELLG  256
               L++ ++  +G  + +   E++    +S++CR+AFGKV       F++ +KE   +  
Sbjct  154  ALHLISSIKVLAGAREPIDLTEKVSSYTSSVVCRAAFGKVSKDDHAAFLQLMKEALPIAS  213

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH-----REKLKNGSESGS  91
            +FD +D+ PS+++LH L    +++++K H K D I+E II +H     R  +  G E G 
Sbjct  214  AFDISDLLPSFKILHPLL-SVESKLLKMHDKEDEILEKIIDQHIDNQARRNISTG-EYGQ  271

Query  90   SDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
             D LIDVL+R  +SG L+ PI+ +NIKA+I
Sbjct  272  ED-LIDVLLRVKESGELQFPITKNNIKAVI  300



>ref|XP_006367128.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=434

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 136/209 (65%), Gaps = 8/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++ + +  KI  Y+C+DIAF PYG+YWR MRK+C+MELL+GK V+SFS IR DE
Sbjct  26   HDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIMELLSGKMVKSFSPIRLDE  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQL-KEISELLG  256
            + SL++ ++S       +   E++F  M S+ CRS+FGK    + E M  L   +  L G
Sbjct  86   LSSLVSSIKSM--ENTPINVSEKLFWFMNSVTCRSSFGKACKDQNEAMISLIHGVLSLAG  143

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSS  88
             F+ AD++PS + L G+  G  +++I+A  KVD +++ +I  HRE   NG    +E GS+
Sbjct  144  GFELADLYPSKKFLSGI-SGMGSKLIEARNKVDTVLDKVIDVHRENHANGKKCNAECGSN  202

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            + LIDV  R M +G L   ++++NIKA+I
Sbjct  203  EDLIDVFFRVMGTGELPFTLTNNNIKAVI  231



>ref|XP_003611883.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94841.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 136/210 (65%), Gaps = 8/210 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L  + I+ Y   DIAF PYGDYWRQMRKIC++ELL+ K V+SFS IR+DE
Sbjct  97   HDVIFANRPHLQASHIMTYGSKDIAFSPYGDYWRQMRKICMLELLSNKRVQSFSYIREDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              + +  ++S+ G    V    R+F L++S + RSAFG     ++EF+  +++  E +G 
Sbjct  157  TRNFIKSIQSSEGSS--VNLTNRIFSLVSSTVSRSAFGDKTEDQDEFVSVIRKAIESVGG  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS-----  88
             + AD+FPS + +  +  G K++++K H+K D I+E I+++H+EK +   E   S     
Sbjct  215  LEPADLFPSMKSIIQMLTGTKSKVLKMHKKADKILEIIVRKHQEKQRRAKEGKVSSDEVE  274

Query  87   -DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
             + L+DVL+R  +SG+L +PI+  NIKA+I
Sbjct  275  QEDLVDVLLRIQESGSLEIPITTSNIKAVI  304



>ref|XP_011073878.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=519

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 139/219 (63%), Gaps = 20/219 (9%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D  FA +PE V  KI++Y+  DIAF PY +YWRQMRKIC++ELL+ KNVRSF SIR DEI
Sbjct  100  DPMFADRPESVAAKIMWYDYVDIAFSPYNEYWRQMRKICIVELLSAKNVRSFGSIRNDEI  159

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              L+  +RS++  G ++   ER+F L +SI CR+A+GKV   R+  ++ + +     G F
Sbjct  160  ALLMQTIRSSA--GSVIDLTERIFKLTSSITCRAAYGKVCRDRDALIKLMNDSIVFAGGF  217

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---------------  115
              AD+FPS ++L+ +   NK R+++  RK+D I+++II EH+  L               
Sbjct  218  MLADLFPSSKLLN-VLSWNKMRLVRMRRKLDVILDDIINEHKVNLARIRSTEVSEKGDVT  276

Query  114  -KNGSESGSSDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
             +   E G+ D L+DVL+R   SG L+ PI++DNIKA+I
Sbjct  277  RRGNGELGNED-LVDVLLRLQGSGELKFPIANDNIKAVI  314



>emb|CDP07872.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 140/208 (67%), Gaps = 5/208 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA + E +  KI+ YNCSDIA CPYGDYWRQMRKIC +ELL+ K+VRS  SIRQ+E
Sbjct  94   HDLAFANRGETLAGKIMLYNCSDIACCPYGDYWRQMRKICTLELLSSKSVRSCGSIRQEE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGRE-EFMEQLKEISELLG  256
               L++ +++ +  G+ +   E+M    ++++ R+AFGKV       F + +KE S +  
Sbjct  154  ALHLVSSIKALANAGKSIDVTEKMSSYASAVLYRAAFGKVSNDDHFAFFQLIKESSSIAS  213

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL-KNGSESGSSDC-  82
            +FD +D+ PS+++LH  F   KN+++    K+D +++ II +H + L +    +G+SD  
Sbjct  214  AFDVSDLLPSFKILHP-FLSVKNKMLNIRYKLDKVLDKIIDQHMDNLARTKIATGASDNE  272

Query  81   -LIDVLIRQMDSGNLRVPISHDNIKAII  1
             +IDVL+R  +SG L++P++ DNIKA++
Sbjct  273  DIIDVLLRVKESGELQIPLTKDNIKAVL  300



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 133/207 (64%), Gaps = 5/207 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA +P+++   II YN + I F PYGD+WRQ+RKICV ELLN K V+SF SIRQ+E
Sbjct  97   HDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLNVKRVQSFESIRQEE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  + S++  G  +   + +F L  +II R+AFG+    ++EF+  L++I +L G 
Sbjct  157  VEDLIKTI-SSNPSGTTINLSQMIFTLTNNIIARAAFGRKLENQDEFIGTLRKIVDLAGG  215

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK---NGSESGSSDC  82
            FD  D FPS + LH L G  K  + K H ++D I+E++++EH+   K   N  +    + 
Sbjct  216  FDLPDTFPSLKFLHPLTGA-KAAMEKIHHQIDKILESVLQEHKAARKVTINHKDKMHKED  274

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  +S +L VPI+ D IKA+I
Sbjct  275  LVDVLLRVQESSDLDVPITTDTIKAVI  301



>ref|XP_006365962.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=504

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 136/208 (65%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++P+  +  I+ YN  DIAF  YGDYW+QMRKIC+MELL+ K V+SFSSIR+DE
Sbjct  92   HDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSAKMVKSFSSIRKDE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + S+L+ + S  G  + V   E++    +S+ CR  FGK+   R+E +  +K+   L+G 
Sbjct  152  LSSVLSSMDSVGGSCE-VNMTEKIVRFTSSVTCRLVFGKLCRDRDELINLMKDALFLVGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK----LKNGSESGSSD  85
            FD  D FPSW++L+ +  G K++++K H+ +D ++E I+ EH +     +K     G  D
Sbjct  211  FDVGDFFPSWKLLYKM-SGAKSKLVKMHQNIDLVLERIVNEHIKNRVAGIKGNGAYGGED  269

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+D+ +R  ++  L+ PI +D+IKA+I
Sbjct  270  -LVDIFLRIKENDQLQFPIINDHIKAVI  296



>gb|EYU21988.1| hypothetical protein MIMGU_mgv1a004711mg [Erythranthe guttata]
Length=513

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 142/216 (66%), Gaps = 13/216 (6%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD +FA +P  V  +I++Y+ ++IAF PYG+YWRQMRKICV+ELL+ K+VRSF+SIR+DE
Sbjct  97   HDPSFADRPRSVGIEIMWYDYTNIAFSPYGNYWRQMRKICVIELLSPKSVRSFASIRKDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +R  +  G+ +   +++F LM+SI CR+AFGKV    E  ++ LKE  E+   
Sbjct  157  VSGLVDSLRRCAASGEPINLTDKIFSLMSSITCRAAFGKVSKDNEALIKLLKEGIEMASG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL------------KN  109
            F+ +D+FP  ++++ L  G + +++K  RK+D I+++II EH+  L            K 
Sbjct  217  FEISDLFPGSKIINALSKG-RFKLLKMRRKLDEILDSIIDEHKANLAKMATENAESAVKR  275

Query  108  GSESGSSDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            G+    ++ L+DV +R  ++G L  PI ++NIKA++
Sbjct  276  GNGDDGNEDLVDVFLRIQENGELEFPIGNNNIKAVL  311



>sp|D5JBW9.1|GAO_SAUCO RecName: Full=Germacrene A oxidase; Short=SlGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Saussurea costus]
 gb|ADF43081.1| germacrene A oxidase [Saussurea costus]
Length=488

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 135/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +PE +T +II Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  92   HDITFANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  V+  SG G+ V   E +F ++A+I+ R+AFGK    ++EF E +KEI    G 
Sbjct  152  CWNLVQEVKE-SGSGRPVDLSENIFKMIATILSRAAFGKGIKDQKEFTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I NI+ EH       + S S++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSIHKKLDNLINNIVAEH----PGNNSSKSNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            V++R  DS  +  P++ DN+KAII
Sbjct  266  VMLRLKDS--VEFPLTADNVKAII  287



>gb|EYU31465.1| hypothetical protein MIMGU_mgv1a004885mg [Erythranthe guttata]
Length=506

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 136/204 (67%), Gaps = 5/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D   A +PE +  KI++Y+ +D+AF PY +YWRQMR+ICV+ELL+ KNV+SF SIRQDE
Sbjct  102  QDPGCAGRPESIALKIMWYDYTDLAFSPYNEYWRQMRRICVVELLSAKNVKSFGSIRQDE  161

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++   G G+ +   E++F +++SI CR+ FG+V   R+  +  +KE   + G 
Sbjct  162  VSILIKSIKKLCG-GEPINLTEKVFGMISSITCRAVFGEVLKDRDSLVYLMKEGLSMAGG  220

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F   D+FPSW++L+ L   N N++ +  RKVD +++ +++EHR  L    E G  D ++D
Sbjct  221  FQLVDLFPSWKLLNILSWSN-NKLWRMRRKVDLVLDALLEEHR--LNKSGEFGGED-IVD  276

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VLIR   +G L+ PI++DNIKA+I
Sbjct  277  VLIRVQRNGELQFPITNDNIKAVI  300



>emb|CDP10756.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 132/209 (63%), Gaps = 10/209 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +PE + +KI+ Y+  DIAF PYGDYW+QMRKIC++ELL+ K+VRSF ++R+DE
Sbjct  98   HDIIFADRPEFLASKILGYDNLDIAFSPYGDYWKQMRKICLLELLSPKSVRSFGTLREDE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
                L  +RS       V   ++ F     I+CR+AFGK F  ++  +  +       G 
Sbjct  158  A---LKVIRSIKSSNSPVNITDKAFTFTNDIVCRAAFGKSFAHQDRLITLINGAISASGG  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKN-----GSESGSS  88
            FD AD+FPS + LH L  G K ++IK H ++D ++E II E ++K  N     GS+S   
Sbjct  215  FDIADLFPSLKFLHSL-SGLKPKLIKLHNEIDQMLETIISERKQKRANQSTPVGSQSEVE  273

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DVL+R  +SG+  +PIS D++KA+I
Sbjct  274  D-LVDVLLRLKESGDFNIPISTDSVKAVI  301



>ref|XP_009587552.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 137/208 (66%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+  +  I+ YN  DIAF  YGDYW+QMRKIC+MELL+ + V+SFSSIR+DE
Sbjct  102  HDLAFANRPQFTSTYIVMYNNKDIAFSEYGDYWKQMRKICIMELLSARMVKSFSSIRKDE  161

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I +LL+ V S  G  + V   E++      + CR  FGK+   RE  ++ +K++  L G 
Sbjct  162  ISNLLSSVHSVKGTSE-VNMTEKIVRYACFVTCRLVFGKLGKDREVLIDLMKKMLLLAGG  220

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH-REKL---KNGSESGSSD  85
             D  D+FPSW++L+ + G  K+R++K H+ VD+++ENI+ EH R +    K   E G  D
Sbjct  221  -DVCDLFPSWKLLYKMTGA-KSRLVKMHQVVDSVLENIVNEHIRSRAAGNKGNGEYGGED  278

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DV +R  ++  L+ PI++D+IKA+I
Sbjct  279  -LVDVFLRIQENDQLQFPITNDHIKAVI  305



>ref|XP_011082254.1| PREDICTED: premnaspirodiene oxygenase [Sesamum indicum]
Length=524

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 135/204 (66%), Gaps = 7/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D  FA +P  +  +I+ YN  DI F PYGDYWRQMRKIC+MELL+ K+VRSF SIR DE
Sbjct  97   QDPVFANRPPAIAMQIMGYNYKDIGFSPYGDYWRQMRKICIMELLSSKSVRSFGSIRNDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SL+ ++++++  G+ V   +++F +M SI CR++FG V    +  ++ L++  ++ G 
Sbjct  157  VSSLVKFIQASA--GKPVNLTDKIFWMMNSITCRASFGTVCKDNDALIKLLRDGMQMAGG  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ ADVFPS +++  L    K R++   RK+D I+++II EH+  L    +  + + L+D
Sbjct  215  FEIADVFPSSKIVSAL-SWTKWRLVMMGRKLDMILDDIINEHKVNL----DKLARENLVD  269

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            V +R  +SG+L  PI +DNIKAI+
Sbjct  270  VFLRLKESGDLEFPIGNDNIKAIL  293



>emb|CDP10758.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 137/209 (66%), Gaps = 10/209 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD++FA +PE +++KI+ Y+  DIAF PYGDYW+QMRKIC++ELL+ K+VRSF ++R+DE
Sbjct  98   HDISFADRPEFLSSKILGYDNLDIAFSPYGDYWKQMRKICLLELLSPKSVRSFGTLREDE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               ++  ++S++     V   ++ F     I+CR+AFGK F  ++  +  +       G 
Sbjct  158  ASKVIRSIKSSNSP---VNITDKAFTFTNDIVCRAAFGKSFAHQDRLITLINGAILASGG  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKN-----GSESGSS  88
            FD AD+FPS + LH L  G K  ++K H ++D ++ENII E ++K  N     GS+S   
Sbjct  215  FDIADLFPSLKFLHSL-SGLKPTLLKLHHEIDQMLENIISERKQKRANQSIPVGSQSEVE  273

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DVL+R  +SG+  +PIS D++KA+I
Sbjct  274  D-LVDVLLRLKESGDFNIPISTDSVKAVI  301



>ref|XP_003611886.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94844.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 138/208 (66%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD AFA +P+L++ +I+ Y   DI F PYGD+WRQMRKICV ELL+ K V+SFS IR+DE
Sbjct  97   HDAAFANRPKLLSPEIMAYGSKDIVFSPYGDFWRQMRKICVFELLSAKRVQSFSYIREDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  ++S++  G  +    R+F +++S I R+AFG     ++EF++ ++++ E+   
Sbjct  157  TKKLIQSIQSST--GSTINLTSRIFSMVSSNISRAAFGDKSKDQDEFVDLVRKVVEMSSG  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDC---  82
            F   D+FPS + LH +  G K ++ K H++VD IIENII++H+EK +   E  +++    
Sbjct  215  FGVDDLFPSIKPLH-ILSGMKPKLEKIHKRVDKIIENIIRQHQEKRERAKEDDNNEVDNE  273

Query  81   -LIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R   S NL + I+ +NIKA+I
Sbjct  274  DLLDVLLRVQQSDNLDIKITTNNIKAVI  301



>gb|AHN62855.1| germacrene A oxidase [Tanacetum parthenium]
Length=488

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 136/204 (67%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++EF E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGRPVNLSENIFKLIATILSRAAFGKGIKDQKEFTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I N++ EH  K    + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSIHQKLDNLINNLVAEHTVK----TSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  266  VLLRLKDSAEF--PLTADNVKAII  287



>dbj|BAM68812.1| cytochrome P450 monooxygenase CYP71AV10 [Artemisia campestris]
Length=495

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 137/204 (67%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ F  +PE ++ +I+ Y+ +DI F PYG+YWRQ+RK+C ++LL+ K V+S+ S+R++E
Sbjct  99   YDITFPNRPETLSGEIVAYHNTDIVFAPYGEYWRQVRKLCTLDLLSVKKVKSYQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F+L+A+I+CRSAFGK    ++EF E +KE+    G 
Sbjct  159  CWNLVQEIKA-SGSGRPVNLSENIFMLIATILCRSAFGKGIKDQKEFTENMKEMLRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I NI+ EH  K    + S + + L+D
Sbjct  218  FDVADIFPSKKFLHYL-SGKRARLTSIHKKLDNLINNIVAEHTVK----TASKTKETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS   +  ++ DN+KAII
Sbjct  273  VLLRVKDSTEFQ--LTADNVKAII  294



>sp|D5JBW8.1|GAO_CICIN RecName: Full=Germacrene A oxidase; Short=CiGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Cichorium intybus]
 gb|ADF43080.1| germacrene A oxidase [Cichorium intybus]
Length=488

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +II Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF SIR++E
Sbjct  92   YDITFANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSIREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  V+  SG G+ +   E +F ++A+I+ R+AFGK    + EF E +KEI    G 
Sbjct  152  CWNLVKEVKE-SGSGKPISLSESIFKMIATILSRAAFGKGIKDQREFTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I NI+ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSIHKKLDTLINNIVAEHHV----STSSKANETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  266  VLLRLKDSAEF--PLTADNVKAII  287



>sp|D5J9U8.1|GAO_LACSA RecName: Full=Germacrene A oxidase; Short=LsGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Lactuca sativa]
 gb|ADF32078.1| germacrene A oxidase [Lactuca sativa]
Length=488

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +II Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF SIR++E
Sbjct  92   YDITFANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSIREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  V+  SG G+ +   E +F ++A+I+ R+AFGK    + EF E +KEI    G 
Sbjct  152  CWNLVKEVKE-SGSGKPINLSESIFTMIATILSRAAFGKGIKDQREFTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I NI+ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSIHKKLDNLINNIVAEHHV----STSSKANETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  266  VLLRLKDSAEF--PLTADNVKAII  287



>ref|XP_006357930.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=498

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 140/209 (67%), Gaps = 9/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+  +  IIFYN  DI F PY +Y +QMRKIC ++L + K V+SFS+IR+DE
Sbjct  93   HDLAFADRPQSTSTTIIFYNNKDIVFSPYDNYCKQMRKICKVQLFSAKMVKSFSTIRKDE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I SL++ +RST      +   E++F    S+ C +AFGK+F  R+EF++ LK+I  L   
Sbjct  153  ISSLISSIRST--RDSPINMTEKIFWFTNSVTCSAAFGKMFKDRDEFIKLLKDILILASG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKN-----GSESGSS  88
            F   D+FPSW++LH L  G ++R++ AH+KVD I+E+I+KEH E   N     G + G  
Sbjct  211  FCVTDLFPSWKLLHKL-SGAESRLMNAHKKVDEIMEDILKEHLENKANRNKGIGDQFGGE  269

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DVL++ M+   L  PI++D+IKA+I
Sbjct  270  D-LVDVLLKVMEDAELECPITNDHIKAVI  297



>gb|AIS36971.1| (-)-limonene 3-hydroxylase-like cytochrome p450-dependent oxygenase 
[Mentha spicata]
Length=500

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 132/203 (65%), Gaps = 4/203 (2%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D A A + + +  KI++Y+  DI F PY ++WRQMRKICV ELL+ +NVRSF  IRQDE+
Sbjct  97   DPACADRFDSIGTKIMWYDNDDIIFSPYSEHWRQMRKICVSELLSARNVRSFGFIRQDEV  156

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              LL ++RS++  G+ V   ER+  L  SIICR+AFG V    EE +E +K+   +   F
Sbjct  157  SRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRDHEELVELVKDALSMASGF  216

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLIDV  70
            + AD+FPS ++L+ L   NK+++ +  R+VDAI+E I++EH  KLK   E G  D +IDV
Sbjct  217  ELADMFPSSKLLN-LLCWNKSKLWRMRRRVDAILEAIVEEH--KLKKSGEFGGED-IIDV  272

Query  69   LIRQMDSGNLRVPISHDNIKAII  1
            L R      ++VPI+ + IKA I
Sbjct  273  LFRMQKDSQIKVPITTNAIKAFI  295



>ref|XP_006367966.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 135/208 (65%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             DL F  +P++++  IIFY+C+DI F  YGDYWR MRK+CV+ELL+ K V+S +SIRQ+E
Sbjct  108  QDLHFVDRPQIMSTSIIFYDCTDIGFSSYGDYWRNMRKVCVLELLSTKMVKSLASIRQEE  167

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I +L++ +RS++    L+    ++F    ++ CR+  GK+   R +F+  +K+I  L+G 
Sbjct  168  ISNLISSLRSSTP-DSLINLSNKIFWFTNTVTCRAVSGKIIHDRNKFIMLVKDIYSLIGG  226

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSSD  85
            FD  D+FPS + LH +  G K ++ KAH KVD I+E I+ +HR+    G+    ESG+ D
Sbjct  227  FDLTDLFPSQKWLHNI-SGMKYKLSKAHSKVDEILEQIVNDHRDNRAKGTKYNGESGNED  285

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
              +D L+R M+S      I++ NIKA+I
Sbjct  286  -FVDALLRVMESEEFGPRITNQNIKAVI  312



>gb|EYU21978.1| hypothetical protein MIMGU_mgv1a004623mg [Erythranthe guttata]
Length=517

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 137/217 (63%), Gaps = 18/217 (8%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  FA +P  +  +I++YN S+I+F  YGDYWRQMRKIC++ELL+ KNV+SFSSIR DE
Sbjct  97   HDPTFADRPVTIAGEILWYNSSNISFSQYGDYWRQMRKICILELLSAKNVKSFSSIRNDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++ +S     V   E++F + +SI CR+AFGKV   +++ +   KE   L+  
Sbjct  157  VSQLIESIKISS---STVDLTEKIFGMTSSITCRAAFGKVCKDKDQLIGMFKEGITLVSG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL-------------K  112
            FD +D++PS ++L  L   N+ R++K   K+D I++++I EHR  L             +
Sbjct  214  FDVSDLYPSSKMLKAL-SCNRMRLMKMRLKLDLILDDVIDEHRRNLEKIVFADEENSERR  272

Query  111  NGSESGSSDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
               E G+ D L+DVL+R  +SG L  PIS DNIKA+I
Sbjct  273  GNGEFGNED-LVDVLLRVKESGELEFPISDDNIKAVI  308



>ref|XP_009803037.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=512

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 141/208 (68%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAF+ +P+  +  I+ YN  DIAF  YGDYW+QMRKIC+MELL+ + V+SFSSIR+DE
Sbjct  102  HDLAFSNRPQFTSTYIVMYNNKDIAFAEYGDYWKQMRKICIMELLSARMVKSFSSIRKDE  161

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + SLL+ V+S  G  + V   E++    +S+ CR  FGK+   RE  +E +K+ + LL  
Sbjct  162  LSSLLSSVQSVKGTSE-VNMTEKIVRFASSVTCRLVFGKLSKDRELLIELMKK-TLLLAG  219

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGS----ESGSSD  85
             D  D+FPSW++L+ +  G K+R++K H++VD++++NI+ EH     +G+    E G  D
Sbjct  220  GDVGDLFPSWKLLYKM-SGAKSRLVKMHQEVDSVLDNIVNEHIRSRADGNKGNGEYGGED  278

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DV +R  ++  L+ PI++D+IKA+I
Sbjct  279  -LVDVFLRIQENDQLQFPITNDHIKAVI  305



>sp|Q9XHE7.1|C71DD_MENPI RecName: Full=Cytochrome P450 71D13; AltName: Full=(-)-(4S)-Limonene-3-hydroxylase; 
AltName: Full=Cytochrome P450 isoform 
PM17 [Mentha x piperita]
 gb|AAD44151.1| cytochrome p450 isoform PM17 [Mentha x piperita]
Length=500

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 131/203 (65%), Gaps = 4/203 (2%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D A A + E +  KI++Y+  DI F PY  +WRQMRKICV ELL+ +NVRSF  IRQDE+
Sbjct  97   DPACADRFESIGTKIMWYDNDDIIFSPYSVHWRQMRKICVSELLSARNVRSFGFIRQDEV  156

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              LL ++RS++  G+ V   ER+  L  SIICR+AFG V    EE +E +K+   +   F
Sbjct  157  SRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRDHEELVELVKDALSMASGF  216

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLIDV  70
            + AD+FPS ++L+ L   NK+++ +  R+VDAI+E I++EH  KLK   E G  D +IDV
Sbjct  217  ELADMFPSSKLLN-LLCWNKSKLWRMRRRVDAILEAIVEEH--KLKKSGEFGGED-IIDV  272

Query  69   LIRQMDSGNLRVPISHDNIKAII  1
            L R      ++VPI+ + IKA I
Sbjct  273  LFRMQKDSQIKVPITTNAIKAFI  295



>emb|CDP18847.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 137/208 (66%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  FA +P+ +  KI++Y+  D+ F PYGD WRQMRKIC  ELL+GK+VRSFS IR+DE
Sbjct  78   HDPTFANRPDRLAVKIMWYDQQDMIFIPYGDKWRQMRKICTTELLSGKHVRSFSYIRKDE  137

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I  L+  +RS+ G    +   E  F+  + + CR+AFG++    E  +  +KE   L   
Sbjct  138  ISKLIESIRSSQGAA--INVGEIFFMYTSLMTCRAAFGRICKEYETMIAYVKEGIALAAG  195

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            FD AD+FPS +VL  L  G + +++K H K+D+I++++I +H+   K+G    +E+G  D
Sbjct  196  FDAADMFPSLKVL-PLISGLRRKLLKMHYKIDSILDDVISQHKLNHKSGKKSNAETGEED  254

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R+ +SGN ++PI+  +IKA++
Sbjct  255  -LIDVLLREQESGNPQMPITSKDIKAVV  281



>ref|XP_006367127.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
Length=505

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 135/209 (65%), Gaps = 8/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA++ + +  KI  Y+C+DIAF PYG+YWR MRK+C+MELL+ K V+SFS IR DE
Sbjct  97   HDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIMELLSAKMVKSFSPIRLDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQL-KEISELLG  256
            + SL++ ++S       +   E++F  M S+ CRS+FGK    + E M  L   +  L G
Sbjct  157  LSSLVSSIKSMK--NTPINVSEKLFWFMNSVTCRSSFGKACKDQNEAMISLIHGVLSLAG  214

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSS  88
             F+ AD++PS + L G+  G  +++I+A  KVD +++ +I  HRE   NG    +E GS+
Sbjct  215  GFELADLYPSKKFLSGI-SGMGSKLIEARNKVDTVLDKVIDVHRENHANGKKCNAECGSN  273

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            + LIDV  R M +G L   ++++NIKA+I
Sbjct  274  EDLIDVFFRVMGTGELPFTLTNNNIKAVI  302



>gb|AGO03789.1| germacrene A oxidase [Tanacetum cinerariifolium]
Length=488

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 135/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++EF E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGRPVNLSENIFKLIATILSRAAFGKGIRDQKEFTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H K+D +I N++ EH  K    + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSIHTKLDNLINNLVAEHTVK----TSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  266  VLLRLKDSAEF--PLTADNVKAII  287



>emb|CDP10755.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 136/207 (66%), Gaps = 9/207 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA +PEL+ +KI+ YN  DIAF PYGDYW+QMRKIC++ELL+ K+VRSF S+R+DE
Sbjct  26   HDIAFADRPELLASKILGYNNLDIAFSPYGDYWKQMRKICLLELLSPKSVRSFGSLREDE  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               ++  ++S+S     V   E++F     ++CR+AFG+ F  ++  +  + E     G 
Sbjct  86   ASKVIRSIKSSSNSP--VNVTEKVFSFTNGVVCRAAFGRSFGHQDVLIPLINEAILAGGG  143

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG---SESGSSDC  82
            FD AD+FPS + LH L  G K +++K H ++  ++ENII EH+EK  +    S+S   D 
Sbjct  144  FDIADLFPSLKFLHSL-SGLKPKLLKLHHEIGQLLENIINEHKEKQTSNLVDSQSAEED-  201

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  + G+    IS D+IKA+I
Sbjct  202  LVDVLLRLKERGDFN--ISTDSIKAVI  226



>gb|KDP39283.1| hypothetical protein JCGZ_01040 [Jatropha curcas]
Length=339

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 134/208 (64%), Gaps = 9/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +P L+   I+ Y+ SDIAF PYGDYWRQ+RKIC +ELL  K V+SF  +R+DE
Sbjct  100  NDVIFAQRPFLLAASIVAYDLSDIAFAPYGDYWRQLRKICTLELLTAKRVKSFRPVREDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMF-LLMASIICRSAFGKVFTGREEFMEQLKEISELLG  256
            +  L+  + S++G    + F  RMF  L  SI   +AFGK++ G E F+  +K + +  G
Sbjct  160  VSKLIRSIYSSAGSP--INF-SRMFNSLTYSITSTAAFGKIWKGEEIFIPNVKNLIKASG  216

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSD  85
             F  AD++PS ++LH L    + ++++ H++VD I +NII EHR +    K+G+ES   D
Sbjct  217  GFSLADLYPSIKLLH-LISTTRPKLLRLHQEVDKIFQNIINEHRARKAAGKSGAESEEED  275

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
              +DVL+   D G+L+ P++ D IKA+I
Sbjct  276  -FVDVLLNFQDQGDLQFPLTDDKIKAVI  302



>sp|E1B2Z9.1|C7AV8_CICIN RecName: Full=Cytochrome P450 71AV8; AltName: Full=(+)-Valencene 
oxidase [Cichorium intybus]
 gb|ADM86719.1| valencene oxidase [Cichorium intybus]
Length=496

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 132/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSNKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +RST G G  +   E +F ++A+I+ R+AFGK    + +F E +KEI  L G 
Sbjct  152  CWNLVKDIRST-GQGSPINLSENIFKMIATILSRAAFGKGIKDQMKFTELVKEILRLTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS ++LH L  G + ++   H K+D +I NII EH         S S + L+D
Sbjct  211  FDVADIFPSKKLLHHL-SGKRAKLTNIHNKLDNLINNIIAEH----PGNRTSSSQETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  +S     P++ DN+KA+I
Sbjct  266  VLLRLKESAEF--PLTADNVKAVI  287



>ref|XP_003537455.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42025.1| Cytochrome P450 71D8 [Glycine soja]
Length=504

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 135/209 (65%), Gaps = 9/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F  +P+L+  + + Y  +DIAF PYGDYWRQ+RKIC +ELL+ K V+SFS IRQDE
Sbjct  96   HDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  + S++G    +    ++F L+ + + R+AFGK    ++EFM  +++   + G 
Sbjct  156  NKKLIQSIHSSAGSP--IDLSGKLFSLLGTTVSRAAFGKENDDQDEFMSLVRKAITMTGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK-----NGSESGSS  88
            F+  D+FPS + LH L    K ++   H++ D I+E+I+++H EK       NGSE+   
Sbjct  214  FEVDDMFPSLKPLH-LLTRQKAKVEHVHQRADKILEDILRKHMEKRTRVKEGNGSEAEQE  272

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DVL+R  +SG+L VP++ +NIKA+I
Sbjct  273  D-LVDVLLRLKESGSLEVPMTMENIKAVI  300



>ref|XP_002522721.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39572.1| cytochrome P450, putative [Ricinus communis]
Length=499

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 132/206 (64%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L+   +I YN +DIAF PY DYWRQ+RKICV+ELL+ K V+SF SIR++E
Sbjct  94   HDIVFAQRPFLLAASVITYNFTDIAFSPYSDYWRQLRKICVLELLSAKRVQSFRSIREEE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  +  TS  G+   F  ++F     I  R++FGK +  +EEF++  ++++E+ G 
Sbjct  154  VSNLINTL--TSFSGKPFNFSRKLFSSTYGIAARASFGKKYKDQEEFIKVAQQMTEVAGG  211

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS--DCL  79
            F  AD+FPS   LH +  G K+R+++     D I+ENII +HR +   G  SG    D L
Sbjct  212  FSLADLFPSIAFLH-VISGMKSRLLRLRDDGDNILENIIDDHRARNMTGKTSGEGEDDDL  270

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+R    G L  P++ +NIKA+I
Sbjct  271  VDVLLRFQKGGQLEFPLTTNNIKAVI  296



>gb|KHN03535.1| Cytochrome P450 71D8 [Glycine soja]
Length=436

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 133/204 (65%), Gaps = 5/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+ + + I+ Y   DIAF PYGDYWRQMRKIC +ELL+ K V+SFS+IR+ E
Sbjct  26   HDLAFAQRPKFLASDIMGYGSVDIAFAPYGDYWRQMRKICTLELLSAKKVQSFSNIREQE  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I  L+  ++S++  G  +     +   +++ + R+AFG +    EEF+   +E  E+   
Sbjct  86   IAKLIEKIQSSA--GAPINLTSMINSFISTFVSRTAFGNITDDHEEFLLITREAIEVADG  143

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS++ +H L  G K ++ K H+KVD I++ IIKE++     G E   ++ L++
Sbjct  144  FDLADMFPSFKPMH-LITGLKAKMDKMHKKVDKILDKIIKENQANKGMGEE--KNENLVE  200

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   SGNL  PI+ +NIKA+I
Sbjct  201  VLLRVQHSGNLDTPITTNNIKAVI  224



>sp|O81974.1|C71D8_SOYBN RecName: Full=Cytochrome P450 71D8; AltName: Full=Cytochrome 
P450 CP7 [Glycine max]
 emb|CAA71517.1| putative cytochrome P450 [Glycine max]
Length=504

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 135/209 (65%), Gaps = 9/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F  +P+L+  + + Y  +DIAF PYGDYWRQ+RKIC +ELL+ K V+SFS IRQDE
Sbjct  96   HDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  + S++G    +    ++F L+ + + R+AFGK    ++EFM  +++   + G 
Sbjct  156  NKKLIQSIHSSAGSP--IDLSGKLFSLLGTTVSRAAFGKENDDQDEFMSLVRKAITMTGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK-----NGSESGSS  88
            F+  D+FPS + LH L    K ++   H++ D I+E+I+++H EK       NGSE+   
Sbjct  214  FEVDDMFPSLKPLH-LLTRQKAKVEHVHQRADKILEDILRKHMEKRTRVKEGNGSEAEQE  272

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            D L+DVL+R  +SG+L VP++ +NIKA+I
Sbjct  273  D-LVDVLLRLKESGSLEVPMTMENIKAVI  300



>gb|ADD84654.1| CYP71D175 [Scoparia dulcis]
Length=519

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 136/213 (64%), Gaps = 11/213 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D  F  KPE++  +I++YN S ++F  YGDYWRQMRKIC++ELL+ KNVRSF  IR DE
Sbjct  99   QDPTFTDKPEMIAAEILWYNSS-LSFSQYGDYWRQMRKICMIELLSVKNVRSFGLIRNDE  157

Query  432  IHSLLAYVRSTSGH-GQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLG  256
            +  L   +   SG+ G LV   E +  + +SIICR+AFG+V   +E+ +E LK+   LL 
Sbjct  158  VSRLAHSIVGDSGNRGTLVDLTEEVAKMTSSIICRAAFGRVCRDKEKMIEMLKDGIALLS  217

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHR----EKLKNGSESGSS  88
              D  D++PS ++L  +   N+ R++K  RK+D I++ II EHR    EKL +    G+ 
Sbjct  218  GLDVCDLYPSSKMLKAM-SWNRVRLLKMRRKLDPILDGIIAEHRRNRAEKLDSSGNIGNG  276

Query  87   DC----LIDVLIRQMDSGNLRVPISHDNIKAII  1
            +     LIDVLIR M+SG L  PI+ DNIKA+I
Sbjct  277  EFGNEDLIDVLIRHMESGELEFPITDDNIKAMI  309



>gb|AIA09035.1| germacrene A oxidase [Cynara cardunculus var. scolymus]
Length=486

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+  A +PE +T +II Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  90   YDITLANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  149

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  V++ SG G+ V   E +F ++A+I+ R+AFGK    ++EF E +KEI    G 
Sbjct  150  CWNLVQEVKA-SGSGRPVDLSENIFKMIATILSRAAFGKGIKDQKEFTEIVKEILRQTGG  208

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I NI+ EH       + S S++ L+D
Sbjct  209  FDVADIFPSKKFLHHL-SGKRARLTSIHKKLDNLINNIVAEH----PGNTSSKSNETLLD  263

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KA+I
Sbjct  264  VLLRLKDSPEF--PLTADNVKAVI  285



>gb|KDP39016.1| hypothetical protein JCGZ_00773 [Jatropha curcas]
Length=460

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 130/206 (63%), Gaps = 7/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F  +P L+  +I+ YN  DIAF PYGD WRQMRKIC +ELL+ K VRSF  IR+DE
Sbjct  49   HDIIFLQRPFLLAAEILMYNFKDIAFAPYGDSWRQMRKICTLELLSTKRVRSFRPIREDE  108

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + + +  + S+S     V     +F L  +I  RSAFGKV   +E F+  +++I ++L  
Sbjct  109  VSTFIRTISSSSK----VNLGRMVFALSNTITLRSAFGKVSERKEAFLPLVQKIVQVLEG  164

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHRE--KLKNGSESGSSDCL  79
            F  ADVFPS R LH +  G + ++ K H++ D ++ENII EHRE  +L   +  G  D L
Sbjct  165  FSVADVFPSVRFLHRI-TGMRGKLEKLHQETDIMLENIINEHRENKRLGRSNSEGKEDDL  223

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+   DS NL  P++ ++IKA++
Sbjct  224  VDVLLNIQDSDNLEFPLTMEHIKAVM  249



>dbj|BAM68817.1| putative cytochrome P450 monooxygenase CYP71AV1 [Artemisia kurramensis]
Length=496

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 137/204 (67%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +PE +T +I+ Y+ +DI   PYG+YWR++RK+C +EL++ K V+S+ S+R++E
Sbjct  100  HDITFAHRPETLTGEIVVYHNTDIILAPYGEYWRRVRKLCTLELMSVKKVKSYQSLREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+CR+AFGK    ++EF E +KE+ +  G 
Sbjct  160  CWNLVQEIKA-SGSGRPVNLSENIFKLIATILCRAAFGKGVKDQKEFTEIMKEMLKETGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D+ I NI+ EH  K    + S +++ L+D
Sbjct  219  FDVADIFPSKKFLHHL-SGKRTRLTSIHKKLDSFINNIVAEHTFK----TSSETAETLLD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   S     P++ DN+KAII
Sbjct  274  VLLRLKHSDEF--PLTADNVKAII  295



>gb|AIA09036.1| germacrene A oxidase [Cynara cardunculus var. altilis]
 gb|AIA09037.1| germacrene A oxidase [Cynara cardunculus var. scolymus]
Length=486

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+  A +PE +T +II Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  90   YDITLANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  149

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  V++ SG G+ V   E +F ++A+I+ R+AFGK    ++EF E +KEI    G 
Sbjct  150  CWDLVQEVKA-SGSGRPVDLSENIFKMIATILSRAAFGKGIKDQKEFTEIVKEILRQTGG  208

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I NI+ EH       + S S++ L+D
Sbjct  209  FDVADIFPSKKFLHHL-SGKRARLTSIHKKLDNLINNIVSEH----PGNTSSKSNETLLD  263

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KA+I
Sbjct  264  VLLRLKDSPEF--PLTADNVKAVI  285



>gb|ABG49365.1| P450 monooxygenase [Artemisia annua]
 gb|ABM88788.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
Length=488

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 135/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D++FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  92   YDISFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  266  VLLRLKDSAEF--PLTSDNIKAII  287



>ref|XP_007154033.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
 gb|ESW26027.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
Length=511

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 132/204 (65%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL F  +P+L+  KI+ Y  +DIAF PYG+YWRQMRKIC +ELL+ K V SFS IR++E
Sbjct  100  HDLNFVQRPQLLCPKILAYGSTDIAFAPYGEYWRQMRKICTLELLSAKRVHSFSFIREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++  +  G  V   E +F  +++++ R+AFGK      E +  LK+ +EL G 
Sbjct  160  VAKLIRSIQLCACAGSQVNVSENVFSFLSTLVSRTAFGKKSEKGNELLCLLKKGAELAGG  219

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + +H L    K ++   H+++D I+E+II EH+ K +NG    + + L+D
Sbjct  220  FDLADLFPSLKAVHFL-TRMKTKLENMHKELDKILESIISEHQSKHRNGD---AEENLVD  275

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   S  L VP++ +NIKA+I
Sbjct  276  VLLRVQQSATLEVPLTINNIKAVI  299



>dbj|BAM68808.1| cytochrome P450 monooxygenase CYP71AV1 [Artemisia annua]
Length=495

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 135/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D++FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  99   YDISFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  159  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  273  VLLRLKDSAEF--PLTSDNIKAII  294



>gb|AFO64615.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=488

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  266  VLLRLKDSAEF--PLTSDNIKAII  287



>gb|ABE57266.1| amorpha-4,11-diene monooxygenase [Artemisia annua]
Length=488

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  266  VLLRLKDSAEF--PLTSDNIKAII  287



>gb|ABC41927.1| amorpha-4,11-diene monooxygenase [Artemisia annua]
Length=488

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGRPVNLSENIFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  266  VLLRLKDSAEF--PLTSDNIKAII  287



>dbj|BAM68810.1| putative CYP71AV1 ortholog [Artemisia absinthium]
Length=495

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  99   YDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++EF E +KEI    G 
Sbjct  159  CWNLVQEIKA-SGSGRPVNLSENIFKLIATILSRAAFGKGIKDQKEFTEIVKEILRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H K+D +I N++ EH       + S +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSIHMKLDNLINNLVAEH----TVNTSSKTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  273  VLLRLKDSAEF--PLTADNVKAII  294



>gb|AFP19100.1| amorphadiene oxidase [Artemisia annua]
Length=488

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  266  VLLRLKDSAEF--PLTSDNIKAII  287



>gb|AFK45297.1| unknown [Lotus japonicus]
Length=489

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 130/204 (64%), Gaps = 7/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H LAFA +PEL++ KI+ Y  +DIAF PYGDYWRQMRKIC +ELL+ K V+SFS IR+DE
Sbjct  101  HGLAFAQRPELLSPKILAYGSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSFIREDE  160

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +  ++  G      + +F L+ + + R  FGK     +E +  +K+  EL   
Sbjct  161  VAKLIQSIHLSASAGSPFNLSKSVFSLVNTFLSRVVFGKKSECEDELLSLIKKAVELTAG  220

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD A++FPS++ LH L    + ++   H+K+D I ++I+ EH+      S+ G  + L+D
Sbjct  221  FDVAELFPSFKPLH-LITRMEAKLENMHKKLDKIFDSIVNEHQ------SDHGKGENLVD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   SGNL +PI+ +NIKA+I
Sbjct  274  VLLRMQHSGNLYIPITVNNIKAVI  297



>gb|ABG91755.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
Length=495

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  99   YDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  159  CWNLVQEIKA-SGSGRPVNLSENIFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  273  VLLRLKDSAEF--PLTSDNIKAII  294



>gb|EYU21953.1| hypothetical protein MIMGU_mgv1a025918mg [Erythranthe guttata]
Length=498

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 141/204 (69%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D   A +PE +  KI++Y+ +DIAF PY +YWRQMRKIC++ELL+ KNV+SF SIR++E
Sbjct  93   QDPGCAGRPESIGTKIMWYDYTDIAFSPYNEYWRQMRKICILELLSAKNVKSFGSIRKEE  152

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  ++  +RS++  G  V   E++F L ++I CR+AFG+V   R+  +  LK+   + G 
Sbjct  153  VSRVIESLRSSARGGAAVNLTEKVFGLTSAITCRAAFGEVLKDRDSLIFLLKKGVTMAGG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ AD+FPS ++L+ +F  NK ++++  R++D+I++ I+ EH  KLK   E G  D ++D
Sbjct  213  FELADLFPSSKLLN-IFSWNKLKLLRMRRRLDSILDVIVAEH--KLKQNGEFGGED-IVD  268

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VLIR   +G L+ PI++DNIKA+I
Sbjct  269  VLIRMQRNGELQFPITNDNIKAVI  292



>gb|KHN36162.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 129/208 (62%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAF  +P+ +  +I+ Y  SDIAF PYGDYWRQM+KICV ELL+ K V+SFS IR+DE
Sbjct  46   HDLAFVQRPQFLPAQILTYGQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSDIREDE  105

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
                +  VR++ G    V    +++ L++S I R AFG     +EEF+  +KE+  +   
Sbjct  106  TAKFIESVRTSEGSP--VNLTNKIYSLVSSAISRVAFGNKCKDQEEFVSLVKELVVVGAG  163

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDC---  82
            F+  D+FPS + LH L  G K ++ K   +VD I++NI+KEH+EK +     G  D    
Sbjct  164  FELDDLFPSMK-LH-LINGRKAKLEKMQEQVDKIVDNILKEHQEKRERARREGRVDLEEE  221

Query  81   -LIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R   S NL + I+  NIKAII
Sbjct  222  DLVDVLLRIQQSDNLEIKITTTNIKAII  249



>sp|Q1PS23.1|AMO_ARTAN RecName: Full=Amorpha-4,11-diene 12-monooxygenase; AltName: Full=Amorpha-4,11-diene 
C-12 oxidase; AltName: Full=Cytochrome 
P450 71AV1 [Artemisia annua]
 gb|ABB82944.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
 gb|AEQ63684.1| amorpha-4,11-diene oxidase [synthetic construct]
Length=495

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  99   YDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  159  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  273  VLLRLKDSAEF--PLTSDNIKAII  294



>gb|ABI31728.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
Length=495

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  99   YDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  159  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  273  VLLRLKDSAEF--PLTSDNIKAII  294



>ref|XP_004512033.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=510

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 136/208 (65%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L +  I+ Y   DIAF PYGDY+RQMRKIC++ELL+ K V+SFS IR+DE
Sbjct  99   HDITFANRPNLESAHIMTYGSIDIAFSPYGDYYRQMRKICMLELLSAKRVQSFSYIREDE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
             +  +  ++S+ G    V    R+F L++S + RSAFG     ++EF+  +++  E +G 
Sbjct  159  TNKFIELIKSSEGSE--VNLTNRIFSLVSSTVSRSAFGDKTEDQDEFVSVIRKAIESVGG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK----NGSESGSSD  85
             + AD+FPS++ +  +  GNK+++ K H++ D I+E I+ +H+EK +    +GS+    D
Sbjct  217  LEPADLFPSFKYIIHVLTGNKSKLEKMHKQADKILEIIVSKHQEKQRRKKLDGSDEEQED  276

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R   SG L +PI+  NIKA+I
Sbjct  277  -LVDVLLRVQQSGTLDIPITTSNIKAVI  303



>ref|XP_004511998.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 134/208 (64%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AFA +P+L++ +I+ Y   DI F PYGDYWRQMRKICV+ELLN K V+SFS IR+DE
Sbjct  97   HDVAFANRPKLLSPEIMAYGSKDIVFSPYGDYWRQMRKICVLELLNAKRVQSFSYIREDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
             +  +  ++S+      +    R+  +++S I R+AFG     ++EF++ ++++ EL G 
Sbjct  157  TNKFIKSIQSSI--DTTINLTSRILSMVSSTISRAAFGDKSKDQDEFVDLVRKVVELSGG  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDC---  82
            FD  D+FPS + LH +  G + ++ K H++ D I+ NI+++H E      E  + D    
Sbjct  215  FDVDDLFPSMKFLH-VITGMRPKLEKIHKRADTIMGNIVRQHEENRGRPKEDNNIDVQNE  273

Query  81   -LIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R   SG+L V I+ +NIKA+I
Sbjct  274  DLVDVLLRVQQSGSLDVQITTNNIKAVI  301



>ref|XP_010655881.1| PREDICTED: cytochrome P450 71D10-like [Vitis vinifera]
Length=505

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 134/206 (65%), Gaps = 6/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  FA +P L+  +I+ Y+CS +AF PYGDYWRQ+RKICV+ELL  K V+SF S+R++E
Sbjct  96   HDTNFAQRPILLATRILSYDCSGVAFAPYGDYWRQLRKICVVELLTAKRVKSFQSVREEE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I +L+  V S S     + F E++  L  SII R+AFGK    ++ F+  +KE+ E    
Sbjct  156  ISNLITMVTSCSRLQ--INFTEKISSLTFSIIARAAFGKKSEDQDAFLSVMKELVETASG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK--NGSESGSSDCL  79
            F  AD++PS + L  L  G + +I K  R  D I++NI+ EHREKLK  +G   G +D L
Sbjct  214  FCVADMYPSVKWLD-LISGMRYKIDKVFRMTDRILQNIVDEHREKLKTQSGKLEGEAD-L  271

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL++   + +L+ P++ +NIKA+I
Sbjct  272  VDVLLKLQQNDDLQFPLTDNNIKAVI  297



>gb|ABG49366.1| P450 monooxygenase [Artemisia annua]
Length=488

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  92   YDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ +G G+ V   E +F L+A+I+ R+AFGK    ++EF E +KEI    G 
Sbjct  152  CWNLVQEIKA-AGSGRPVNLSENIFKLIATILSRAAFGKGIKDQKEFTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H K+D +I N++ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSIHMKLDNLINNLVAEH----TVNTSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  266  VLLRLKDSAEF--PLTADNVKAII  287



>ref|XP_011081964.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=513

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 140/216 (65%), Gaps = 16/216 (7%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  FA +PE +  +I++YN S+I+F  YGDYWRQMRKIC++ELL+ KNV+SF SIR DE
Sbjct  96   HDPTFADRPENIAGEILWYNSSNISFSQYGDYWRQMRKICILELLSAKNVKSFGSIRNDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  + ++S  G  V   E++F+L +SI CR+AFGKV   +++ +E  KE   L+  
Sbjct  156  VSHLVDSIGASS--GAPVDLTEKIFMLTSSITCRAAFGKVCRDKDQLIEMFKEGITLVSG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL------------KN  109
            FD +D++PS ++L  +   N+ ++++  RK+D I+++II EHR  L            + 
Sbjct  214  FDVSDLYPSSKILRAI-SCNRRKLLRMRRKLDLILDDIIGEHRRNLAKIAADKDNLERRG  272

Query  108  GSESGSSDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
              E G+ D L+DVL+R   SG L  PI+ DNIKA+I
Sbjct  273  NGEFGNED-LVDVLLRVQQSGELEFPITDDNIKAVI  307



>ref|XP_004511997.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=506

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 135/207 (65%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L +  I+ Y   DIAF PYGDY+RQMRKIC++ELL+ K V+SFS IR+DE
Sbjct  97   HDIVFANRPHLESAHIMSYGSKDIAFSPYGDYYRQMRKICMLELLSAKRVQSFSYIREDE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
             +  +  ++S++G    V    R+F L++SI+ RSAFG     ++EF+  +++  E +G 
Sbjct  157  TNIFIELIKSSAGSE--VNLTNRIFSLVSSIVSRSAFGDKTEDQDEFVRVIRKTIESVGG  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK---LKNGSESGSSDC  82
             + AD+FPS + +  +  GNK+++ K  ++ D I+E I+ +H+EK    K GS+    D 
Sbjct  215  LEPADLFPSMKYIIHVLTGNKSKLEKMQKQSDKILEIIVGKHQEKQRRAKEGSDEEQED-  273

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R   SG L +PI+  NIKAII
Sbjct  274  LVDVLLRVQQSGTLDIPITTSNIKAII  300



>dbj|BAM68815.1| cytochrome P450 monooxygenase CYP71AV2 [Artemisia maritima]
Length=495

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  99   YDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ +G G+ V   E +F L+A+I+ R+AFGK    + EF E +KEI    G 
Sbjct  159  CWNLVQEIKA-AGSGRPVNLSENIFKLIATILSRAAFGKGIKDQREFTEIVKEILRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H K+D +I N++ EH       + S +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSIHMKLDNLINNLVAEH----TVNTSSKTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  273  VLLRLKDSAEF--PLTADNVKAII  294



>emb|CDP17903.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 131/208 (63%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  F  +P+ +   I++Y+  D+ F PYGD+WRQ+RKIC+ ELL+ KNVRSFS IR+DE
Sbjct  100  HDPVFTNRPDRLAINIMWYDKQDMIFTPYGDHWRQLRKICITELLSNKNVRSFSYIRKDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I  L+  +RS+ G    V   E  F     + CR+AFG +    E  ++ LKE   L   
Sbjct  160  IMKLMESIRSSQGLS--VNVTEMFFRYATYMTCRAAFGTISKDTETMIKCLKEAMVLAAG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            FD ADVFPS ++L  L  G K +++K H K+D I++++I +H+   K+G    + SG  D
Sbjct  218  FDAADVFPSLKIL-PLISGLKRKLLKMHDKMDEILDDVINQHKLNHKSGKMGNAVSGEED  276

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SGNL++PI+  NIK ++
Sbjct  277  -LIDVLLRLQESGNLQMPITDRNIKGVL  303



>dbj|BAM68821.1| putative cytochrome P450 monooxygenase CYP71AV11v2 [Artemisia 
capillaris]
Length=496

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ F  +PE ++ +II Y+ +DI F PYG+YWRQ+RKIC ++LL+ K V+S+ S+R++E
Sbjct  100  YDITFGNRPETLSGEIIGYHNTDIVFAPYGEYWRQVRKICTLDLLSAKKVKSYQSLREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A I CR+AFGK     +EF E +KE+ +  G 
Sbjct  160  CWNLVQEIKA-SGSGRPVNLSENIFKLIAMIFCRAAFGKGIKEHKEFTENVKEMLKETGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
             D AD+FPS + LH L  G + R+   H+K+D II N++ EH  K    + S +++ L+D
Sbjct  219  MDVADIFPSKKFLHHL-SGKRARLTSIHKKLDNIINNVVAEHNVK----TASKTNETLLD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS   +  ++ DN+KAII
Sbjct  274  VLLRLKDSAEFQ--LTADNVKAII  295



>ref|XP_003517259.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 131/207 (63%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F  +P+L+  + + Y  +DI F PYGDYWRQ+RKIC +ELL+ K V+SFS IRQDE
Sbjct  96   HDVHFVQRPQLLAPQFMVYGATDIVFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  + S++G    +    ++F L+ + + R+AFGK    ++E M  +++   + G 
Sbjct  156  NRKLIQSIHSSAGSS--IDLSGKLFSLLGTTVSRAAFGKENDDQDELMSLVRKAITMTGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSDC  82
            F+  D+FPS + LH L    K ++   H++ D I+E+I+++H EK    K GS     + 
Sbjct  214  FELDDMFPSLKPLH-LLTRQKAKVEHVHQRADKILEDILRKHMEKRTIGKEGSNEAEQED  272

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  +SG+L VP++ +NIKA+I
Sbjct  273  LVDVLLRLKESGSLEVPMTMENIKAVI  299



>dbj|BAM68809.1| putative CYP71AV1 ortholog [Artemisia afra]
Length=495

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  99   YDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSIKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+     E +F L+A+I+ R+AFGK    ++EF E +KEI    G 
Sbjct  159  CWNLVQEIKA-SGSGRPFNLSENVFKLIATILSRAAFGKGIKDQKEFTEIVKEILRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H+K+D +I N++ EH     N     +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSIHQKLDNLINNLVAEHTVTTSN----KTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  273  VLLRLKDSAEF--PLTSDNVKAII  294



>ref|XP_003537457.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42026.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 134/209 (64%), Gaps = 8/209 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAF  +P+L+  + + Y  +DIAF PYG+YWRQMRKIC +ELL+ K V+SFS IRQDE
Sbjct  96   HDLAFVQRPQLLAPQYMAYGATDIAFAPYGEYWRQMRKICTLELLSAKRVQSFSHIRQDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  ++S++G    +    ++F L+ + + R+AFG     ++EFM  +++   + G 
Sbjct  156  NRKLIQSIQSSAGSP--IDLSSKLFSLLGTTVSRAAFGNKNDDQDEFMSLVRKAVAMTGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS-----  88
            F+  D+FPS + LH L  G K ++ + H++ D I+E+I+++H EK     E G++     
Sbjct  214  FELDDMFPSLKPLH-LLTGQKAKVEEIHKRADRILEDILRKHVEKRTRAKEEGNNSEAQQ  272

Query  87   DCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            + L+DVL+R   SG+L V ++  ++KA+I
Sbjct  273  EDLVDVLLRIQQSGSLEVQMTTGHVKAVI  301



>gb|KHN36164.1| Cytochrome P450 71D8 [Glycine soja]
Length=503

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 131/207 (63%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F  +P+L+  + + Y  +DI F PYGDYWRQ+RKIC +ELL+ K V+SFS IRQDE
Sbjct  96   HDVHFVQRPQLLAPQFMVYGATDIVFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  + S++G    +    ++F L+ + + R+AFGK    ++E M  +++   + G 
Sbjct  156  NRKLIQSIHSSAGSS--IDLSGKLFSLLGTTVSRAAFGKENDDQDELMSLVRKAITMTGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSDC  82
            F+  D+FPS + LH L    K ++   H++ D I+E+I+++H EK    K GS     + 
Sbjct  214  FELDDMFPSLKPLH-LLTRQKAKVEHVHQRADKILEDILRKHMEKRTIGKEGSNEAEQED  272

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+R  +SG+L VP++ +NIKA+I
Sbjct  273  LVDVLLRLKESGSLEVPMTMENIKAVI  299



>dbj|BAM68818.1| putative cytochrome P450 monooxygenase CYP71AV1 [Artemisia chamaemelifolia]
Length=496

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 136/204 (67%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+S+ S+R++E
Sbjct  100  YDIIFANRPETLTGEIVVYHNTDIVLAPYGEYWRQLRKLCTLELLSAKKVKSYQSLREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G  V   E +F L+A+I+ R+ FGK     +EF E ++E+ + LG 
Sbjct  160  CWNLVQEIKA-SGSGIPVNLSENIFKLVATILSRAVFGKRIKDHKEFTELVEEMLKELGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH +  G ++R+   H+K+D +I N++ EH  K    + S + + L+D
Sbjct  219  FDVADIFPSKKFLHHI-SGKRSRLTSIHKKLDNLINNLVAEHTVK----ASSTTKETLLD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS  +  P++ DN+KAII
Sbjct  274  VLLRLKDS--VEFPLTADNVKAII  295



>ref|XP_003516583.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 129/208 (62%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAF  +P+ +  +I+ Y  SDIAF PYGDYWRQM+KICV ELL+ K V+SFS IR+DE
Sbjct  99   HDLAFVQRPQFLPAQILTYGQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSDIREDE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
                +  VR++ G    V    +++ L++S I R AFG     +EEF+  +KE+  +   
Sbjct  159  TAKFIESVRTSEGSP--VNLTNKIYSLVSSAISRVAFGNKCKDQEEFVSLVKELVVVGAG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDC---  82
            F+  D+FPS + LH L  G K ++ K   +VD I++NI+KEH+EK +     G  D    
Sbjct  217  FELDDLFPSMK-LH-LINGRKAKLEKMQEQVDKIVDNILKEHQEKRERARREGRVDLEEE  274

Query  81   -LIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R   S NL + I+  NIKAII
Sbjct  275  DLVDVLLRIQQSDNLEIKITTTNIKAII  302



>ref|XP_003550472.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=559

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 132/204 (65%), Gaps = 5/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+ + + I+ Y   DIAF PYGDYWRQMRKIC +ELL+ K V+SFS+IR+ E
Sbjct  149  HDLAFAQRPKFLASDIMGYGSVDIAFAPYGDYWRQMRKICTLELLSAKKVQSFSNIREQE  208

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I  L+  ++S++  G  +     +   +++ + R+ FG +    EEF+   +E  E+   
Sbjct  209  IAKLIEKIQSSA--GAPINLTSMINSFISTFVSRTTFGNITDDHEEFLLITREAIEVADG  266

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS++ +H L  G K ++ K H+KVD I++ IIKE++     G E   ++ L++
Sbjct  267  FDLADMFPSFKPMH-LITGLKAKMDKMHKKVDKILDKIIKENQANKGMGEE--KNENLVE  323

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   SGNL  PI+ +NIKA+I
Sbjct  324  VLLRVQHSGNLDTPITTNNIKAVI  347



>gb|KHN42275.1| Cytochrome P450 71D8 [Glycine soja]
Length=511

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 133/204 (65%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL F  +PEL+  KI+ Y+ +DIAF PYGDYWRQMRKIC +ELL+ K V+SFS IR++E
Sbjct  100  HDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSFIREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++  +  G  V   + +F L++++I R+AFGK     ++ +  LK+  EL G 
Sbjct  160  VAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKKSEYEDKLLALLKKAVELTGG  219

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + +H L    K ++    +++D I+ENII +H+    N  +  + + L+D
Sbjct  220  FDLADLFPSMKPIH-LITRMKAKLEDMQKELDKILENIINQHQS---NHGKGEAEENLVD  275

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   SG+L + ++ +NIKA+I
Sbjct  276  VLLRVQKSGSLEIQVTINNIKAVI  299



>gb|ABQ24001.1| limonene hydroxylase [Mentha arvensis]
Length=500

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 130/203 (64%), Gaps = 4/203 (2%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D A A + + +  KI++Y+  DI F PY ++WRQMRKICV  LL+ +NVRSF  IRQDE+
Sbjct  97   DPACADRFDSIGTKIMWYDNDDIIFSPYSEHWRQMRKICVSGLLSARNVRSFGFIRQDEV  156

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              LL ++RS++  G+ V   ER+  L  SIICR+AFG V    EE +E +K+   +   F
Sbjct  157  SRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRDHEELVELVKDALSMASGF  216

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLIDV  70
            + AD+FPS ++L+ L   NK+++ +  R+VD I+E I++EH  KLK   E G  D +IDV
Sbjct  217  ELADLFPSSKLLN-LLCWNKSKLWRMRRRVDTILEAIVEEH--KLKKSGEFGGED-IIDV  272

Query  69   LIRQMDSGNLRVPISHDNIKAII  1
            L R      ++VPI+ + IKA I
Sbjct  273  LFRMQKDSQIKVPITTNAIKAFI  295



>gb|AJD25166.1| cytochrome P450 CYP71D413 [Salvia miltiorrhiza]
Length=511

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 132/208 (63%), Gaps = 8/208 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD A A +P+ V  +I++YN SDI F PYGDYWRQMRKIC++ELL+ KNVRSF  IR+DE
Sbjct  96   HDPACADRPKSVATQIMWYNYSDIVFSPYGDYWRQMRKICILELLSAKNVRSFEYIRKDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
               L+  ++ST   G      E++FL M S+ CR+AFG     R   ++ +K+   L G 
Sbjct  156  ASLLIESIQST--RGAPFDLTEKIFLFMNSMTCRAAFGNASMDRAAAIKLIKKAICLAGH  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG----SESGSSD  85
            FD AD+FPS + L  L   N+  ++K  RK+D I++++I EH   L +      E G+ D
Sbjct  214  FDLADLFPSIK-LFDLLTWNRFELLKLRRKLDKILDDVIDEHERNLASTKMGYGELGTED  272

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R   SG L + I++D+IK++I
Sbjct  273  -LVDVLLRLKGSGELELSITNDSIKSVI  299



>gb|KDP39254.1| hypothetical protein JCGZ_01011 [Jatropha curcas]
Length=510

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 125/204 (61%), Gaps = 3/204 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA +P  +  KII Y+ + I F PYG YWRQ+RKIC MELL+ K V+SF  IR+DE
Sbjct  99   HDLDFAERPPNLAPKIISYDSTHIVFSPYGAYWRQLRKICTMELLSPKRVQSFRFIREDE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  +  +S  G L+   E +F L   I  R+AFGK +  +E F++ + E+S++   
Sbjct  159  VLNLIKTI--SSLEGSLINISEMIFSLTYGITSRAAFGKKYEDQETFIQVITEVSKIAAG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F  AD++PS + L     G + ++ K H K D I+E I+KEHR K+    E    D L+D
Sbjct  217  FSVADLYPSIKFLEQA-SGLRPKLGKLHEKADGILERIVKEHRNKMNRSEEIQEDDDLVD  275

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+   + G+L  P+S DNIK +I
Sbjct  276  VLLELQEHGDLEFPLSDDNIKTVI  299



>ref|XP_007147597.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
 gb|ESW19591.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
Length=506

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 132/204 (65%), Gaps = 5/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAFA +P+ + + I+ Y   DIAF PYGDYWRQMRK+C +ELL+ K V+SF  IR++E
Sbjct  95   HDLAFAQRPKFLASDIMGYGSGDIAFAPYGDYWRQMRKLCTLELLSAKKVQSFFHIREEE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++S++  G+ +    R    +++ + R+ FGK+    EEF+  +KE  E+   
Sbjct  155  VAKLIKTIQSSA--GEPIDLSSRFGSFISTFVSRATFGKINEDHEEFVLTVKEAIEVADG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD FPS++ +H L  G K ++ K H+K D I+E II+E++     G E+  +  L++
Sbjct  213  FDLADAFPSFKPIH-LITGLKAKLDKMHKKSDKILEKIIRENQANEGMGEENNEN--LVE  269

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R    GNL  PI+++NIKA+I
Sbjct  270  VLLRFQHRGNLDTPITNNNIKAVI  293



>ref|XP_003529672.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=522

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 133/204 (65%), Gaps = 4/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL F  +PEL+  KI+ Y+ +DIAF PYGDYWRQMRKIC +ELL+ K V+SFS IR++E
Sbjct  111  HDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSFIREEE  170

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++  +  G  V   + +F L++++I R+AFGK     ++ +  LK+  EL G 
Sbjct  171  VAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKKSEYEDKLLALLKKAVELTGG  230

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + +H L    K ++    +++D I+ENII +H+    N  +  + + L+D
Sbjct  231  FDLADLFPSMKPIH-LITRMKAKLEDMQKELDKILENIINQHQS---NHGKGEAEENLVD  286

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   SG+L + ++ +NIKA+I
Sbjct  287  VLLRVQKSGSLEIQVTINNIKAVI  310



>ref|XP_004295869.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FAT+P L+   I+ YNC++I F  YGDYWRQ+RKIC +E+L+ K V+S+  IR++E
Sbjct  98   HDVTFATRPYLLAADIVNYNCTNIVFAKYGDYWRQLRKICTLEVLSPKRVQSYRPIREEE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+ ++ S +     +   E+++    +I  R+AFGK     EEF++ +KE  +L G 
Sbjct  158  MLNLIKWIASKARSP--INLTEKIYSSTYTITTRAAFGKKSKYHEEFIDCVKEGIQLGGG  215

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK-LKNGSESGSSDCLI  76
            FD ADVFPS+R+LH +  G + ++ + H+K D I+ENIIKE R+K    G ES + + LI
Sbjct  216  FDLADVFPSYRLLH-MITGLRPKLERLHKKTDRILENIIKELRDKETSKGGESETQEHLI  274

Query  75   DVLIR-QMDSGNLRVPISHDNIKAII  1
            +VL++   D+G+L   ++ DNIKA++
Sbjct  275  EVLLKFHEDNGSLEFTLTTDNIKAVM  300



>dbj|BAM68820.1| putative cytochrome P450 monooxygenase CYP71AV11v1 [Artemisia 
capillaris]
Length=496

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 134/204 (66%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ F  +PE ++ +II Y+ +DI F PYG+YWRQ+RKIC ++LL+ K V+S+ S+R++E
Sbjct  100  YDITFGNRPETLSGEIIGYHNTDIVFAPYGEYWRQVRKICTLDLLSAKKVKSYQSLREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A I CR+AFGK     +EF E +KE+ +  G 
Sbjct  160  CWNLVQEIKA-SGSGRPVNPSENIFKLIAMIFCRAAFGKGIKEHKEFTENVKEMLKETGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
             D AD+FPS + LH L  G + R+   H+K+D II N++ EH  K    + S +++ L+D
Sbjct  219  MDVADIFPSKKFLHHL-SGKRARLTSIHKKLDNIINNVVAEHNVK----TASKTNETLLD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS   +  ++ DN+KAII
Sbjct  274  VLLRLKDSAEFQ--LTADNVKAII  295



>gb|KDP39256.1| hypothetical protein JCGZ_01013 [Jatropha curcas]
Length=488

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 137/207 (66%), Gaps = 7/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F+ +P ++   II YN + I F PYG+YWRQ+RKICV+ELL+ K V+SF SIR++E
Sbjct  78   HDIVFSNRPSILAANIISYNATSIVFSPYGEYWRQLRKICVLELLSAKRVQSFKSIREEE  137

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +++  + S+S    L+     +F L  SI  R+AFGK+   +E F+  ++EI E+ G 
Sbjct  138  VSNIVRRISSSS--DSLINLSRMLFSLTYSITSRAAFGKIRKEQEAFIPLVEEIIEVGGG  195

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHR---EKLKNGSESGSSDC  82
            F  AD+FPS ++L+ +  G K+R+ + H++ D I+ENII EHR    + K GS+ G +D 
Sbjct  196  FSIADLFPSIKLLNRI-NGMKSRVERLHQEADKILENIINEHRASKARAKPGSK-GEADD  253

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+   + G+L   ++ +NIKA+I
Sbjct  254  LVDVLLNIQEQGDLGFALTTNNIKAVI  280



>gb|ACF74516.1| amorpha-4,11-diene monooxygenase [Artemisia annua]
Length=495

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D++FA +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC  ELL+ K V+SF S+R++E
Sbjct  99   YDISFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTSELLSVKKVKSFQSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KE     G 
Sbjct  159  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKETLRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  273  VLLRLKDSAEF--PLTSDNIKAII  294



>gb|ADU25498.1| cytochrome P450 monooxygenase [Artemisia annua]
Length=488

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+  A +PE +T +I+ Y+ +D+   PYG+YWRQ+RKIC +ELL+ K V+SF S+R++E
Sbjct  92   YDITSANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A+I+ R+AFGK    ++E  E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGRPVNLSENVFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+    +K+D +I+N++ EH       + S +++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRARLTSLRKKIDNLIDNLVAEH----TVNTSSKTNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DNIKAII
Sbjct  266  VLLRLKDSAEF--PLTSDNIKAII  287



>ref|XP_010644547.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 135/207 (65%), Gaps = 7/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F+ +P ++   I+ Y+C+DIAF PYGDYWRQ+RKI ++ELL+ K V+SF S+R++E
Sbjct  98   HDIIFSQRPCILAASIVSYDCTDIAFAPYGDYWRQIRKISILELLSAKRVQSFRSVREEE  157

Query  432  IHSLLAYVRS-TSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLG  256
            +   L  VRS +S  G  +   E +F L  SII R+AFGK    +E F   L++ +   G
Sbjct  158  V---LNLVRSISSQEGVSINLTESIFSLTFSIISRAAFGKKCKDQEAFSVTLEKFAGSGG  214

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH--REKLKNGSESGSSDC  82
             F  ADVFPS ++LH +  G ++++ K H+K+D I+ENII EH  R +    SE+   + 
Sbjct  215  GFTIADVFPSIKLLH-VVSGIRHKLEKIHKKLDTILENIINEHKARSEASEISEAEVDED  273

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL++    G+L  P++ DNIKAI+
Sbjct  274  LVDVLLKVQKQGDLEFPLTTDNIKAIL  300



>emb|CBI39028.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 131/206 (64%), Gaps = 7/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L+ +KI+ Y+  DI F PYGDYWRQ+RKICV+ELL  K V+SF  +R++E
Sbjct  26   HDINFAQRPPLLASKILSYDSMDIVFSPYGDYWRQLRKICVVELLTAKRVKSFQLVREEE  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  + S S   + +   E +F    SII R+A G+ F G++ F+  +KEI EL   
Sbjct  86   LSNLITAIVSCS---RPINLTENIFSSTFSIIARAAIGEKFEGQDAFLSVMKEIVELFSG  142

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKN--GSESGSSDCL  79
            F  AD++PS + L  L  G + ++ K  ++ D +++NI+ +HREKLK   G   G  D L
Sbjct  143  FCVADMYPSVKWLD-LISGMRYKLDKVFQRTDRMLQNIVDQHREKLKTQAGKLQGEGD-L  200

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+     G+L  P++ +NIKA+I
Sbjct  201  VDVLLELQQHGDLEFPLTDNNIKAVI  226



>dbj|BAM68814.1| putative cytochrome P450 monooxygenase CYP71AV11 [Artemisia japonica]
Length=496

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 132/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ F  +PE ++ +II Y+ +DI F PYG+YWRQ+RKIC ++LL+ K V+S+ S+R++E
Sbjct  100  YDITFGNRPETLSGEIIGYHNTDIVFAPYGEYWRQVRKICTLDLLSAKKVKSYQSLREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A I CR+AFGK     +EF E +KE+    G 
Sbjct  160  CWNLVQEIKA-SGSGRPVNLSENIFKLIAMIFCRAAFGKGIKEHKEFTENVKEMLRETGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
             D  D+FPS + LH L  G + R+   H+K+D II N++ EH  K    + S +++ L+D
Sbjct  219  LDVEDIFPSKKFLHHL-SGKRARLTSIHKKLDNIINNVVAEHNVK----TASKTNETLLD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS   +  ++ DN+KAII
Sbjct  274  VLLRLKDSAEFQ--LTADNVKAII  295



>dbj|BAM68813.1| cytochrome P450 monooxygenase CYP71AV11 [Artemisia campestris]
Length=496

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 132/204 (65%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ F  +PE ++ +II Y+ +DI F PYG+YWRQ+RKIC ++LL+ K V+S+ S+R++E
Sbjct  100  YDITFGNRPETLSGEIIGYHNTDIVFAPYGEYWRQVRKICTLDLLSAKKVKSYQSLREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G+ V   E +F L+A I CR+AFGK     +EF E +KE+    G 
Sbjct  160  CWNLVQEIKA-SGSGRPVNLSENIFKLIAMIFCRAAFGKGIKEHKEFTENVKEMLRETGG  218

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
             D  D+FPS + LH L  G + R+   H+K+D II N++ EH  K    + S +++ L+D
Sbjct  219  LDVEDIFPSKKFLHHL-SGKRARLTSIHKKLDNIINNVVAEHNVK----TASKTNETLLD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS   +  ++ DN+KAII
Sbjct  274  VLLRLKDSAEFQ--LTADNVKAII  295



>ref|XP_003611884.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94842.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 134/208 (64%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P+L + KI+ Y   DI F PYGDYWRQMRKICV+E+L+ K V+SFS IR+DE
Sbjct  98   HDVVFANRPKLPSLKILAYGFKDIVFSPYGDYWRQMRKICVLEILSAKRVQSFSYIREDE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
                +  ++S +G    +    R+F ++ SII R+A G     +EEF+  +++   +   
Sbjct  158  TKKFIESIKSFAGSK--INLTTRIFSVINSIILRAALGDKSEDQEEFVSLIRKAVAVSSG  215

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDC---  82
             +  D+FPS +++H L G  KN + K H++VD I++N++++H+EK   G+E   S+    
Sbjct  216  LELIDLFPSMKLIHVLTGMKKN-VEKIHKRVDKILDNVVRKHQEKRARGNEGNKSEIEKE  274

Query  81   -LIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R   SG+L V ++ +NIKA+I
Sbjct  275  DLVDVLLRVQQSGSLDVQLTINNIKAVI  302



>ref|XP_006346274.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 136/210 (65%), Gaps = 14/210 (7%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAF+ +P+ ++  I FYN  +IAFCP+ +YW+QMRKIC ++LL+ K V+SF +IR+DE
Sbjct  115  HDLAFSDRPQSMSTNITFYNNKNIAFCPHDNYWKQMRKICNVQLLSVKMVKSFGAIRKDE  174

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            I S ++ +RST G    +   E++F    S+ C + FGK+F  R+EF++ LK++  L+  
Sbjct  175  ISSPVSSIRSTKGSP--INMTEKIFWFTNSVTCSAPFGKIFKNRDEFIKLLKDMVILVSG  232

Query  252  FDFADVFPSWRVLHGLF--GGNKNRIIKAHRKVDAIIENIIKEHRE----KLKNGSESGS  91
            FD AD F     L G +   G ++R++  H+KVD I+E+I+KEH E    + K   E G 
Sbjct  233  FDVADFF-----LLGSYKLSGVESRLMNVHKKVDEIMEDILKEHLENKATRNKGIGEFGG  287

Query  90   SDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
             D L+DVL+R  +   L  P ++D+IKA+I
Sbjct  288  ED-LVDVLLRVTEDAELECPFTNDHIKAVI  316



>sp|Q6WKY9.1|C7D95_MENGR RecName: Full=Cytochrome P450 71D95; AltName: Full=(-)-(4S)-Limonene-3-hydroxylase 
[Mentha x gracilis]
 gb|AAQ18708.1| limonene-3-hydroxylase [Mentha x gracilis]
Length=497

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 131/203 (65%), Gaps = 6/203 (3%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D A A + E +  +I++Y+  DI F PY D+WRQMRKICV ELL+ +NVRSF  IRQDE+
Sbjct  96   DPACADRFESIGTRIMWYDNDDIIFSPYSDHWRQMRKICVSELLSARNVRSFGFIRQDEM  155

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              LL +++S++  G+ V   ER+  L  SIICR+AFG +    EE +E +K+   +   F
Sbjct  156  SRLLRHLQSSA--GETVDMTERIATLTCSIICRAAFGAIINDHEELVELVKDSLSMASGF  213

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLIDV  70
            + AD+FPS ++L+ L   NK+++ +  R+VD I+E I++EH  KLK   E G  D +IDV
Sbjct  214  ELADLFPSSKLLN-LLCWNKSKLWRMRRRVDTILEAIVEEH--KLKKSGEFGGED-IIDV  269

Query  69   LIRQMDSGNLRVPISHDNIKAII  1
            L R      ++VPI+ + IKA I
Sbjct  270  LFRMQKDSQIKVPITTNAIKAFI  292



>ref|XP_006364814.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=526

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 142/207 (69%), Gaps = 9/207 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+AF  +PEL++ K++ YNCSDIAF PYG+YWRQMRK+C +ELL+ KNV SF+SIR++E
Sbjct  117  HDIAFTNRPELLSVKVLTYNCSDIAFAPYGNYWRQMRKLCTLELLSAKNVVSFASIREEE  176

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREE---FMEQLKEISEL  262
              +L+ YV S S  G ++   E+++ L  ++ICR+AFGK    +EE   FM  +KE+S +
Sbjct  177  ALNLVQYVESKS--GSIINLTEKIYALTNAVICRAAFGK--RRKEESVYFMSLIKELSLM  232

Query  261  LGSFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDC  82
            +   D ++VFPS + L  +  G K +++K H+K D +++ II+EH+ K  +  ES   + 
Sbjct  233  VSGLDISEVFPSLKFLQ-VITGTKEKLLKLHKKFDKVLDMIIEEHKHKY-DEEESSRKND  290

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+++L++  +SG L    + DNIKA+I
Sbjct  291  LVNLLLKLQESGTLDFSFTADNIKAVI  317



>dbj|BAM68811.1| putative CYP71AV1 ortholog [Artemisia abrotanum]
Length=495

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 131/204 (64%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +I+ Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  99   YDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFRSLREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+   ++ +G G+ V   E +F L+A I+ R+AFGK    ++EF E +KEI    G 
Sbjct  159  CWNLVQEFKA-AGSGRPVNLSENIFKLIARILSRAAFGKGIKDQKEFTEIVKEILRQTGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H K+D +I N++ EH       +   +++ L+D
Sbjct  218  FDVADIFPSKKFLHHL-SGKRARLTSIHMKLDNLINNLVAEH----TVNTSDKTNETLLD  272

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  DS     P++ DN+KAII
Sbjct  273  VLLRLKDSAEF--PLTADNVKAII  294



>sp|Q6IV13.1|C7D95_MENSP RecName: Full=Cytochrome P450 71D95; AltName: Full=Limonene-3-hydroxylase 
[Mentha spicata]
 gb|AAT39473.1| limonene-3-hydroxylase [Mentha spicata]
Length=496

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 130/203 (64%), Gaps = 6/203 (3%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D A A + E +  +I++Y+  DI F PY D+WRQMRKICV ELL+ +NVRSF  IRQDE+
Sbjct  96   DPACADRFESIGTRIMWYDNDDIIFSPYSDHWRQMRKICVSELLSARNVRSFGFIRQDEM  155

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              LL +++S++  G+ V   ER+  L  SIICR+AFG +    EE +E +K+   +   F
Sbjct  156  SRLLRHLQSSA--GETVDMTERIATLTCSIICRAAFGAIINDHEELVELVKDSLSMASGF  213

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLIDV  70
            + AD+FPS ++L+ L   NK+++ +  R+VD I+E I+ EH  KLK   E G  D +IDV
Sbjct  214  ELADLFPSSKLLN-LLCWNKSKLWRMRRRVDTILEAIVDEH--KLKKSGEFGGED-IIDV  269

Query  69   LIRQMDSGNLRVPISHDNIKAII  1
            L R      ++VPI+ + IKA I
Sbjct  270  LFRMQKDSQIKVPITTNAIKAFI  292



>gb|KDP39285.1| hypothetical protein JCGZ_01042 [Jatropha curcas]
Length=505

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 128/204 (63%), Gaps = 3/204 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FAT+P LV  +++ YN +DIAF PYGDYWRQ++KIC MELL  K V+ F+ IRQ+E
Sbjct  97   HDLIFATRPSLVAVQLVTYNFTDIAFAPYGDYWRQIKKICTMELLTAKRVQLFAPIRQEE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  ++  +  TS  G  + F   +  L   I+ RS  GK+  G E F+  + +++E    
Sbjct  157  VSKVITDI--TSNVGSTINFTNVLTSLTYKILSRSTIGKILKGEEGFIRAVMDLTEEGAG  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ AD +PS ++   +FG  K+++ + H++VD +++N+I + R   +          ++D
Sbjct  215  FNLADFYPSIKLFR-MFGSLKHKLKRIHQQVDKMMQNVIDDRRATKRESGVDDEERDIVD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  + G+L++P++ DNIKA+I
Sbjct  274  VLLRIQEQGDLQLPLTDDNIKAVI  297



>ref|XP_004231934.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA +P+L++ +I+  N   ++F PYG  WRQ+RK+CV+ELL+ K V+SF SIR++E
Sbjct  95   HDLIFANRPQLLSVQILSNNSPTLSFSPYGANWRQLRKVCVLELLSAKRVQSFESIREEE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  +         +   E +F +  +I  R+AFGK    ++EF++ +K I+EL G 
Sbjct  155  VDNLIEAISLIQPQVP-IDISEMIFSMTNNITARAAFGKKCKHKDEFIKAMKTITELSGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESG-SSDCLI  76
            FD  D+FPS ++ H L  G K  + K H+KVD I E+II+EH+E  ++ S +    + L+
Sbjct  214  FDIPDLFPSLKIFHSL-SGVKPALEKVHQKVDKIFEDIIQEHKENKRDMSSNMLYKEDLV  272

Query  75   DVLIRQMDSGNLRVPISHDNIKAII  1
            DVL+R  +SG+L +PIS + +K++I
Sbjct  273  DVLLRVQESGDLEIPISRNTLKSVI  297



>gb|ADA70806.1| cytochrome P450 CYP71D177 [Scoparia dulcis]
Length=504

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 131/201 (65%), Gaps = 11/201 (5%)
 Frame = -3

Query  597  ATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEIHSLL  418
            A +PE + ++I++Y+  DI F PY DYWRQMRKIC++ELL+ KNVRSFSSIRQDE   ++
Sbjct  99   ADRPESIGSQIMWYDYRDIIFSPYNDYWRQMRKICMIELLSTKNVRSFSSIRQDEALQMV  158

Query  417  AYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTG--REEFMEQLKEISELLGSFDF  244
              +R++S  G+ V F E +     +I CR+AFGKV     R    E LK+ + +   ++ 
Sbjct  159  ESIRASS--GKPVNFTETILAFTCAITCRTAFGKVMKPEDRHTLSELLKKAAAMAAGYEL  216

Query  243  ADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLIDVLI  64
            AD+FP+      LF  NK +++K  R++D+I++ I+KEH  + K   E G  D ++DVL+
Sbjct  217  ADLFPAL----SLFSVNKYKLMKMRRQMDSILDAIVKEH--EFKQRGEFGGED-IVDVLL  269

Query  63   RQMDSGNLRVPISHDNIKAII  1
            R   +G+L+ PI  DNIKA+I
Sbjct  270  RLKQTGDLQFPIERDNIKAVI  290



>dbj|BAJ39894.1| P450 mono-oxygenase [Zingiber zerumbet]
Length=505

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 130/204 (64%), Gaps = 5/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D  FA +PE    KII Y  SDIAF   G+YWRQ+RKICVMELL  K V+SF S+R+++
Sbjct  97   QDANFAFRPEFTAAKIIAYGQSDIAFS-NGEYWRQLRKICVMELLGAKRVKSFVSLRKEQ  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L++ V + +  G+ V   ER+  L  SI+ +++FG+    +++FME +KE+ ++   
Sbjct  156  VGRLMSDVSNAAAIGKPVNLGERLNELTNSIVVQASFGRRCQQQKKFMETIKEVIKMASG  215

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F   D+FPS +V+  +  G   ++ K H+K+DAI++  IKEH+     G E    + LID
Sbjct  216  FSVGDLFPSLQVVD-VLTGFSTQLKKYHKKLDAILDATIKEHQMTRDGGEE---EEDLID  271

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  D GNL VPI+ DNIKA++
Sbjct  272  VLLRLKDEGNLEVPITFDNIKAVV  295



>emb|CDP07805.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 138/208 (66%), Gaps = 6/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLA + + E++ +KI+ Y+ ++IA  PYG YWRQMRKIC M+LL  + VRSF SI QDE
Sbjct  26   HDLALSDRAEILASKIVCYDSTNIAGSPYGPYWRQMRKICTMKLLGPEKVRSFGSIMQDE  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVF-TGREEFMEQLKEISELLG  256
               L++ +++ S  G  +   E++    +S++ R+AFGKV    ++ F++ LK+   L+ 
Sbjct  86   AWHLISSIQALSVAGAPINLTEKLS-YTSSMVFRAAFGKVSRQHKDTFLQVLKQALPLVS  144

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSD  85
            + D +D+FPS+++LH  F     +++K H+K+D I +NII E  + L   + G    S +
Sbjct  145  TCDVSDLFPSYKILHP-FSRVSTKVMKMHQKIDKIFDNIIAERVDNLARTRKGMGESSDE  203

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             LIDVL+R  +SG+L++PI+++NIKA++
Sbjct  204  DLIDVLLRVKESGDLQIPITNNNIKAVL  231



>ref|XP_011047545.1| PREDICTED: cytochrome P450 71D11-like isoform X2 [Populus euphratica]
Length=508

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 133/207 (64%), Gaps = 7/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H++ F  +P L+  K+++YN  D+ F PYGDYWRQM+K+CV+ELL+ K V+SF SIR++E
Sbjct  99   HEINFVDRPCLLVAKVMYYNSKDVGFAPYGDYWRQMKKVCVLELLSAKRVKSFRSIREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + + +  + S +G    +   + MF L+  I  R++ GK +  +E F+  ++ + E +G 
Sbjct  159  VSNFIRTIYSRAGSP--INLSKMMFDLLNGITTRTSVGKKYKHQEAFLPIMEHLMEAVGG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH---REKLKNGSESGSSDC  82
             + ADVFPS ++L+ +    ++R+ ++H+  D I+ENII EH   RE  K G ES + D 
Sbjct  217  ANIADVFPSSKLLYKI-SRYRSRLERSHQDADEILENIIYEHRVCREVAKTGEESEAED-  274

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+   D G+L  P++ D+IKA I
Sbjct  275  LLDVLLNLQDHGDLGFPLTTDSIKATI  301



>emb|CDP11810.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA++P+L+   II YN + IAF PYGDYWRQ+RKIC +ELL+ K V++F SIR++ 
Sbjct  26   HDIIFASRPKLLAINIISYNATSIAFSPYGDYWRQLRKICTVELLSQKRVQTFRSIREEA  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +++  +      G +V   + +  L  SII ++AFGK    +EEF+    ++++L+  
Sbjct  86   VSNMIRAI--ALQEGSVVNLSKEVSSLTYSIIAQAAFGKKSNYQEEFISTAVDLAQLVSG  143

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ A+++PS ++L  +  G + ++ + HR++D I+ENI+ EHREK     +    + L+D
Sbjct  144  FNLAEMYPSVKILERI-SGMRQKVERTHRRLDEILENILTEHREKRAQPGKGEGKEDLVD  202

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+    SG    P++  N+KA+I
Sbjct  203  VLLNVQKSGEFGAPLTDSNLKAVI  226



>sp|D5JBX0.1|GAO_HELAN RecName: Full=Germacrene A oxidase; Short=HaGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Helianthus annuus]
 gb|ADF43082.1| germacrene A oxidase [Helianthus annuus]
Length=488

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 131/204 (64%), Gaps = 8/204 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            +D+ FA +PE +T +II Y+ +DI   PYG+YWRQ+RK+C +ELL+ K V+SF S+R++E
Sbjct  92   YDIPFANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +L+  +++ SG G      E +F ++A+++ R+AFGK    +++F E +KEI    G 
Sbjct  152  CWNLVQEIKA-SGSGTPFNLSEGIFKVIATVLSRAAFGKGIKDQKQFTEIVKEILRETGG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS + LH L  G + R+   H K+D++I N++ EH         S  ++ L+D
Sbjct  211  FDVADIFPSKKFLHHL-SGKRGRLTSIHNKLDSLINNLVAEH----TVSKSSKVNETLLD  265

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  +S     P++ DN+KAII
Sbjct  266  VLLRLKNSEEF--PLTADNVKAII  287



>ref|XP_011087047.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=498

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 128/205 (62%), Gaps = 8/205 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLAF+++  L +  II YN  D+   PYGDYW+QMR+IC  ELL+ KNVRSFS+IR +E
Sbjct  95   HDLAFSSRARLPSLAIITYNYQDMVMAPYGDYWKQMRRICFSELLSSKNVRSFSTIRDEE  154

Query  432  IHSLLAYVRSTSGHGQLVK--FPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELL  259
              +L+  +RS   H  L+     +++      ++CR+AFGK   G++EF+  + E     
Sbjct  155  AVNLVESIRS---HPSLMPMDLAQKVLSYTNDVLCRAAFGKSRGGKDEFLPLIIEFGTSS  211

Query  258  GSFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCL  79
            G FD AD+FPS   L  +  G + +++K H K+D ++  II EH E+L+ G    + + +
Sbjct  212  GGFDVADLFPSITFLPAV-TGLRTKLMKLHHKLDQVLNVIIDEHMERLRFGQH--AEEDI  268

Query  78   IDVLIRQMDSGNLRVPISHDNIKAI  4
            +DVL+R  + GNL  PI+ DNIKAI
Sbjct  269  VDVLLRFKEKGNLEFPITLDNIKAI  293



>ref|XP_011081932.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=505

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 137/204 (67%), Gaps = 5/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D A A +PE +  +I++Y+  D+ F PY  YWRQMRKIC +ELL+ KNVRSF  IRQ+E
Sbjct  100  QDPACANRPESIGIQIMWYDYVDMTFSPYNGYWRQMRKICTLELLSAKNVRSFGYIRQEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  LL  +RS+SG    +   +++F   +S+ICR++ GKV   R++ +E LK+   + G 
Sbjct  160  LSLLLESLRSSSGEA--INLTQKVFAFTSSVICRASLGKVMRDRDKLIEMLKKAVAMAGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            F+ AD+FPS +++H +   NK ++++  RK+DAI++ I++EH  KLK   +    + ++D
Sbjct  218  FELADLFPSSKLMH-VLCWNKYKLLRMRRKLDAILDVILEEH--KLKKSGDVSRGEDIVD  274

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   +G L+ PI++DNIKA+I
Sbjct  275  VLLRMQKNGELQFPITNDNIKAVI  298



>ref|XP_004295868.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 132/206 (64%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  FA++P L+   I+ YN ++I F  YGDYWRQ+RKIC +E+L+ K V+S+  IR++E
Sbjct  98   HDATFASRPHLLAADIVSYNSTNIVFAKYGDYWRQLRKICTLEVLSPKRVQSYRPIREEE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+ ++ S +     +   E+++L   +I  R+AFGK     EEF++ +KE  +L G 
Sbjct  158  MLNLIKWIASKA--RSPINLTEKIYLSTYTITTRAAFGKKSKYHEEFIDAVKEGIQLAGG  215

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK-LKNGSESGSSDCLI  76
            FD ADVFPS+ +LH +  G + ++ +  +K D I+ENIIKEH EK    G E  + + LI
Sbjct  216  FDLADVFPSYSLLH-MITGMRPKLQRLQKKTDRILENIIKEHTEKATSQGGEREAQEHLI  274

Query  75   DVLIR-QMDSGNLRVPISHDNIKAII  1
            +VL++   D+  L   ++ DNIKA+I
Sbjct  275  EVLLKFHKDNCGLEFNLTTDNIKAVI  300



>ref|XP_002310636.2| hypothetical protein POPTR_0007s07310g [Populus trichocarpa]
 gb|EEE91086.2| hypothetical protein POPTR_0007s07310g [Populus trichocarpa]
Length=509

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 132/206 (64%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H++ F  +P L+  K++FYN  DIAF PYGDYWRQM+K+CV+ELL+ K V+SF SIR++E
Sbjct  100  HEINFVDRPCLLVAKVMFYNSKDIAFAPYGDYWRQMKKVCVLELLSAKRVKSFRSIREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + + +  + S +G    +   + MF L+  I  R++ GK +  +E F+  ++ + E +G 
Sbjct  160  VSNFIRTIYSKAGSP--INLSKMMFDLLNGITARTSVGKKYKHQEAFLPIIEHVMEAMGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHR--EKLKNGSESGSSDCL  79
             + ADVFPS ++L+ +    ++R+ ++H+  D I+ENII EHR   ++    E   ++ L
Sbjct  218  MNIADVFPSSKLLY-MISRFRSRLERSHQDADEILENIIYEHRVCREVAKTDEESEAENL  276

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+   + G+L  P++ D+IKA I
Sbjct  277  LDVLLNLQNHGDLGFPLTTDSIKATI  302



>ref|XP_007146609.1| hypothetical protein PHAVU_006G054600g [Phaseolus vulgaris]
 gb|ESW18603.1| hypothetical protein PHAVU_006G054600g [Phaseolus vulgaris]
Length=453

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 131/205 (64%), Gaps = 4/205 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FAT+P+++ ++II YN +DI F PYG+YWRQ+RKIC +ELL+ K V SF  IR+DE
Sbjct  96   HDINFATRPKILASEIISYNSTDIVFAPYGNYWRQLRKICTLELLSLKRVNSFQPIREDE  155

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+ ++ S  G    +   + +   + SI  RSAFGK +  ++ F+ ++K++ +L+G 
Sbjct  156  LSNLVKWIDSEKGSP--INLTQAVLSSIYSIASRSAFGKKYKDQQNFIAEVKKLIKLVGG  213

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSE-SGSSDCLI  76
            FD  D+FPS   L  +  G + ++ + H++VD I+E II EH+E      +    ++ L+
Sbjct  214  FDIGDLFPSATWLQHV-TGIRPKLERLHQQVDQILEGIINEHKEARSEAKDFERETEDLV  272

Query  75   DVLIRQMDSGNLRVPISHDNIKAII  1
            DVLI+  D  N    ++ +NIKAII
Sbjct  273  DVLIQYEDGSNQDFTLTRNNIKAII  297



>gb|KDO37182.1| hypothetical protein CISIN_1g010699mg [Citrus sinensis]
Length=503

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 130/207 (63%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA++P +   +I+ Y+ SDIAF PYG YWR ++KICV ELL  K V+SF SIR++E
Sbjct  92   HDLVFASRPHVPAAQILSYDFSDIAFAPYGPYWRTLKKICVTELLGVKRVQSFRSIREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+ ++ S +  G +V   E++FLLM SI  R+AFGK     E F   + E +E+   
Sbjct  152  VTNLVDWIGSKA--GSVVNLTEKVFLLMCSITSRAAFGKKNEDIEAFQAVVSEATEMFAG  209

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
               AD++PS + L  L  G K ++ + H K D I+  I+++H+++    S+SG     + 
Sbjct  210  SSIADLYPSIKFLLAL-TGVKAKMQRMHNKTDKILSKIVEDHKKRRAMRSKSGKKEEVED  268

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL++  + GNL  P++  N+KA++
Sbjct  269  LVDVLLKAQEDGNLEFPLTTKNVKAVV  295



>ref|XP_003610580.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92777.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 128/204 (63%), Gaps = 6/204 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL+F  +PEL+  KI+ Y+ +DI + PYGDYWRQMRKIC  +LL+ K V  FSSIR++E
Sbjct  100  HDLSFVQRPELLAPKILSYDSTDIVYAPYGDYWRQMRKICTSQLLSAKRVHYFSSIREEE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  ++ +      +   +  F L+++ + R+AFGK     +E +  LK+  E+   
Sbjct  160  VQKLIQSIQVSLSLP--LNVTKTAFSLVSTFVSRAAFGKKSKYEDELLSLLKQTVEMASG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD AD+FPS++ +H L    K ++    +K+D I+E+IIKEH+    +G +    + L+D
Sbjct  218  FDPADLFPSFKPIH-LITRTKAKLQNMQKKLDKILESIIKEHQSNSIHGKQ---GENLVD  273

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R   S N  +PI+ DN+KA++
Sbjct  274  VLLRVQQSDNFDIPITDDNVKAVL  297



>ref|XP_002522762.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39613.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 130/207 (63%), Gaps = 8/207 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L+   +  YN +DIAF PYGDYWRQMRK+C +ELL  K V+SF SIR++E
Sbjct  98   HDVVFAQRPHLLAASVTSYNYTDIAFAPYGDYWRQMRKLCTLELLTAKRVQSFRSIREEE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMF-LLMASIICRSAFGKVFTGREEFMEQLKEISELLG  256
            +  L+  + S++  G  + F  RMF  L  SII R++FGK++ G E F+  +K++    G
Sbjct  158  VSRLMRSLSSSA--GSPINF-SRMFNSLTYSIISRASFGKIWKGEEIFIPIVKKLIVAAG  214

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK--LKNGSESGSSDC  82
             F  ADV+PS ++LH +  G   R+ + H  VD I +NII +HR K    N S  G  D 
Sbjct  215  GFTLADVYPSVKLLHWI-SGMAPRLKRIHHIVDNIFQNIIDDHRTKRAAANSSVEGEGD-  272

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+      +L VPI++DNIK II
Sbjct  273  LVDVLLNFQAQEDLAVPITNDNIKGII  299



>ref|XP_007020556.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12081.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=508

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 127/206 (62%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H + FA +P+L++  II Y   DI   PYGDYWRQ+RKIC +ELL  K V+SF SIRQ+E
Sbjct  98   HGIVFAQRPQLLSMSIITYGFRDIGMAPYGDYWRQVRKICTVELLTAKQVQSFHSIRQEE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  V  +S  G  +    ++F L   I  R+AFG     +E F   ++E+ +L+  
Sbjct  158  VSALVKSV--SSNEGSQINLSNKIFSLTYGITSRAAFGNKCKDQETFSSTIREVVKLISG  215

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG--SESGSSDCL  79
            F  AD++PS+RVL  L  G + ++   H+K D I++ II EHRE++++G  SE  + + L
Sbjct  216  FSIADMYPSFRVLQ-LISGLRQKLGTLHQKSDKILQGIIDEHRERMESGKISEGEAKEDL  274

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            + VL++      L  P++ +NIKA+I
Sbjct  275  VTVLLKIQQLDYLEFPLTDNNIKAVI  300



>ref|XP_009385309.1| PREDICTED: premnaspirodiene oxygenase-like [Musa acuminata subsp. 
malaccensis]
Length=508

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 128/206 (62%), Gaps = 6/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D+ FA++P+LV  ++I Y  +DI + PYG YW+Q+R+IC MELL  K +RSF+SIR +E
Sbjct  99   QDITFASRPQLVAAQVIVYGATDIGWTPYGPYWKQLRRICFMELLGTKRIRSFTSIRTEE  158

Query  432  IHSLLAYV-RSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLG  256
               L+  + RS + H   +   E++F L  +I+CR+AFGK +  RE F+  +KE  +LLG
Sbjct  159  TLDLMRDISRSETEH---IDLSEKLFGLANAIVCRAAFGKRWDRRERFVTIIKETFDLLG  215

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK-LKNGSESGSSDCL  79
                AD FPS   L  +  G+ +++ +  R++D I+  +IKEH  K   + SE      L
Sbjct  216  GLCLADTFPSLNFLD-ILTGSMSKMQRVRRQMDDILGEVIKEHEVKAATSNSERVDEVDL  274

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+R  D   L +P++ DN+KA+I
Sbjct  275  VDVLLRLKDDPKLEIPMTTDNVKAVI  300



>gb|KDP39288.1| hypothetical protein JCGZ_01045 [Jatropha curcas]
Length=463

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 130/207 (63%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD  FA +P L+   I+ YN +D+AF PYGDYWRQMR+IC  E+L+ K V+SF  IR++E
Sbjct  53   HDHIFAQRPFLLAANIMAYNSTDLAFAPYGDYWRQMREICTQEMLSNKRVQSFGLIREEE  112

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+A + S +  G  V F +    +  +II R A GK++ G E  +  +K++ E  G 
Sbjct  113  VSKLIAELSSRA--GSTVNFSKMFNSVTYNIIQRVAIGKLWKGEEVVIPAIKKLIEASGG  170

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGS---SDC  82
            F  +DV+PS ++LH +    K ++ +AH++ D I +NII EHR +  + ++SG+    + 
Sbjct  171  FSLSDVYPSIKLLHKI-STTKFKLQRAHKEADRIFQNIIDEHRARRASRAKSGAKNEEED  229

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            LIDVL++     +L  PI+ DNIKA+I
Sbjct  230  LIDVLLQAQSKEDLEFPITDDNIKAVI  256



>ref|XP_011047544.1| PREDICTED: cytochrome P450 71D11-like isoform X1 [Populus euphratica]
Length=508

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 132/207 (64%), Gaps = 7/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H++ F  +P L+  K+++YN  D+ F PYGDYWRQM+K+CV+ELL+ K V+SF SIR++E
Sbjct  99   HEINFVDRPCLLVAKVMYYNSKDVGFAPYGDYWRQMKKVCVLELLSAKRVKSFRSIREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + + +  + S +G    +   + MF L+  I  R++ GK +  +E F+  ++ + E +G 
Sbjct  159  VSNFIRTIYSRAGSP--INLSKMMFDLLNGITARTSVGKKYKHQEAFLPIIEHVMEAIGG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH---REKLKNGSESGSSDC  82
             + ADVFPS ++L+ +    ++R+ ++H+  D ++ENII EH   RE  K G ES + D 
Sbjct  217  ANIADVFPSSKLLYKI-SRFRSRLKRSHQDADEMLENIIYEHRVCREVAKTGEESKAED-  274

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+   D G+L  P+  D+IKA I
Sbjct  275  LLDVLLNLQDHGDLGFPLRTDSIKATI  301



>ref|XP_006452560.1| hypothetical protein CICLE_v10008075mg [Citrus clementina]
 ref|XP_006474919.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65800.1| hypothetical protein CICLE_v10008075mg [Citrus clementina]
Length=503

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 130/207 (63%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA++P +   +I+ Y+ SDIAF PYG YWR ++KICV ELL  K V+SF SIR++E
Sbjct  92   HDLVFASRPHVPAAQILSYDFSDIAFAPYGPYWRTLKKICVTELLGVKRVQSFRSIREEE  151

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+ ++ S +  G +V   E++FLLM SI  R+AFGK     E F   + E +E+   
Sbjct  152  VTNLVDWIGSKA--GSVVNLTEKVFLLMCSITSRAAFGKKNEDIEAFQAVVSEATEMFAG  209

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---DC  82
               AD++PS + L  L  G K ++ + H K D I+  I+++H+++    S+SG     + 
Sbjct  210  SSIADLYPSIKFLLAL-TGVKAKMQRMHNKTDKILSKIVEDHKKRRAMRSKSGKKEEVED  268

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL++  + GNL  P++  N+KA++
Sbjct  269  LVDVLLKAQEDGNLEFPLNTKNVKAVV  295



>gb|KDP39024.1| hypothetical protein JCGZ_00781 [Jatropha curcas]
Length=537

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 129/206 (63%), Gaps = 7/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F+ +P L+  +IIFYN  DIA  PYGD WRQMRKIC +ELL+ K VRSF +IR++E
Sbjct  95   HDIIFSQRPFLLAGEIIFYNFKDIALAPYGDSWRQMRKICTLELLSTKRVRSFRAIREEE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +   ++RS S   + V   + +  L  +I  RSAFGKV    E F+  +++I  +L  
Sbjct  155  TSN---FIRSISSLSE-VNISKMVLSLSNAITLRSAFGKVSERHEAFLPLVQKIVLVLEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHRE--KLKNGSESGSSDCL  79
            F  AD+FPS + LHG+ G  +++I K H++ D ++ENII EHRE  +L   +  G  D L
Sbjct  211  FSVADIFPSVKFLHGIIGM-RSKIEKLHQEADIMLENIINEHRENKRLGRSNTQGKEDDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+      +L  P+  +NIKA++
Sbjct  270  VDVLLNLQCGDSLEFPLRIENIKAVM  295



>ref|XP_007020549.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY12074.1| Cytochrome P450 [Theobroma cacao]
Length=504

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 126/205 (61%), Gaps = 4/205 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L+   I+ YN +DIAF PYG YWRQ+RKIC +E+L  K V+SFS IR++E
Sbjct  95   HDILFANRPYLLCANIVSYNATDIAFSPYGAYWRQLRKICTLEMLTSKRVQSFSPIREEE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  + S +G    V   + ++ L   I+ R+AFG     + EF    +E  +L   
Sbjct  155  VSKLVRAISSKAGSP--VNLSKMLYSLTYEIVSRTAFGGKCKDKGEFTLLFREAIKLGAG  212

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHR-EKLKNGSESGSSDCLI  76
            F  +D+FPS ++L  L  G + ++ + H+KVD I+EN+I EH+  K    S  G SD L+
Sbjct  213  FTVSDLFPSVKLLQFL-NGLRPKLERLHQKVDKILENVINEHKASKGMAKSGEGESDDLV  271

Query  75   DVLIRQMDSGNLRVPISHDNIKAII  1
            DVL+   + GNL  P++ DNIKA++
Sbjct  272  DVLLTLQEHGNLEFPLTTDNIKAVL  296



>gb|KDP39022.1| hypothetical protein JCGZ_00779 [Jatropha curcas]
Length=458

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 129/206 (63%), Gaps = 7/206 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F+ +P L+  +IIFYN  DIA  PYGD WRQMRKIC +ELL+ K VRSF +IR++E
Sbjct  49   HDIIFSQRPFLLAAEIIFYNFKDIALAPYGDSWRQMRKICTLELLSTKRVRSFRAIREEE  108

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +   ++RS S   + V   + +  L  +I  RSAFGKV    E F+  +++I  +L  
Sbjct  109  TSN---FIRSISSLSE-VNISKMVLSLSNAITLRSAFGKVSERHEAFLPLVQKIVLVLEG  164

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHRE--KLKNGSESGSSDCL  79
            F  AD+FPS + LHG+  G ++++ K H++ D ++ENII EHRE  +L   +  G  D L
Sbjct  165  FSVADIFPSVKFLHGI-TGMRSKMEKLHQEADIMLENIINEHRENKRLGRSNSQGKEDDL  223

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+      +L  P+  +NIKA++
Sbjct  224  VDVLLNLQCGDSLEFPLRIENIKAVM  249



>ref|XP_006363816.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363817.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=503

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 131/204 (64%), Gaps = 5/204 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P+L++ +I+  N   ++F PYG  WRQ+RK+CV+ELL+ K V+SF SIR++E
Sbjct  97   HDIIFANRPQLLSVQILSNNSPTLSFSPYGANWRQLRKVCVLELLSAKRVQSFESIREEE  156

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  +         +   E +F +  +I  R+AFGK    ++EF++ +K I+EL G 
Sbjct  157  VENLIEAISFIQPQVP-IDISEMLFSMTNNITARAAFGKKCKHKDEFIKAMKTITELSGG  215

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLID  73
            FD  D+FPS ++ H L  G ++ + K H+ VD I E+II+EH+    N  +    + L+D
Sbjct  216  FDIPDLFPSLKIFHSL-SGVRSALEKVHQNVDKIFEDIIQEHK---ANKRDMLYKEDLVD  271

Query  72   VLIRQMDSGNLRVPISHDNIKAII  1
            VL+R  +SG+L +PIS + +K++I
Sbjct  272  VLLRVQESGDLEIPISRNTLKSVI  295



>ref|XP_007212458.1| hypothetical protein PRUPE_ppa017406mg [Prunus persica]
 gb|EMJ13657.1| hypothetical protein PRUPE_ppa017406mg [Prunus persica]
Length=331

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 132/207 (64%), Gaps = 6/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDL FA++P ++  +I+ Y+ +DI F PYG+YWRQ+RKIC +ELL+ K V+S+  IR++E
Sbjct  99   HDLIFASRPHVLAIRILSYDFTDIVFAPYGEYWRQLRKICTLELLSAKRVQSYQPIREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  + S +G    +   + ++    +I  R+AFGK    +E+F+  +KE+++    
Sbjct  159  VRNLIKSIASRAGSP--INLTQEIYSSTYTITSRAAFGKKNRDQEKFIYIVKEVAKAASG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKN--GSESGSSDCL  79
            F  ADVFPS  +LH L  G + ++ K H++ D I+ NIIKEH+  + N    E  + + L
Sbjct  217  FTLADVFPSVSLLH-LLSGMRPKLEKLHKEADRIMGNIIKEHQRDMVNTKSGEGEAEEDL  275

Query  78   IDVLIRQMDSGN-LRVPISHDNIKAII  1
            +DVL++  D GN L   ++ +NIKA+I
Sbjct  276  VDVLLKFHDHGNELEFSLTTENIKAVI  302



>gb|AJD25165.1| cytochrome P450 CYP71D412 [Salvia miltiorrhiza]
Length=502

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 131/217 (60%), Gaps = 17/217 (8%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D +FA +P+ V  +I++Y    IAFCPYGDYWRQMRKIC+ ELL+ + VRS++SIR+DE 
Sbjct  84   DPSFAGRPQGVAMEIMWYGYQSIAFCPYGDYWRQMRKICINELLSPRMVRSYASIRRDEA  143

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              L+  +R +SG    V   E++F    SI CR+AFG V   +E  ++ + E  ++ G F
Sbjct  144  ARLVDSLRESSGRS--VNLTEKVFTFSCSITCRAAFGGVCEDKEGLIKVMMETVKMAGGF  201

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK----------NGSE  100
            +  D+FPS R++  L   +K R+ K  R++D I++++I +H E L           +G  
Sbjct  202  EIEDIFPSSRIVRAL-SWSKTRLKKMRRRLDVILDDVIDQHEENLAKMAAPEIQEDSGRR  260

Query  99   SGSSDC----LIDVLIRQMDSGNLRVPISHDNIKAII  1
            SG+ +      +DVL+R      L++P  +D+IKA++
Sbjct  261  SGNGEFGGEDFVDVLLRMKGGEELKIPFGYDSIKAVL  297



>gb|KHN08403.1| Cytochrome P450 71D8 [Glycine soja]
Length=434

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 128/208 (62%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD++F  +P LV  ++I Y    IAF PYGD+WRQMRK+C  ELL+ K V+SF+SIR+DE
Sbjct  26   HDVSFLQRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASIREDE  85

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQL-KEISELLG  256
                +  +R ++G    +    R+F L+ + I R AFG ++  ++EF+  L ++I E  G
Sbjct  86   AAKFIDLIRESAGSP--INLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGG  143

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---D  85
             FD ADVFPS   L+    G   R+ K H++VD ++ENIIK+H EK K+  E G+     
Sbjct  144  GFDLADVFPSIPFLY-FITGKMARLKKLHKQVDKVLENIIKDHHEKNKSAKEDGAEVEDQ  202

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
              ID+L+R      L + ++ +NIKA+I
Sbjct  203  DFIDLLLRIQQDDTLGIEMTTNNIKALI  230



>gb|KDP39284.1| hypothetical protein JCGZ_01041 [Jatropha curcas]
Length=459

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 132/207 (64%), Gaps = 7/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P L+   I+ YNC+D+ F PYG+YWRQ+RKI ++ELL  K V+SF SIR+++
Sbjct  49   HDVIFAQRPSLLAGIIVGYNCTDLTFAPYGEYWRQVRKISMLELLTAKRVQSFKSIREEQ  108

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            +  L+  +  +SG G  + F + +  L  +II  +AFGKV++G E F+  +K++ E    
Sbjct  109  MSKLIREM--SSGSGSPINFSKMVNSLTYNIISTAAFGKVWSGEEMFIPAVKKVIEAAAG  166

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKL---KNGSESGSSDC  82
               AD++PS ++   +F   K+++++  +++D I +NII EHR +    K G ES  +D 
Sbjct  167  LSLADLYPSIKLFQ-MFSTLKHKLLRVQKELDEIFQNIIDEHRARRMEGKPGLESEEAD-  224

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
             +DVL+R  D  + + P++ + IKAII
Sbjct  225  FVDVLLRFQDQEDFQFPVTDEKIKAII  251



>ref|XP_004512032.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=508

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ FA +P+L++ +I+ Y   DI F PYGDYWRQMRKICV+E+L+ K V+SFS IR+DE
Sbjct  100  HDVVFANRPKLLSPQILAYGFKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYIREDE  159

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
                +  ++S S  G  +    R+F ++ SII R+AFG     ++EF+  +++   L G 
Sbjct  160  TTKFIKSIKSFS--GSTINLTSRIFSVINSIISRAAFGDKSEDQDEFVSLIRKAIALSGG  217

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSE----SGSSD  85
             +  D+FPS + +H +  G K++  K H++VD I++N++++H EK     +        +
Sbjct  218  LELDDLFPSMKPIH-ILTGMKSKFEKIHKRVDKILDNVVRKHEEKRAITKDEKKIEAEKE  276

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
             L+DVL+R   SG+L + ++ +NIKA+I
Sbjct  277  DLVDVLLRVQQSGSLDIQMTINNIKAVI  304



>ref|XP_004501854.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=509

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 128/212 (60%), Gaps = 18/212 (8%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HDLA A++P+L + K +FYNC+DIAF PY  YWR +RKIC++ELL+ K V S+SS+R++E
Sbjct  104  HDLALASRPQLFSAKYLFYNCTDIAFAPYSAYWRHVRKICILELLSAKRVHSYSSVREEE  163

Query  432  IHSLLAYVR-STSGHGQLVKFPERMFLLMASIICRSAFGKVFT-----GREEFMEQLKEI  271
            + SL+  V  S  G   L K    + L   +++CR AFG+ F+      +  F + L E 
Sbjct  164  VASLVHRVAGSYPGTTNLSKM---LGLYANNVVCRVAFGRDFSEAGDHKKHGFQKMLDEY  220

Query  270  SELLGSFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHR--EKLKNGSES  97
             ELLG F   D FPS   +H L  G K R+++  RK D +I+ I+ EHR   K+K   + 
Sbjct  221  QELLGGFSVGDFFPSLEFIHSL-TGMKARLLETSRKFDQLIDQIVNEHRACNKIKEHKD-  278

Query  96   GSSDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
                 L+D+L+     G+  +P++ DNIKAII
Sbjct  279  -----LVDILLEVQKDGSGEMPLTIDNIKAII  305



>sp|Q9XHE6.1|C71DF_MENPI RecName: Full=Cytochrome P450 71D15; AltName: Full=(-)-(4S)-Limonene-3-hydroxylase; 
AltName: Full=Cytochrome P450 isoform 
PM2 [Mentha x piperita]
 gb|AAD44152.1| cytochrome p450 isoform PM2 [Mentha x piperita]
 gb|ABW86882.1| limonene hydroxylase [Mentha x piperita]
Length=498

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 127/203 (63%), Gaps = 6/203 (3%)
 Frame = -3

Query  609  DLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDEI  430
            D A A + E +  +I++Y+  DI F PY ++WRQMRKICV ELL+ +NVRSF  IRQDE+
Sbjct  97   DPACANRFESIGTRIMWYDNEDIIFSPYSEHWRQMRKICVSELLSSRNVRSFGFIRQDEV  156

Query  429  HSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGSF  250
              LL ++RS++G    V   ER+  L  SIICR+AFG V     E +  +K+   +   F
Sbjct  157  SRLLRHLRSSAGAA--VDMTERIETLTCSIICRAAFGSVIRDNAELVGLVKDALSMASGF  214

Query  249  DFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSSDCLIDV  70
            + AD+FPS ++L+ L   NK+++ +  R+VD I+E I+ EH  K K   E G  D +IDV
Sbjct  215  ELADMFPSSKLLN-LLCWNKSKLWRMRRRVDTILEAIVDEH--KFKKSGEFGGED-IIDV  270

Query  69   LIRQMDSGNLRVPISHDNIKAII  1
            L R      ++VPI+ ++IKA I
Sbjct  271  LFRMQKDTQIKVPITTNSIKAFI  293



>ref|XP_011014080.1| PREDICTED: cytochrome P450 71D11-like [Populus euphratica]
Length=508

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 132/207 (64%), Gaps = 7/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H++ F  +P L+  +++FYN  DIAF PYGDYWRQM+K+CV ELL+ K V+SF SIR++E
Sbjct  99   HEINFVDRPCLLVAEVMFYNSKDIAFAPYGDYWRQMKKVCVSELLSAKRVKSFRSIREEE  158

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + + +  + S +G    +   + +F L+  I  R++ GK +  +E F+  ++ + E +G 
Sbjct  159  VSNFIRTIYSRAGSP--INLSKMIFHLLNGITARTSVGKKYKHQEAFLPIIEHVMEAIGG  216

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEH---REKLKNGSESGSSDC  82
             + ADVFPS ++L+ +    ++R+ ++H+  D ++ENII EH   RE  K G ES + D 
Sbjct  217  ANIADVFPSSKLLYKI-SRFRSRLKRSHQDADEMLENIIYEHRVCREVAKTGEESKAED-  274

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            L+DVL+   D G+L  P+  D+IKA I
Sbjct  275  LLDVLLNLQDHGDLGFPLRTDSIKATI  301



>ref|XP_009419189.1| PREDICTED: premnaspirodiene oxygenase-like [Musa acuminata subsp. 
malaccensis]
Length=508

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 126/207 (61%), Gaps = 7/207 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
             D  FA +PE+V   I+FY CSD+ F PYG YW+Q+R IC MELL  K VRSF+SIR++E
Sbjct  98   QDPNFAARPEVVVGDIVFYGCSDVIFSPYGPYWKQLRYICFMELLRTKRVRSFASIREEE  157

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
                L  +R  S   Q +   E++F +  +II R+A G     +E F+   +E+ ++LG 
Sbjct  158  T---LNVIRDISTAAQPINMREKLFRMSNAIISRAAIGPRSKHQETFILVAREVIDVLGE  214

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREK--LKNGSESGS-SDC  82
            F   D+FPS +++H +  G KN++ +  R++D I ++IIKEH  K  +  G +     + 
Sbjct  215  FYAVDMFPSLKLIH-VLSGAKNKLQRIRRRLDKIFDDIIKEHEVKANMNKGRQVAEVEED  273

Query  81   LIDVLIRQMDSGNLRVPISHDNIKAII  1
            ++D L+R  D   L+VP++ D IKA+I
Sbjct  274  IVDALLRLKDESELQVPMTMDGIKAVI  300



>ref|XP_007099625.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY20406.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=655

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 128/206 (62%), Gaps = 5/206 (2%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            H + FA +P+L++  II Y+  DI   PYG+YWRQ+RKIC +ELL  K V+SF SIRQ+E
Sbjct  245  HGIVFAQRPQLLSMSIITYDFRDIGMAPYGNYWRQVRKICTVELLTAKQVQSFHSIRQEE  304

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
            + +L+  +  +S  G  +   +++F L   I  R+AFG     +E F   L+E  +L+  
Sbjct  305  VSALVKSI--SSNEGSQINLSDKIFSLTYGITSRAAFGNKCKDQETFSSTLREEVKLISG  362

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG--SESGSSDCL  79
            F  AD++PS+RVL  L  G + ++   H+K D I++ II EHRE+++ G  SE  + + L
Sbjct  363  FSIADMYPSFRVLQ-LISGMRQKLGTLHQKSDTILQGIIDEHRERMERGKISEGEAKEDL  421

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            + VL+R     +L  P++ +NIKA+I
Sbjct  422  VTVLLRIQLLDDLEFPLTDNNIKAVI  447



>ref|XP_006427937.1| hypothetical protein CICLE_v10025671mg [Citrus clementina]
 gb|ESR41177.1| hypothetical protein CICLE_v10025671mg [Citrus clementina]
Length=428

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 129/213 (61%), Gaps = 11/213 (5%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCS-DIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQD  436
            HDLAFA +PE +  K+++      I   P GDYWRQMRK+C +ELL+ K V+SF+ IR+D
Sbjct  4    HDLAFADRPEFLAFKVLYEKTGMPIVSAPIGDYWRQMRKLCALELLSNKRVKSFAHIRED  63

Query  435  EIHSLLAYVRSTSG--HGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISEL  262
            E  +L+  +RS S   + Q +   + M    +++  R+AFG  F  ++EF+   KEI +L
Sbjct  64   ETLNLIESIRSASATSNSQPINLSKMMVSFTSTVTFRAAFGSRFEQQDEFVSLDKEICKL  123

Query  261  LGSFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLK------NGSE  100
             G F   +VFPS + +H  F G + +I+K H K D I++N+I + RE +K        S 
Sbjct  124  AGGFSLVEVFPSLKFIH-FFSGMEAKILKLHGKADKILDNLINQRRESMKLEKITATASA  182

Query  99   SGSSDCLIDVLIRQMDSGNLRVPISHDNIKAII  1
            SG  + L+DVL+R  ++ +L  PI+  NIK+II
Sbjct  183  SGEEN-LVDVLLRLQETSSLGFPITTKNIKSII  214



>ref|XP_003520242.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=502

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 128/208 (62%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD++F  +P LV  ++I Y    IAF PYGD+WRQMRK+C  ELL+ K V+SF+SIR+DE
Sbjct  94   HDVSFLQRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSAKRVQSFASIREDE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQL-KEISELLG  256
                +  +R ++G    +    R+F L+ + I R AFG ++  ++EF+  L ++I E  G
Sbjct  154  AAKFIDLIRESAGSP--INLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGG  211

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---D  85
             FD ADVFPS   L+    G   R+ K H++VD ++ENIIK+H EK K+  E G+     
Sbjct  212  GFDLADVFPSIPFLY-FITGKMARLKKLHKQVDKVLENIIKDHHEKNKSAKEDGAEVEDQ  270

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
              ID+L+R      L + ++ +NIKA+I
Sbjct  271  DFIDLLLRIQQDDTLGIEMTTNNIKALI  298



>gb|KDP39088.1| hypothetical protein JCGZ_00845 [Jatropha curcas]
Length=460

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 129/206 (63%), Gaps = 9/206 (4%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD+ F  +P L+   II YN  DI F PYGD WRQMRKIC +ELL+ K VRSF +IR++E
Sbjct  95   HDIIFVQRPFLLAANIIMYNSKDIVFAPYGDSWRQMRKICTLELLSTKRVRSFRAIREEE  154

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQLKEISELLGS  253
              +   ++RS S   + V   + +  L  +I  RSAFGKV   +E F+  +++I+ +L  
Sbjct  155  TSN---FIRSISSLSE-VNISKILLSLSNAITLRSAFGKVSERQEAFLPLVQKIALMLEG  210

Query  252  FDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNG--SESGSSDCL  79
            F  AD+FPS + LHG+  G ++++ K H++ D ++ENII EHRE  + G  +  G  D L
Sbjct  211  FSIADIFPSVKFLHGI-TGMRSKLQKLHQEADIMLENIINEHRENKRLGRRNSEGKEDDL  269

Query  78   IDVLIRQMDSGNLRVPISHDNIKAII  1
            +DVL+   D  NL   ++ +N+KA++
Sbjct  270  VDVLLNLQDHDNLE--LTTENMKAVM  293



>ref|XP_003535170.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 ref|XP_003535172.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 ref|XP_003537208.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN08716.1| Cytochrome P450 71D8 [Glycine soja]
 gb|KHN13522.1| Cytochrome P450 71D8 [Glycine soja]
 gb|KHN28263.1| Cytochrome P450 71D8 [Glycine soja]
Length=501

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 129/208 (62%), Gaps = 7/208 (3%)
 Frame = -3

Query  612  HDLAFATKPELVTNKIIFYNCSDIAFCPYGDYWRQMRKICVMELLNGKNVRSFSSIRQDE  433
            HD++F  +P LV  ++I Y    IAF PYGD+WRQMRK+C  ELL+ K V+SF+SIR+DE
Sbjct  94   HDVSFLQRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASIREDE  153

Query  432  IHSLLAYVRSTSGHGQLVKFPERMFLLMASIICRSAFGKVFTGREEFMEQL-KEISELLG  256
                +  +R ++G    +    R+F L+ + I R AFG ++  ++EF+  L ++I E  G
Sbjct  154  AAKFIDSIRESAGSP--INLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGG  211

Query  255  SFDFADVFPSWRVLHGLFGGNKNRIIKAHRKVDAIIENIIKEHREKLKNGSESGSS---D  85
             FD ADVFPS   L+ L  G   R+ K H++VD ++ENII+EH+EK K   E G+     
Sbjct  212  GFDLADVFPSIPFLYFL-TGKMTRLKKLHKQVDKVLENIIREHQEKNKIAKEDGAELEDQ  270

Query  84   CLIDVLIRQMDSGNLRVPISHDNIKAII  1
              ID+L+R      L + ++ +NIKA+I
Sbjct  271  DFIDLLLRIQQDDTLDIQMTTNNIKALI  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 776559819808