BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16023_g2_i1 len=835 path=[813:0-834]

Length=835
                                                                      Score     E

ref|XP_009784644.1|  PREDICTED: pentatricopeptide repeat-containi...    486   3e-165   
ref|XP_006340539.1|  PREDICTED: pentatricopeptide repeat-containi...    478   1e-161   
ref|XP_009596850.1|  PREDICTED: pentatricopeptide repeat-containi...    476   7e-161   
ref|XP_004231485.1|  PREDICTED: pentatricopeptide repeat-containi...    476   7e-161   
ref|XP_011080741.1|  PREDICTED: pentatricopeptide repeat-containi...    454   2e-152   
emb|CDP16313.1|  unnamed protein product                                452   2e-151   
gb|EYU45680.1|  hypothetical protein MIMGU_mgv1a026212mg                448   8e-151   
ref|XP_008224305.1|  PREDICTED: pentatricopeptide repeat-containi...    445   6e-149   
ref|XP_010277136.1|  PREDICTED: pentatricopeptide repeat-containi...    444   9e-149   
gb|KDP40185.1|  hypothetical protein JCGZ_02183                         444   1e-148   
ref|XP_007225674.1|  hypothetical protein PRUPE_ppa002602mg             441   9e-148   
ref|XP_002282622.1|  PREDICTED: pentatricopeptide repeat-containi...    441   2e-147   Vitis vinifera
ref|XP_004303188.1|  PREDICTED: pentatricopeptide repeat-containi...    433   2e-144   
ref|XP_006419949.1|  hypothetical protein CICLE_v10006593mg             432   5e-144   
ref|XP_006489403.1|  PREDICTED: pentatricopeptide repeat-containi...    432   9e-144   
ref|XP_007034774.1|  Pentatricopeptide repeat (PPR) superfamily p...    431   2e-143   
ref|XP_007034772.1|  Pentatricopeptide repeat (PPR) superfamily p...    431   2e-143   
gb|KDO74556.1|  hypothetical protein CISIN_1g007881mg                   427   3e-143   
ref|XP_008390906.1|  PREDICTED: pentatricopeptide repeat-containi...    428   2e-142   
emb|CBI26264.3|  unnamed protein product                                423   1e-141   
ref|XP_011021521.1|  PREDICTED: pentatricopeptide repeat-containi...    425   2e-141   
ref|XP_009335332.1|  PREDICTED: pentatricopeptide repeat-containi...    424   5e-141   
ref|XP_010096136.1|  hypothetical protein L484_005415                   424   5e-141   
ref|XP_002314694.1|  hypothetical protein POPTR_0010s09690g             421   4e-140   Populus trichocarpa [western balsam poplar]
ref|XP_004168898.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    416   9e-139   
ref|XP_004134445.1|  PREDICTED: pentatricopeptide repeat-containi...    416   1e-138   
ref|XP_008438671.1|  PREDICTED: pentatricopeptide repeat-containi...    416   2e-138   
ref|XP_007143263.1|  hypothetical protein PHAVU_007G057700g             416   9e-138   
ref|XP_002870277.1|  hypothetical protein ARALYDRAFT_493409             414   5e-137   
gb|KCW60726.1|  hypothetical protein EUGRSUZ_H03456                     409   5e-136   
ref|XP_004496720.1|  PREDICTED: pentatricopeptide repeat-containi...    411   1e-135   
gb|AAQ65087.1|  At4g14850                                               409   1e-135   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08295.1|  BnaA05g13240D                                          409   2e-135   
ref|XP_009144705.1|  PREDICTED: pentatricopeptide repeat-containi...    410   3e-135   
ref|NP_193221.3|  pentatricopeptide repeat-containing protein LOI1      410   3e-135   Arabidopsis thaliana [mouse-ear cress]
gb|KHN02718.1|  Pentatricopeptide repeat-containing protein             408   4e-135   
ref|XP_010024272.1|  PREDICTED: pentatricopeptide repeat-containi...    408   1e-134   
ref|XP_003536531.1|  PREDICTED: pentatricopeptide repeat-containi...    408   2e-134   
ref|XP_009369851.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    400   2e-134   
ref|XP_008797346.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    407   3e-134   
ref|XP_010435060.1|  PREDICTED: pentatricopeptide repeat-containi...    405   1e-133   
ref|XP_010525197.1|  PREDICTED: pentatricopeptide repeat-containi...    405   2e-133   
ref|XP_010449980.1|  PREDICTED: pentatricopeptide repeat-containi...    405   2e-133   
ref|XP_010917746.1|  PREDICTED: pentatricopeptide repeat-containi...    404   5e-133   
ref|XP_006283247.1|  hypothetical protein CARUB_v10004282mg             404   7e-133   
ref|XP_003617141.1|  Pentatricopeptide repeat-containing protein        402   3e-132   
ref|XP_010440383.1|  PREDICTED: pentatricopeptide repeat-containi...    401   6e-132   
ref|XP_006414633.1|  hypothetical protein EUTSA_v10024593mg             400   9e-132   
gb|KFK43734.1|  hypothetical protein AALP_AA1G165800                    405   1e-131   
gb|KEH43872.1|  PPR containing plant-like protein                       398   1e-130   
ref|XP_009394794.1|  PREDICTED: pentatricopeptide repeat-containi...    394   4e-129   
emb|CDY06488.1|  BnaC06g11560D                                          390   7e-129   
ref|XP_006651923.1|  PREDICTED: pentatricopeptide repeat-containi...    385   5e-126   
gb|EAZ18852.1|  hypothetical protein OsJ_34389                          383   6e-126   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001068161.1|  Os11g0583200                                       385   1e-125   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94388.1|  PPR986-12, putative, expressed                          384   5e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004980647.1|  PREDICTED: pentatricopeptide repeat-containi...    379   2e-123   
gb|EMT05102.1|  hypothetical protein F775_08604                         375   3e-122   
emb|CAB10264.1|  hypothetical protein                                   373   5e-122   Arabidopsis thaliana [mouse-ear cress]
gb|EPS73044.1|  hypothetical protein M569_01710                         374   2e-121   
ref|XP_008667737.1|  PREDICTED: uncharacterized protein LOC100278...    374   4e-121   
ref|XP_002456912.1|  hypothetical protein SORBIDRAFT_03g045330          371   8e-121   Sorghum bicolor [broomcorn]
ref|XP_003575959.1|  PREDICTED: pentatricopeptide repeat-containi...    372   1e-120   
ref|XP_004954668.1|  PREDICTED: pentatricopeptide repeat-containi...    367   1e-118   
ref|XP_010928025.1|  PREDICTED: pentatricopeptide repeat-containi...    281   6e-86    
ref|XP_008373195.1|  PREDICTED: pentatricopeptide repeat-containi...    277   5e-84    
ref|XP_010243118.1|  PREDICTED: pentatricopeptide repeat-containi...    277   6e-84    
gb|KCW82874.1|  hypothetical protein EUGRSUZ_C04243                     276   1e-83    
ref|XP_008775674.1|  PREDICTED: pentatricopeptide repeat-containi...    275   2e-83    
ref|XP_010050039.1|  PREDICTED: pentatricopeptide repeat-containi...    276   3e-83    
ref|XP_010272360.1|  PREDICTED: pentatricopeptide repeat-containi...    276   2e-82    
ref|XP_010272359.1|  PREDICTED: pentatricopeptide repeat-containi...    276   6e-82    
ref|XP_006655248.1|  PREDICTED: pentatricopeptide repeat-containi...    268   1e-81    
gb|ADE77505.1|  unknown                                                 266   1e-81    
ref|XP_010270910.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-81    
ref|XP_008386604.1|  PREDICTED: pentatricopeptide repeat-containi...    265   2e-81    
gb|KDO78644.1|  hypothetical protein CISIN_1g047067mg                   267   2e-81    
ref|XP_008245349.1|  PREDICTED: pentatricopeptide repeat-containi...    269   5e-81    
ref|XP_008678753.1|  PREDICTED: pentatricopeptide repeat-containi...    272   7e-81    
ref|XP_006467236.1|  PREDICTED: pentatricopeptide repeat-containi...    268   9e-81    
emb|CDP09094.1|  unnamed protein product                                265   1e-80    
ref|XP_007214219.1|  hypothetical protein PRUPE_ppa023254mg             265   2e-80    
ref|XP_008799669.1|  PREDICTED: pentatricopeptide repeat-containi...    266   2e-80    
ref|XP_008350106.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    267   2e-80    
ref|XP_010908711.1|  PREDICTED: pentatricopeptide repeat-containi...    267   2e-80    
ref|XP_007153023.1|  hypothetical protein PHAVU_003G001300g             270   2e-80    
ref|XP_010912584.1|  PREDICTED: pentatricopeptide repeat-containi...    264   4e-80    
ref|XP_010931098.1|  PREDICTED: pentatricopeptide repeat-containi...    265   5e-80    
ref|XP_009413319.1|  PREDICTED: pentatricopeptide repeat-containi...    270   5e-80    
ref|XP_009347115.1|  PREDICTED: pentatricopeptide repeat-containi...    266   6e-80    
ref|XP_008804906.1|  PREDICTED: pentatricopeptide repeat-containi...    262   6e-80    
ref|XP_007224413.1|  hypothetical protein PRUPE_ppa021206mg             264   7e-80    
ref|XP_010260583.1|  PREDICTED: pentatricopeptide repeat-containi...    266   8e-80    
ref|XP_008813688.1|  PREDICTED: pentatricopeptide repeat-containi...    265   1e-79    
ref|XP_002308737.1|  pentatricopeptide repeat-containing family p...    263   1e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010271319.1|  PREDICTED: pentatricopeptide repeat-containi...    259   2e-79    
ref|XP_008224655.1|  PREDICTED: pentatricopeptide repeat-containi...    265   2e-79    
emb|CBI21289.3|  unnamed protein product                                262   2e-79    
ref|XP_004499782.1|  PREDICTED: pentatricopeptide repeat-containi...    267   2e-79    
gb|KHG29369.1|  Pentatricopeptide repeat-containing -like protein       263   2e-79    
ref|XP_009407242.1|  PREDICTED: pentatricopeptide repeat-containi...    264   3e-79    
ref|XP_010243611.1|  PREDICTED: pentatricopeptide repeat-containi...    267   3e-79    
ref|XP_002298341.1|  hypothetical protein POPTR_0001s25060g             257   5e-79    Populus trichocarpa [western balsam poplar]
ref|XP_007031998.1|  Tetratricopeptide repeat (TPR)-like superfam...    263   5e-79    
ref|XP_002280683.1|  PREDICTED: pentatricopeptide repeat-containi...    260   6e-79    Vitis vinifera
ref|XP_006857535.1|  hypothetical protein AMTR_s00061p00035580          262   7e-79    
ref|XP_010090626.1|  hypothetical protein L484_003942                   266   8e-79    
ref|XP_011035271.1|  PREDICTED: pentatricopeptide repeat-containi...    260   9e-79    
emb|CBI30291.3|  unnamed protein product                                261   9e-79    
ref|XP_009388285.1|  PREDICTED: pentatricopeptide repeat-containi...    262   1e-78    
gb|KDO55063.1|  hypothetical protein CISIN_1g040643mg                   267   1e-78    
ref|XP_004485987.1|  PREDICTED: pentatricopeptide repeat-containi...    261   1e-78    
ref|XP_004952954.1|  PREDICTED: pentatricopeptide repeat-containi...    266   1e-78    
ref|XP_011087320.1|  PREDICTED: pentatricopeptide repeat-containi...    268   1e-78    
ref|NP_001055349.1|  Os05g0370000                                       262   1e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010914194.1|  PREDICTED: pentatricopeptide repeat-containi...    262   1e-78    
ref|XP_010660692.1|  PREDICTED: pentatricopeptide repeat-containi...    262   1e-78    
gb|KCW65849.1|  hypothetical protein EUGRSUZ_G03194                     264   2e-78    
gb|EEE69272.1|  hypothetical protein OsJ_28537                          264   2e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087319.1|  PREDICTED: pentatricopeptide repeat-containi...    267   2e-78    
ref|XP_011087317.1|  PREDICTED: pentatricopeptide repeat-containi...    267   2e-78    
ref|XP_008358389.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    260   2e-78    
ref|XP_010067671.1|  PREDICTED: pentatricopeptide repeat-containi...    265   2e-78    
ref|XP_004516023.1|  PREDICTED: pentatricopeptide repeat-containi...    266   3e-78    
ref|XP_006660454.1|  PREDICTED: pentatricopeptide repeat-containi...    265   3e-78    
ref|XP_002276764.2|  PREDICTED: putative pentatricopeptide repeat...    261   3e-78    Vitis vinifera
ref|XP_010255496.1|  PREDICTED: pentatricopeptide repeat-containi...    264   4e-78    
ref|XP_010518772.1|  PREDICTED: pentatricopeptide repeat-containi...    266   4e-78    
ref|XP_002272111.2|  PREDICTED: pentatricopeptide repeat-containi...    264   4e-78    Vitis vinifera
ref|XP_004296321.1|  PREDICTED: pentatricopeptide repeat-containi...    256   4e-78    
ref|XP_009416825.1|  PREDICTED: pentatricopeptide repeat-containi...    259   5e-78    
ref|XP_007214178.1|  hypothetical protein PRUPE_ppa019185mg             264   5e-78    
ref|XP_006479094.1|  PREDICTED: pentatricopeptide repeat-containi...    266   6e-78    
ref|XP_002275298.1|  PREDICTED: pentatricopeptide repeat-containi...    263   6e-78    Vitis vinifera
ref|XP_006493918.1|  PREDICTED: putative pentatricopeptide repeat...    259   6e-78    
emb|CAN80331.1|  hypothetical protein VITISV_018275                     261   6e-78    Vitis vinifera
ref|XP_010273499.1|  PREDICTED: pentatricopeptide repeat-containi...    262   6e-78    
ref|XP_009386862.1|  PREDICTED: pentatricopeptide repeat-containi...    263   7e-78    
ref|XP_010273754.1|  PREDICTED: putative pentatricopeptide repeat...    256   7e-78    
ref|XP_007147940.1|  hypothetical protein PHAVU_006G167300g             259   7e-78    
ref|XP_010257249.1|  PREDICTED: putative pentatricopeptide repeat...    259   7e-78    
ref|NP_001062682.1|  Os09g0251500                                       264   7e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010273504.1|  PREDICTED: pentatricopeptide repeat-containi...    262   7e-78    
gb|KDP38705.1|  hypothetical protein JCGZ_04058                         263   8e-78    
ref|XP_002316490.2|  hypothetical protein POPTR_0010s24750g             256   8e-78    Populus trichocarpa [western balsam poplar]
gb|EMT03352.1|  hypothetical protein F775_15521                         254   8e-78    
gb|KGN58242.1|  hypothetical protein Csa_3G598390                       260   8e-78    
ref|XP_010268183.1|  PREDICTED: putative pentatricopeptide repeat...    259   8e-78    
ref|XP_009412103.1|  PREDICTED: pentatricopeptide repeat-containi...    264   1e-77    
gb|KDP21001.1|  hypothetical protein JCGZ_21472                         263   1e-77    
ref|XP_008464285.1|  PREDICTED: pentatricopeptide repeat-containi...    259   1e-77    
ref|XP_006357349.1|  PREDICTED: pentatricopeptide repeat-containi...    264   1e-77    
gb|KEH23680.1|  PPR containing plant-like protein                       259   1e-77    
gb|KHN07701.1|  Pentatricopeptide repeat-containing protein, chlo...    264   1e-77    
ref|XP_003545972.2|  PREDICTED: pentatricopeptide repeat-containi...    264   1e-77    
gb|KHN26409.1|  Pentatricopeptide repeat-containing protein             263   1e-77    
emb|CBI24015.3|  unnamed protein product                                257   1e-77    
ref|XP_007226779.1|  hypothetical protein PRUPE_ppa018015mg             258   1e-77    
ref|XP_010654317.1|  PREDICTED: putative pentatricopeptide repeat...    265   2e-77    
ref|XP_010255945.1|  PREDICTED: pentatricopeptide repeat-containi...    261   2e-77    
ref|XP_006468176.1|  PREDICTED: pentatricopeptide repeat-containi...    253   2e-77    
ref|NP_001182909.1|  uncharacterized protein LOC100501193               252   2e-77    
ref|XP_006663835.1|  PREDICTED: pentatricopeptide repeat-containi...    258   2e-77    
ref|XP_002263755.1|  PREDICTED: pentatricopeptide repeat-containi...    258   2e-77    Vitis vinifera
emb|CAN74095.1|  hypothetical protein VITISV_023708                     263   2e-77    Vitis vinifera
ref|XP_007148792.1|  hypothetical protein PHAVU_005G014700g             261   3e-77    
emb|CAN61868.1|  hypothetical protein VITISV_002466                     253   3e-77    Vitis vinifera
ref|XP_002273710.2|  PREDICTED: pentatricopeptide repeat-containi...    263   3e-77    Vitis vinifera
gb|KDO45403.1|  hypothetical protein CISIN_1g0074162mg                  254   3e-77    
ref|XP_006305855.1|  hypothetical protein CARUB_v10010934mg             256   3e-77    
ref|NP_001172331.1|  Os01g0355000                                       262   3e-77    
gb|KHN26334.1|  Putative pentatricopeptide repeat-containing protein    254   3e-77    
ref|XP_010658203.1|  PREDICTED: putative pentatricopeptide repeat...    260   3e-77    
gb|EAZ11837.1|  hypothetical protein OsJ_01713                          262   3e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010096505.1|  hypothetical protein L484_017957                   260   4e-77    
ref|XP_010912819.1|  PREDICTED: pentatricopeptide repeat-containi...    258   4e-77    
ref|XP_008464284.1|  PREDICTED: pentatricopeptide repeat-containi...    258   4e-77    
gb|KHN47346.1|  Pentatricopeptide repeat-containing protein             251   5e-77    
gb|KEH25607.1|  pentatricopeptide (PPR) repeat protein                  264   5e-77    
ref|XP_008450012.1|  PREDICTED: pentatricopeptide repeat-containi...    258   5e-77    
ref|XP_002278128.1|  PREDICTED: pentatricopeptide repeat-containi...    256   5e-77    Vitis vinifera
ref|XP_003526349.1|  PREDICTED: pentatricopeptide repeat-containi...    261   5e-77    
ref|XP_008225136.1|  PREDICTED: pentatricopeptide repeat-containi...    263   5e-77    
gb|KEH36690.1|  PPR containing plant-like protein                       256   6e-77    
ref|XP_004237632.1|  PREDICTED: putative pentatricopeptide repeat...    262   7e-77    
ref|XP_011005774.1|  PREDICTED: pentatricopeptide repeat-containi...    256   8e-77    
ref|XP_011072035.1|  PREDICTED: pentatricopeptide repeat-containi...    257   9e-77    
ref|XP_010087050.1|  hypothetical protein L484_012294                   259   1e-76    
dbj|BAK04789.1|  predicted protein                                      261   1e-76    
gb|EMT13280.1|  hypothetical protein F775_05245                         256   1e-76    
emb|CBI25399.3|  unnamed protein product                                260   1e-76    
ref|XP_009375928.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-76    
ref|XP_009794124.1|  PREDICTED: putative pentatricopeptide repeat...    261   2e-76    
ref|XP_008370927.1|  PREDICTED: putative pentatricopeptide repeat...    256   2e-76    
ref|XP_006421438.1|  hypothetical protein CICLE_v10005013mg             250   2e-76    
ref|XP_004139511.1|  PREDICTED: pentatricopeptide repeat-containi...    257   2e-76    
ref|XP_003578890.2|  PREDICTED: pentatricopeptide repeat-containi...    256   2e-76    
ref|XP_003575265.1|  PREDICTED: pentatricopeptide repeat-containi...    260   2e-76    
ref|XP_008793549.1|  PREDICTED: pentatricopeptide repeat-containi...    258   2e-76    
ref|XP_008784571.1|  PREDICTED: pentatricopeptide repeat-containi...    260   2e-76    
ref|XP_008358674.1|  PREDICTED: pentatricopeptide repeat-containi...    261   2e-76    
gb|KDP45013.1|  hypothetical protein JCGZ_01513                         256   2e-76    
ref|XP_010550535.1|  PREDICTED: putative pentatricopeptide repeat...    254   2e-76    
gb|EYU32070.1|  hypothetical protein MIMGU_mgv1a017635mg                258   2e-76    
ref|XP_007212726.1|  hypothetical protein PRUPE_ppa018986mg             249   2e-76    
ref|XP_006449392.1|  hypothetical protein CICLE_v10018358mg             261   2e-76    
ref|XP_010931126.1|  PREDICTED: pentatricopeptide repeat-containi...    255   2e-76    
emb|CAN63659.1|  hypothetical protein VITISV_008415                     258   2e-76    Vitis vinifera
ref|XP_007025555.1|  Tetratricopeptide repeat-like superfamily pr...    261   3e-76    
ref|XP_007227203.1|  hypothetical protein PRUPE_ppa019251mg             256   3e-76    
ref|XP_008445930.1|  PREDICTED: pentatricopeptide repeat-containi...    259   3e-76    
gb|AES81540.2|  PPR containing plant-like protein                       259   3e-76    
ref|XP_006490200.1|  PREDICTED: pentatricopeptide repeat-containi...    258   3e-76    
ref|XP_010940790.1|  PREDICTED: pentatricopeptide repeat-containi...    259   3e-76    
ref|XP_011024172.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    254   3e-76    
ref|XP_007162366.1|  hypothetical protein PHAVU_001G146000g             256   3e-76    
ref|XP_008231609.1|  PREDICTED: pentatricopeptide repeat-containi...    259   3e-76    
ref|XP_003553418.1|  PREDICTED: putative pentatricopeptide repeat...    254   3e-76    
ref|XP_004963823.1|  PREDICTED: pentatricopeptide repeat-containi...    256   3e-76    
gb|EMT08309.1|  hypothetical protein F775_09081                         259   3e-76    
ref|XP_010647024.1|  PREDICTED: pentatricopeptide repeat-containi...    256   4e-76    
ref|XP_010682981.1|  PREDICTED: pentatricopeptide repeat-containi...    256   4e-76    
ref|XP_010312485.1|  PREDICTED: pentatricopeptide repeat-containi...    255   4e-76    
ref|XP_006350965.1|  PREDICTED: pentatricopeptide repeat-containi...    255   4e-76    
ref|XP_009618280.1|  PREDICTED: putative pentatricopeptide repeat...    254   4e-76    
ref|XP_002520533.1|  pentatricopeptide repeat-containing protein,...    253   4e-76    Ricinus communis
ref|XP_010096042.1|  hypothetical protein L484_008698                   256   4e-76    
gb|KDP42221.1|  hypothetical protein JCGZ_02951                         253   4e-76    
ref|XP_003571917.1|  PREDICTED: putative pentatricopeptide repeat...    256   4e-76    
ref|XP_003572732.1|  PREDICTED: pentatricopeptide repeat-containi...    256   4e-76    
ref|XP_010907118.1|  PREDICTED: pentatricopeptide repeat-containi...    257   4e-76    
gb|KHN25259.1|  Pentatricopeptide repeat-containing protein             254   5e-76    
ref|XP_009621017.1|  PREDICTED: pentatricopeptide repeat-containi...    255   5e-76    
gb|KCW60105.1|  hypothetical protein EUGRSUZ_H02838                     255   5e-76    
ref|XP_002284744.1|  PREDICTED: pentatricopeptide repeat-containi...    257   5e-76    Vitis vinifera
ref|XP_004167188.1|  PREDICTED: putative pentatricopeptide repeat...    256   5e-76    
ref|XP_010920084.1|  PREDICTED: pentatricopeptide repeat-containi...    257   5e-76    
ref|XP_010112708.1|  hypothetical protein L484_020434                   254   5e-76    
ref|XP_010521079.1|  PREDICTED: pentatricopeptide repeat-containi...    255   6e-76    
ref|XP_004295338.1|  PREDICTED: pentatricopeptide repeat-containi...    255   6e-76    
emb|CDY40596.1|  BnaC06g02120D                                          257   6e-76    
ref|XP_004306162.1|  PREDICTED: putative pentatricopeptide repeat...    254   6e-76    
ref|XP_004985045.1|  PREDICTED: putative pentatricopeptide repeat...    253   7e-76    
ref|XP_010106812.1|  hypothetical protein L484_005358                   253   7e-76    
ref|XP_007026296.1|  Tetratricopeptide repeat-like superfamily pr...    252   7e-76    
gb|KDO77668.1|  hypothetical protein CISIN_1g046775mg                   257   8e-76    
ref|XP_009361929.1|  PREDICTED: pentatricopeptide repeat-containi...    258   8e-76    
ref|XP_004288861.1|  PREDICTED: pentatricopeptide repeat-containi...    258   8e-76    
ref|XP_010108948.1|  hypothetical protein L484_027143                   257   8e-76    
gb|ABA96502.1|  SEC14 cytosolic factor, putative                        254   8e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008390483.1|  PREDICTED: pentatricopeptide repeat-containi...    254   8e-76    
ref|XP_007220255.1|  hypothetical protein PRUPE_ppa001444mg             258   8e-76    
ref|XP_006359274.1|  PREDICTED: pentatricopeptide repeat-containi...    256   8e-76    
ref|XP_007038897.1|  Tetratricopeptide repeat (TPR)-like superfam...    255   8e-76    
ref|XP_008232744.1|  PREDICTED: pentatricopeptide repeat-containi...    258   9e-76    
gb|KDP23699.1|  hypothetical protein JCGZ_23532                         257   9e-76    
ref|XP_008797358.1|  PREDICTED: putative pentatricopeptide repeat...    253   9e-76    
ref|XP_008375325.1|  PREDICTED: pentatricopeptide repeat-containi...    258   9e-76    
ref|XP_006449889.1|  hypothetical protein CICLE_v10017607mg             254   9e-76    
ref|XP_009352868.1|  PREDICTED: pentatricopeptide repeat-containi...    259   9e-76    
ref|XP_009144084.1|  PREDICTED: putative pentatricopeptide repeat...    253   1e-75    
ref|XP_006338732.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-75    
ref|XP_003625322.1|  Pentatricopeptide repeat protein                   259   1e-75    
ref|XP_007143000.1|  hypothetical protein PHAVU_007G035200g             252   1e-75    
emb|CAN61593.1|  hypothetical protein VITISV_030555                     254   1e-75    Vitis vinifera
gb|AFW77609.1|  hypothetical protein ZEAMMB73_798524                    254   1e-75    
gb|AFW68492.1|  hypothetical protein ZEAMMB73_143921                    252   1e-75    
ref|XP_008649501.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-75    
ref|XP_010023746.1|  PREDICTED: pentatricopeptide repeat-containi...    256   1e-75    
ref|XP_004146744.1|  PREDICTED: putative pentatricopeptide repeat...    254   1e-75    
gb|KFK36081.1|  hypothetical protein AALP_AA4G075000                    256   1e-75    
ref|XP_010931698.1|  PREDICTED: pentatricopeptide repeat-containi...    259   1e-75    
ref|XP_010932118.1|  PREDICTED: putative pentatricopeptide repeat...    259   1e-75    
ref|XP_006349560.1|  PREDICTED: putative pentatricopeptide repeat...    253   1e-75    
ref|XP_008384204.1|  PREDICTED: pentatricopeptide repeat-containi...    253   1e-75    
ref|XP_009600826.1|  PREDICTED: putative pentatricopeptide repeat...    258   1e-75    
ref|XP_011078387.1|  PREDICTED: pentatricopeptide repeat-containi...    255   1e-75    
ref|XP_007220232.1|  hypothetical protein PRUPE_ppa001951mg             256   1e-75    
ref|XP_004493063.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-75    
ref|XP_008799069.1|  PREDICTED: pentatricopeptide repeat-containi...    252   1e-75    
ref|XP_010558253.1|  PREDICTED: pentatricopeptide repeat-containi...    253   1e-75    
ref|XP_010313040.1|  PREDICTED: pentatricopeptide repeat-containi...    257   2e-75    
gb|KHG24599.1|  Pentatricopeptide repeat-containing -like protein       255   2e-75    
ref|XP_010088819.1|  hypothetical protein L484_018381                   253   2e-75    
ref|XP_008784229.1|  PREDICTED: putative pentatricopeptide repeat...    254   2e-75    
ref|XP_006474838.1|  PREDICTED: pentatricopeptide repeat-containi...    253   2e-75    
ref|XP_002281942.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-75    
ref|XP_008234081.1|  PREDICTED: pentatricopeptide repeat-containi...    256   2e-75    
ref|XP_006658490.1|  PREDICTED: pentatricopeptide repeat-containi...    252   2e-75    
ref|XP_010550534.1|  PREDICTED: putative pentatricopeptide repeat...    254   2e-75    
emb|CDX93683.1|  BnaA06g03650D                                          256   2e-75    
ref|XP_004308197.1|  PREDICTED: pentatricopeptide repeat-containi...    257   2e-75    
ref|XP_006842433.1|  hypothetical protein AMTR_s00077p00031710          258   2e-75    
ref|XP_009147955.1|  PREDICTED: pentatricopeptide repeat-containi...    256   2e-75    
ref|NP_001058441.1|  Os06g0694300                                       253   2e-75    
gb|ABR17838.1|  unknown                                                 256   2e-75    
ref|XP_010660114.1|  PREDICTED: pentatricopeptide repeat-containi...    256   2e-75    
emb|CAN80796.1|  hypothetical protein VITISV_034275                     256   2e-75    
ref|XP_003632994.1|  PREDICTED: pentatricopeptide repeat-containi...    253   2e-75    
ref|XP_010942245.1|  PREDICTED: putative pentatricopeptide repeat...    255   2e-75    
gb|KEH44228.1|  pentatricopeptide (PPR) repeat protein                  257   2e-75    
ref|XP_002891564.1|  predicted protein                                  252   2e-75    
ref|XP_004493626.1|  PREDICTED: pentatricopeptide repeat-containi...    253   2e-75    
ref|XP_007139957.1|  hypothetical protein PHAVU_008G072900g             256   2e-75    
emb|CAN70212.1|  hypothetical protein VITISV_038740                     254   2e-75    
ref|XP_010245284.1|  PREDICTED: pentatricopeptide repeat-containi...    251   2e-75    
ref|XP_004502949.1|  PREDICTED: pentatricopeptide repeat-containi...    254   3e-75    
ref|XP_006651209.1|  PREDICTED: putative pentatricopeptide repeat...    253   3e-75    
ref|XP_004986483.1|  PREDICTED: putative pentatricopeptide repeat...    254   3e-75    
gb|KHN05841.1|  Pentatricopeptide repeat-containing protein             255   3e-75    
ref|XP_006343488.1|  PREDICTED: pentatricopeptide repeat-containi...    256   3e-75    
ref|XP_009797200.1|  PREDICTED: putative pentatricopeptide repeat...    257   3e-75    
emb|CDP05407.1|  unnamed protein product                                252   3e-75    
ref|XP_006662462.1|  PREDICTED: putative pentatricopeptide repeat...    251   3e-75    
gb|EMT23004.1|  hypothetical protein F775_19212                         247   3e-75    
gb|KEH32949.1|  pentatricopeptide (PPR) repeat protein                  256   3e-75    
ref|XP_002263673.2|  PREDICTED: pentatricopeptide repeat-containi...    258   3e-75    
ref|XP_007204553.1|  hypothetical protein PRUPE_ppa016618mg             250   3e-75    
ref|XP_004168907.1|  PREDICTED: pentatricopeptide repeat-containi...    256   3e-75    
gb|EYU39565.1|  hypothetical protein MIMGU_mgv1a003555mg                251   3e-75    
ref|XP_009599644.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-75    
ref|XP_002300569.2|  hypothetical protein POPTR_0001s47030g             255   3e-75    
gb|EMT27117.1|  hypothetical protein F775_08942                         251   3e-75    
ref|XP_009374834.1|  PREDICTED: pentatricopeptide repeat-containi...    252   4e-75    
ref|XP_008439708.1|  PREDICTED: putative pentatricopeptide repeat...    255   4e-75    
ref|XP_010112869.1|  hypothetical protein L484_017705                   254   4e-75    
ref|XP_007208585.1|  hypothetical protein PRUPE_ppa023060mg             247   4e-75    
ref|XP_004485865.1|  PREDICTED: pentatricopeptide repeat-containi...    258   4e-75    
ref|XP_010536431.1|  PREDICTED: pentatricopeptide repeat-containi...    255   4e-75    
ref|XP_010447165.1|  PREDICTED: pentatricopeptide repeat-containi...    254   4e-75    
ref|XP_003541672.2|  PREDICTED: pentatricopeptide repeat-containi...    252   4e-75    
ref|XP_006467747.1|  PREDICTED: pentatricopeptide repeat-containi...    257   4e-75    
gb|EYU23563.1|  hypothetical protein MIMGU_mgv1a002297mg                253   4e-75    
ref|XP_010686415.1|  PREDICTED: pentatricopeptide repeat-containi...    257   4e-75    
gb|KDO70236.1|  hypothetical protein CISIN_1g006388mg                   253   4e-75    
ref|XP_008810189.1|  PREDICTED: pentatricopeptide repeat-containi...    257   4e-75    
ref|XP_010916602.1|  PREDICTED: pentatricopeptide repeat-containi...    255   4e-75    
ref|XP_008456467.1|  PREDICTED: putative pentatricopeptide repeat...    253   4e-75    
ref|XP_006468878.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-75    
ref|XP_008787073.1|  PREDICTED: putative pentatricopeptide repeat...    257   4e-75    
ref|XP_008366262.1|  PREDICTED: pentatricopeptide repeat-containi...    250   4e-75    
ref|XP_008809450.1|  PREDICTED: pentatricopeptide repeat-containi...    254   4e-75    
ref|XP_009592247.1|  PREDICTED: pentatricopeptide repeat-containi...    254   4e-75    
ref|XP_010250314.1|  PREDICTED: putative pentatricopeptide repeat...    254   4e-75    
emb|CAN78152.1|  hypothetical protein VITISV_040250                     251   5e-75    
emb|CAN81045.1|  hypothetical protein VITISV_006763                     259   5e-75    
ref|XP_003540710.1|  PREDICTED: pentatricopeptide repeat-containi...    253   5e-75    
gb|KHN11450.1|  Pentatricopeptide repeat-containing protein             250   5e-75    
gb|EYU23583.1|  hypothetical protein MIMGU_mgv1a001176mg                256   5e-75    
ref|XP_004237174.1|  PREDICTED: pentatricopeptide repeat-containi...    253   5e-75    
ref|XP_008221208.1|  PREDICTED: pentatricopeptide repeat-containi...    254   5e-75    
ref|XP_004136748.1|  PREDICTED: putative pentatricopeptide repeat...    251   5e-75    
ref|XP_007198996.1|  hypothetical protein PRUPE_ppa002176mg             253   6e-75    
gb|KCW76568.1|  hypothetical protein EUGRSUZ_D00959                     250   6e-75    
dbj|BAD45498.1|  hypothetical protein                                   255   6e-75    
ref|XP_002467045.1|  hypothetical protein SORBIDRAFT_01g018760          250   6e-75    
ref|XP_006656417.1|  PREDICTED: pentatricopeptide repeat-containi...    247   6e-75    
ref|XP_003602631.1|  Pentatricopeptide repeat-containing protein        253   6e-75    
ref|XP_004956000.1|  PREDICTED: pentatricopeptide repeat-containi...    253   6e-75    
gb|KDP40584.1|  hypothetical protein JCGZ_24583                         255   6e-75    
ref|XP_010257783.1|  PREDICTED: putative pentatricopeptide repeat...    254   7e-75    
ref|XP_010265006.1|  PREDICTED: putative pentatricopeptide repeat...    255   7e-75    
ref|XP_011020490.1|  PREDICTED: pentatricopeptide repeat-containi...    256   7e-75    
ref|XP_009369706.1|  PREDICTED: pentatricopeptide repeat-containi...    251   7e-75    
ref|XP_006412272.1|  hypothetical protein EUTSA_v10027054mg             252   7e-75    
ref|XP_008218537.1|  PREDICTED: putative pentatricopeptide repeat...    252   7e-75    
gb|KHN41862.1|  Pentatricopeptide repeat-containing protein             254   8e-75    
ref|XP_004134800.1|  PREDICTED: pentatricopeptide repeat-containi...    248   8e-75    
ref|XP_006429754.1|  hypothetical protein CICLE_v10011150mg             254   8e-75    
ref|XP_002267354.1|  PREDICTED: pentatricopeptide repeat-containi...    251   8e-75    
ref|XP_002319164.2|  pentatricopeptide repeat-containing family p...    256   8e-75    
ref|XP_003538894.1|  PREDICTED: pentatricopeptide repeat-containi...    254   8e-75    
ref|XP_002282164.2|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    259   8e-75    
ref|XP_010270350.1|  PREDICTED: pentatricopeptide repeat-containi...    250   9e-75    
gb|EAZ03563.1|  hypothetical protein OsI_25699                          249   9e-75    
ref|XP_002872815.1|  pentatricopeptide repeat-containing protein        254   9e-75    
ref|XP_010275265.1|  PREDICTED: pentatricopeptide repeat-containi...    254   9e-75    
emb|CDP04327.1|  unnamed protein product                                252   9e-75    
gb|KGN45817.1|  hypothetical protein Csa_6G013890                       254   9e-75    
ref|NP_192184.1|  pentatricopeptide repeat-containing protein           254   9e-75    
ref|XP_009359788.1|  PREDICTED: pentatricopeptide repeat-containi...    251   1e-74    
gb|KGN54859.1|  hypothetical protein Csa_4G554180                       254   1e-74    
ref|XP_009631745.1|  PREDICTED: pentatricopeptide repeat-containi...    249   1e-74    
ref|XP_009402026.1|  PREDICTED: pentatricopeptide repeat-containi...    251   1e-74    
ref|XP_004138557.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-74    
ref|XP_010685179.1|  PREDICTED: pentatricopeptide repeat-containi...    252   1e-74    
ref|XP_004160754.1|  PREDICTED: pentatricopeptide repeat-containi...    254   1e-74    
gb|KGN46048.1|  hypothetical protein Csa_6G046260                       249   1e-74    
ref|XP_006393165.1|  hypothetical protein EUTSA_v10011334mg             250   1e-74    
ref|XP_008389362.1|  PREDICTED: putative pentatricopeptide repeat...    253   1e-74    
gb|EEC74844.1|  hypothetical protein OsI_10704                          251   1e-74    
ref|XP_004165491.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    250   1e-74    
ref|XP_002302563.2|  hypothetical protein POPTR_0002s15650g             254   1e-74    
ref|XP_004308608.1|  PREDICTED: pentatricopeptide repeat-containi...    255   1e-74    
ref|XP_007204599.1|  hypothetical protein PRUPE_ppa002987mg             251   1e-74    
ref|XP_007152087.1|  hypothetical protein PHAVU_004G101000g             252   1e-74    
ref|XP_004159154.1|  PREDICTED: uncharacterized protein LOC101226880    259   1e-74    
ref|XP_007016350.1|  Tetratricopeptide repeat (TPR)-like superfam...    249   1e-74    
gb|EYU24289.1|  hypothetical protein MIMGU_mgv1a024266mg                255   1e-74    
ref|XP_008788339.1|  PREDICTED: putative pentatricopeptide repeat...    251   1e-74    
ref|XP_008811840.1|  PREDICTED: pentatricopeptide repeat-containi...    253   1e-74    
ref|XP_006605886.1|  PREDICTED: pentatricopeptide repeat-containi...    250   1e-74    
ref|XP_006437829.1|  hypothetical protein CICLE_v10033304mg             253   1e-74    
ref|XP_006393385.1|  hypothetical protein EUTSA_v10011302mg             251   2e-74    
ref|XP_004170671.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    252   2e-74    
ref|XP_006292572.1|  hypothetical protein CARUB_v10018807mg             252   2e-74    
gb|KDO40958.1|  hypothetical protein CISIN_1g0075302mg                  247   2e-74    
ref|XP_009769373.1|  PREDICTED: pentatricopeptide repeat-containi...    251   2e-74    
ref|XP_004234835.1|  PREDICTED: putative pentatricopeptide repeat...    250   2e-74    
ref|XP_010432483.1|  PREDICTED: pentatricopeptide repeat-containi...    252   2e-74    
ref|XP_004145727.1|  PREDICTED: uncharacterized protein LOC101212001    260   2e-74    
ref|XP_010936927.1|  PREDICTED: putative pentatricopeptide repeat...    250   2e-74    
ref|XP_010447163.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-74    
gb|EYU34329.1|  hypothetical protein MIMGU_mgv1a001967mg                253   2e-74    
emb|CAN70248.1|  hypothetical protein VITISV_032008                     251   2e-74    
ref|XP_003523921.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-74    
ref|XP_007220666.1|  hypothetical protein PRUPE_ppa014747mg             252   2e-74    
ref|XP_010447164.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-74    
ref|XP_010261389.1|  PREDICTED: pentatricopeptide repeat-containi...    253   2e-74    
ref|XP_004301443.1|  PREDICTED: putative pentatricopeptide repeat...    249   2e-74    
gb|EMT26579.1|  hypothetical protein F775_06134                         249   2e-74    
gb|KEH44229.1|  pentatricopeptide (PPR) repeat protein                  256   2e-74    
tpg|DAA44337.1|  TPA: hypothetical protein ZEAMMB73_255594              251   2e-74    
ref|XP_010269696.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-74    
gb|EYU34910.1|  hypothetical protein MIMGU_mgv1a001179mg                254   2e-74    
ref|XP_010928853.1|  PREDICTED: putative pentatricopeptide repeat...    249   2e-74    
ref|XP_006290208.1|  hypothetical protein CARUB_v10003899mg             253   2e-74    
gb|EAZ16497.1|  hypothetical protein OsJ_31969                          250   2e-74    
ref|XP_008223521.1|  PREDICTED: pentatricopeptide repeat-containi...    250   2e-74    
ref|XP_008236588.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-74    
ref|XP_009380253.1|  PREDICTED: pentatricopeptide repeat-containi...    253   2e-74    
ref|XP_010268581.1|  PREDICTED: pentatricopeptide repeat-containi...    248   2e-74    
ref|XP_008802215.1|  PREDICTED: putative pentatricopeptide repeat...    254   2e-74    
ref|XP_010094686.1|  Pentatricopeptide repeat-containing protein        251   3e-74    
ref|XP_004984470.1|  PREDICTED: putative pentatricopeptide repeat...    253   3e-74    
gb|KDP37060.1|  hypothetical protein JCGZ_06116                         244   3e-74    
ref|XP_010052500.1|  PREDICTED: pentatricopeptide repeat-containi...    251   3e-74    
ref|XP_011101861.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-74    
ref|XP_010537149.1|  PREDICTED: putative pentatricopeptide repeat...    249   3e-74    
ref|XP_008780816.1|  PREDICTED: pentatricopeptide repeat-containi...    243   3e-74    
gb|EMT11382.1|  hypothetical protein F775_11112                         244   3e-74    
ref|XP_008805366.1|  PREDICTED: pentatricopeptide repeat-containi...    256   3e-74    
ref|XP_009376982.1|  PREDICTED: putative pentatricopeptide repeat...    253   3e-74    
gb|KDP26017.1|  hypothetical protein JCGZ_21050                         250   3e-74    
ref|XP_009398523.1|  PREDICTED: pentatricopeptide repeat-containi...    256   3e-74    
ref|XP_007031200.1|  Tetratricopeptide repeat (TPR)-like superfam...    249   3e-74    
ref|XP_004159483.1|  PREDICTED: pentatricopeptide repeat-containi...    250   3e-74    
ref|XP_009769160.1|  PREDICTED: putative pentatricopeptide repeat...    249   3e-74    
ref|XP_010437685.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-74    
gb|KHN10657.1|  Pentatricopeptide repeat-containing protein             254   3e-74    
ref|XP_007028824.1|  Mitochondrial RNAediting factor 1                  249   3e-74    
ref|XP_009591801.1|  PREDICTED: pentatricopeptide repeat-containi...    254   3e-74    
ref|XP_008375323.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-74    
ref|XP_007051907.1|  Tetratricopeptide repeat-like superfamily pr...    253   3e-74    
ref|XP_010449130.1|  PREDICTED: pentatricopeptide repeat-containi...    249   3e-74    
emb|CDY53559.1|  BnaC04g55710D                                          248   3e-74    
ref|XP_010244917.1|  PREDICTED: pentatricopeptide repeat-containi...    251   3e-74    
ref|XP_010476046.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-74    
ref|XP_009412879.1|  PREDICTED: pentatricopeptide repeat-containi...    249   4e-74    
ref|XP_004984117.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-74    
ref|XP_002512645.1|  pentatricopeptide repeat-containing protein,...    251   4e-74    
ref|XP_009416987.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    253   4e-74    
ref|XP_009351179.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-74    
gb|EEE58673.1|  hypothetical protein OsJ_10095                          250   4e-74    
ref|XP_008243021.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-74    
ref|XP_010661558.1|  PREDICTED: putative pentatricopeptide repeat...    253   4e-74    
gb|AET03186.2|  PPR containing plant-like protein                       252   4e-74    
gb|EPS72044.1|  hypothetical protein M569_02714                         255   4e-74    
ref|XP_009782353.1|  PREDICTED: pentatricopeptide repeat-containi...    251   4e-74    
ref|XP_008356785.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-74    
ref|XP_004298334.1|  PREDICTED: putative pentatricopeptide repeat...    252   4e-74    
ref|XP_009340625.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-74    
ref|XP_004233728.1|  PREDICTED: pentatricopeptide repeat-containi...    250   4e-74    
ref|XP_006340666.1|  PREDICTED: pentatricopeptide repeat-containi...    250   4e-74    
ref|XP_010653819.1|  PREDICTED: putative pentatricopeptide repeat...    250   4e-74    
ref|XP_010087048.1|  hypothetical protein L484_012292                   252   4e-74    
ref|XP_006827122.1|  hypothetical protein AMTR_s00010p00246970          252   4e-74    
gb|EYU43084.1|  hypothetical protein MIMGU_mgv1a021074mg                254   4e-74    
dbj|BAB62625.1|  P0402A09.8                                             255   4e-74    
gb|ACK44496.1|  AT5G09950-like protein                                  252   4e-74    
ref|XP_010653129.1|  PREDICTED: putative pentatricopeptide repeat...    252   5e-74    
ref|XP_010449129.1|  PREDICTED: pentatricopeptide repeat-containi...    249   5e-74    
ref|XP_004147126.1|  PREDICTED: pentatricopeptide repeat-containi...    253   5e-74    
gb|KEH44280.1|  pentatricopeptide (PPR) repeat protein                  249   5e-74    
ref|XP_010250280.1|  PREDICTED: pentatricopeptide repeat-containi...    247   5e-74    
emb|CBI32403.3|  unnamed protein product                                250   5e-74    
ref|XP_009413734.1|  PREDICTED: putative pentatricopeptide repeat...    251   5e-74    
ref|XP_007044258.1|  Pentatricopeptide repeat (PPR) superfamily p...    251   5e-74    
ref|XP_010230196.1|  PREDICTED: putative pentatricopeptide repeat...    250   6e-74    
gb|KDO62894.1|  hypothetical protein CISIN_1g004024mg                   252   6e-74    
ref|XP_010942915.1|  PREDICTED: pentatricopeptide repeat-containi...    253   6e-74    
emb|CDX79826.1|  BnaA05g03300D                                          253   6e-74    
gb|KFK25048.1|  hypothetical protein AALP_AA8G059800                    244   6e-74    
ref|XP_004140992.1|  PREDICTED: pentatricopeptide repeat-containi...    249   6e-74    
gb|EPS73682.1|  hypothetical protein M569_01069                         248   6e-74    
ref|XP_003628710.1|  Pentatricopeptide repeat-containing protein        251   6e-74    
emb|CBI15551.3|  unnamed protein product                                250   6e-74    
ref|XP_004160443.1|  PREDICTED: pentatricopeptide repeat-containi...    252   6e-74    
ref|XP_010248175.1|  PREDICTED: pentatricopeptide repeat-containi...    249   7e-74    
ref|XP_007151411.1|  hypothetical protein PHAVU_004G044000g             254   7e-74    



>ref|XP_009784644.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Nicotiana sylvestris]
Length=687

 Score =   486 bits (1252),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 222/278 (80%), Positives = 253/278 (91%), Gaps = 0/278 (0%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +ERNGVSWC++LAVYEQND+ EKA  VFLKAR+E I+PTEFM+SS LSACAG+A  ELGR
Sbjct  274  NERNGVSWCTMLAVYEQNDIWEKAFMVFLKARKEDIKPTEFMISSALSACAGMAVLELGR  333

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            SIHGL VKAC+E N+FV S LVDMYGKCG IEDCE  FYEMPERNLITWNA++GGYAHQG
Sbjct  334  SIHGLAVKACIESNIFVGSALVDMYGKCGNIEDCESVFYEMPERNLITWNAVMGGYAHQG  393

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            +A+MAL LFE+MT ++ DVVPNYVT VCVLTACSRAG V+ GMDIFE+M+ KYGI+PG E
Sbjct  394  YADMALSLFEEMTSESHDVVPNYVTLVCVLTACSRAGTVKIGMDIFESMRKKYGIQPGPE  453

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACVVDML RAG+VERAYEFIK+MP+ PTVSVWGALLGACRV+GKPELGK+AADNLFQ+
Sbjct  454  HYACVVDMLARAGLVERAYEFIKKMPVPPTVSVWGALLGACRVYGKPELGKVAADNLFQL  513

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSGNHVILSNMFA++GRWEEANLVRKEMKD+GI K
Sbjct  514  DPKDSGNHVILSNMFAAAGRWEEANLVRKEMKDVGINK  551


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 80/163 (49%), Gaps = 1/163 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   Q      AL  F   R E ++P +F    +  A A L +   G+ +
Sbjct  73   RSVVTWTALIAGSVQTGHFTSALLHFSNMRRECVQPNDFTFPCLFKASAFLHSPVTGQQL  132

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L +K  + E+VFV     DMYGK G  E   + F EMP RN+ TWNA I      G +
Sbjct  133  HALALKTSLIEDVFVGCSAFDMYGKTGLREYARKMFDEMPHRNIATWNARISNSVLDGKS  192

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
              A   F ++ R  ++  PN +TF   L ACS    ++ G  +
Sbjct  193  YDAALKFIELLRVGEE-PPNSITFCVFLNACSDGLYLKLGRQL  234


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 103/230 (45%), Gaps = 5/230 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSV-LSACAGLAAFELGR  181
             RN  +W + ++    +     A   F++    G EP   +   V L+AC+     +LGR
Sbjct  173  HRNIATWNARISNSVLDGKSYDAALKFIELLRVGEEPPNSITFCVFLNACSDGLYLKLGR  232

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HG V++     +V V + L+D YGKC  ++  E  F E+ ERN ++W  ++  Y    
Sbjct  233  QLHGYVIRLGFRSDVSVLNGLIDFYGKCHEVKYSELVFDEINERNGVSWCTMLAVYEQND  292

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                A  +F  +  + +D+ P        L+AC+    +E G  I   +  K  IE    
Sbjct  293  IWEKAFMVF--LKARKEDIKPTEFMISSALSACAGMAVLELGRSI-HGLAVKACIESNIF  349

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
              + +VDM G+ G +E        MP R  ++ W A++G     G  ++ 
Sbjct  350  VGSALVDMYGKCGNIEDCESVFYEMPERNLIT-WNAVMGGYAHQGYADMA  398



>ref|XP_006340539.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Solanum tuberosum]
Length=687

 Score =   478 bits (1229),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 218/276 (79%), Positives = 254/276 (92%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RNGVSWC++LAVYEQND+ + A  +FLKAR+EGI+PTEFM+SSVLSACAG+A  ELGRSI
Sbjct  276  RNGVSWCTMLAVYEQNDIWDNAFMLFLKARKEGIKPTEFMLSSVLSACAGMAVLELGRSI  335

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL VKAC+E NVFV S LVDMYGKCG I++CE +FYEMPERNLITWNA++GGYAHQG A
Sbjct  336  HGLAVKACIEHNVFVGSALVDMYGKCGSIDNCESSFYEMPERNLITWNAVMGGYAHQGCA  395

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE+MT ++ +VVP+YVTFVCVLTACSRAGAV+ GMDIFE+M+ KYGIEPG EHY
Sbjct  396  DMALSLFEEMTSESHNVVPSYVTFVCVLTACSRAGAVKIGMDIFESMQKKYGIEPGPEHY  455

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAG+VERAY+FIK+MP+ PTVSVWGALLGACRVHGKPELGK+AADNLF++DP
Sbjct  456  ACVVDILGRAGLVERAYDFIKKMPVPPTVSVWGALLGACRVHGKPELGKVAADNLFRLDP  515

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSGNHVILSNMFA++GRW+EANLVRKEMKD+GI K
Sbjct  516  LDSGNHVILSNMFAAAGRWDEANLVRKEMKDVGITK  551


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 97/217 (45%), Gaps = 3/217 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   QN     AL  F   R + ++P +F    +  A A L    +G+ +
Sbjct  73   RSVVTWTALIAGSVQNGHFTSALLHFSDMRRQSVQPNDFTFPCLFKASAFLHYPLMGQQL  132

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L +K     +VFV     DMY K G  E  ++ F EMP RN+ TWNA I      G  
Sbjct  133  HALALKGSFINDVFVGCSAFDMYCKNGLREYAQKMFDEMPHRNIATWNACISNSVLDGRP  192

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A   F ++ R  ++  PN +TF   L ACS    ++ G  +      ++G        
Sbjct  193  YDASLKFVELLRLGEE-PPNSITFCVFLNACSDGLYLKLGQQL-HGYVIRFGFGSDVSVL  250

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              +VD  G+   V+ +      + +R  VS W  +L 
Sbjct  251  NGMVDFYGKCHQVKYSELVFNEINVRNGVS-WCTMLA  286


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 100/219 (46%), Gaps = 5/219 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSV-LSACAGLAAFELGR  181
             RN  +W + ++    +     A   F++    G EP   +   V L+AC+     +LG+
Sbjct  173  HRNIATWNACISNSVLDGRPYDASLKFVELLRLGEEPPNSITFCVFLNACSDGLYLKLGQ  232

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HG V++     +V V + +VD YGKC  ++  E  F E+  RN ++W  ++  Y    
Sbjct  233  QLHGYVIRFGFGSDVSVLNGMVDFYGKCHQVKYSELVFNEINVRNGVSWCTMLAVYEQND  292

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              + A  LF  +  + + + P       VL+AC+    +E G  I   +  K  IE    
Sbjct  293  IWDNAFMLF--LKARKEGIKPTEFMLSSVLSACAGMAVLELGRSI-HGLAVKACIEHNVF  349

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              + +VDM G+ G ++        MP R  ++ W A++G
Sbjct  350  VGSALVDMYGKCGSIDNCESSFYEMPERNLIT-WNAVMG  387



>ref|XP_009596850.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Nicotiana tomentosiformis]
 ref|XP_009596851.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Nicotiana tomentosiformis]
 ref|XP_009596852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Nicotiana tomentosiformis]
 ref|XP_009596854.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Nicotiana tomentosiformis]
Length=686

 Score =   476 bits (1224),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 218/278 (78%), Positives = 252/278 (91%), Gaps = 1/278 (0%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +ERNGVSWC++LA YEQND+ EKA  VFLKAR+E I+PTEFM+SS LSACAG+A  ELGR
Sbjct  274  NERNGVSWCTMLAAYEQNDIWEKAFMVFLKARKEDIKPTEFMISSALSACAGMAVLELGR  333

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            SIHGL VK+C + N+FV S LVDMYGKCG IEDCE AFYEMPERNLITWNA++GGYAHQG
Sbjct  334  SIHGLAVKSC-KSNIFVGSALVDMYGKCGNIEDCESAFYEMPERNLITWNAVMGGYAHQG  392

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            +A+MAL+LFE+MT ++ D VPNYVT VCVLTACSRAG V+ GMDIFE+M+ +YGI+PG E
Sbjct  393  YADMALNLFEEMTSESHDAVPNYVTLVCVLTACSRAGTVKIGMDIFESMRKEYGIQPGPE  452

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACVVDML RAG +ERAYEFIK+MP+ PTVSVWGALLGACRV+GKPELGK+AADNLFQ+
Sbjct  453  HYACVVDMLARAGFLERAYEFIKKMPVPPTVSVWGALLGACRVYGKPELGKVAADNLFQL  512

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSGNHVILSNMFA++GRWEEANLVRKEMKD+GIKK
Sbjct  513  DPKDSGNHVILSNMFAAAGRWEEANLVRKEMKDVGIKK  550


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 99/218 (45%), Gaps = 3/218 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   Q+     AL  F   R E ++P +F    +  A A L +   G+ +
Sbjct  73   RSVVTWTALIAGSVQSGHFTSALLHFSNMRRECVQPNDFTFPCLFKASAFLHSPVTGQQL  132

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L +K  + E+VFV     DMY K G  E   + F EMP+RN+ TWNA I      G +
Sbjct  133  HALALKTSLIEDVFVGCSAFDMYYKTGLREYARKMFDEMPQRNIATWNACISNSVLDGRS  192

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A   F ++ R  ++  PN +TF   L ACS    ++ G  +      + G        
Sbjct  193  YDAALKFVELLRVGEE-PPNSITFCVFLNACSDGLYLKLGRQL-HGYVIRLGFRSDVSVL  250

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   V+ +      +  R  VS W  +L A
Sbjct  251  NGLIDFYGKCHEVKYSELVFHEINERNGVS-WCTMLAA  287


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 112/241 (46%), Gaps = 14/241 (6%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSV-LSACAGLAAFELGR  181
            +RN  +W + ++    +     A   F++    G EP   +   V L+AC+     +LGR
Sbjct  173  QRNIATWNACISNSVLDGRSYDAALKFVELLRVGEEPPNSITFCVFLNACSDGLYLKLGR  232

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HG V++     +V V + L+D YGKC  ++  E  F+E+ ERN ++W  ++  Y    
Sbjct  233  QLHGYVIRLGFRSDVSVLNGLIDFYGKCHEVKYSELVFHEINERNGVSWCTMLAAYEQND  292

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFE-AMKD-KYGIEPG  535
                A  +F  +  + +D+ P        L+AC+    +E G  I   A+K  K  I  G
Sbjct  293  IWEKAFMVF--LKARKEDIKPTEFMISSALSACAGMAVLELGRSIHGLAVKSCKSNIFVG  350

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF  715
                + +VDM G+ G +E        MP R  ++ W A++G     G  ++    A NLF
Sbjct  351  ----SALVDMYGKCGNIEDCESAFYEMPERNLIT-WNAVMGGYAHQGYADM----ALNLF  401

Query  716  Q  718
            +
Sbjct  402  E  402



>ref|XP_004231485.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Solanum lycopersicum]
Length=687

 Score =   476 bits (1224),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 219/275 (80%), Positives = 251/275 (91%), Gaps = 0/275 (0%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            NGVSW ++LAVYEQND+ +KA  +FLKAR+EGI+PTEFMVSSVLSACAG A  ELGRSIH
Sbjct  277  NGVSWSTMLAVYEQNDIWDKAFMLFLKARKEGIKPTEFMVSSVLSACAGTAVLELGRSIH  336

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
            GL VKAC+E NVFV S LVDMYGKCG IE+CE AFYEMPERNLITWNA++GGYAHQG A+
Sbjct  337  GLAVKACIEHNVFVGSALVDMYGKCGSIENCESAFYEMPERNLITWNAVMGGYAHQGCAD  396

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
            MAL LFE+MT ++ DVVP+YVTF+CVLTACSRAGAV+ GMDIFE+M+ KYGIEPG EHYA
Sbjct  397  MALRLFEEMTSESHDVVPSYVTFICVLTACSRAGAVKIGMDIFESMRKKYGIEPGPEHYA  456

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQ  730
            CVVD+LGRAG+VERAY+FIK+MP+ PTVSVWGALLGACRVHGKPELGK+AADNLF++DP 
Sbjct  457  CVVDILGRAGLVERAYDFIKKMPVPPTVSVWGALLGACRVHGKPELGKVAADNLFRLDPL  516

Query  731  DSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DSGNHV+LSNMFA++GRW EANLVRKEMKD+GI K
Sbjct  517  DSGNHVVLSNMFAAAGRWHEANLVRKEMKDVGITK  551


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 76/163 (47%), Gaps = 1/163 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   QN     AL  F   R + ++P +F    +  A A L    +G  +
Sbjct  73   RSVVTWTALIAGSVQNGHFTSALLHFSDMRCQSVQPNDFTFPCLFKASAFLHYPLMGLQL  132

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L +K     + FV     DMY K G  E  ++ F EMP RN+ TWNA I      G  
Sbjct  133  HALALKGSFINDAFVGCSAFDMYCKTGLREYAQKVFDEMPHRNIATWNACISNSVLDGRP  192

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
              A   F ++ R  ++  PN +TF   L ACS    ++ G  +
Sbjct  193  YDASLKFVELLRLGEE-PPNSITFSVFLNACSDGLYLKLGQQL  234


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 101/219 (46%), Gaps = 5/219 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSV-LSACAGLAAFELGR  181
             RN  +W + ++    +     A   F++    G EP   +  SV L+AC+     +LG+
Sbjct  173  HRNIATWNACISNSVLDGRPYDASLKFVELLRLGEEPPNSITFSVFLNACSDGLYLKLGQ  232

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HG V++     +V V + +VD YGKC  ++  E  F E+   N ++W+ ++  Y    
Sbjct  233  QLHGYVIRLGFGSDVSVLNGMVDFYGKCHQVKYSELVFNEINVCNGVSWSTMLAVYEQND  292

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              + A  LF  +  + + + P       VL+AC+    +E G  I   +  K  IE    
Sbjct  293  IWDKAFMLF--LKARKEGIKPTEFMVSSVLSACAGTAVLELGRSI-HGLAVKACIEHNVF  349

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              + +VDM G+ G +E        MP R  ++ W A++G
Sbjct  350  VGSALVDMYGKCGSIENCESAFYEMPERNLIT-WNAVMG  387


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 86/191 (45%), Gaps = 13/191 (7%)
 Frame = +2

Query  122  FMVSSVLSACAGLAAFELGRSIHGLVVKACVEENV--FVRSVLVDMYGKCGCIEDCER--  289
            +++ S LS  + L    LGR+IH  +++  +E     F+ + L++ Y K   +   +   
Sbjct  11   WLIESALSTQSLL----LGRAIHAHIIRT-IEPPFPPFLSNHLINFYSKLDSLNSAQLLL  65

Query  290  AFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRA  469
            +    P R+++TW ALI G    GH   AL  F DM  + Q V PN  TF C+  A +  
Sbjct  66   SLTPPPFRSVVTWTALIAGSVQNGHFTSALLHFSDM--RCQSVQPNDFTFPCLFKASAFL  123

Query  470  GAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGA  649
                 G+ +  A+  K      A       DM  + G+ E A +    MP R  ++ W A
Sbjct  124  HYPLMGLQL-HALALKGSFINDAFVGCSAFDMYCKTGLREYAQKVFDEMPHR-NIATWNA  181

Query  650  LLGACRVHGKP  682
             +    + G+P
Sbjct  182  CISNSVLDGRP  192



>ref|XP_011080741.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Sesamum indicum]
 ref|XP_011080742.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Sesamum indicum]
 ref|XP_011080743.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Sesamum indicum]
Length=689

 Score =   454 bits (1168),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 207/280 (74%), Positives = 244/280 (87%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
             ERNGVSWCS+L VYEQND+GEKA +VFL+AR  G+EP++FMVSSVLSACAGLA  E GR
Sbjct  274  SERNGVSWCSMLVVYEQNDIGEKACEVFLQARRAGVEPSDFMVSSVLSACAGLATLEAGR  333

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HGL VKAC++EN+FV S LVDMYGKCG IEDCERAF+ MP RNLI WNALIGGYAHQG
Sbjct  334  VVHGLAVKACIDENIFVGSALVDMYGKCGSIEDCERAFFMMPRRNLICWNALIGGYAHQG  393

Query  362  HANMALDLFEDMTRKT--QDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPG  535
             A+MAL LF++MT  T  + ++PNYVTFVCVLTACSR G V  GM+IFE+M+ KYGI PG
Sbjct  394  LADMALKLFKEMTNCTGSEGLLPNYVTFVCVLTACSRGGMVNVGMNIFESMRGKYGISPG  453

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF  715
            AEHYAC+VDMLGRAG VE AY+ I +MP RPT+S+WGALLGAC++H K ELGKIAA+NLF
Sbjct  454  AEHYACIVDMLGRAGQVEHAYQVISQMPFRPTISIWGALLGACKMHSKSELGKIAAENLF  513

Query  716  QIDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++DPQDSGNHV+LSNMFA++G+W+EANLVRKEMKD+GIKK
Sbjct  514  ELDPQDSGNHVLLSNMFAAAGQWDEANLVRKEMKDVGIKK  553


 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 112/247 (45%), Gaps = 11/247 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W SL++   QN      L  F   R+E I+P +F    +  A   L +  LG+  
Sbjct  73   RSVVTWTSLISGNVQNGHFASVLSCFSSMRQECIQPNDFTFPCLFKAATSLHSPILGQQF  132

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL +K    ++VFV     DMY K G + +  + F EM  RN+ TWNA I       + 
Sbjct  133  HGLAIKLFFIDDVFVACSAFDMYSKTGFLTEASKMFDEMSYRNIATWNACISNAVLNANP  192

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+  F  + R ++   PN +TF   L ACS    +  G  +   +  K G E      
Sbjct  193  REAIRKFVQLLRDSE-AAPNSITFCAYLNACSDGALLMQGQQLHGYLI-KGGHEADISVL  250

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ---  718
              ++D  G+   V  + +   +M  R  VS W ++L    V+ + ++G+ A +   Q   
Sbjct  251  NGLIDFYGKCQQVGFSEKVFDKMSERNGVS-WCSML---VVYEQNDIGEKACEVFLQARR  306

Query  719  --IDPQD  733
              ++P D
Sbjct  307  AGVEPSD  313



>emb|CDP16313.1| unnamed protein product [Coffea canephora]
Length=695

 Score =   452 bits (1162),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 208/277 (75%), Positives = 244/277 (88%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSWCS++AVYEQN +GEKA + F++AR    EPT+F++SSVLSACAGLA  E GR+
Sbjct  283  DRNVVSWCSMVAVYEQNYMGEKACETFVEARRGNFEPTDFLLSSVLSACAGLADLEFGRA  342

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+ VKAC+E +VFV S LVDMYGKCG I+DCE+AFYEMP+RNLITWNALIGGYAHQG 
Sbjct  343  VHGIAVKACIERDVFVGSALVDMYGKCGSIDDCEQAFYEMPDRNLITWNALIGGYAHQGR  402

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MAL+LFE+MT  +  V+PNYVTFVCVLTACSR G V  GMDIFE+M+ KYGIEPGAEH
Sbjct  403  ADMALELFEEMTSGSSVVMPNYVTFVCVLTACSRGGMVNKGMDIFESMRWKYGIEPGAEH  462

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVDMLGRAG VE AYE+IK MPIRPT+SVWGALLGAC+V+ KPELG IAA+NLF++D
Sbjct  463  YACVVDMLGRAGFVEHAYEYIKSMPIRPTISVWGALLGACKVYKKPELGTIAAENLFELD  522

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P DSGNHVILSNMFA++GRWEEAN VR+EMKD+GIKK
Sbjct  523  PMDSGNHVILSNMFAAAGRWEEANHVREEMKDVGIKK  559


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 106/222 (48%), Gaps = 12/222 (5%)
 Frame = +2

Query  95   REEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCI  274
            RE+G  P      +VL+ACA     +LG+ +HG V++   E ++ V + L+D YGKC  +
Sbjct  214  REDG--PNSITFCAVLNACADSLNLKLGKQLHGYVIRYGYEGDLAVLNGLIDFYGKCKEV  271

Query  275  EDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
               E  F  M +RN+++W +++  Y        A + F +  R   +  P       VL+
Sbjct  272  MFSEMVFDGMMDRNVVSWCSMVAVYEQNYMGEKACETFVEARRGNFE--PTDFLLSSVLS  329

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC+    +E G  +   +  K  IE      + +VDM G+ G ++   +    MP R  +
Sbjct  330  ACAGLADLEFGRAV-HGIAVKACIERDVFVGSALVDMYGKCGSIDDCEQAFYEMPDRNLI  388

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNHVILSN  760
            + W AL+G     G+ ++    A  LF+     SG+ V++ N
Sbjct  389  T-WNALIGGYAHQGRADM----ALELFE--EMTSGSSVVMPN  423


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 85/194 (44%), Gaps = 6/194 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKARE-EGIEPTEFMVSSVLSACAGLAAFELGRS  184
            R+ V+W SL++   QN     AL  F   R  + I P +F    +  A   L +  LG+ 
Sbjct  75   RSVVTWTSLISGSVQNGHFTSALSQFSSMRRVDNILPNDFTFPCLFKASTALNSPFLGQQ  134

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H L  K  +  +V+V     DMY K G   D  + F +MP RN+  WNA I      G 
Sbjct  135  FHALAEKLKLTSDVYVGCSAFDMYYKAGLNADACKMFDKMPHRNIAMWNAYICNAVVNGK  194

Query  365  ANMALDLFEDM----TRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEP  532
               A+  F ++        ++  PN +TF  VL AC+ +  ++ G  +      +YG E 
Sbjct  195  PKDAIIKFIELLYVGVEGLREDGPNSITFCAVLNACADSLNLKLGKQL-HGYVIRYGYEG  253

Query  533  GAEHYACVVDMLGR  574
                   ++D  G+
Sbjct  254  DLAVLNGLIDFYGK  267



>gb|EYU45680.1| hypothetical protein MIMGU_mgv1a026212mg [Erythranthe guttata]
Length=632

 Score =   448 bits (1152),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 208/277 (75%), Positives = 241/277 (87%), Gaps = 5/277 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSWCS+LAVYEQND+GE A  +F KAR  G+EPT+FMVSSVLSACAGLAA E GR 
Sbjct  225  ERNSVSWCSMLAVYEQNDMGEMACGLFFKARRAGVEPTDFMVSSVLSACAGLAALESGRV  284

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGL VKAC+EEN+FV S LVDMYGKCG IEDCERAF+ +P RNLI WNALIGGYAHQG 
Sbjct  285  VHGLAVKACIEENIFVGSALVDMYGKCGSIEDCERAFFMLPNRNLICWNALIGGYAHQGR  344

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A++AL+LF +MT       PNYVTFVCVLTACSR G V  G+DIF++MK KYG+ PGAEH
Sbjct  345  ADVALELFREMTYP-----PNYVTFVCVLTACSRGGLVSEGLDIFDSMKSKYGVNPGAEH  399

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVDMLGRAG VERA+ FI++M IRPT+S+WGALLGAC++HGK ELGKIAA+NLF++D
Sbjct  400  YACVVDMLGRAGQVERAHSFIQQMRIRPTISIWGALLGACKMHGKSELGKIAAENLFELD  459

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            PQDSGNHV+LSNMFA+SG+WEEANLVRKEMK++GIKK
Sbjct  460  PQDSGNHVLLSNMFAASGQWEEANLVRKEMKEVGIKK  496


 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 119/255 (47%), Gaps = 11/255 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W SL++   QN     AL  F   R E I+P +F    +  A A L +  LGR  
Sbjct  23   RSVVTWTSLISGNVQNGHFSSALSYFATMRRECIQPNDFTFPCLFKASASLRSPVLGRQF  82

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L  K  + ++VFV     DMY K G + D ++ F EMP RN+ TWNA I      G  
Sbjct  83   HALATKLLLIDDVFVACSAFDMYSKTGFLSDADKLFEEMPYRNIATWNACISNAVLNGKP  142

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +  +  F  + R  ++  PN ++F   L ACS    +  G  +   +  K G E      
Sbjct  143  HEGVRKFVQLLR-YEEAAPNSISFCAFLNACSDGNFLTQGQQLHGYLI-KQGHESEVSIL  200

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ---  718
              ++D  G+   ++ + +    M  R +VS W ++L    V+ + ++G++A    F+   
Sbjct  201  NGLIDFYGKCRKIQFSKKVFDDMGERNSVS-WCSMLA---VYEQNDMGEMACGLFFKARR  256

Query  719  --IDPQDSGNHVILS  757
              ++P D     +LS
Sbjct  257  AGVEPTDFMVSSVLS  271



>ref|XP_008224305.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Prunus mume]
Length=684

 Score =   445 bits (1144),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 207/278 (74%), Positives = 244/278 (88%), Gaps = 0/278 (0%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+RN VSWCSL+A   QND  E A ++FL+AR+EG+EPT+FMVSSVLSAC+GLA  E GR
Sbjct  271  DKRNDVSWCSLVAACVQNDEEEMACELFLRARKEGVEPTDFMVSSVLSACSGLAWLEQGR  330

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+H + VKACVE N+FV S LVDMYGKCG IED +RAF  MP RNLI+WNA++GGYAHQG
Sbjct  331  SVHAIAVKACVEGNLFVGSALVDMYGKCGSIEDAKRAFNGMPSRNLISWNAMVGGYAHQG  390

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HANMAL LFE+MT ++ +V PNYVT VCVL+ACSRAGAVETGM IFE+MK KYGIEPGAE
Sbjct  391  HANMALALFEEMTVRSHEVKPNYVTLVCVLSACSRAGAVETGMQIFESMKAKYGIEPGAE  450

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACVVD+LGRAGMVERAYEFI +MPI PT+S+WGALLGAC+++ K ELG++AAD LF++
Sbjct  451  HYACVVDLLGRAGMVERAYEFITKMPICPTISIWGALLGACKMYRKTELGRVAADKLFEL  510

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSGNHVILSNMFA++GRWEEA LVRKEMKD+GIKK
Sbjct  511  DPKDSGNHVILSNMFAAAGRWEEATLVRKEMKDVGIKK  548


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/259 (26%), Positives = 117/259 (45%), Gaps = 4/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +     A+  F++    G EP      + L+AC+  +  ELGR 
Sbjct  171  ERNLATWNAYMSNAVLDGRPLNAVYKFIEFLRAGGEPNSITFCAFLNACSDTSNLELGRQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V++    ++V V + L+D YGKC  +      F  + +RN ++W +L+        
Sbjct  231  LHGFVMRCGFGKDVSVLNGLIDFYGKCREVASSMMVFDTIDKRNDVSWCSLVAACVQNDE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
              MA +LF  +  + + V P       VL+ACS    +E G  +  A+  K  +E     
Sbjct  291  EEMACELF--LRARKEGVEPTDFMVSSVLSACSGLAWLEQGRSV-HAIAVKACVEGNLFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A      MP R  +S W A++G     G   +     + +    
Sbjct  348  GSALVDMYGKCGSIEDAKRAFNGMPSRNLIS-WNAMVGGYAHQGHANMALALFEEMTVRS  406

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V L  + ++  R
Sbjct  407  HEVKPNYVTLVCVLSACSR  425


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/229 (29%), Positives = 98/229 (43%), Gaps = 4/229 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ V+W +L+A   QN     A+  F     E ++P +F       A   L     G+ 
Sbjct  70   SRSVVTWTALIAGSVQNGHFASAILHFANMLRESVQPNDFTFPCAFKASGSLRLPATGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VKA    +VFV     DMY K G  ++  + F EMPERNL TWNA +      G 
Sbjct  130  VHALAVKAGQICDVFVGCSAFDMYCKTGLRDEARKVFDEMPERNLATWNAYMSNAVLDGR  189

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  F +  R   +  PN +TF   L ACS    +E G  +      + G       
Sbjct  190  PLNAVYKFIEFLRAGGE--PNSITFCAFLNACSDTSNLELGRQL-HGFVMRCGFGKDVSV  246

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
               ++D  G+   V  +      +  R  VS W +L+ AC  + + E+ 
Sbjct  247  LNGLIDFYGKCREVASSMMVFDTIDKRNDVS-WCSLVAACVQNDEEEMA  294


 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 81/187 (43%), Gaps = 9/187 (5%)
 Frame = +2

Query  125  MVSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYE  301
            +V S LS  + L    LGR+ H  +++        F+ + LV+MY K    +  +     
Sbjct  12   LVQSALSTQSTL----LGRAAHAQMIRTLDTPLPSFLSNHLVNMYSKLDLPDSAQLVLQL  67

Query  302  MPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE  481
             P R+++TW ALI G    GH   A+  F +M R++  V PN  TF C   A        
Sbjct  68   NPSRSVVTWTALIAGSVQNGHFASAILHFANMLRES--VQPNDFTFPCAFKASGSLRLPA  125

Query  482  TGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
            TG  +  A+  K G            DM  + G+ + A +    MP R  ++ W A +  
Sbjct  126  TGKQV-HALAVKAGQICDVFVGCSAFDMYCKTGLRDEARKVFDEMPER-NLATWNAYMSN  183

Query  662  CRVHGKP  682
              + G+P
Sbjct  184  AVLDGRP  190



>ref|XP_010277136.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Nelumbo nucifera]
Length=684

 Score =   444 bits (1143),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 206/277 (74%), Positives = 238/277 (86%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            + N VSW S++  YEQND+ EKA   FL A  EG+ PT+FMVSSVLSACAGLA  ELGRS
Sbjct  272  QPNDVSWGSMITAYEQNDVEEKACITFLHALREGVRPTDFMVSSVLSACAGLAGLELGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + VKACVE NV+V S LVDMYGKCG IED E AF EMP RNLI+WNA++GGYAHQGH
Sbjct  332  VHAIAVKACVEGNVYVGSALVDMYGKCGSIEDSELAFDEMPRRNLISWNAMVGGYAHQGH  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MAL L E+MT+    +VPNYVT VCVL+ACSRAGAVE GM  FE+MK +YGIEPGAEH
Sbjct  392  ADMALSLLEEMTQGANGIVPNYVTLVCVLSACSRAGAVEEGMQTFESMKGRYGIEPGAEH  451

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAGMV+RAYEFI++MPI PTVSVWGALLGACRV+GKPELGKIAA+ LFQ+D
Sbjct  452  YACIVDLLGRAGMVDRAYEFIRKMPIPPTVSVWGALLGACRVYGKPELGKIAAEKLFQLD  511

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            PQDSGNHV+LSNMFA+SGRWEEA +VRKEMK++GIKK
Sbjct  512  PQDSGNHVLLSNMFAASGRWEEATIVRKEMKEVGIKK  548


 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 98/219 (45%), Gaps = 4/219 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V+W +L++   QN     AL  F   R E I+P +F       A   L +   G+ 
Sbjct  70   ERSVVTWTALISGSVQNGHFASALLQFSAMRRESIQPNDFTFPCAFKATGSLFSPLTGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L +KA    +VFV     DMY K G  ED  + F EMPE N+ TWNA I      G 
Sbjct  130  IHALALKAGQMGDVFVGCSAFDMYCKTGLREDARKLFNEMPEPNVATWNAYISNSVLYGR  189

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  +  +  +   + PN +TF   L ACS A  +  G  +      + G +     
Sbjct  190  PYDAIGAY--IRFRHAGLEPNSITFCAFLNACSDASDLRLGRQL-HGFVIRNGSDADVSV  246

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
               ++D  G+    + A E +    ++P    WG+++ A
Sbjct  247  ANGLIDFYGKCKEFKSA-ELVFYRIVQPNDVSWGSMITA  284


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 108/237 (46%), Gaps = 4/237 (2%)
 Frame = +2

Query  71   ALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVD  250
            A+  +++ R  G+EP      + L+AC+  +   LGR +HG V++   + +V V + L+D
Sbjct  193  AIGAYIRFRHAGLEPNSITFCAFLNACSDASDLRLGRQLHGFVIRNGSDADVSVANGLID  252

Query  251  MYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNY  430
             YGKC   +  E  FY + + N ++W ++I  Y        A   F    R  + V P  
Sbjct  253  FYGKCKEFKSAELVFYRIVQPNDVSWGSMITAYEQNDVEEKACITFLHALR--EGVRPTD  310

Query  431  VTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIK  610
                 VL+AC+    +E G  +  A+  K  +E      + +VDM G+ G +E +     
Sbjct  311  FMVSSVLSACAGLAGLELGRSV-HAIAVKACVEGNVYVGSALVDMYGKCGSIEDSELAFD  369

Query  611  RMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNHVILSNMFASSGR  781
             MP R  +S W A++G     G  ++     + + Q       N+V L  + ++  R
Sbjct  370  EMPRRNLIS-WNAMVGGYAHQGHADMALSLLEEMTQGANGIVPNYVTLVCVLSACSR  425


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 83/188 (44%), Gaps = 8/188 (4%)
 Frame = +2

Query  125  MVSSVLSACAGLAAFELGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYE  301
            + S V SA A  +    GR+ H  ++K        F+   L++MY K   +         
Sbjct  9    LASLVESAVAAQSTL-FGRAAHAQIIKTLGSLLPSFLSIHLINMYSKLDLLSSAHLVLSL  67

Query  302  MPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE  481
             PER+++TW ALI G    GH   AL  F  M R++  + PN  TF C   A     +  
Sbjct  68   NPERSVVTWTALISGSVQNGHFASALLQFSAMRRES--IQPNDFTFPCAFKATGSLFSPL  125

Query  482  TGMDIFEAMKDKYGIEPGAEHYAC-VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
            TG  I  A+  K G + G     C   DM  + G+ E A +    MP  P V+ W A + 
Sbjct  126  TGKQI-HALALKAG-QMGDVFVGCSAFDMYCKTGLREDARKLFNEMP-EPNVATWNAYIS  182

Query  659  ACRVHGKP  682
               ++G+P
Sbjct  183  NSVLYGRP  190



>gb|KDP40185.1| hypothetical protein JCGZ_02183 [Jatropha curcas]
Length=681

 Score =   444 bits (1141),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 242/278 (87%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+RN VSWCSL+A +EQN   EKA  +FLK R+EG+EPT +MVSSV+SACAG AA ELGR
Sbjct  271  DKRNAVSWCSLMAAFEQNGEKEKACVLFLKGRKEGVEPTNYMVSSVISACAGFAALELGR  330

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+H L +KAC+E+++FV S LVDMYGKCG IEDC +AF EMPERNL+TWNA+I GYAHQG
Sbjct  331  SVHALALKACLEDDIFVGSALVDMYGKCGSIEDCRQAFQEMPERNLVTWNAMISGYAHQG  390

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HA+MA+ +FE+MT    +V PNYVT VCVL+ACSR GAVE GM++FE+M+D+Y IEPGAE
Sbjct  391  HADMAIRVFEEMT---SEVAPNYVTMVCVLSACSRGGAVELGMELFESMRDRYSIEPGAE  447

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC+VD+LGRAGMVE AYEF+++MPI PT+ VWGALL ACRV+GKPELGK+AADNLF++
Sbjct  448  HYACIVDLLGRAGMVEHAYEFVQKMPIHPTIEVWGALLNACRVYGKPELGKLAADNLFEL  507

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSGNHV+LSNMFA+ GRWEEA LVRKEM D+GIKK
Sbjct  508  DPKDSGNHVLLSNMFAAVGRWEEATLVRKEMMDVGIKK  545


 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 111/229 (48%), Gaps = 4/229 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +   E A+  F++ R  G EP      + L+AC     F+LGR 
Sbjct  171  ERNVATWNAYISNAVLDGRHENAVNAFIEFRRVGGEPDSITFCAFLNACVDPQYFDLGRQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V++   E ++ V + L+D YGKC  +   E  F EM +RN ++W +L+  +   G 
Sbjct  231  LHGFVIRTGFEMDMSVSNGLIDFYGKCKEVRLAEMVFGEMDKRNAVSWCSLMAAFEQNGE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  LF  +  + + V P       V++AC+   A+E G  +  A+  K  +E     
Sbjct  291  KEKACVLF--LKGRKEGVEPTNYMVSSVISACAGFAALELGRSV-HALALKACLEDDIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
             + +VDM G+ G +E   +  + MP R  V+ W A++      G  ++ 
Sbjct  348  GSALVDMYGKCGSIEDCRQAFQEMPERNLVT-WNAMISGYAHQGHADMA  395


 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 100/226 (44%), Gaps = 4/226 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L++   QN     AL  F   R E I+P +F       A A L +  +GR +
Sbjct  71   RSVVTWTALISGSVQNGHFSSALLHFFNMRRENIQPNDFTFPCAFKASALLRSPFVGRQV  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + VK     +VFV     DMY K G   + ++ F E+PERN+ TWNA I      G  
Sbjct  131  HAIAVKFGQINDVFVGCSAFDMYSKTGLKHEAQKLFDELPERNVATWNAYISNAVLDGRH  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R   +  P+ +TF   L AC      + G  +      + G E      
Sbjct  191  ENAVNAFIEFRRVGGE--PDSITFCAFLNACVDPQYFDLGRQL-HGFVIRTGFEMDMSVS  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
              ++D  G+   V  A      M  R  VS W +L+ A   +G+ E
Sbjct  248  NGLIDFYGKCKEVRLAEMVFGEMDKRNAVS-WCSLMAAFEQNGEKE  292


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/187 (26%), Positives = 82/187 (44%), Gaps = 5/187 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            ++S+L +     +  LGR++H   +K+       F+ + L++MY K              
Sbjct  9    IASLLESAVSTRSSLLGRAVHAQAMKSLQSPLPPFLANHLINMYSKLDLPNPAHLVLQLT  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P R+++TW ALI G    GH + AL  F +M R  +++ PN  TF C   A +   +   
Sbjct  69   PTRSVVTWTALISGSVQNGHFSSALLHFFNMRR--ENIQPNDFTFPCAFKASALLRSPFV  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
            G  +  A+  K+G            DM  + G+   A +    +P R  V+ W A +   
Sbjct  127  GRQV-HAIAVKFGQINDVFVGCSAFDMYSKTGLKHEAQKLFDELPER-NVATWNAYISNA  184

Query  665  RVHGKPE  685
             + G+ E
Sbjct  185  VLDGRHE  191



>ref|XP_007225674.1| hypothetical protein PRUPE_ppa002602mg [Prunus persica]
 gb|EMJ26873.1| hypothetical protein PRUPE_ppa002602mg [Prunus persica]
Length=653

 Score =   441 bits (1134),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 206/278 (74%), Positives = 243/278 (87%), Gaps = 0/278 (0%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+RN VSWCSL+A   QND  E A ++FL+AR+EG+EPT+FMVSSVLSAC+GLA  E GR
Sbjct  240  DKRNDVSWCSLVAACVQNDEEEMACELFLRARKEGVEPTDFMVSSVLSACSGLAWLEQGR  299

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+H + VKACVE N+FV S LVDMYGKCG IED + AF  MP RNLI+WNA++GGYAHQG
Sbjct  300  SVHAIAVKACVEGNLFVGSALVDMYGKCGSIEDAKCAFNGMPSRNLISWNAMVGGYAHQG  359

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HANMAL LFE+MT ++ +V PNYVT VCVL+ACSRAGAVETGM IFE+MK KYGIEPGAE
Sbjct  360  HANMALVLFEEMTVRSHEVKPNYVTLVCVLSACSRAGAVETGMQIFESMKAKYGIEPGAE  419

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACVVD+LGRAGMVERAYEFI +MPIRPT+S+WGALLGAC+++ K ELG++AAD LF++
Sbjct  420  HYACVVDLLGRAGMVERAYEFITKMPIRPTISIWGALLGACKMYRKTELGRVAADKLFEL  479

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSGNHVILSNMFA++GRWEEA LVRK MKD+GIKK
Sbjct  480  DPKDSGNHVILSNMFAAAGRWEEATLVRKGMKDVGIKK  517


 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/259 (26%), Positives = 119/259 (46%), Gaps = 4/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +   + A+  F++    G EP      + L+AC+  +  ELGR 
Sbjct  140  ERNLATWNAYMSNAVLDGRPQNAVYKFIEFLRAGGEPNSITFCAFLNACSDTSNLELGRQ  199

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V++    ++V V + L+D YGKC  +      F  + +RN ++W +L+        
Sbjct  200  LHGFVMRCGFGKDVSVLNGLIDFYGKCREVGSSMMVFDTIDKRNDVSWCSLVAACVQNDE  259

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
              MA +LF  +  + + V P       VL+ACS    +E G  +  A+  K  +E     
Sbjct  260  EEMACELF--LRARKEGVEPTDFMVSSVLSACSGLAWLEQGRSV-HAIAVKACVEGNLFV  316

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A      MP R  +S W A++G     G   +  +  + +    
Sbjct  317  GSALVDMYGKCGSIEDAKCAFNGMPSRNLIS-WNAMVGGYAHQGHANMALVLFEEMTVRS  375

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V L  + ++  R
Sbjct  376  HEVKPNYVTLVCVLSACSR  394


 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 98/228 (43%), Gaps = 4/228 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   QN     A+  F     E ++P +F       A   L     G+ +
Sbjct  40   RSVVTWTALIAGSVQNGHFASAILHFANMLRESVQPNDFTFPCAFKASGSLRLPATGKQV  99

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VKA    +VFV     DMY K G  ++  + F EMPERNL TWNA +      G  
Sbjct  100  HALAVKAGQICDVFVGCSAFDMYCKTGLRDEARKVFDEMPERNLATWNAYMSNAVLDGRP  159

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+  F +  R   +  PN +TF   L ACS    +E G  +      + G        
Sbjct  160  QNAVYKFIEFLRAGGE--PNSITFCAFLNACSDTSNLELGRQL-HGFVMRCGFGKDVSVL  216

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
              ++D  G+   V  +      +  R  VS W +L+ AC  + + E+ 
Sbjct  217  NGLIDFYGKCREVGSSMMVFDTIDKRNDVS-WCSLVAACVQNDEEEMA  263


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 67/153 (44%), Gaps = 4/153 (3%)
 Frame = +2

Query  227  FVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRK  406
            F+ + LV+MY K    +  +      P R+++TW ALI G    GH   A+  F +M R+
Sbjct  12   FLSNHLVNMYSKLDLPDSAQLVLQLNPSRSVVTWTALIAGSVQNGHFASAILHFANMLRE  71

Query  407  TQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMV  586
            +  V PN  TF C   A        TG  +  A+  K G            DM  + G+ 
Sbjct  72   S--VQPNDFTFPCAFKASGSLRLPATGKQV-HALAVKAGQICDVFVGCSAFDMYCKTGLR  128

Query  587  ERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            + A +    MP R  ++ W A +    + G+P+
Sbjct  129  DEARKVFDEMPER-NLATWNAYMSNAVLDGRPQ  160



>ref|XP_002282622.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Vitis vinifera]
Length=684

 Score =   441 bits (1134),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 205/275 (75%), Positives = 241/275 (88%), Gaps = 0/275 (0%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N VSWCS++  Y QND  EKA  VFL+AR+EGIEPT+FMVSSVLSACAGL+  E+G+S+H
Sbjct  274  NDVSWCSMIVSYVQNDEEEKACLVFLRARKEGIEPTDFMVSSVLSACAGLSVLEVGKSVH  333

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
             L VKACV  N+FV S LVDMYGKCG IED ERAF EMPERNL+TWNA+IGGYAHQG A+
Sbjct  334  TLAVKACVVGNIFVGSALVDMYGKCGSIEDAERAFDEMPERNLVTWNAMIGGYAHQGQAD  393

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
            MA+ LF++MT  +  V PNYVTFVCVL+ACSRAG+V  GM+IFE+M+ +YGIEPGAEHYA
Sbjct  394  MAVTLFDEMTCGSHRVAPNYVTFVCVLSACSRAGSVNVGMEIFESMRGRYGIEPGAEHYA  453

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQ  730
            CVVD+LGRAGMVE+AY+FIK+MPIRPTVSVWGALLGA ++ GK ELGK+AADNLF++DP 
Sbjct  454  CVVDLLGRAGMVEQAYQFIKKMPIRPTVSVWGALLGASKMFGKSELGKVAADNLFELDPL  513

Query  731  DSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DSGNHV+LSNMFA++GRWEEA LVRKEMKD+GIKK
Sbjct  514  DSGNHVLLSNMFAAAGRWEEATLVRKEMKDVGIKK  548


 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 117/252 (46%), Gaps = 10/252 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + L+        + AL  F++ R EG EP      + L+ACAG +   LGR 
Sbjct  171  ERNIATWNAYLSNSVLEGRYDDALTAFIEFRHEGWEPNLITFCAFLNACAGASYLRLGRQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V+++  E +V V + L+D YGKC  +   E  F  + + N ++W ++I  Y     
Sbjct  231  LHGFVLQSGFEADVSVANGLIDFYGKCHQVGCSEIIFSGISKPNDVSWCSMIVSYVQNDE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  +F  +  + + + P       VL+AC+    +E G  +   +  K  +      
Sbjct  291  EEKACLVF--LRARKEGIEPTDFMVSSVLSACAGLSVLEVGKSV-HTLAVKACVVGNIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A      MP R  V+ W A++G     G+ ++    A  LF  D
Sbjct  348  GSALVDMYGKCGSIEDAERAFDEMPERNLVT-WNAMIGGYAHQGQADM----AVTLF--D  400

Query  725  PQDSGNHVILSN  760
                G+H +  N
Sbjct  401  EMTCGSHRVAPN  412


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 80/163 (49%), Gaps = 2/163 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   QN     AL  F   R + I+P +F       A   L +  +G+ +
Sbjct  71   RSVVTWTALIAGSVQNGRFTSALFHFSNMRRDSIQPNDFTFPCAFKASGSLRSPLVGKQV  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VKA    +VFV     DMY K G  E+  + F EMPERN+ TWNA +     +G  
Sbjct  131  HALAVKAGQISDVFVGCSAFDMYSKAGLTEEARKMFDEMPERNIATWNAYLSNSVLEGRY  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
            + AL  F +   +  +  PN +TF   L AC+ A  +  G  +
Sbjct  191  DDALTAFIEFRHEGWE--PNLITFCAFLNACAGASYLRLGRQL  231


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 77/185 (42%), Gaps = 5/185 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            ++S++ +        LGR+ H  ++K        F+ + LV+MY K       +      
Sbjct  9    LASLVESAVSTQCSRLGRAAHAQIIKTLDNPLPSFIYNHLVNMYSKLDRPNSAQLLLSLT  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P R+++TW ALI G    G    AL  F +M R +  + PN  TF C   A     +   
Sbjct  69   PNRSVVTWTALIAGSVQNGRFTSALFHFSNMRRDS--IQPNDFTFPCAFKASGSLRSPLV  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
            G  +  A+  K G            DM  +AG+ E A +    MP R  ++ W A L   
Sbjct  127  GKQV-HALAVKAGQISDVFVGCSAFDMYSKAGLTEEARKMFDEMPER-NIATWNAYLSNS  184

Query  665  RVHGK  679
             + G+
Sbjct  185  VLEGR  189



>ref|XP_004303188.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Fragaria vesca subsp. vesca]
Length=684

 Score =   433 bits (1114),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/277 (71%), Positives = 239/277 (86%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            + N VSWCS++A Y QN+  EKA ++FL+AR EG+EPT+FMVSSVLSAC+GLA  E GRS
Sbjct  272  QANHVSWCSMVAAYVQNNEEEKACELFLRARREGVEPTDFMVSSVLSACSGLAWLEQGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L VKACV+ NVFV S LVDMYGKCG IED E AF  MP RNLI+WNA++GGY HQGH
Sbjct  332  IHALAVKACVDGNVFVGSALVDMYGKCGSIEDAECAFDMMPSRNLISWNAMVGGYTHQGH  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            AN AL LFE+M+ ++ ++ PNYVT VCVL+ACSRAG V+ GM IF++MK +YG+EPGAEH
Sbjct  392  ANTALALFEEMSDRSHELKPNYVTLVCVLSACSRAGDVQKGMQIFDSMKSRYGVEPGAEH  451

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGRAGMVERAYEFI +MPIRPT+S+WGALLGAC+++ KPELGKIAAD LF++D
Sbjct  452  YACVVDLLGRAGMVERAYEFITKMPIRPTISIWGALLGACKMYKKPELGKIAADKLFELD  511

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGNHV+LSN+ A++GRWEEA LVRKEMKD+GIKK
Sbjct  512  PKDSGNHVVLSNLLAATGRWEEATLVRKEMKDVGIKK  548


 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/218 (29%), Positives = 105/218 (48%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +     A++ F++    G EP      + L+AC+ L+A ELGR 
Sbjct  171  ERNLATWNAYMSNAVLDRRPVSAVEKFVEFVRAGGEPNSITFCAFLNACSDLSALELGRQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V++     +V V + LVD YGKC  +      F  + + N ++W +++  Y     
Sbjct  231  LHGFVMRFGFGRDVSVMNGLVDFYGKCRDVGLARMVFERIGQANHVSWCSMVAAYVQNNE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A +LF  +  + + V P       VL+ACS    +E G  I  A+  K  ++     
Sbjct  291  EEKACELF--LRARREGVEPTDFMVSSVLSACSGLAWLEQGRSI-HALAVKACVDGNVFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
             + +VDM G+ G +E A      MP R  +S W A++G
Sbjct  348  GSALVDMYGKCGSIEDAECAFDMMPSRNLIS-WNAMVG  384


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 78/164 (48%), Gaps = 2/164 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ V+W +L+A   QN     AL  F+  R + + P +F       A   L    +G+ 
Sbjct  70   SRSVVTWTALIAGLVQNRHFASALLNFINMRRDSVVPNDFTFPCAFKASGLLRRPVIGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VKA    +VFV     DMY K G  +D  + F EMPERNL TWNA +        
Sbjct  130  VHALAVKAGQICDVFVGCSAFDMYCKTGLGDDAGKVFDEMPERNLATWNAYMSNAVLDRR  189

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
               A++ F +  R   +  PN +TF   L ACS   A+E G  +
Sbjct  190  PVSAVEKFVEFVRAGGE--PNSITFCAFLNACSDLSALELGRQL  231


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 71/170 (42%), Gaps = 5/170 (3%)
 Frame = +2

Query  176  GRSIHGLVVKACVEEN-VFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYA  352
            GR+ H  +++     +  F+ + L++MY K       +   +  P R+++TW ALI G  
Sbjct  25   GRAAHAHIIRTLQPPHPSFLSNHLINMYSKLDLPNSAQLLLHLTPSRSVVTWTALIAGLV  84

Query  353  HQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEP  532
               H   AL  F +M R +  VVPN  TF C   A         G  +  A+  K G   
Sbjct  85   QNRHFASALLNFINMRRDS--VVPNDFTFPCAFKASGLLRRPVIGKQV-HALAVKAGQIC  141

Query  533  GAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKP  682
                     DM  + G+ + A +    MP R  ++ W A +    +  +P
Sbjct  142  DVFVGCSAFDMYCKTGLGDDAGKVFDEMPER-NLATWNAYMSNAVLDRRP  190



>ref|XP_006419949.1| hypothetical protein CICLE_v10006593mg [Citrus clementina]
 gb|ESR33189.1| hypothetical protein CICLE_v10006593mg [Citrus clementina]
Length=686

 Score =   432 bits (1112),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 201/277 (73%), Positives = 237/277 (86%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++N VSWCS+LAVY QN   E   ++FL AR EG+EP +FM+SSVLSACA +A  ELGRS
Sbjct  274  DKNDVSWCSMLAVYVQNYEEENGCRMFLTARREGVEPKDFMISSVLSACARIAGLELGRS  333

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + VKACVE N+FV S LVDMYGKCG IED E AF +MPERNL+ WNA+IGGYAHQGH
Sbjct  334  VHAVAVKACVEGNIFVGSALVDMYGKCGSIEDAEIAFNKMPERNLVCWNAIIGGYAHQGH  393

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MAL  FE+MT    + VPNYVT VCVL+ACSRAGAVE GM+IF +M  KYGI+PGAEH
Sbjct  394  ADMALSSFEEMTSMRCEAVPNYVTLVCVLSACSRAGAVEKGMEIFYSMTLKYGIKPGAEH  453

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGRAG+V+RAYE IK MP+RPT+SVWGALL ACRV+GKPELG+IAADNLF++D
Sbjct  454  YACVVDLLGRAGLVDRAYEIIKEMPMRPTISVWGALLNACRVYGKPELGRIAADNLFKLD  513

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P DSGNHV+LSNMFA++GRWEEA+LVRKEMKD+GIKK
Sbjct  514  PNDSGNHVLLSNMFAATGRWEEADLVRKEMKDVGIKK  550


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 121/259 (47%), Gaps = 4/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++        + A+  F+  R  G EP      + L+AC+     +LGR 
Sbjct  173  ERNLATWNAYISNAVLGGRPKNAIDAFINLRRTGGEPDLITFCAFLNACSDCLLLQLGRQ  232

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG +V++  + NV V + LVD YGKC  +   +  F  + ++N ++W +++  Y     
Sbjct  233  LHGFLVRSGFDGNVSVCNGLVDFYGKCNEVGLAKAVFDGIIDKNDVSWCSMLAVYVQNYE  292

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                  +F  +T + + V P       VL+AC+R   +E G  +  A+  K  +E     
Sbjct  293  EENGCRMF--LTARREGVEPKDFMISSVLSACARIAGLELGRSV-HAVAVKACVEGNIFV  349

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A     +MP R  V  W A++G     G  ++   + + +  + 
Sbjct  350  GSALVDMYGKCGSIEDAEIAFNKMPERNLV-CWNAIIGGYAHQGHADMALSSFEEMTSMR  408

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V L  + ++  R
Sbjct  409  CEAVPNYVTLVCVLSACSR  427


 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 78/164 (48%), Gaps = 2/164 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R  VSW +L++   QN     A   F   R E I P +F    +  A + L     G+ 
Sbjct  72   SRTVVSWTALISGLVQNGHFTSAFLHFTNMRLECISPNDFTFPCLFKASSALHIPVTGKQ  131

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +K+    +VFV     DMY K G  +D ++ F EMPERNL TWNA I      G 
Sbjct  132  LHALALKSGQIHDVFVGCSAFDMYSKTGLKDDADKMFDEMPERNLATWNAYISNAVLGGR  191

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
               A+D F ++ R   +  P+ +TF   L ACS    ++ G  +
Sbjct  192  PKNAIDAFINLRRTGGE--PDLITFCAFLNACSDCLLLQLGRQL  233



>ref|XP_006489403.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
isoform X1 [Citrus sinensis]
 ref|XP_006489404.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
isoform X2 [Citrus sinensis]
Length=686

 Score =   432 bits (1110),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 201/277 (73%), Positives = 236/277 (85%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++N VSWCS+LAVY QN   E   ++FL AR EG+EP +FM+SSVLSACA +A  ELGRS
Sbjct  274  DKNDVSWCSMLAVYVQNYEEENGCRMFLTARREGVEPKDFMISSVLSACARIAGLELGRS  333

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + VKACVE N+FV S LVDMYGKCG IED E AF +MPERNL+ WNA+IGGYAHQGH
Sbjct  334  VHAVAVKACVEGNIFVGSALVDMYGKCGSIEDAEIAFNKMPERNLVCWNAIIGGYAHQGH  393

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MAL  FE+MT    + VPNYVT VCVL+ACSRAGAVE GM IF +M  KYGI+PGAEH
Sbjct  394  ADMALSSFEEMTSMRCEAVPNYVTLVCVLSACSRAGAVEKGMKIFYSMTLKYGIKPGAEH  453

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGRAG+V+RAYE IK MP+RPT+SVWGALL ACRV+GKPELG+IAADNLF++D
Sbjct  454  YACVVDLLGRAGLVDRAYEIIKEMPMRPTISVWGALLNACRVYGKPELGRIAADNLFKLD  513

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P DSGNHV+LSNMFA++GRWEEA+LVRKEMKD+GIKK
Sbjct  514  PNDSGNHVLLSNMFAATGRWEEADLVRKEMKDVGIKK  550


 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 126/271 (46%), Gaps = 7/271 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++        + A+  F+  R  G EP      + L+AC+     +LGR 
Sbjct  173  ERNLATWNAYISNAVLGGRPKNAIDAFINLRRTGGEPDLITFCAFLNACSDCLLLQLGRQ  232

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG +V++  + NV V + LVD YGKC  +   +  F  + ++N ++W +++  Y     
Sbjct  233  LHGFLVRSGFDGNVSVCNGLVDFYGKCNEVGLAKAVFDGIIDKNDVSWCSMLAVYVQNYE  292

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                  +F  +T + + V P       VL+AC+R   +E G  +  A+  K  +E     
Sbjct  293  EENGCRMF--LTARREGVEPKDFMISSVLSACARIAGLELGRSV-HAVAVKACVEGNIFV  349

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A     +MP R  V  W A++G     G  ++   + + +  + 
Sbjct  350  GSALVDMYGKCGSIEDAEIAFNKMPERNLV-CWNAIIGGYAHQGHADMALSSFEEMTSMR  408

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMK  817
             +   N+V L  + ++  R   A  V K MK
Sbjct  409  CEAVPNYVTLVCVLSACSR---AGAVEKGMK  436


 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 78/164 (48%), Gaps = 2/164 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R  VSW +L++   QN     A   F   R E I P +F    +  A + L     G+ 
Sbjct  72   SRTVVSWTALISGLVQNGHFTSAFLHFTNMRLECISPNDFTFPCLFKASSALHIPVTGKQ  131

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +K+    +VFV     DMY K G  +D ++ F EMPERNL TWNA I      G 
Sbjct  132  LHALALKSGQIHDVFVGCSAFDMYSKTGLKDDADKMFDEMPERNLATWNAYISNAVLGGR  191

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
               A+D F ++ R   +  P+ +TF   L ACS    ++ G  +
Sbjct  192  PKNAIDAFINLRRTGGE--PDLITFCAFLNACSDCLLLQLGRQL  233



>ref|XP_007034774.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 3 
[Theobroma cacao]
 gb|EOY05700.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 3 
[Theobroma cacao]
Length=683

 Score =   431 bits (1108),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 243/278 (87%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            ++RN VSWCSL++ YEQN   E A +VFL AR+EG+EPT+FMVSSV+SACAG++  E GR
Sbjct  273  EKRNAVSWCSLVSAYEQNYEEENACEVFLAARKEGVEPTDFMVSSVISACAGMSGLEFGR  332

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+HGL VKACV+ NVFV S L+DMYGKCG I+D E+AF+EMPERNL+TWNA+IGGYAHQG
Sbjct  333  SVHGLAVKACVKGNVFVGSALIDMYGKCGSIKDAEQAFHEMPERNLVTWNAMIGGYAHQG  392

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             A+MAL LF+DM   +  VVPNYVT VCVL+ACSR GAV+ G+ IFE+M +++ IEPGAE
Sbjct  393  CADMALALFQDMM--SCGVVPNYVTLVCVLSACSRGGAVKLGVKIFESMNERFHIEPGAE  450

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACVVD+LGRAGMVERAY+FIK+MPI PT+SVWGALL ACRV+ KPELG+IAA  LF++
Sbjct  451  HYACVVDLLGRAGMVERAYDFIKKMPIAPTISVWGALLNACRVYKKPELGRIAAYKLFEL  510

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSGNHV+LSN+FAS+GRWEEA+LVRKEMKD+GIKK
Sbjct  511  DPKDSGNHVLLSNLFASTGRWEEADLVRKEMKDVGIKK  548


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 98/196 (50%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   ALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVD  250
            A+ VF+K R  G EP        L+AC+     ELGR +HG V+++  + N+ V + LVD
Sbjct  195  AVDVFIKFRRVGGEPDPITFCVFLNACSDAFYLELGRQLHGCVIRSGFDGNLSVCNGLVD  254

Query  251  MYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNY  430
             YGKC  +E  +  F  M +RN ++W +L+  Y        A ++F  +  + + V P  
Sbjct  255  FYGKCKEVESAKMVFDGMEKRNAVSWCSLVSAYEQNYEEENACEVF--LAARKEGVEPTD  312

Query  431  VTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIK  610
                 V++AC+    +E G  +   +  K  ++      + ++DM G+ G ++ A +   
Sbjct  313  FMVSSVISACAGMSGLEFGRSV-HGLAVKACVKGNVFVGSALIDMYGKCGSIKDAEQAFH  371

Query  611  RMPIRPTVSVWGALLG  658
             MP R  V+ W A++G
Sbjct  372  EMPERNLVT-WNAMIG  386


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 102/220 (46%), Gaps = 4/220 (2%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + R+ V+W +L++ + QN     AL  F   R++ I P +F       A A L +  +G+
Sbjct  71   ESRSVVTWTALISGHVQNGHFASALIHFSHMRKDLISPNDFTFPCAFKASAALRSPVVGK  130

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H L +K+    + FV     DMY K G   +    F EMP+R++  WNA I      G
Sbjct  131  QLHALALKSAQIFDSFVGCSCFDMYLKTGLRGEARNMFDEMPDRSVAMWNANISNAVLDG  190

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              ++A+D+F    R   +  P+ +TF   L ACS A  +E G  +   +  + G +    
Sbjct  191  KPSIAVDVFIKFRRVGGE--PDPITFCVFLNACSDAFYLELGRQLHGCVI-RSGFDGNLS  247

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
                +VD  G+   VE A      M  R  VS W +L+ A
Sbjct  248  VCNGLVDFYGKCKEVESAKMVFDGMEKRNAVS-WCSLVSA  286



>ref|XP_007034772.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007034773.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007034775.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY05698.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY05699.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY05701.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 
[Theobroma cacao]
Length=684

 Score =   431 bits (1107),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 243/278 (87%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            ++RN VSWCSL++ YEQN   E A +VFL AR+EG+EPT+FMVSSV+SACAG++  E GR
Sbjct  273  EKRNAVSWCSLVSAYEQNYEEENACEVFLAARKEGVEPTDFMVSSVISACAGMSGLEFGR  332

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+HGL VKACV+ NVFV S L+DMYGKCG I+D E+AF+EMPERNL+TWNA+IGGYAHQG
Sbjct  333  SVHGLAVKACVKGNVFVGSALIDMYGKCGSIKDAEQAFHEMPERNLVTWNAMIGGYAHQG  392

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             A+MAL LF+DM   +  VVPNYVT VCVL+ACSR GAV+ G+ IFE+M +++ IEPGAE
Sbjct  393  CADMALALFQDMM--SCGVVPNYVTLVCVLSACSRGGAVKLGVKIFESMNERFHIEPGAE  450

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACVVD+LGRAGMVERAY+FIK+MPI PT+SVWGALL ACRV+ KPELG+IAA  LF++
Sbjct  451  HYACVVDLLGRAGMVERAYDFIKKMPIAPTISVWGALLNACRVYKKPELGRIAAYKLFEL  510

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSGNHV+LSN+FAS+GRWEEA+LVRKEMKD+GIKK
Sbjct  511  DPKDSGNHVLLSNLFASTGRWEEADLVRKEMKDVGIKK  548


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 98/196 (50%), Gaps = 4/196 (2%)
 Frame = +2

Query  71   ALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVD  250
            A+ VF+K R  G EP        L+AC+     ELGR +HG V+++  + N+ V + LVD
Sbjct  195  AVDVFIKFRRVGGEPDPITFCVFLNACSDAFYLELGRQLHGCVIRSGFDGNLSVCNGLVD  254

Query  251  MYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNY  430
             YGKC  +E  +  F  M +RN ++W +L+  Y        A ++F  +  + + V P  
Sbjct  255  FYGKCKEVESAKMVFDGMEKRNAVSWCSLVSAYEQNYEEENACEVF--LAARKEGVEPTD  312

Query  431  VTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIK  610
                 V++AC+    +E G  +   +  K  ++      + ++DM G+ G ++ A +   
Sbjct  313  FMVSSVISACAGMSGLEFGRSV-HGLAVKACVKGNVFVGSALIDMYGKCGSIKDAEQAFH  371

Query  611  RMPIRPTVSVWGALLG  658
             MP R  V+ W A++G
Sbjct  372  EMPERNLVT-WNAMIG  386


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 102/220 (46%), Gaps = 4/220 (2%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + R+ V+W +L++ + QN     AL  F   R++ I P +F       A A L +  +G+
Sbjct  71   ESRSVVTWTALISGHVQNGHFASALIHFSHMRKDLISPNDFTFPCAFKASAALRSPVVGK  130

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H L +K+    + FV     DMY K G   +    F EMP+R++  WNA I      G
Sbjct  131  QLHALALKSAQIFDSFVGCSCFDMYLKTGLRGEARNMFDEMPDRSVAMWNANISNAVLDG  190

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              ++A+D+F    R   +  P+ +TF   L ACS A  +E G  +   +  + G +    
Sbjct  191  KPSIAVDVFIKFRRVGGE--PDPITFCVFLNACSDAFYLELGRQLHGCVI-RSGFDGNLS  247

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
                +VD  G+   VE A      M  R  VS W +L+ A
Sbjct  248  VCNGLVDFYGKCKEVESAKMVFDGMEKRNAVS-WCSLVSA  286



>gb|KDO74556.1| hypothetical protein CISIN_1g007881mg [Citrus sinensis]
 gb|KDO74557.1| hypothetical protein CISIN_1g007881mg [Citrus sinensis]
Length=586

 Score =   427 bits (1098),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 199/277 (72%), Positives = 235/277 (85%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++N VSWCS+L VY QN   E   ++FL AR EG+EP +FM+SSVLSACA +A  ELGRS
Sbjct  174  DKNDVSWCSMLVVYVQNYEEENGCQMFLTARREGVEPKDFMISSVLSACARIAGLELGRS  233

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + VKACVE N+FV S LVDMYGKCG I+D E AF +MPERNL+ WNA+IGGYAHQGH
Sbjct  234  VHAVAVKACVEGNIFVGSALVDMYGKCGSIQDAEIAFNKMPERNLVCWNAIIGGYAHQGH  293

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MAL  FE+MT    + VPNYVT VCVL+ACSRAGAVE GM IF +M  KYGI+PGAEH
Sbjct  294  ADMALSSFEEMTSMRCEAVPNYVTLVCVLSACSRAGAVEKGMKIFYSMTLKYGIKPGAEH  353

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGRAG+V+RAYE IK MP+RPT+SVWGALL ACRV+GKPELG+IAADNLF++D
Sbjct  354  YACVVDLLGRAGLVDRAYEIIKEMPMRPTISVWGALLNACRVYGKPELGRIAADNLFKLD  413

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P DSGNHV+LSNMFA++GRWEEA+LVRKEMKD+GIKK
Sbjct  414  PNDSGNHVLLSNMFAATGRWEEADLVRKEMKDVGIKK  450


 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/271 (26%), Positives = 127/271 (47%), Gaps = 7/271 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++        + A+  F+  R  G EP      + L+AC+  +  +LGR 
Sbjct  73   ERNLATWNAYISNAVLGGRPKNAIDAFINLRRTGGEPDLITFCAFLNACSDCSLLQLGRQ  132

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG +V++  + NV V + LVD YGKC  +   +  F  + ++N ++W +++  Y     
Sbjct  133  LHGFLVRSGFDGNVSVCNGLVDFYGKCNEVGLAKVVFDGIIDKNDVSWCSMLVVYVQNYE  192

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                  +F  +T + + V P       VL+AC+R   +E G  +  A+  K  +E     
Sbjct  193  EENGCQMF--LTARREGVEPKDFMISSVLSACARIAGLELGRSV-HAVAVKACVEGNIFV  249

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G ++ A     +MP R  V  W A++G     G  ++   + + +  + 
Sbjct  250  GSALVDMYGKCGSIQDAEIAFNKMPERNLV-CWNAIIGGYAHQGHADMALSSFEEMTSMR  308

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMK  817
             +   N+V L  + ++  R   A  V K MK
Sbjct  309  CEAVPNYVTLVCVLSACSR---AGAVEKGMK  336


 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 66/134 (49%), Gaps = 2/134 (1%)
 Frame = +2

Query  95   REEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCI  274
            R E I P +F    +  A + L     G+ +H L +K+    +VFV     DMY K G  
Sbjct  2    RRECISPNDFTFPCLFKASSALHIPVTGKQLHALALKSGQIHDVFVGCSAFDMYSKTGLK  61

Query  275  EDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
            +D ++ F EMPERNL TWNA I      G    A+D F ++ R   +  P+ +TF   L 
Sbjct  62   DDADKMFDEMPERNLATWNAYISNAVLGGRPKNAIDAFINLRRTGGE--PDLITFCAFLN  119

Query  455  ACSRAGAVETGMDI  496
            ACS    ++ G  +
Sbjct  120  ACSDCSLLQLGRQL  133



>ref|XP_008390906.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Malus domestica]
Length=684

 Score =   428 bits (1101),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 199/277 (72%), Positives = 237/277 (86%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSWCS++A   QND  EKA + FL+A +EG++PT+FMVSSVLSACAG+A  E GRS
Sbjct  272  QRNDVSWCSMVAACVQNDEEEKACEFFLRAMKEGVKPTDFMVSSVLSACAGVAWLEQGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + VKACVE NVFV S LVDMYGKCGCIED +RAF EMP RNLITWNA++G YAHQG 
Sbjct  332  VHSVAVKACVEGNVFVGSALVDMYGKCGCIEDAKRAFDEMPSRNLITWNAMVGAYAHQGL  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MAL LF++M  ++ +  PNYVT VCVL+ACSRAGAV+ GM IFE+MK KYGIEPGAEH
Sbjct  392  ADMALALFKEMCTQSHEFKPNYVTLVCVLSACSRAGAVQMGMRIFESMKAKYGIEPGAEH  451

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGRAGM+ERAYEFI +MPIRPT+S+WGALLGAC+++   ELGKIAAD LF++D
Sbjct  452  YACVVDLLGRAGMIERAYEFITKMPIRPTISIWGALLGACKMYRNTELGKIAADKLFELD  511

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGNHV+LSNMFA+ GRWEEA LVRK MKD+GIKK
Sbjct  512  PKDSGNHVVLSNMFAACGRWEEATLVRKGMKDVGIKK  548


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 76/164 (46%), Gaps = 2/164 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ V+W SL+A   QN     A+  F   R E I+P +F       A   L     G+ 
Sbjct  70   SRSVVTWTSLIAGSVQNGHFASAILHFSNMRRESIQPNDFTFPCAFKASGLLRLPVTGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VKA    +VFV     DMY K G  ++    F EMPERNL TWNA +      G 
Sbjct  130  LHALAVKAGQICDVFVGCSAFDMYCKTGLRDEARNVFDEMPERNLATWNAYMSNAVLDGR  189

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
               A+  F +  R   +  PN +TF   L ACS   ++E G  +
Sbjct  190  PLNAVYKFIEFLRAGGE--PNSITFCAFLNACSDTSSLELGKQL  231


 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/259 (24%), Positives = 117/259 (45%), Gaps = 4/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +     A+  F++    G EP      + L+AC+  ++ ELG+ 
Sbjct  171  ERNLATWNAYMSNAVLDGRPLNAVYKFIEFLRAGGEPNSITFCAFLNACSDTSSLELGKQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V++    ++V V + L+D YGKC  +      FY + +RN ++W +++        
Sbjct  231  LHGFVMRCGFGKDVSVLNGLIDFYGKCREVGFSMTVFYGIGQRNDVSWCSMVAACVQNDE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A + F  +    + V P       VL+AC+    +E G  +  ++  K  +E     
Sbjct  291  EEKACEFF--LRAMKEGVKPTDFMVSSVLSACAGVAWLEQGRSV-HSVAVKACVEGNVFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A      MP R  ++ W A++GA    G  ++       +    
Sbjct  348  GSALVDMYGKCGCIEDAKRAFDEMPSRNLIT-WNAMVGAYAHQGLADMALALFKEMCTQS  406

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V L  + ++  R
Sbjct  407  HEFKPNYVTLVCVLSACSR  425


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 72/171 (42%), Gaps = 5/171 (3%)
 Frame = +2

Query  173  LGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGY  349
            L R+ H  +++        F+ + LV+MY K    +  +      P R+++TW +LI G 
Sbjct  24   LARAAHAHMIRTLGASLPSFLSNHLVNMYSKLDLPDSAQLVLRLSPSRSVVTWTSLIAGS  83

Query  350  AHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIE  529
               GH   A+  F +M R++  + PN  TF C   A        TG  +  A+  K G  
Sbjct  84   VQNGHFASAILHFSNMRRES--IQPNDFTFPCAFKASGLLRLPVTGKQL-HALAVKAGQI  140

Query  530  PGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKP  682
                      DM  + G+ + A      MP R  ++ W A +    + G+P
Sbjct  141  CDVFVGCSAFDMYCKTGLRDEARNVFDEMPER-NLATWNAYMSNAVLDGRP  190



>emb|CBI26264.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   423 bits (1087),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/277 (71%), Positives = 236/277 (85%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + L+        + AL  F++AR+EGIEPT+FMVSSVLSACAGL+  E+G+S
Sbjct  171  ERNIATWNAYLSNSVLEGRYDDALTAFIEARKEGIEPTDFMVSSVLSACAGLSVLEVGKS  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VKACV  N+FV S LVDMYGKCG IED ERAF EMPERNL+TWNA+IGGYAHQG 
Sbjct  231  VHTLAVKACVVGNIFVGSALVDMYGKCGSIEDAERAFDEMPERNLVTWNAMIGGYAHQGQ  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MA+ LF++MT  +  V PNYVTFVCVL+ACSRAG+V  GM+IFE+M+ +YGIEPGAEH
Sbjct  291  ADMAVTLFDEMTCGSHRVAPNYVTFVCVLSACSRAGSVNVGMEIFESMRGRYGIEPGAEH  350

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGRAGMVE+AY+FIK+MPIRPTVSVWGALLGA ++ GK ELGK+AADNLF++D
Sbjct  351  YACVVDLLGRAGMVEQAYQFIKKMPIRPTVSVWGALLGASKMFGKSELGKVAADNLFELD  410

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P DSGNHV+LSNMFA++GRWEEA LVRKEMKD+GIKK
Sbjct  411  PLDSGNHVLLSNMFAAAGRWEEATLVRKEMKDVGIKK  447


 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 116/251 (46%), Gaps = 10/251 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   QN     AL  F   R + I+P +F       A   L +  +G+ +
Sbjct  71   RSVVTWTALIAGSVQNGRFTSALFHFSNMRRDSIQPNDFTFPCAFKASGSLRSPLVGKQV  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VKA    +VFV     DMY K G  E+  + F EMPERN+ TWNA +     +G  
Sbjct  131  HALAVKAGQISDVFVGCSAFDMYSKAGLTEEARKMFDEMPERNIATWNAYLSNSVLEGRY  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            + AL  F  +  + + + P       VL+AC+    +E G  +   +  K  +       
Sbjct  191  DDALTAF--IEARKEGIEPTDFMVSSVLSACAGLSVLEVGKSV-HTLAVKACVVGNIFVG  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            + +VDM G+ G +E A      MP R  V+ W A++G     G+ ++    A  LF  D 
Sbjct  248  SALVDMYGKCGSIEDAERAFDEMPERNLVT-WNAMIGGYAHQGQADM----AVTLF--DE  300

Query  728  QDSGNHVILSN  760
               G+H +  N
Sbjct  301  MTCGSHRVAPN  311


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 77/185 (42%), Gaps = 5/185 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            ++S++ +        LGR+ H  ++K        F+ + LV+MY K       +      
Sbjct  9    LASLVESAVSTQCSRLGRAAHAQIIKTLDNPLPSFIYNHLVNMYSKLDRPNSAQLLLSLT  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P R+++TW ALI G    G    AL  F +M R +  + PN  TF C   A     +   
Sbjct  69   PNRSVVTWTALIAGSVQNGRFTSALFHFSNMRRDS--IQPNDFTFPCAFKASGSLRSPLV  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
            G  +  A+  K G            DM  +AG+ E A +    MP R  ++ W A L   
Sbjct  127  GKQV-HALAVKAGQISDVFVGCSAFDMYSKAGLTEEARKMFDEMPER-NIATWNAYLSNS  184

Query  665  RVHGK  679
             + G+
Sbjct  185  VLEGR  189



>ref|XP_011021521.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Populus euphratica]
Length=681

 Score =   425 bits (1093),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/276 (70%), Positives = 238/276 (86%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWC+++A  EQND  EKA  VFL AR+EGIE T++MVSSV+SA AG++  E GRS+
Sbjct  273  RNSVSWCTMVAACEQNDEKEKACVVFLMARKEGIELTDYMVSSVISAYAGISGLEFGRSV  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VKACVE ++FV S LVDMYGKCG IEDCE+ F+EMPERNL++WNA+I GYAHQG  
Sbjct  333  HALAVKACVEGDIFVGSALVDMYGKCGSIEDCEQVFHEMPERNLVSWNAMISGYAHQGDV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MA+ LFE+M     + +PNYVT +CVL+ACSR GAV+ G +IFE+M+D+Y IEPGAEHY
Sbjct  393  DMAMTLFEEMQ---SEALPNYVTLICVLSACSRGGAVKLGNEIFESMRDRYRIEPGAEHY  449

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            AC+ DMLGRAGMVERAYEF+++MPIRPT+SVWGALL ACRV+G+PELGKIAADNLF++DP
Sbjct  450  ACIADMLGRAGMVERAYEFVQKMPIRPTISVWGALLNACRVYGEPELGKIAADNLFKLDP  509

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSNMFA++GRW+EA LVRKEMKD+GIKK
Sbjct  510  KDSGNHVLLSNMFAAAGRWDEATLVRKEMKDVGIKK  545


 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 98/223 (44%), Gaps = 4/223 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W +L++ Y QN     AL  F K R E I+P +F       A   L     G+ IH +
Sbjct  74   VTWTALISGYVQNGYFSSALLYFSKMRRENIKPNDFTFPCAFKASTALCLPFAGKQIHAI  133

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K     + FV     DMY K G   + +R F EMP RN+  WNA I      G    A
Sbjct  134  ALKLGQINDKFVGCSAFDMYSKTGLKFEAQRLFDEMPPRNVAVWNAYISNAVLDGRPRKA  193

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +D F +  R   +  P+ +TF   L AC+ A  ++ G  +      + G E        +
Sbjct  194  IDKFIEFRRMGGE--PDLITFCAFLNACADARCLDLGRQL-HGFVIRSGFEGDVSVANGI  250

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +D  G+   VE A      M  R +VS W  ++ AC  + + E
Sbjct  251  IDFYGKCKEVELAEMVFNGMGRRNSVS-WCTMVAACEQNDEKE  292


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/259 (27%), Positives = 119/259 (46%), Gaps = 9/259 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN   W + ++    +    KA+  F++ R  G EP      + L+ACA     +LGR +
Sbjct  172  RNVAVWNAYISNAVLDGRPRKAIDKFIEFRRMGGEPDLITFCAFLNACADARCLDLGRQL  231

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG V+++  E +V V + ++D YGKC  +E  E  F  M  RN ++W  ++         
Sbjct  232  HGFVIRSGFEGDVSVANGIIDFYGKCKEVELAEMVFNGMGRRNSVSWCTMVAACEQNDEK  291

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A  +F  M RK    + +Y+    V++A +    +E G  +  A+  K  +E      
Sbjct  292  EKACVVFL-MARKEGIELTDYMV-SSVISAYAGISGLEFGRSV-HALAVKACVEGDIFVG  348

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF-QID  724
            + +VDM G+ G +E   +    MP R  VS W A++      G  ++    A  LF ++ 
Sbjct  349  SALVDMYGKCGSIEDCEQVFHEMPERNLVS-WNAMISGYAHQGDVDM----AMTLFEEMQ  403

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V L  + ++  R
Sbjct  404  SEALPNYVTLICVLSACSR  422


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 80/188 (43%), Gaps = 9/188 (5%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKA--CVEENVFVRSVLVDMYGKCGCIEDCERAFYE  301
            ++++L       +  LGR+ H  ++K   C     F+   L+ MY K       +     
Sbjct  9    LATILETAVSTHSSLLGRATHAQILKTLQCTIPP-FLSIHLISMYSKLDLPNSAQLILQL  67

Query  302  MPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE  481
             P R ++TW ALI GY   G+ + AL  F  M R  +++ PN  TF C   A +      
Sbjct  68   TPTRCVVTWTALISGYVQNGYFSSALLYFSKMRR--ENIKPNDFTFPCAFKASTALCLPF  125

Query  482  TGMDIFEAMKDKYGIEPGAEHYAC-VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
             G  I  A+  K G +   +   C   DM  + G+   A      MP R  V+VW A + 
Sbjct  126  AGKQI-HAIALKLG-QINDKFVGCSAFDMYSKTGLKFEAQRLFDEMPPR-NVAVWNAYIS  182

Query  659  ACRVHGKP  682
               + G+P
Sbjct  183  NAVLDGRP  190



>ref|XP_009335332.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Pyrus x bretschneideri]
Length=684

 Score =   424 bits (1091),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/277 (71%), Positives = 235/277 (85%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSWCS++A   QND  E A + FL+A +EG++PT+FMVSSVLSACAG+A  E GRS
Sbjct  272  QRNDVSWCSMVAACVQNDEEENACEFFLRAMKEGVKPTDFMVSSVLSACAGVAWLEQGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + VKACVE NVFV S LVDMYGKCGCIED +RAF EMP RNLITWNA++G YAHQG 
Sbjct  332  VHSVAVKACVEGNVFVGSALVDMYGKCGCIEDAKRAFDEMPSRNLITWNAMVGAYAHQGL  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MAL  F++M  ++ +  PNYVT VCVL+ACSRAGAV+ GM IFE+MK KY IEPGAEH
Sbjct  392  ADMALAFFKEMCSRSHEFKPNYVTLVCVLSACSRAGAVQMGMQIFESMKAKYAIEPGAEH  451

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGRAGM+ERAYEFI +MPIRPT+S+WGALLGAC+++   ELGKIAAD LF++D
Sbjct  452  YACVVDLLGRAGMIERAYEFITKMPIRPTISIWGALLGACKMYRSTELGKIAADKLFELD  511

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGNHV+LSNMFA++GRWEEA LVRK MKD+GIKK
Sbjct  512  PKDSGNHVVLSNMFAAAGRWEEATLVRKGMKDVGIKK  548


 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 96/220 (44%), Gaps = 4/220 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ V+W SL+A   QN     A+  F   R E I+P +F       A   L     G+ 
Sbjct  70   SRSVVTWTSLIAGAVQNGHFASAILHFSNMRRESIQPNDFTFPCAFKASGLLRLPVTGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VKA    +VFV     DMY K G  ++    F EMPERNL TWNA +      G 
Sbjct  130  LHALAVKAGQICDVFVGCSAFDMYCKTGLRDEARNVFDEMPERNLATWNAYMSNAVLDGR  189

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  F +  R   +  PN +TF   L ACS   ++E G  +      ++G       
Sbjct  190  PLNAVYKFIEFLRAGGE--PNSITFCAFLNACSDTSSLELGKQL-HGFVMRWGFGKDVSV  246

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
               ++D  G+   V  +      +  R  VS W +++ AC
Sbjct  247  LNGLIDFYGKCREVGCSMTVFYGIGQRNDVS-WCSMVAAC  285


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/259 (24%), Positives = 117/259 (45%), Gaps = 4/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +     A+  F++    G EP      + L+AC+  ++ ELG+ 
Sbjct  171  ERNLATWNAYMSNAVLDGRPLNAVYKFIEFLRAGGEPNSITFCAFLNACSDTSSLELGKQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V++    ++V V + L+D YGKC  +      FY + +RN ++W +++        
Sbjct  231  LHGFVMRWGFGKDVSVLNGLIDFYGKCREVGCSMTVFYGIGQRNDVSWCSMVAACVQNDE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A + F  +    + V P       VL+AC+    +E G  +  ++  K  +E     
Sbjct  291  EENACEFF--LRAMKEGVKPTDFMVSSVLSACAGVAWLEQGRSV-HSVAVKACVEGNVFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A      MP R  ++ W A++GA    G  ++       +    
Sbjct  348  GSALVDMYGKCGCIEDAKRAFDEMPSRNLIT-WNAMVGAYAHQGLADMALAFFKEMCSRS  406

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V L  + ++  R
Sbjct  407  HEFKPNYVTLVCVLSACSR  425


 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 74/171 (43%), Gaps = 5/171 (3%)
 Frame = +2

Query  173  LGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGY  349
            LGR+ HG +++        F+ + LV+MY K    +  +      P R+++TW +LI G 
Sbjct  24   LGRAAHGHMIRTLGASLPSFLSNHLVNMYSKLDLPDSAQLILRLSPSRSVVTWTSLIAGA  83

Query  350  AHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIE  529
               GH   A+  F +M R++  + PN  TF C   A        TG  +  A+  K G  
Sbjct  84   VQNGHFASAILHFSNMRRES--IQPNDFTFPCAFKASGLLRLPVTGKQL-HALAVKAGQI  140

Query  530  PGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKP  682
                      DM  + G+ + A      MP R  ++ W A +    + G+P
Sbjct  141  CDVFVGCSAFDMYCKTGLRDEARNVFDEMPER-NLATWNAYMSNAVLDGRP  190



>ref|XP_010096136.1| hypothetical protein L484_005415 [Morus notabilis]
 gb|EXB63452.1| hypothetical protein L484_005415 [Morus notabilis]
Length=678

 Score =   424 bits (1091),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 198/276 (72%), Positives = 235/276 (85%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++AVY QND  E A +VFLKAR+EG+ P +FM+S+ LSACAGL+ F+LGRS 
Sbjct  267  RNDVSWCSMMAVYVQNDEEENACEVFLKARKEGLVPNDFMISTFLSACAGLSDFDLGRSG  326

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VKACVE N+FV S LVDMYGKCG I D ER F EMP RN ITWNA+I GYAHQGHA
Sbjct  327  HTLAVKACVEGNIFVGSALVDMYGKCGSINDAEREFNEMPHRNSITWNAMINGYAHQGHA  386

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL L E MT    +V+PNYVT V +L+ACS+AGAVE GM+IFE+M+ +YG+EPG EHY
Sbjct  387  DMALALCEKMTSSNCEVLPNYVTLVSILSACSKAGAVEKGMEIFESMRARYGVEPGVEHY  446

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAG+VERAYEFIK+MPI PT SVWGALLGAC+++ K ELG+IAADNLF++DP
Sbjct  447  ACVVDLLGRAGLVERAYEFIKKMPILPTTSVWGALLGACKMYRKSELGEIAADNLFKLDP  506

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSNMFA++GRWEEA LVRKEMKD+GIKK
Sbjct  507  KDSGNHVVLSNMFAAAGRWEEATLVRKEMKDVGIKK  542


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/259 (24%), Positives = 118/259 (46%), Gaps = 4/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +      +K F++    G EP      S L+AC+ ++  ELGR 
Sbjct  165  ERNSTTWNAYISNAVLSGRPIYGIKKFIEFLRVGGEPDSITFCSFLNACSDMSDLELGRQ  224

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V++    + V V + L+D YGKC  +E  E  F  +  RN ++W +++  Y     
Sbjct  225  LHGFVIRCGYGKYVKVMNGLIDFYGKCQEVESSEMVFDRIHLRNDVSWCSMMAVYVQNDE  284

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A ++F  +  + + +VPN       L+AC+     + G      +  K  +E     
Sbjct  285  EENACEVF--LKARKEGLVPNDFMISTFLSACAGLSDFDLGRS-GHTLAVKACVEGNIFV  341

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +  A      MP R +++ W A++      G  ++     + +   +
Sbjct  342  GSALVDMYGKCGSINDAEREFNEMPHRNSIT-WNAMINGYAHQGHADMALALCEKMTSSN  400

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V L ++ ++  +
Sbjct  401  CEVLPNYVTLVSILSACSK  419


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 96/221 (43%), Gaps = 12/221 (5%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W SL+A    N     AL  F   R + I+P +F    +  A A L    +GR +
Sbjct  65   RSVVTWSSLIAGCVHNGHFASALHHFSGMRLDCIQPNDFTFPCIFKASASLGMSFVGRQV  124

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H +  K     +VFV     DMY K G  +D  + F EMPERN  TWNA I      G  
Sbjct  125  HAVAFKIGQIHDVFVGCGAFDMYCKTGLWDDACKVFDEMPERNSTTWNAYISNAVLSGRP  184

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               +  F +  R   +  P+ +TF   L ACS    +E G  +       + I  G   Y
Sbjct  185  IYGIKKFIEFLRVGGE--PDSITFCSFLNACSDMSDLELGRQL-----HGFVIRCGYGKY  237

Query  548  ACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              V    +D  G+   VE +     R+ +R  VS W +++ 
Sbjct  238  VKVMNGLIDFYGKCQEVESSEMVFDRIHLRNDVS-WCSMMA  277


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 75/174 (43%), Gaps = 5/174 (3%)
 Frame = +2

Query  173  LGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGY  349
            LGR +H  +++        F+ + LV MY K    +  +      P R+++TW++LI G 
Sbjct  18   LGRVVHAQIIRNLGSSLPAFLCNHLVHMYSKLDLPDSAQLVLSLTPSRSVVTWSSLIAGC  77

Query  350  AHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIE  529
             H GH   AL  F  M  +   + PN  TF C+  A +  G    G  +  A+  K G  
Sbjct  78   VHNGHFASALHHFSGM--RLDCIQPNDFTFPCIFKASASLGMSFVGRQV-HAVAFKIGQI  134

Query  530  PGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
                      DM  + G+ + A +    MP R + + W A +    + G+P  G
Sbjct  135  HDVFVGCGAFDMYCKTGLWDDACKVFDEMPERNS-TTWNAYISNAVLSGRPIYG  187



>ref|XP_002314694.1| hypothetical protein POPTR_0010s09690g [Populus trichocarpa]
 gb|EEF00865.1| hypothetical protein POPTR_0010s09690g [Populus trichocarpa]
Length=631

 Score =   421 bits (1081),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 193/276 (70%), Positives = 236/276 (86%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWC+++A  EQND  EKA  VFL  R+EGIE T++MVSSV+SA AG++  E GRS+
Sbjct  223  RNSVSWCTMVAACEQNDEKEKACVVFLMGRKEGIELTDYMVSSVISAYAGISGLEFGRSV  282

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VKACVE ++FV S LVDMYGKCG IEDCE+ F+EMPERNL++WNA+I GYAHQG  
Sbjct  283  HALAVKACVEGDIFVGSALVDMYGKCGSIEDCEQVFHEMPERNLVSWNAMISGYAHQGDV  342

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MA+ LFE+M     + V NYVT +CVL+ACSR GAV+ G +IFE+M+D+Y IEPGAEHY
Sbjct  343  DMAMTLFEEMQ---SEAVANYVTLICVLSACSRGGAVKLGNEIFESMRDRYRIEPGAEHY  399

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            AC+ DMLGRAGMVERAYEF+++MPIRPT+SVWGALL ACRV+G+PELGKIAADNLF++DP
Sbjct  400  ACIADMLGRAGMVERAYEFVQKMPIRPTISVWGALLNACRVYGEPELGKIAADNLFKLDP  459

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSNMFA++GRW+EA LVRKEMKD+GIKK
Sbjct  460  KDSGNHVLLSNMFAAAGRWDEATLVRKEMKDVGIKK  495


 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 99/223 (44%), Gaps = 4/223 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W +L++   QN     AL  F K R E I+P +F       A   L     G+ IH +
Sbjct  24   VTWTALISGSVQNGYFSSALLYFSKMRRENIKPNDFTFPCAFKASTALCLPFAGKQIHAI  83

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K     + FV     DMY K G   + +R F EMP RN+  WNA I      G    A
Sbjct  84   ALKLGQINDKFVGCSAFDMYSKTGLKFEAQRLFDEMPPRNVAVWNAYISNAVLDGRPGKA  143

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +D F +  R   +  P+ +TF   L AC+ A  ++ G  +   +  + G E        +
Sbjct  144  IDKFIEFRRVGGE--PDLITFCAFLNACADARCLDLGRQL-HGLVIRSGFEGDVSVANGI  200

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +D+ G+   VE A      M  R +VS W  ++ AC  + + E
Sbjct  201  IDVYGKCKEVELAEMVFNGMGRRNSVS-WCTMVAACEQNDEKE  242


 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 121/259 (47%), Gaps = 9/259 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN   W + ++    +    KA+  F++ R  G EP      + L+ACA     +LGR +
Sbjct  122  RNVAVWNAYISNAVLDGRPGKAIDKFIEFRRVGGEPDLITFCAFLNACADARCLDLGRQL  181

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGLV+++  E +V V + ++D+YGKC  +E  E  F  M  RN ++W  ++         
Sbjct  182  HGLVIRSGFEGDVSVANGIIDVYGKCKEVELAEMVFNGMGRRNSVSWCTMVAACEQNDEK  241

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A  +F  M RK    + +Y+    V++A +    +E G  +  A+  K  +E      
Sbjct  242  EKACVVFL-MGRKEGIELTDYMV-SSVISAYAGISGLEFGRSV-HALAVKACVEGDIFVG  298

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF-QID  724
            + +VDM G+ G +E   +    MP R  VS W A++      G  ++    A  LF ++ 
Sbjct  299  SALVDMYGKCGSIEDCEQVFHEMPERNLVS-WNAMISGYAHQGDVDM----AMTLFEEMQ  353

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V L  + ++  R
Sbjct  354  SEAVANYVTLICVLSACSR  372


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 60/145 (41%), Gaps = 6/145 (4%)
 Frame = +2

Query  251  MYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNY  430
            MY K       +      P R ++TW ALI G    G+ + AL  F  M R  +++ PN 
Sbjct  1    MYSKLDLPNPAQLLLQLTPTRCVVTWTALISGSVQNGYFSSALLYFSKMRR--ENIKPND  58

Query  431  VTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYAC-VVDMLGRAGMVERAYEFI  607
             TF C   A +       G  I  A+  K G +   +   C   DM  + G+   A    
Sbjct  59   FTFPCAFKASTALCLPFAGKQI-HAIALKLG-QINDKFVGCSAFDMYSKTGLKFEAQRLF  116

Query  608  KRMPIRPTVSVWGALLGACRVHGKP  682
              MP R  V+VW A +    + G+P
Sbjct  117  DEMPPR-NVAVWNAYISNAVLDGRP  140



>ref|XP_004168898.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g14850-like [Cucumis sativus]
Length=606

 Score =   416 bits (1070),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 189/277 (68%), Positives = 235/277 (85%), Gaps = 1/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW SL+A Y QN+  EKA  +FL+AR+E IEPT+FMVSSVL ACAGL+  E GRS
Sbjct  272  ERNSVSWSSLIAAYVQNNEEEKASCLFLRARKEDIEPTDFMVSSVLCACAGLSEIEFGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +  L VKACVE+N+FV S LVDMYGKCG I++ E+AF  MPERNL++WNAL+GGYAHQGH
Sbjct  332  VQALAVKACVEQNIFVASALVDMYGKCGSIDNAEQAFNAMPERNLVSWNALLGGYAHQGH  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            AN A+ L E+MT     +VP+YV+ +C L+ACSRAG ++TGM IFE+MK++YG+EPG EH
Sbjct  392  ANKAVALLEEMT-SAAGIVPSYVSLICALSACSRAGDLKTGMKIFESMKERYGVEPGPEH  450

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAGMVE AY+FIKRMP  PT+S+WGALLGACR+HGKPELGK+AA+ LF++D
Sbjct  451  YACLVDLLGRAGMVECAYDFIKRMPFPPTISIWGALLGACRMHGKPELGKLAAEKLFELD  510

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGNHV+LSNMFA++GRWEE  +VR EMK++GIKK
Sbjct  511  PKDSGNHVVLSNMFAATGRWEEVTVVRNEMKEVGIKK  547


 Score = 99.0 bits (245),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 105/218 (48%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN  +W + ++    +   E ++  F++    G +P        L+AC+       G  
Sbjct  171  HRNLETWNAYISNSVLHGRPEDSVIAFIELLRVGGKPDSITFCXFLNACSDKLGLGPGCQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG ++++   +NV V + L+D YGKCG +E  E  F  M ERN ++W++LI  Y     
Sbjct  231  LHGFIIRSGYGQNVSVSNGLIDFYGKCGEVECSEMVFDRMGERNSVSWSSLIAAYVQNNE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  LF  +  + +D+ P       VL AC+    +E G  + +A+  K  +E     
Sbjct  291  EEKASCLF--LRARKEDIEPTDFMVSSVLCACAGLSEIEFGRSV-QALAVKACVEQNIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
             + +VDM G+ G ++ A +    MP R  VS W ALLG
Sbjct  348  ASALVDMYGKCGSIDNAEQAFNAMPERNLVS-WNALLG  384


 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 101/233 (43%), Gaps = 34/233 (15%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   QN     AL  F     + + P +F    VL A  GL     G+ +
Sbjct  71   RSVVTWTALIAGSVQNGCFVSALLHFSDMLSDCVRPNDFTFPCVLKASTGLRMDTTGKQL  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK  +  +VFV   + DMY K G + D  + F EMP RNL TWNA I      G  
Sbjct  131  HALAVKEGLINDVFVGCSVFDMYSKLGFLNDAYKVFDEMPHRNLETWNAYISNSVLHGRP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              ++  F ++ R      P+ +TF   L ACS                DK G+ PG + +
Sbjct  191  EDSVIAFIELLRVGGK--PDSITFCXFLNACS----------------DKLGLGPGCQLH  232

Query  548  ACV---------------VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              +               +D  G+ G VE +     RM  R +VS W +L+ A
Sbjct  233  GFIIRSGYGQNVSVSNGLIDFYGKCGEVECSEMVFDRMGERNSVS-WSSLIAA  284


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 88/199 (44%), Gaps = 5/199 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            ++SV+     + +  LGR+ H  ++K        F+ + LV+MY K   +   +      
Sbjct  9    LASVVELAVSVRSSLLGRAAHAQILKTLKTPFPAFLYNHLVNMYAKLDHLNSAKLILELA  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P R+++TW ALI G    G    AL  F DM      V PN  TF CVL A +      T
Sbjct  69   PCRSVVTWTALIAGSVQNGCFVSALLHFSDMLSDC--VRPNDFTFPCVLKASTGLRMDTT  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
            G  +  A+  K G+         V DM  + G +  AY+    MP R  +  W A +   
Sbjct  127  GKQL-HALAVKEGLINDVFVGCSVFDMYSKLGFLNDAYKVFDEMPHR-NLETWNAYISNS  184

Query  665  RVHGKPELGKIAADNLFQI  721
             +HG+PE   IA   L ++
Sbjct  185  VLHGRPEDSVIAFIELLRV  203



>ref|XP_004134445.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Cucumis sativus]
 gb|KGN56980.1| hypothetical protein Csa_3G146650 [Cucumis sativus]
Length=606

 Score =   416 bits (1069),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/277 (68%), Positives = 235/277 (85%), Gaps = 1/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW SL+A Y QN+  EKA  +FL+AR+E IEPT+FMVSSVL ACAGL+  E GRS
Sbjct  272  ERNSVSWSSLIAAYVQNNEEEKASCLFLRARKEDIEPTDFMVSSVLCACAGLSEIEFGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +  L VKACVE+N+FV S LVDMYGKCG I++ E+AF  MPERNL++WNAL+GGYAHQGH
Sbjct  332  VQALAVKACVEQNIFVASALVDMYGKCGSIDNAEQAFNAMPERNLVSWNALLGGYAHQGH  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            AN A+ L E+MT     +VP+YV+ +C L+ACSRAG ++TGM IFE+MK++YG+EPG EH
Sbjct  392  ANKAVALLEEMT-SAAGIVPSYVSLICALSACSRAGDLKTGMKIFESMKERYGVEPGPEH  450

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAGMVE AY+FIKRMP  PT+S+WGALLGACR+HGKPELGK+AA+ LF++D
Sbjct  451  YACLVDLLGRAGMVECAYDFIKRMPFPPTISIWGALLGACRMHGKPELGKLAAEKLFELD  510

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGNHV+LSNMFA++GRWEE  +VR EMK++GIKK
Sbjct  511  PKDSGNHVVLSNMFAATGRWEEVTVVRNEMKEVGIKK  547


 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 106/218 (49%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN  +W + ++    +   E ++  F++    G +P      + L+AC+       G  
Sbjct  171  HRNLETWNAYISNSVLHGRPEDSVIAFIELLRVGGKPDSITFCAFLNACSDKLGLGPGCQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG ++++   +NV V + L+D YGKCG +E  E  F  M ERN ++W++LI  Y     
Sbjct  231  LHGFIIRSGYGQNVSVSNGLIDFYGKCGEVECSEMVFDRMGERNSVSWSSLIAAYVQNNE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  LF  +  + +D+ P       VL AC+    +E G  + +A+  K  +E     
Sbjct  291  EEKASCLF--LRARKEDIEPTDFMVSSVLCACAGLSEIEFGRSV-QALAVKACVEQNIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
             + +VDM G+ G ++ A +    MP R  VS W ALLG
Sbjct  348  ASALVDMYGKCGSIDNAEQAFNAMPERNLVS-WNALLG  384


 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 101/233 (43%), Gaps = 34/233 (15%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   QN     AL  F     + + P +F    VL A  GL     G+ +
Sbjct  71   RSVVTWTALIAGSVQNGCFVSALLHFSDMLSDCVRPNDFTFPCVLKASTGLRMDTTGKQL  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK  +  +VFV   + DMY K G + D  + F EMP RNL TWNA I      G  
Sbjct  131  HALAVKEGLINDVFVGCSVFDMYSKLGFLNDAYKVFDEMPHRNLETWNAYISNSVLHGRP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              ++  F ++ R      P+ +TF   L ACS                DK G+ PG + +
Sbjct  191  EDSVIAFIELLRVGGK--PDSITFCAFLNACS----------------DKLGLGPGCQLH  232

Query  548  ACV---------------VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              +               +D  G+ G VE +     RM  R +VS W +L+ A
Sbjct  233  GFIIRSGYGQNVSVSNGLIDFYGKCGEVECSEMVFDRMGERNSVS-WSSLIAA  284


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 88/199 (44%), Gaps = 5/199 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            ++SV+     + +  LGR+ H  ++K        F+ + LV+MY K   +   +      
Sbjct  9    LASVVELAVSVRSSLLGRAAHAQILKTLKTPFPAFLYNHLVNMYAKLDHLNSAKLILELA  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P R+++TW ALI G    G    AL  F DM      V PN  TF CVL A +      T
Sbjct  69   PCRSVVTWTALIAGSVQNGCFVSALLHFSDMLSDC--VRPNDFTFPCVLKASTGLRMDTT  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
            G  +  A+  K G+         V DM  + G +  AY+    MP R  +  W A +   
Sbjct  127  GKQL-HALAVKEGLINDVFVGCSVFDMYSKLGFLNDAYKVFDEMPHR-NLETWNAYISNS  184

Query  665  RVHGKPELGKIAADNLFQI  721
             +HG+PE   IA   L ++
Sbjct  185  VLHGRPEDSVIAFIELLRV  203



>ref|XP_008438671.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Cucumis melo]
Length=606

 Score =   416 bits (1068),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/277 (68%), Positives = 235/277 (85%), Gaps = 1/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW SL+A Y QN+  EKA  +FL+AR+E IEPT+FMVSSVL ACAGL+  E GRS
Sbjct  272  ERNSVSWSSLIAAYVQNNEEEKASCLFLRARKEDIEPTDFMVSSVLCACAGLSEIEFGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +  L VKACVE+N+FV S LVDMYGKCG I++  +AF  MPERNL++WNAL+GGYAHQGH
Sbjct  332  VQALAVKACVEQNIFVASALVDMYGKCGSIDNAVQAFNAMPERNLVSWNALLGGYAHQGH  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            AN A+ L E+MT     +VP+YV+ +C L+ACSRAG ++TGM IFE+MK++YG+EPG EH
Sbjct  392  ANKAVALLEEMT-SAAGIVPSYVSLICALSACSRAGDLKTGMKIFESMKERYGVEPGPEH  450

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAGMVE AY+FIKRMP  PT+S+WGALLGACR+HGKPELGK+AA+ LF++D
Sbjct  451  YACLVDLLGRAGMVECAYDFIKRMPFPPTISIWGALLGACRMHGKPELGKLAAEKLFELD  510

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGNHV+LSNMFA++GRWEEA +VR EMK++GIKK
Sbjct  511  PKDSGNHVVLSNMFAATGRWEEATVVRNEMKEVGIKK  547


 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 105/218 (48%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN  +W + +     +   E +   F++    G +P      + L+AC+       G  
Sbjct  171  QRNLETWNAYITNSVLHGRPEDSAIAFIELLRVGEKPDSITFCAFLNACSDKLGLGPGCQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V+++   +NV V + L+D YGKCG +E  E  F  M ERN ++W++LI  Y     
Sbjct  231  LHGFVIRSGYGQNVSVSNGLIDFYGKCGEVECSEMVFDRMGERNSVSWSSLIAAYVQNNE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  LF  +  + +D+ P       VL AC+    +E G  + +A+  K  +E     
Sbjct  291  EEKASCLF--LRARKEDIEPTDFMVSSVLCACAGLSEIEFGRSV-QALAVKACVEQNIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
             + +VDM G+ G ++ A +    MP R  VS W ALLG
Sbjct  348  ASALVDMYGKCGSIDNAVQAFNAMPERNLVS-WNALLG  384


 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 102/233 (44%), Gaps = 34/233 (15%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+A   QN     AL  F     + + P +F    VL A  GL     G+ +
Sbjct  71   RSVVTWTALIAGSVQNGCFVSALLHFSDMLSDCVRPNDFTFPCVLKASTGLRMDMTGKQL  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK  +  +VFV   + DMY K G + D  + F EMP+RNL TWNA I      G  
Sbjct  131  HALAVKEGLINDVFVGCSVFDMYSKLGFLNDAYKLFDEMPQRNLETWNAYITNSVLHGRP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              +   F ++ R  +   P+ +TF   L ACS                DK G+ PG + +
Sbjct  191  EDSAIAFIELLRVGEK--PDSITFCAFLNACS----------------DKLGLGPGCQLH  232

Query  548  ACV---------------VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              V               +D  G+ G VE +     RM  R +VS W +L+ A
Sbjct  233  GFVIRSGYGQNVSVSNGLIDFYGKCGEVECSEMVFDRMGERNSVS-WSSLIAA  284


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 88/199 (44%), Gaps = 5/199 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            ++SV+     + +  LGR+ H  ++K        F+ + LV+MY K   +   +      
Sbjct  9    LASVVELAVSVRSSLLGRAAHAQILKTLKTPFPAFLYNHLVNMYAKLDHLNSAKLILELA  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P R+++TW ALI G    G    AL  F DM      V PN  TF CVL A +      T
Sbjct  69   PCRSVVTWTALIAGSVQNGCFVSALLHFSDMLSDC--VRPNDFTFPCVLKASTGLRMDMT  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
            G  +  A+  K G+         V DM  + G +  AY+    MP R  +  W A +   
Sbjct  127  GKQL-HALAVKEGLINDVFVGCSVFDMYSKLGFLNDAYKLFDEMPQR-NLETWNAYITNS  184

Query  665  RVHGKPELGKIAADNLFQI  721
             +HG+PE   IA   L ++
Sbjct  185  VLHGRPEDSAIAFIELLRV  203



>ref|XP_007143263.1| hypothetical protein PHAVU_007G057700g [Phaseolus vulgaris]
 gb|ESW15257.1| hypothetical protein PHAVU_007G057700g [Phaseolus vulgaris]
Length=685

 Score =   416 bits (1070),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 192/276 (70%), Positives = 232/276 (84%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS+LA   QN   E+A  VFLKAR+E +EPT+FM+SSVLSACA L   ELGRS+
Sbjct  275  RNVVSWCSMLAALVQNHEEERACTVFLKARKE-VEPTDFMISSVLSACAELGGLELGRSV  333

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VKACVEEN++V S LVD+YGKCG IE  E+ F EMPE+NL+TWNA+IGGYAH G  
Sbjct  334  HALAVKACVEENIYVGSALVDLYGKCGSIEKAEQVFREMPEKNLVTWNAMIGGYAHLGDV  393

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE+MT  +  + PNYVT V VL+ACSRAGAVE G+ IFE+M+ +YGIEPGAEHY
Sbjct  394  DMALSLFEEMTLSSFGITPNYVTLVSVLSACSRAGAVERGLHIFESMRGRYGIEPGAEHY  453

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            AC+VD+LGR+G+V+RAYEFIKRMPI PT+SVWGALLG+C++HGK +LGKIAA+ LFQ+DP
Sbjct  454  ACIVDLLGRSGLVDRAYEFIKRMPILPTISVWGALLGSCKMHGKTKLGKIAAEKLFQLDP  513

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSGNHV+ SNM AS+GRWEEA +VRKEM+D+GIKK
Sbjct  514  DDSGNHVVFSNMLASAGRWEEATIVRKEMRDVGIKK  549


 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/241 (29%), Positives = 117/241 (49%), Gaps = 13/241 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN  +W + ++   Q+     A+  F K   EG EP        L+ACA + + ELG  
Sbjct  171  HRNLATWNAYISNAVQDGRCLDAVAAFKKFLCEGGEPNAITFCVFLNACADMVSLELGIQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEM--PERNLITWNALIGGYAHQ  358
            +HG +V++   E+V V + L+D YGKCG I   E  F  +    RN+++W +++      
Sbjct  231  VHGFIVRSRYREDVSVSNGLIDFYGKCGDIVSSEMVFSTIGGGRRNVVSWCSMLAALVQN  290

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
                 A  +F    +  ++V P       VL+AC+  G +E G  +  A+  K  +E   
Sbjct  291  HEEERACTVF---LKARKEVEPTDFMISSVLSACAELGGLELGRSV-HALAVKACVEENI  346

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKI-AADNLF  715
               + +VD+ G+ G +E+A +  + MP +  V+ W A++G     G   LG +  A +LF
Sbjct  347  YVGSALVDLYGKCGSIEKAEQVFREMPEKNLVT-WNAMIG-----GYAHLGDVDMALSLF  400

Query  716  Q  718
            +
Sbjct  401  E  401


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 72/165 (44%), Gaps = 2/165 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + R  V+W SL++    N     A   F   R E + P +F    V  A   L     G+
Sbjct  69   NPRTVVTWTSLISGCVHNRRFTSAFLHFSNMRRESVLPNDFTFPCVFKASGSLHMPFTGK  128

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H L +K     +VFV     DMY K G   +    F EMP RNL TWNA I      G
Sbjct  129  QLHALALKGGNILDVFVGCSAFDMYSKTGLRVEARNMFEEMPHRNLATWNAYISNAVQDG  188

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
                A+  F+    +  +  PN +TF   L AC+   ++E G+ +
Sbjct  189  RCLDAVAAFKKFLCEGGE--PNAITFCVFLNACADMVSLELGIQV  231


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 79/182 (43%), Gaps = 5/182 (3%)
 Frame = +2

Query  113  PTEFMVSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCER  289
            P+  ++ S+L +     +  LGR++H L+++      + F+ + LV+MY K   +   E 
Sbjct  4    PSPNLLGSLLESAVSTHSSLLGRAVHALILRTHDTPLSSFLCNHLVNMYSKLDRLNSAEL  63

Query  290  AFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRA  469
                   R ++TW +LI G  H      A   F +M R++  V+PN  TF CV  A    
Sbjct  64   LLSLTNPRTVVTWTSLISGCVHNRRFTSAFLHFSNMRRES--VLPNDFTFPCVFKASGSL  121

Query  470  GAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGA  649
                TG  +  A+  K G            DM  + G+   A    + MP R  ++ W A
Sbjct  122  HMPFTGKQL-HALALKGGNILDVFVGCSAFDMYSKTGLRVEARNMFEEMPHR-NLATWNA  179

Query  650  LL  655
             +
Sbjct  180  YI  181



>ref|XP_002870277.1| hypothetical protein ARALYDRAFT_493409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46536.1| hypothetical protein ARALYDRAFT_493409 [Arabidopsis lyrata subsp. 
lyrata]
Length=684

 Score =   414 bits (1064),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 232/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSL+A Y QN   EKA  ++L++R+E +E ++FM+SSVLSACAG+A  ELGRSI
Sbjct  273  KNAVSWCSLVAAYVQNHEDEKASVLYLRSRKEIVETSDFMISSVLSACAGMAGLELGRSI  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE N+FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  333  HAHAVKACVERNIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTLNSLIGGYAHQGQV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFEDM  +     PNY+TFV +L+ACSRAGAVE GM IF++MK  YGIEPGAEHY
Sbjct  393  DMALALFEDMAPRGCGPAPNYMTFVSLLSACSRAGAVENGMKIFDSMKSTYGIEPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +C+VDMLGRAGMVE+A+EFIK+MPI+PT+SVWGAL  ACR+HGKP LG +AA+NLF++DP
Sbjct  453  SCIVDMLGRAGMVEQAFEFIKKMPIKPTISVWGALQNACRMHGKPHLGILAAENLFKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+EMK +GIKK
Sbjct  513  KDSGNHVLLSNTFAAAGRWAEANTVREEMKGVGIKK  548


 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 100/218 (46%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++   QN     AL  F + R EG+ P +F    V  A A L     G+ I
Sbjct  71   RNVVSWTSLVSGLAQNGHFSTALFEFFEMRREGVAPNDFTFPCVFKAVASLRLPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK     +VFV     DMY K    +D  + F E+PERNL TWNA I      G  
Sbjct  131  HALAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPERNLETWNAYISNSVTDGRP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R      PN +TF   L ACS    ++ GM +   +  + G +     Y
Sbjct  191  KEAIEAFIEFRRIGGQ--PNSITFCGFLNACSDGLLLDLGMQM-HGLVFRSGFDTDVSVY  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   +  +      M ++  VS W +L+ A
Sbjct  248  NGLIDFYGKCKQIRSSEIIFAEMGMKNAVS-WCSLVAA  284


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 112/229 (49%), Gaps = 4/229 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +   ++A++ F++ R  G +P        L+AC+     +LG  
Sbjct  171  ERNLETWNAYISNSVTDGRPKEAIEAFIEFRRIGGQPNSITFCGFLNACSDGLLLDLGMQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV ++  + +V V + L+D YGKC  I   E  F EM  +N ++W +L+  Y  Q H
Sbjct  231  MHGLVFRSGFDTDVSVYNGLIDFYGKCKQIRSSEIIFAEMGMKNAVSWCSLVAAYV-QNH  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +    +    +RK + V  +      VL+AC+    +E G  I  A   K  +E     
Sbjct  290  EDEKASVLYLRSRK-EIVETSDFMISSVLSACAGMAGLELGRSI-HAHAVKACVERNIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
             + +VDM G+ G +E + +    MP +  V++  +L+G     G+ ++ 
Sbjct  348  GSALVDMYGKCGCIEDSEQAFDEMPEKNLVTL-NSLIGGYAHQGQVDMA  395


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 5/184 (3%)
 Frame = +2

Query  137  VLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER  313
            +L      ++  LGR +H  +VK        F+ + L++MY K    E         P R
Sbjct  12   LLKNAISTSSMRLGRVVHARIVKTLDSPPPPFLANYLINMYSKLDHPESARLVLRLTPAR  71

Query  314  NLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMD  493
            N+++W +L+ G A  GH + AL  F +M R  + V PN  TF CV  A +      TG  
Sbjct  72   NVVSWTSLVSGLAQNGHFSTALFEFFEMRR--EGVAPNDFTFPCVFKAVASLRLPVTGKQ  129

Query  494  IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            I  A+  K G            DM  +  + + A +    +P R  +  W A +      
Sbjct  130  I-HALAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPER-NLETWNAYISNSVTD  187

Query  674  GKPE  685
            G+P+
Sbjct  188  GRPK  191



>gb|KCW60726.1| hypothetical protein EUGRSUZ_H03456 [Eucalyptus grandis]
Length=588

 Score =   409 bits (1050),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 186/277 (67%), Positives = 230/277 (83%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSWCSL++   QN   EKA   FL AR+EGI+PT+F+VSSVL+ACAGLA  ELGRS
Sbjct  176  EPNDVSWCSLMSTLVQNHEQEKACVAFLMARKEGIQPTDFLVSSVLNACAGLAGLELGRS  235

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +KACV  N+FV + LVDMYGKCGCIED E AF+ M +RNLITWN+LIGGYAHQG 
Sbjct  236  VHSLAIKACVMGNIFVGTALVDMYGKCGCIEDAEGAFHGMRQRNLITWNSLIGGYAHQGL  295

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MA+ +FE M     +++PNYVTFVC+LTACSRAG VE GMDIF +M+ ++ IEPG EH
Sbjct  296  ADMAVAVFEKMLSSCSEMIPNYVTFVCLLTACSRAGNVELGMDIFASMRRRHAIEPGPEH  355

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAGM+++AY+FI +MP RPT+S+WGALLGACR+H  PELG+IAA+NLFQ+D
Sbjct  356  YACIVDLLGRAGMLKQAYDFIMKMPFRPTISIWGALLGACRIHRNPELGRIAAENLFQLD  415

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGN V+LSN  A++GRWEEA  VRKE+KDIG+KK
Sbjct  416  PKDSGNFVVLSNSLAAAGRWEEATNVRKEIKDIGLKK  452


 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 68/263 (26%), Positives = 109/263 (41%), Gaps = 9/263 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW SL++   QN     +L +F+   +E I P +F       A  GL     G+ I
Sbjct  71   RSVVSWTSLISGSAQNGHFSFSLLMFVDMLKECIRPNDFTFPCAFKASGGLCMPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDC-----ERAFYEMPERNLITWNALIGGYA  352
            HG+ +K     +VFV S   DMY K G  +D      E  F E+ E N ++W +L+    
Sbjct  131  HGIAIKVGEIVDVFVGSSAFDMYCKTGLKDDARKLCSEMVFDEIREPNDVSWCSLMSTLV  190

Query  353  HQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEP  532
                   A   F  M RK + + P       VL AC+    +E G  +  ++  K  +  
Sbjct  191  QNHEQEKACVAFL-MARK-EGIQPTDFLVSSVLNACAGLAGLELGRSV-HSLAIKACVMG  247

Query  533  GAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNL  712
                   +VDM G+ G +E A      M  R  ++ W +L+G     G  ++     + +
Sbjct  248  NIFVGTALVDMYGKCGCIEDAEGAFHGMRQRNLIT-WNSLIGGYAHQGLADMAVAVFEKM  306

Query  713  FQIDPQDSGNHVILSNMFASSGR  781
                 +   N+V    +  +  R
Sbjct  307  LSSCSEMIPNYVTFVCLLTACSR  329


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 51/111 (46%), Gaps = 3/111 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            ++S+LSA     +  LGR+ H  +VK         V   L  MY K              
Sbjct  9    LASLLSAAVSARSSLLGRATHARIVKTLRHPLPALVSDHLTHMYSKLDLPGSAHLVLRLN  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTA  457
            P R++++W +LI G A  GH + +L +F DM ++   + PN  TF C   A
Sbjct  69   PTRSVVSWTSLISGSAQNGHFSFSLLMFVDMLKEC--IRPNDFTFPCAFKA  117



>ref|XP_004496720.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Cicer arietinum]
Length=684

 Score =   411 bits (1056),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 233/277 (84%), Gaps = 1/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSWCS+LA   QN   E+A  VFL+AR+E +EPT+FM+SS+LSACA L   ELGRS
Sbjct  273  KRNVVSWCSMLAALVQNHEEERACMVFLEARKE-VEPTDFMISSMLSACAELGGLELGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VKACVE+N+FV S LVD+YGKCG IE+ E+ F EMPERNL+TWNALIGGYAHQG 
Sbjct  332  VHALAVKACVEDNIFVGSALVDLYGKCGSIENAEQVFTEMPERNLVTWNALIGGYAHQGD  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
              MAL LFE+MT  ++ + P+YVT V VL+ACSRAGAVE GM IFE+M+  YGIEPGAEH
Sbjct  392  VGMALRLFEEMTLGSRGMTPSYVTLVSVLSACSRAGAVERGMQIFESMRLNYGIEPGAEH  451

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGR+G+V+RAYEFI+ MP+ PT+SVWGALLGACR+HGK +LGKIAA+ LF++D
Sbjct  452  YACIVDLLGRSGLVDRAYEFIQNMPMEPTISVWGALLGACRMHGKTKLGKIAAEKLFELD  511

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
              DSGNHV+LSNM AS+GRWEEA ++RKEMKDIGIKK
Sbjct  512  HVDSGNHVVLSNMLASAGRWEEATIIRKEMKDIGIKK  548


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 86/215 (40%), Gaps = 3/215 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W SL++    N     A   F   R + + P +F    V  A A L     G+ +H L
Sbjct  74   VTWTSLISGCVHNRRFVTAFLHFTNMRRDSVHPNDFTFPGVFKASASLHMPMTGKQVHAL  133

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K     +VFV     DMY K G   +    F EMP RN  TWNA I      G +  A
Sbjct  134  ALKGGQIYDVFVGCSAFDMYCKTGLRVEARNMFDEMPHRNSATWNAYISNAVQDGRSLDA  193

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +  F++         PN +TF   L AC        G  +  A   + G +        +
Sbjct  194  IAAFKEFLCVHGH--PNSITFCAFLNACVDTLRSNLGRQL-HAFIVRCGYKEDVSVANGL  250

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
            +D  G+ G +  +     R+  +  V  W ++L A
Sbjct  251  IDFYGKCGDIVSSELVFSRIGRKRNVVSWCSMLAA  285



>gb|AAQ65087.1| At4g14850 [Arabidopsis thaliana]
Length=634

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/276 (68%), Positives = 232/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSL+A Y QN   EKA  ++L++R++ +E ++FM+SSVLSACAG+A  ELGRSI
Sbjct  223  KNAVSWCSLVAAYVQNHEDEKASVLYLRSRKDIVETSDFMISSVLSACAGMAGLELGRSI  282

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  283  HAHAVKACVERTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTRNSLIGGYAHQGQV  342

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE+M  +     PNY+TFV +L+ACSRAGAVE GM IF++M+  YGIEPGAEHY
Sbjct  343  DMALALFEEMAPRGCGPTPNYMTFVSLLSACSRAGAVENGMKIFDSMRSTYGIEPGAEHY  402

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +C+VDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+HGKP+LG +AA+NLF++DP
Sbjct  403  SCIVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHGKPQLGLLAAENLFKLDP  462

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+E+K +GIKK
Sbjct  463  KDSGNHVLLSNTFAAAGRWAEANTVREELKGVGIKK  498


 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 97/218 (44%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++   QN     AL  F + R EG+ P +F       A A L     G+ I
Sbjct  21   RNVVSWTSLISGLAQNGHFSTALVEFFEMRREGVVPNDFTFPCAFKAVASLRLPVTGKQI  80

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK     +VFV     DMY K    +D  + F E+PERNL TWNA I      G  
Sbjct  81   HALAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPERNLETWNAFISNSVTDGRP  140

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R   D  PN +TF   L ACS    +  GM +   +  + G +      
Sbjct  141  REAIEAFIEFRR--IDGHPNSITFCAFLNACSDWLHLNLGMQL-HGLVLRSGFDTDVSVC  197

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   +  +      M  +  VS W +L+ A
Sbjct  198  NGLIDFYGKCKQIRSSEIIFTEMGTKNAVS-WCSLVAA  234


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 108/230 (47%), Gaps = 6/230 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +    +A++ F++ R     P      + L+AC+      LG  
Sbjct  121  ERNLETWNAFISNSVTDGRPREAIEAFIEFRRIDGHPNSITFCAFLNACSDWLHLNLGMQ  180

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV+++  + +V V + L+D YGKC  I   E  F EM  +N ++W +L+  Y     
Sbjct  181  LHGLVLRSGFDTDVSVCNGLIDFYGKCKQIRSSEIIFTEMGTKNAVSWCSLVAAYVQNHE  240

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFV-CVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
               A  L+    R  +D+V      +  VL+AC+    +E G  I  A   K  +E    
Sbjct  241  DEKASVLY---LRSRKDIVETSDFMISSVLSACAGMAGLELGRSI-HAHAVKACVERTIF  296

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
              + +VDM G+ G +E + +    MP +  V+   +L+G     G+ ++ 
Sbjct  297  VGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTR-NSLIGGYAHQGQVDMA  345


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 69/183 (38%), Gaps = 6/183 (3%)
 Frame = +2

Query  251  MYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNY  430
            MY K    E         P RN+++W +LI G A  GH + AL  F +M R  + VVPN 
Sbjct  1    MYSKLDHPESARLVLRLTPARNVVSWTSLISGLAQNGHFSTALVEFFEMRR--EGVVPND  58

Query  431  VTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIK  610
             TF C   A +      TG  I  A+  K G            DM  +  + + A +   
Sbjct  59   FTFPCAFKAVASLRLPVTGKQI-HALAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFD  117

Query  611  RMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNHVILSNMFASSGRWEE  790
             +P R  +  W A +      G+P     A     +ID     N +       +   W  
Sbjct  118  EIPER-NLETWNAFISNSVTDGRPREAIEAFIEFRRIDGHP--NSITFCAFLNACSDWLH  174

Query  791  ANL  799
             NL
Sbjct  175  LNL  177



>emb|CDY08295.1| BnaA05g13240D [Brassica napus]
Length=660

 Score =   409 bits (1052),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/276 (68%), Positives = 228/276 (83%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCSL+A Y QN   EKA  +FL++R+E +E ++FM+SS LSACAG+A  ELGRS+
Sbjct  249  RNAVSWCSLVAAYVQNHEDEKASLLFLRSRKEIVETSDFMISSTLSACAGMAGLELGRSV  308

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  309  HAHAVKACVERTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTMNSLIGGYAHQGQV  368

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LF+ M  +     PNY+TFV VL+ACSRAG VE GM+IF++MK  YGIEPGAEHY
Sbjct  369  DMALALFDQMAPRGSGPAPNYMTFVSVLSACSRAGDVENGMEIFDSMKSSYGIEPGAEHY  428

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +CVVDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+H KP LG +AA+NLF++DP
Sbjct  429  SCVVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHSKPHLGVLAAENLFKLDP  488

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+EMK +GI+K
Sbjct  489  KDSGNHVLLSNTFAAAGRWAEANTVREEMKGVGIRK  524


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 65/241 (27%), Positives = 114/241 (47%), Gaps = 10/241 (4%)
 Frame = +2

Query  68   KALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLV  247
            +A+  F++ R+ G  P      + L+AC+      LG  +HGLV  +  + +V V + L+
Sbjct  168  EAVGAFIEFRKIGGHPNSITFCAFLNACSDGLLLSLGEQLHGLVFCSGFDTDVSVCNGLI  227

Query  248  DMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPN  427
            D YGKC  I   E  F EM  RN ++W +L+  Y  Q H +    L    +RK + V  +
Sbjct  228  DFYGKCKKIHCSETVFAEMGTRNAVSWCSLVAAYV-QNHEDEKASLLFLRSRK-EIVETS  285

Query  428  YVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFI  607
                   L+AC+    +E G  +  A   K  +E      + +VDM G+ G +E + +  
Sbjct  286  DFMISSTLSACAGMAGLELGRSV-HAHAVKACVERTIFVGSALVDMYGKCGCIEDSEQAF  344

Query  608  KRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSG---NHVILSNMFASSG  778
              MP +  V++  +L+G     G+ ++     D   Q+ P+ SG   N++   ++ ++  
Sbjct  345  DEMPEKNLVTM-NSLIGGYAHQGQVDMALALFD---QMAPRGSGPAPNYMTFVSVLSACS  400

Query  779  R  781
            R
Sbjct  401  R  401


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 57/124 (46%), Gaps = 3/124 (2%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            + S+L+     ++  LGR +H  +VK        F+ + L++MY K    +         
Sbjct  9    LGSLLANAISTSSMRLGRVVHARIVKTLDSPPPPFLANYLINMYSKLDHPDSARLLLRLT  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P RN+++W +L+ G    GH + AL  F +M R  + V PN  TF C   A +      T
Sbjct  69   PSRNVVSWTSLVSGLVQNGHFSSALLEFLEMRR--EGVFPNDFTFPCAFKAAASLRWPVT  126

Query  485  GMDI  496
            G  I
Sbjct  127  GKQI  130


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 81/219 (37%), Gaps = 28/219 (13%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN VSW SL++   QN     AL  FL+ R EG+ P +F       A A L     G+ 
Sbjct  70   SRNVVSWTSLVSGLVQNGHFSSALLEFLEMRREGVFPNDFTFPCAFKAAASLRWPVTGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L VK     +VFV     DMY K     D  +    MP   +    A I      GH
Sbjct  130  IHALSVKCGRILDVFVGCSAFDMYCKTKLRGDARK----MPMEAV---GAFIEFRKIGGH  182

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                               PN +TF   L ACS    +  G +    +    G +     
Sbjct  183  -------------------PNSITFCAFLNACSDGLLLSLG-EQLHGLVFCSGFDTDVSV  222

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
               ++D  G+   +  +      M  R  VS W +L+ A
Sbjct  223  CNGLIDFYGKCKKIHCSETVFAEMGTRNAVS-WCSLVAA  260



>ref|XP_009144705.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Brassica rapa]
Length=684

 Score =   410 bits (1053),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/276 (68%), Positives = 228/276 (83%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCSL+A Y QN   EKA  +FL++R+E +E ++FM+SS LSACAG+A  ELGRS+
Sbjct  273  RNAVSWCSLVAAYVQNHEDEKASLLFLRSRKEIVETSDFMISSTLSACAGMAGLELGRSV  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  333  HAHAVKACVERTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTMNSLIGGYAHQGQV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LF+ M  +     PNY+TFV VL+ACSRAG VE GM+IF++MK  YGIEPGAEHY
Sbjct  393  DMALALFDQMAPRGSGPAPNYMTFVSVLSACSRAGDVENGMEIFDSMKSSYGIEPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +CVVDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+H KP LG +AA+NLF++DP
Sbjct  453  SCVVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHSKPHLGVLAAENLFKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+EMK +GI+K
Sbjct  513  KDSGNHVLLSNTFAAAGRWAEANTVREEMKGVGIRK  548


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 95/219 (43%), Gaps = 4/219 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN VSW SL++   QN     AL  FL+ R EG+ P +F       A A L     G+ 
Sbjct  70   SRNVVSWTSLVSGLVQNGHFSSALLEFLEMRREGVFPNDFTFPCAFKAAASLRWPVTGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L VK     +VFV     DMY K     D  + F E+P+RNL TWNA +      G 
Sbjct  130  IHALSVKCGRILDVFVGCSAFDMYCKTKLRGDARKMFDEIPQRNLATWNAFLSNSVTDGR  189

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  F +  +      PN +TF   L ACS    +  G +    +    G++  A  
Sbjct  190  PREAVGAFIEFRKIGGH--PNSITFCAFLNACSDGLLLSLG-EQLHGLVFCSGVDTDASV  246

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
               ++D  G+   +  +      M  R  VS W +L+ A
Sbjct  247  CNGLIDFYGKCKKIHCSETVFAEMGTRNAVS-WCSLVAA  284


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 123/262 (47%), Gaps = 10/262 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN  +W + L+    +    +A+  F++ R+ G  P      + L+AC+      LG  
Sbjct  171  QRNLATWNAFLSNSVTDGRPREAVGAFIEFRKIGGHPNSITFCAFLNACSDGLLLSLGEQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV  + V+ +  V + L+D YGKC  I   E  F EM  RN ++W +L+  Y  Q H
Sbjct  231  LHGLVFCSGVDTDASVCNGLIDFYGKCKKIHCSETVFAEMGTRNAVSWCSLVAAYV-QNH  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +    L    +RK + V  +       L+AC+    +E G  +  A   K  +E     
Sbjct  290  EDEKASLLFLRSRK-EIVETSDFMISSTLSACAGMAGLELGRSV-HAHAVKACVERTIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E + +    MP +  V++  +L+G     G+ ++     D   Q+ 
Sbjct  348  GSALVDMYGKCGCIEDSEQAFDEMPEKNLVTM-NSLIGGYAHQGQVDMALALFD---QMA  403

Query  725  PQDSG---NHVILSNMFASSGR  781
            P+ SG   N++   ++ ++  R
Sbjct  404  PRGSGPAPNYMTFVSVLSACSR  425


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 78/187 (42%), Gaps = 5/187 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            + S+L+     ++  LGR +H  +VK        F+ + L++MY K    +         
Sbjct  9    LGSLLANAISTSSMRLGRVVHARIVKTLDSPPPPFLANYLINMYSKLDHPDSARLLLRLT  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P RN+++W +L+ G    GH + AL  F +M R  + V PN  TF C   A +      T
Sbjct  69   PSRNVVSWTSLVSGLVQNGHFSSALLEFLEMRR--EGVFPNDFTFPCAFKAAASLRWPVT  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
            G  I  A+  K G            DM  +  +   A +    +P R  ++ W A L   
Sbjct  127  GKQI-HALSVKCGRILDVFVGCSAFDMYCKTKLRGDARKMFDEIPQR-NLATWNAFLSNS  184

Query  665  RVHGKPE  685
               G+P 
Sbjct  185  VTDGRPR  191



>ref|NP_193221.3| pentatricopeptide repeat-containing protein LOI1 [Arabidopsis 
thaliana]
 sp|Q0WSH6.1|PP312_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14850; 
AltName: Full=Protein LOVASTATIN INSENSITIVE 1 [Arabidopsis 
thaliana]
 dbj|BAE99922.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83509.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=684

 Score =   410 bits (1053),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 187/276 (68%), Positives = 232/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSL+A Y QN   EKA  ++L++R++ +E ++FM+SSVLSACAG+A  ELGRSI
Sbjct  273  KNAVSWCSLVAAYVQNHEDEKASVLYLRSRKDIVETSDFMISSVLSACAGMAGLELGRSI  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  333  HAHAVKACVERTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTRNSLIGGYAHQGQV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE+M  +     PNY+TFV +L+ACSRAGAVE GM IF++M+  YGIEPGAEHY
Sbjct  393  DMALALFEEMAPRGCGPTPNYMTFVSLLSACSRAGAVENGMKIFDSMRSTYGIEPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +C+VDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+HGKP+LG +AA+NLF++DP
Sbjct  453  SCIVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHGKPQLGLLAAENLFKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+E+K +GIKK
Sbjct  513  KDSGNHVLLSNTFAAAGRWAEANTVREELKGVGIKK  548


 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 97/218 (44%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++   QN     AL  F + R EG+ P +F       A A L     G+ I
Sbjct  71   RNVVSWTSLISGLAQNGHFSTALVEFFEMRREGVVPNDFTFPCAFKAVASLRLPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK     +VFV     DMY K    +D  + F E+PERNL TWNA I      G  
Sbjct  131  HALAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPERNLETWNAFISNSVTDGRP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R   D  PN +TF   L ACS    +  GM +   +  + G +      
Sbjct  191  REAIEAFIEFRR--IDGHPNSITFCAFLNACSDWLHLNLGMQL-HGLVLRSGFDTDVSVC  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   +  +      M  +  VS W +L+ A
Sbjct  248  NGLIDFYGKCKQIRSSEIIFTEMGTKNAVS-WCSLVAA  284


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 108/230 (47%), Gaps = 6/230 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +    +A++ F++ R     P      + L+AC+      LG  
Sbjct  171  ERNLETWNAFISNSVTDGRPREAIEAFIEFRRIDGHPNSITFCAFLNACSDWLHLNLGMQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV+++  + +V V + L+D YGKC  I   E  F EM  +N ++W +L+  Y     
Sbjct  231  LHGLVLRSGFDTDVSVCNGLIDFYGKCKQIRSSEIIFTEMGTKNAVSWCSLVAAYVQNHE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFV-CVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
               A  L+    R  +D+V      +  VL+AC+    +E G  I  A   K  +E    
Sbjct  291  DEKASVLY---LRSRKDIVETSDFMISSVLSACAGMAGLELGRSI-HAHAVKACVERTIF  346

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
              + +VDM G+ G +E + +    MP +  V+   +L+G     G+ ++ 
Sbjct  347  VGSALVDMYGKCGCIEDSEQAFDEMPEKNLVT-RNSLIGGYAHQGQVDMA  395


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 57/214 (27%), Positives = 85/214 (40%), Gaps = 7/214 (3%)
 Frame = +2

Query  161  AAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNAL  337
            ++  LGR +H  +VK        F+ + L++MY K    E         P RN+++W +L
Sbjct  20   SSMRLGRVVHARIVKTLDSPPPPFLANYLINMYSKLDHPESARLVLRLTPARNVVSWTSL  79

Query  338  IGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDK  517
            I G A  GH + AL  F +M R  + VVPN  TF C   A +      TG  I  A+  K
Sbjct  80   ISGLAQNGHFSTALVEFFEMRR--EGVVPNDFTFPCAFKAVASLRLPVTGKQI-HALAVK  136

Query  518  YGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKI  697
             G            DM  +  + + A +    +P R  +  W A +      G+P     
Sbjct  137  CGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPER-NLETWNAFISNSVTDGRPREAIE  195

Query  698  AADNLFQIDPQDSGNHVILSNMFASSGRWEEANL  799
            A     +ID     N +       +   W   NL
Sbjct  196  AFIEFRRIDGHP--NSITFCAFLNACSDWLHLNL  227



>gb|KHN02718.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=635

 Score =   408 bits (1048),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 192/276 (70%), Positives = 231/276 (84%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCSLLA   QN   E+A  VFL+AR+E +EPT+FM+SSVLSACA L   ELGRS+
Sbjct  225  RNVVSWCSLLAALVQNHEEERACMVFLQARKE-VEPTDFMISSVLSACAELGGLELGRSV  283

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L +KACVEEN+FV S LVD+YGKCG IE  E+ F EMPERNL+TWNA+IGGYAH G  
Sbjct  284  HALALKACVEENIFVGSALVDLYGKCGSIEYAEQVFREMPERNLVTWNAMIGGYAHLGDV  343

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LF++MT  +  +  +YVT V VL+ACSRAGAVE G+ IFE+M+ +YGIEPGAEHY
Sbjct  344  DMALSLFQEMTSGSCGIALSYVTLVSVLSACSRAGAVERGLQIFESMRGRYGIEPGAEHY  403

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGR+G+V+RAYEFIKRMPI PT+SVWGALLGAC++HGK +LGKIAA+ LF++DP
Sbjct  404  ACVVDLLGRSGLVDRAYEFIKRMPILPTISVWGALLGACKMHGKTKLGKIAAEKLFELDP  463

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSGNHV+ SNM AS+GRWEEA +VRKEM+DIGIKK
Sbjct  464  DDSGNHVVFSNMLASAGRWEEATIVRKEMRDIGIKK  499


 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 94/222 (42%), Gaps = 6/222 (3%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + R  V+W SL++    N     AL  F   R E + P +F    V  A A L     G+
Sbjct  19   NPRTVVTWTSLISGCVHNRRFTSALLHFSNMRRECVLPNDFTFPCVFKASASLHMPVTGK  78

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H L +K     +VFV     DMY K G   +    F EMP RNL TWNA +      G
Sbjct  79   QLHALALKGGNILDVFVGCSAFDMYSKTGLRPEARNMFDEMPHRNLATWNAYMSNAVQDG  138

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFE-AMKDKYGIEPGA  538
                A+  F+       D  PN +TF   L AC+   ++E G  +    ++ +Y      
Sbjct  139  RCLDAIAAFKKFL--CVDGEPNAITFCAFLNACADIVSLELGRQLHGFIVRSRY--REDV  194

Query  539  EHYACVVDMLGRAG-MVERAYEFIKRMPIRPTVSVWGALLGA  661
              +  ++D  G+ G +V     F +    R  V  W +LL A
Sbjct  195  SVFNGLIDFYGKCGDIVSSELVFSRIGSGRRNVVSWCSLLAA  236



>ref|XP_010024272.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Eucalyptus grandis]
 ref|XP_010024273.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Eucalyptus grandis]
 ref|XP_010024274.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Eucalyptus grandis]
 ref|XP_010024275.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Eucalyptus grandis]
 ref|XP_010024276.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Eucalyptus grandis]
 ref|XP_010024278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Eucalyptus grandis]
Length=684

 Score =   408 bits (1049),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/277 (67%), Positives = 230/277 (83%), Gaps = 0/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSWCSL++   QN   EKA   FL AR+EGI+PT+F+VSSVL+ACAGLA  ELGRS
Sbjct  272  EPNDVSWCSLMSTLVQNHEQEKACVAFLMARKEGIQPTDFLVSSVLNACAGLAGLELGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +KACV  N+FV + LVDMYGKCGCIED E AF+ M +RNLITWN+LIGGYAHQG 
Sbjct  332  VHSLAIKACVMGNIFVGTALVDMYGKCGCIEDAEGAFHGMRQRNLITWNSLIGGYAHQGL  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MA+ +FE M     +++PNYVTFVC+LTACSRAG VE GMDIF +M+ ++ IEPG EH
Sbjct  392  ADMAVAVFEKMLSSCSEMIPNYVTFVCLLTACSRAGNVELGMDIFASMRRRHAIEPGPEH  451

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAGM+++AY+FI +MP RPT+S+WGALLGACR+H  PELG+IAA+NLFQ+D
Sbjct  452  YACIVDLLGRAGMLKQAYDFIMKMPFRPTISIWGALLGACRIHRNPELGRIAAENLFQLD  511

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGN V+LSN  A++GRWEEA  VRKE+KDIG+KK
Sbjct  512  PKDSGNFVVLSNSLAAAGRWEEATNVRKEIKDIGLKK  548


 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 85/191 (45%), Gaps = 3/191 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW SL++   QN     +L +F+   +E I P +F       A  GL     G+ I
Sbjct  71   RSVVSWTSLISGSAQNGHFSFSLLMFVDMLKECIRPNDFTFPCAFKASGGLCMPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG+ +K     +VFV S   DMY K G  +D  + F EMP++N + WN  I      G  
Sbjct  131  HGIAIKVGEIVDVFVGSSAFDMYCKTGLKDDARKLFDEMPQKNRVAWNTYISNAVLDGMP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               +  F    R     VP+Y+T    L ACS    +E G  +      + G+E      
Sbjct  191  QDGIGAFIKFRRVGG--VPDYITLCAFLNACSDTANLELGHQL-HGYVLRSGLEADISVA  247

Query  548  ACVVDMLGRAG  580
              +VD  G+ G
Sbjct  248  NGLVDFYGKCG  258


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 116/259 (45%), Gaps = 4/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++N V+W + ++    + + +  +  F+K R  G  P    + + L+AC+  A  ELG  
Sbjct  171  QKNRVAWNTYISNAVLDGMPQDGIGAFIKFRRVGGVPDYITLCAFLNACSDTANLELGHQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V+++ +E ++ V + LVD YGKCG +   E  F E+ E N ++W +L+        
Sbjct  231  LHGYVLRSGLEADISVANGLVDFYGKCGELSCSEMVFDEIREPNDVSWCSLMSTLVQNHE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A   F  M RK + + P       VL AC+    +E G  +  ++  K  +      
Sbjct  291  QEKACVAFL-MARK-EGIQPTDFLVSSVLNACAGLAGLELGRSV-HSLAIKACVMGNIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
               +VDM G+ G +E A      M  R  ++ W +L+G     G  ++     + +    
Sbjct  348  GTALVDMYGKCGCIEDAEGAFHGMRQRNLIT-WNSLIGGYAHQGLADMAVAVFEKMLSSC  406

Query  725  PQDSGNHVILSNMFASSGR  781
             +   N+V    +  +  R
Sbjct  407  SEMIPNYVTFVCLLTACSR  425


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 78/189 (41%), Gaps = 5/189 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            ++S+LSA     +  LGR+ H  +VK         V   L  MY K              
Sbjct  9    LASLLSAAVSARSSLLGRATHARIVKTLRHPLPALVSDHLTHMYSKLDLPGSAHLVLRLN  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P R++++W +LI G A  GH + +L +F DM ++   + PN  TF C   A        T
Sbjct  69   PTRSVVSWTSLISGSAQNGHFSFSLLMFVDMLKEC--IRPNDFTFPCAFKASGGLCMPVT  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
            G  I   +  K G        +   DM  + G+ + A +    MP +  V+ W   +   
Sbjct  127  GKQI-HGIAIKVGEIVDVFVGSSAFDMYCKTGLKDDARKLFDEMPQKNRVA-WNTYISNA  184

Query  665  RVHGKPELG  691
             + G P+ G
Sbjct  185  VLDGMPQDG  193



>ref|XP_003536531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Glycine max]
Length=686

 Score =   408 bits (1048),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 231/277 (83%), Gaps = 1/277 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN VSWCSLLA   QN   E+A  VFL+AR+E +EPT+FM+SSVLSACA L   ELGRS
Sbjct  275  RRNVVSWCSLLAALVQNHEEERACMVFLQARKE-VEPTDFMISSVLSACAELGGLELGRS  333

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +KACVEEN+FV S LVD+YGKCG IE  E+ F EMPERNL+TWNA+IGGYAH G 
Sbjct  334  VHALALKACVEENIFVGSALVDLYGKCGSIEYAEQVFREMPERNLVTWNAMIGGYAHLGD  393

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +MAL LF++MT  +  +  +YVT V VL+ACSRAGAVE G+ IFE+M+ +YGIEPGAEH
Sbjct  394  VDMALSLFQEMTSGSCGIALSYVTLVSVLSACSRAGAVERGLQIFESMRGRYGIEPGAEH  453

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGR+G+V+RAYEFIKRMPI PT+SVWGALLGAC++HGK +LGKIAA+ LF++D
Sbjct  454  YACVVDLLGRSGLVDRAYEFIKRMPILPTISVWGALLGACKMHGKTKLGKIAAEKLFELD  513

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P DSGNHV+ SNM AS+GRWEEA +VRKEM+DIGIKK
Sbjct  514  PDDSGNHVVFSNMLASAGRWEEATIVRKEMRDIGIKK  550


 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 94/222 (42%), Gaps = 6/222 (3%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + R  V+W SL++    N     AL  F   R E + P +F    V  A A L     G+
Sbjct  70   NPRTVVTWTSLISGCVHNRRFTSALLHFSNMRRECVLPNDFTFPCVFKASASLHMPVTGK  129

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H L +K     +VFV     DMY K G   +    F EMP RNL TWNA +      G
Sbjct  130  QLHALALKGGNILDVFVGCSAFDMYSKTGLRPEARNMFDEMPHRNLATWNAYMSNAVQDG  189

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFE-AMKDKYGIEPGA  538
                A+  F+       D  PN +TF   L AC+   ++E G  +    ++ +Y      
Sbjct  190  RCLDAIAAFKKFL--CVDGEPNAITFCAFLNACADIVSLELGRQLHGFIVRSRY--REDV  245

Query  539  EHYACVVDMLGRAG-MVERAYEFIKRMPIRPTVSVWGALLGA  661
              +  ++D  G+ G +V     F +    R  V  W +LL A
Sbjct  246  SVFNGLIDFYGKCGDIVSSELVFSRIGSGRRNVVSWCSLLAA  287


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 75/180 (42%), Gaps = 10/180 (6%)
 Frame = +2

Query  119  EFMVSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAF  295
             F+ S+VLS  +      LGR++H  +++        F+ + LV+MY K       +   
Sbjct  12   SFLESAVLSRSS-----LLGRAVHAHILRTHDTPLPSFLCNHLVNMYSKLDLPNSAQLVL  66

Query  296  YEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGA  475
                 R ++TW +LI G  H      AL  F +M R+   V+PN  TF CV  A +    
Sbjct  67   SLTNPRTVVTWTSLISGCVHNRRFTSALLHFSNMRREC--VLPNDFTFPCVFKASASLHM  124

Query  476  VETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
              TG  +  A+  K G            DM  + G+   A      MP R  ++ W A +
Sbjct  125  PVTGKQL-HALALKGGNILDVFVGCSAFDMYSKTGLRPEARNMFDEMPHR-NLATWNAYM  182



>ref|XP_009369851.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g14850, partial [Pyrus x bretschneideri]
Length=467

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/279 (69%), Positives = 232/279 (83%), Gaps = 2/279 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSWCS++A   QND  EKA ++FL+ARE G++PT+FMVSSVLSACAG+A  E GRS
Sbjct  54   QRNDVSWCSMVAACVQNDEEEKACELFLRAREXGVKPTDFMVSSVLSACAGVAWIEQGRS  113

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + VKACVE NVFV S LVDMYGK   IED ERAF EMP  NLITWNAL+G YAHQGH
Sbjct  114  VHAVAVKACVEGNVFVGSALVDMYGKYESIEDAERAFDEMPLWNLITWNALVGAYAHQGH  173

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+MAL LFE+M   + +V PNYV+ VCVL+ACSRAG V+ GM IFE+MK +YGIEPGAEH
Sbjct  174  ADMALALFEEMCAXSHEVKPNYVSLVCVLSACSRAGTVQMGMQIFESMKARYGIEPGAEH  233

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C VD+ GRAG+VERAYEFI +MPI PTVS++G LLG C+++ KPELGKIAAD LF++D
Sbjct  234  YTCXVDLQGRAGVVERAYEFIPKMPICPTVSIYGXLLGGCKMYRKPELGKIAADKLFELD  293

Query  725  PQD--SGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+D  SGN+V++SNMFA++GRWEEA LVRK+MKD+GIKK
Sbjct  294  PKDSVSGNNVVISNMFAAAGRWEEATLVRKKMKDVGIKK  332


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 93/211 (44%), Gaps = 4/211 (2%)
 Frame = +2

Query  149  CAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITW  328
            C+ +   ELGR  HG V++    ++V + + LVD YGK   +      F  + +RN ++W
Sbjct  1    CSDMLNLELGRQFHGFVMRCGFGKDVSILNGLVDFYGKXQEVGCSMMVFDGIGQRNDVSW  60

Query  329  NALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM  508
             +++           A +LF  +  +   V P       VL+AC+    +E G  +  A+
Sbjct  61   CSMVAACVQNDEEEKACELF--LRAREXGVKPTDFMVSSVLSACAGVAWIEQGRSV-HAV  117

Query  509  KDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPEL  688
              K  +E      + +VDM G+   +E A      MP+   ++ W AL+GA    G  ++
Sbjct  118  AVKACVEGNVFVGSALVDMYGKYESIEDAERAFDEMPLWNLIT-WNALVGAYAHQGHADM  176

Query  689  GKIAADNLFQIDPQDSGNHVILSNMFASSGR  781
                 + +     +   N+V L  + ++  R
Sbjct  177  ALALFEEMCAXSHEVKPNYVSLVCVLSACSR  207



>ref|XP_008797346.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g14850-like [Phoenix dactylifera]
Length=684

 Score =   407 bits (1046),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 186/276 (67%), Positives = 229/276 (83%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCS+L VY QN   E+A KV+L AR EGIEPT+FMVSS+L+ CAGLA  +LGRS+
Sbjct  274  KNDVSWCSMLVVYAQNGTEEEAFKVYLDARREGIEPTDFMVSSILTTCAGLAGLDLGRSV  333

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + +++CV+ N+FV S LVDMYGKCG I D E+AF  MP+RNL++WNA+IGGYAH G A
Sbjct  334  HAVAIRSCVDGNIFVGSALVDMYGKCGSISDAEQAFRVMPDRNLVSWNAMIGGYAHYGDA  393

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL +F+ M   + +V PNYVT V V+TACSR G    G+++FE M++++GIE   EHY
Sbjct  394  HMALAVFDKMI-NSGEVAPNYVTLVNVITACSRGGMTREGLELFETMRERFGIERRTEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM ERAYEFIK MP+RP+VSVWGALLGACRVHGK ELG+IAA+ LF+IDP
Sbjct  453  ACVVDLLGRAGMEERAYEFIKEMPVRPSVSVWGALLGACRVHGKTELGRIAAEKLFEIDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNMFAS+GRWEEA +VRKEMKD+GIKK
Sbjct  513  QDSGNHVLLSNMFASAGRWEEATVVRKEMKDVGIKK  548


 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 123/259 (47%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             +N V+W +++     +   ++A+  F+K R  G  P    + + L+ACAG +   LG  
Sbjct  172  HKNIVAWNAVMTNAVLDGRPDEAIDAFMKLRLSGECPNTISLCAFLNACAGASYLWLGAQ  231

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  V+++  + NV V + L+D YGKC  +++       MP +N ++W +++  YA  G 
Sbjct  232  LHAFVIQSGFDSNVSVGNGLIDFYGKCHWVDEARAVLDRMPTKNDVSWCSMLVVYAQNGT  291

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  ++ D  R  + + P       +LT C+    ++ G  +  A+  +  ++     
Sbjct  292  EEEAFKVYLDARR--EGIEPTDFMVSSILTTCAGLAGLDLGRSV-HAVAIRSCVDGNIFV  348

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +  A +  + MP R  VS W A++G    +G   +     D +    
Sbjct  349  GSALVDMYGKCGSISDAEQAFRVMPDRNLVS-WNAMIGGYAHYGDAHMALAVFDKMIN-S  406

Query  725  PQDSGNHVILSNMFASSGR  781
             + + N+V L N+  +  R
Sbjct  407  GEVAPNYVTLVNVITACSR  425


 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 98/213 (46%), Gaps = 4/213 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W +L++   QN     AL  F       + P +F   SV  A A L     GR +H L
Sbjct  75   VTWTALISGATQNGRPLPALLHFTSMLRASVRPNDFTFPSVFKAAAALRHSLAGRQLHSL  134

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K+ +  +VFV    +DMY K G   +  + F EMP +N++ WNA++      G  + A
Sbjct  135  SLKSGLINDVFVACGALDMYYKTGLAFEARQMFDEMPHKNIVAWNAVMTNAVLDGRPDEA  194

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +D F  M  +     PN ++    L AC+ A  +  G  +  A   + G +        +
Sbjct  195  IDAF--MKLRLSGECPNTISLCAFLNACAGASYLWLGAQL-HAFVIQSGFDSNVSVGNGL  251

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
            +D  G+   V+ A   + RMP +  VS W ++L
Sbjct  252  IDFYGKCHWVDEARAVLDRMPTKNDVS-WCSML  283


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 74/178 (42%), Gaps = 15/178 (8%)
 Frame = +2

Query  170  ELGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGG  346
             LGR+ H  +VK+       F+ S LV+MY K              P  +++TW ALI G
Sbjct  24   RLGRAAHAQIVKSLSPLIPCFLSSHLVNMYSKLDLPSAAAATLALDPAPSVVTWTALISG  83

Query  347  YAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTAC-----SRAGAVETGMDIFEAMK  511
                G    AL  F  M R +  V PN  TF  V  A      S AG     + +   + 
Sbjct  84   ATQNGRPLPALLHFTSMLRAS--VRPNDFTFPSVFKAAAALRHSLAGRQLHSLSLKSGLI  141

Query  512  DKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +   +  GA      +DM  + G+   A +    MP +  V+ W A++    + G+P+
Sbjct  142  NDVFVACGA------LDMYYKTGLAFEARQMFDEMPHKNIVA-WNAVMTNAVLDGRPD  192



>ref|XP_010435060.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Camelina sativa]
Length=684

 Score =   405 bits (1042),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/276 (67%), Positives = 230/276 (83%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSL+A Y QN   EKA  ++L++R++ +E +++M+SS LSACAG+A  ELGRSI
Sbjct  273  KNAVSWCSLVAAYVQNHEDEKASMLYLRSRKDIVETSDYMISSALSACAGMAGLELGRSI  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPERNL+T N+LIGGYAHQG  
Sbjct  333  HAQAVKACVERTIFVGSALVDMYGKCGCIEDSEQAFDEMPERNLVTLNSLIGGYAHQGQV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            ++AL LFE+M  +     PNY+TFV +L+ACSRAGAVE GM IF++MK  YGIEPGAEHY
Sbjct  393  DLALALFEEMAPRGCGPTPNYMTFVSLLSACSRAGAVEDGMKIFDSMKSTYGIEPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +C+VDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+HGKP LG +AA++LF++DP
Sbjct  453  SCIVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHGKPHLGILAAESLFKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+EMK +GIKK
Sbjct  513  KDSGNHVLLSNTFAAAGRWAEANTVREEMKGVGIKK  548


 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 96/218 (44%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++    N     AL  F + R EG+ P +F       A   L     G+ I
Sbjct  71   RNVVSWTSLVSGLVNNGHFSTALFEFFEMRREGVVPNDFTFPCAFKAVGSLRLPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL VK     +VFV     DMY K    +D  + F E+PERN  TWNA I      G  
Sbjct  131  HGLAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPERNCETWNAYISNSVIDGKP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R      PN +TF   L ACS    ++ G  +   +  ++G +     Y
Sbjct  191  LEAIEAFIEFRRIGGK--PNSITFCGFLNACSDGLHLDLGKQL-HGLVFRFGFDSDVSVY  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   +  +      M  +  VS W +L+ A
Sbjct  248  NGLIDFYGKCKQILCSEIVFAEMGTKNAVS-WCSLVAA  284


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 110/228 (48%), Gaps = 4/228 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +    +A++ F++ R  G +P        L+AC+     +LG+ 
Sbjct  171  ERNCETWNAYISNSVIDGKPLEAIEAFIEFRRIGGKPNSITFCGFLNACSDGLHLDLGKQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV +   + +V V + L+D YGKC  I   E  F EM  +N ++W +L+  Y  Q H
Sbjct  231  LHGLVFRFGFDSDVSVYNGLIDFYGKCKQILCSEIVFAEMGTKNAVSWCSLVAAYV-QNH  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +    +    +RK      +Y+     L+AC+    +E G  I  A   K  +E     
Sbjct  290  EDEKASMLYLRSRKDIVETSDYM-ISSALSACAGMAGLELGRSI-HAQAVKACVERTIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPEL  688
             + +VDM G+ G +E + +    MP R  V++  +L+G     G+ +L
Sbjct  348  GSALVDMYGKCGCIEDSEQAFDEMPERNLVTL-NSLIGGYAHQGQVDL  394


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 75/183 (41%), Gaps = 5/183 (3%)
 Frame = +2

Query  137  VLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER  313
            +L      ++  LGR +HG +VK        F+ + L+ +Y K    E         P R
Sbjct  12   LLKNAISTSSLRLGRVVHGRIVKTLDSPPPPFLANYLISLYSKLDHPESARIVLRLTPAR  71

Query  314  NLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMD  493
            N+++W +L+ G  + GH + AL  F +M R  + VVPN  TF C   A        TG  
Sbjct  72   NVVSWTSLVSGLVNNGHFSTALFEFFEMRR--EGVVPNDFTFPCAFKAVGSLRLPVTGKQ  129

Query  494  IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            I   +  K G            DM  +  + + A +    +P R     W A +    + 
Sbjct  130  I-HGLAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPER-NCETWNAYISNSVID  187

Query  674  GKP  682
            GKP
Sbjct  188  GKP  190



>ref|XP_010525197.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Tarenaya hassleriana]
Length=684

 Score =   405 bits (1041),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/276 (66%), Positives = 231/276 (84%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSLLA + QN   EKA  +F +AR EGIEPT+F++SS LSACAG+A  ELGRSI
Sbjct  273  KNAVSWCSLLAAHVQNHEDEKASVLFSRARNEGIEPTDFLISSALSACAGMAGLELGRSI  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VKAC+E N+FV S LVDMYGKCG IED E AF EMPE+NL+T N+LIGGY HQG  
Sbjct  333  HALAVKACIEGNIFVGSALVDMYGKCGSIEDAEWAFDEMPEKNLVTLNSLIGGYTHQGGI  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            + A+ +F+++      + PNY+TFV +L+ACSRAGAV+ GM++FE+MK +YGI+PGAEHY
Sbjct  393  DSAIQIFDEIASGIYKLTPNYLTFVSILSACSRAGAVDKGMELFESMKSRYGIDPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVDMLGRAGMVE AYEFI++MP +PT+SVWGALL ACRV+ KP+LGK+AA+NLF++DP
Sbjct  453  ACVVDMLGRAGMVESAYEFIQKMPFQPTISVWGALLNACRVYSKPQLGKVAAENLFKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSG+HV+LSN++A++GRW EAN VR+EMK +GIKK
Sbjct  513  KDSGHHVLLSNLYAATGRWAEANAVREEMKGVGIKK  548


 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 97/218 (44%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW +L+A   QN     AL  F   R EGI P +F +     A A L     G+ +
Sbjct  71   RNVVSWTALVAGLVQNGHFSSALFDFCNMRREGISPNDFTLPCAFKASASLRLPVTGKQL  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK     +VFV     DMY K G   D  + F E+PERN  TWNA I      G +
Sbjct  131  HALSVKNGRILDVFVGCSAFDMYSKTGLRVDARKLFDEIPERNSATWNAFISNAVADGRS  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R   D  PN +TF   L ACS   ++E GM +      + G        
Sbjct  191  RDAIEAFIEFRRIGGD--PNSITFCAFLNACSDRLSLELGMQL-HGFILRSGFNTDVSVS  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   +  A      M  +  VS W +LL A
Sbjct  248  NGLIDFYGKCEQICCAEMVFTEMGTKNAVS-WCSLLAA  284


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 103/218 (47%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +     A++ F++ R  G +P      + L+AC+   + ELG  
Sbjct  171  ERNSATWNAFISNAVADGRSRDAIEAFIEFRRIGGDPNSITFCAFLNACSDRLSLELGMQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG ++++    +V V + L+D YGKC  I   E  F EM  +N ++W +L+  +     
Sbjct  231  LHGFILRSGFNTDVSVSNGLIDFYGKCEQICCAEMVFTEMGTKNAVSWCSLLAAHVQNHE  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  LF     + + + P        L+AC+    +E G  I  A+  K  IE     
Sbjct  291  DEKASVLFSRA--RNEGIEPTDFLISSALSACAGMAGLELGRSI-HALAVKACIEGNIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
             + +VDM G+ G +E A      MP +  V++  +L+G
Sbjct  348  GSALVDMYGKCGSIEDAEWAFDEMPEKNLVTL-NSLIG  384


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 70/171 (41%), Gaps = 5/171 (3%)
 Frame = +2

Query  170  ELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGG  346
             LGR +H  +V+        F+ + L++MY K    +         P RN+++W AL+ G
Sbjct  23   RLGRVVHAKIVRTLDSPPPPFLSNHLINMYSKLDLQDSARIVLRRTPARNVVSWTALVAG  82

Query  347  YAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
                GH + AL  F +M R  + + PN  T  C   A +      TG  +  A+  K G 
Sbjct  83   LVQNGHFSSALFDFCNMRR--EGISPNDFTLPCAFKASASLRLPVTGKQL-HALSVKNGR  139

Query  527  EPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
                       DM  + G+   A +    +P R + + W A +      G+
Sbjct  140  ILDVFVGCSAFDMYSKTGLRVDARKLFDEIPERNSAT-WNAFISNAVADGR  189



>ref|XP_010449980.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
isoform X1 [Camelina sativa]
 ref|XP_010449981.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
isoform X2 [Camelina sativa]
Length=684

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/276 (68%), Positives = 230/276 (83%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSL+A Y QN   EKA  ++L++R++ +E +++M+SS LSACAG+A  ELGRSI
Sbjct  273  KNAVSWCSLVAAYVQNHEDEKASLLYLRSRKDIVETSDYMISSALSACAGMAGLELGRSI  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG  VKACVE  +FV S LVDMYGKCGCIED E AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  333  HGHAVKACVERTLFVGSALVDMYGKCGCIEDSEHAFDEMPEKNLVTLNSLIGGYAHQGQV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE+M  +     PNY+TFV +L+ACSRAGAVE GM IF++MK  YGIEPGAEHY
Sbjct  393  DMALALFEEMAPRGCGPTPNYMTFVSLLSACSRAGAVENGMWIFDSMKSTYGIEPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +C+VDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+HGKP LG +AA++LF++DP
Sbjct  453  SCIVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHGKPHLGILAAESLFKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+EMK +GIKK
Sbjct  513  KDSGNHVLLSNTFAAAGRWAEANTVREEMKGVGIKK  548


 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 96/218 (44%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++    N     AL  F + R EG+ P +F       A   L     G+ I
Sbjct  71   RNVVSWTSLVSGLVNNGHFSTALFEFFEMRREGVVPNDFTFPCAFKAVGSLRLPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL VK     +VFV     DMY K    +D  + F E+PERN  TWNA I      G  
Sbjct  131  HGLAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPERNCETWNAYITNSVIDGKP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R      PN +TF   L ACS    ++ G  +   +  ++G +     Y
Sbjct  191  REAIEAFIEFRRIGGQ--PNSITFCGFLNACSDGLHLDLGKQL-HGLVFRFGFDSDVSVY  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   +  +      M  +  VS W +L+ A
Sbjct  248  NGLIDFYGKCKQILCSEIVFAEMGAKNAVS-WCSLVAA  284


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/228 (27%), Positives = 107/228 (47%), Gaps = 4/228 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + +     +    +A++ F++ R  G +P        L+AC+     +LG+ 
Sbjct  171  ERNCETWNAYITNSVIDGKPREAIEAFIEFRRIGGQPNSITFCGFLNACSDGLHLDLGKQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV +   + +V V + L+D YGKC  I   E  F EM  +N ++W +L+  Y  Q H
Sbjct  231  LHGLVFRFGFDSDVSVYNGLIDFYGKCKQILCSEIVFAEMGAKNAVSWCSLVAAYV-QNH  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +    L    +RK      +Y+     L+AC+    +E G  I      K  +E     
Sbjct  290  EDEKASLLYLRSRKDIVETSDYM-ISSALSACAGMAGLELGRSI-HGHAVKACVERTLFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPEL  688
             + +VDM G+ G +E +      MP +  V++  +L+G     G+ ++
Sbjct  348  GSALVDMYGKCGCIEDSEHAFDEMPEKNLVTL-NSLIGGYAHQGQVDM  394


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 73/184 (40%), Gaps = 5/184 (3%)
 Frame = +2

Query  137  VLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER  313
            +L      ++  LGR  H  +VK        F+ + L+ +Y K    E         P R
Sbjct  12   LLKNAISTSSLRLGRVAHARIVKTLDSPPPPFLANYLISLYSKLDHPESARIVLRLTPAR  71

Query  314  NLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMD  493
            N+++W +L+ G  + GH + AL  F +M R  + VVPN  TF C   A        TG  
Sbjct  72   NVVSWTSLVSGLVNNGHFSTALFEFFEMRR--EGVVPNDFTFPCAFKAVGSLRLPVTGKQ  129

Query  494  IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            I   +  K G            DM  +  + + A +    +P R     W A +    + 
Sbjct  130  I-HGLAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPER-NCETWNAYITNSVID  187

Query  674  GKPE  685
            GKP 
Sbjct  188  GKPR  191



>ref|XP_010917746.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Elaeis guineensis]
Length=684

 Score =   404 bits (1038),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/276 (66%), Positives = 229/276 (83%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCS++ VY QN   E+A  V+L AR EGI+PT+F+VSSVL+ CAGL+  +LGRS+
Sbjct  274  KNDVSWCSMIVVYAQNGAEEEAFNVYLDARREGIKPTDFIVSSVLTTCAGLSGLDLGRSV  333

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + +++C++ N+FV S LVDMYGKCG I D E+AF EMP+RNL++WNA+IGGYAH G A
Sbjct  334  HAVAIRSCIDGNIFVGSALVDMYGKCGSISDAEQAFREMPDRNLVSWNAMIGGYAHYGDA  393

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL +F++M   + +V PNYVT V V+TACSR G    G+D+FE M++++GI+P  EHY
Sbjct  394  HMALAVFDEMI-NSGEVAPNYVTLVNVITACSRGGMTREGLDLFETMRERFGIQPRTEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM ERAYEFIK MP+RP+VSVWGALLGACRVHG  ELG+IAA+ LF+IDP
Sbjct  453  ACVVDLLGRAGMEERAYEFIKEMPVRPSVSVWGALLGACRVHGMTELGRIAAEKLFEIDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNMFAS+GRWEEA  VRKEMKD+GIKK
Sbjct  513  QDSGNHVLLSNMFASAGRWEEATEVRKEMKDVGIKK  548


 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 123/259 (47%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             +N V+W +++     +    +A+  F K R  G  P    + +  +ACAG +   LG  
Sbjct  172  HKNIVAWNAVMTNAVLDGRPGEAIDAFSKLRLSGESPNTISLCAFFNACAGASYLWLGAQ  231

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  V+++  + ++ V + L+D YGKC C+++    F  MP +N ++W ++I  YA  G 
Sbjct  232  LHAFVIQSGFDSDMSVGNGLIDFYGKCHCVDEARAVFDGMPTKNDVSWCSMIVVYAQNGA  291

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A +++ D  R  + + P       VLT C+    ++ G  +  A+  +  I+     
Sbjct  292  EEEAFNVYLDARR--EGIKPTDFIVSSVLTTCAGLSGLDLGRSV-HAVAIRSCIDGNIFV  348

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +  A +  + MP R  VS W A++G    +G   +     D +    
Sbjct  349  GSALVDMYGKCGSISDAEQAFREMPDRNLVS-WNAMIGGYAHYGDAHMALAVFDEMIN-S  406

Query  725  PQDSGNHVILSNMFASSGR  781
             + + N+V L N+  +  R
Sbjct  407  GEVAPNYVTLVNVITACSR  425


 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 92/213 (43%), Gaps = 4/213 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +L++   QN     AL  F       + P +F + S   A A L     GR +H  
Sbjct  75   VSWTALISGAAQNGRALPALLHFTAMLRASVRPNDFTLPSTFKAAAALRHSLAGRQLHSF  134

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K  +  +VFV    +DMY K G   +  + F EMP +N++ WNA++      G    A
Sbjct  135  SLKTGLINDVFVACGALDMYYKTGLALEARQMFDEMPHKNIVAWNAVMTNAVLDGRPGEA  194

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +D F  +    +   PN ++      AC+ A  +  G  +  A   + G +        +
Sbjct  195  IDAFSKLRLSGES--PNTISLCAFFNACAGASYLWLGAQL-HAFVIQSGFDSDMSVGNGL  251

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
            +D  G+   V+ A      MP +  VS W +++
Sbjct  252  IDFYGKCHCVDEARAVFDGMPTKNDVS-WCSMI  283



>ref|XP_006283247.1| hypothetical protein CARUB_v10004282mg [Capsella rubella]
 gb|EOA16145.1| hypothetical protein CARUB_v10004282mg [Capsella rubella]
Length=684

 Score =   404 bits (1037),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 186/276 (67%), Positives = 230/276 (83%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSL+A Y QN   EKA  ++L++R+E +E ++FM+SS LSACAG+A  ELGRSI
Sbjct  273  KNAVSWCSLVAAYVQNHEDEKASLLYLRSRKEIVETSDFMISSALSACAGMAGLELGRSI  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  333  HAHAVKACVEMTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTLNSLIGGYAHQGEV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE+M  +     PNY+TFV +L+ACSRAGAVE GM IF++MK  YGIEPGAEHY
Sbjct  393  DMALALFEEMAPRGCGPTPNYMTFVSLLSACSRAGAVENGMKIFDSMKSIYGIEPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +C+VDMLGRAGMVE+AY+FIK++PI+PT+SVWGAL  ACR+HGKP LG +AA+NLF++DP
Sbjct  453  SCIVDMLGRAGMVEQAYKFIKKLPIQPTISVWGALQNACRMHGKPHLGIVAAENLFKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+EMK +GIKK
Sbjct  513  KDSGNHVLLSNTFAAAGRWAEANTVREEMKGVGIKK  548


 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 96/218 (44%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++    N     AL  F++ R +G+ P +F       A A L     G+ I
Sbjct  71   RNVVSWTSLVSGLVNNGHFSIALFEFVEMRRDGVSPNDFTFPCAFKAVASLRLPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL VK     +VFV     DMY K    +D  + F E+PERN  TWNA I      G  
Sbjct  131  HGLAVKCGRILDVFVGCSAFDMYCKTRLRDDARQLFDEIPERNCETWNAFISNSVTDGRP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R      PN +TF   L ACS    +  G  +   +  + G +     Y
Sbjct  191  REAIEAFIEFRRIGGQ--PNTITFCGFLNACSDGLHLNLGKQL-HGLVFRCGFDTDVSVY  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   +  +      M  +  VS W +L+ A
Sbjct  248  NGLIDFYGKCKQIICSEIVFAEMGTKNAVS-WCSLVAA  284


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 109/229 (48%), Gaps = 4/229 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +    +A++ F++ R  G +P        L+AC+      LG+ 
Sbjct  171  ERNCETWNAFISNSVTDGRPREAIEAFIEFRRIGGQPNTITFCGFLNACSDGLHLNLGKQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV +   + +V V + L+D YGKC  I   E  F EM  +N ++W +L+  Y  Q H
Sbjct  231  LHGLVFRCGFDTDVSVYNGLIDFYGKCKQIICSEIVFAEMGTKNAVSWCSLVAAYV-QNH  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +    L    +RK + V  +       L+AC+    +E G  I  A   K  +E     
Sbjct  290  EDEKASLLYLRSRK-EIVETSDFMISSALSACAGMAGLELGRSI-HAHAVKACVEMTIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
             + +VDM G+ G +E + +    MP +  V++  +L+G     G+ ++ 
Sbjct  348  GSALVDMYGKCGCIEDSEQAFDEMPEKNLVTL-NSLIGGYAHQGEVDMA  395


 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 74/184 (40%), Gaps = 5/184 (3%)
 Frame = +2

Query  137  VLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER  313
            +L      ++  LGR +HG +VK        F+ + L+ +Y K    E         P R
Sbjct  12   ILKNAISTSSMRLGRVVHGRIVKTLDSPPPPFLANYLISLYSKLDHPESARLVLRFTPAR  71

Query  314  NLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMD  493
            N+++W +L+ G  + GH ++AL  F +M R    V PN  TF C   A +      TG  
Sbjct  72   NVVSWTSLVSGLVNNGHFSIALFEFVEMRR--DGVSPNDFTFPCAFKAVASLRLPVTGKQ  129

Query  494  IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            I   +  K G            DM  +  + + A +    +P R     W A +      
Sbjct  130  I-HGLAVKCGRILDVFVGCSAFDMYCKTRLRDDARQLFDEIPER-NCETWNAFISNSVTD  187

Query  674  GKPE  685
            G+P 
Sbjct  188  GRPR  191



>ref|XP_003617141.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AET00100.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=684

 Score =   402 bits (1033),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/278 (68%), Positives = 231/278 (83%), Gaps = 1/278 (0%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + +N VSWCS+LA   QN   E+A  VFL+AR+E +EPT+FM+SSVLSACA L   ELGR
Sbjct  272  NRKNVVSWCSMLAALVQNHEEERACMVFLQARKE-VEPTDFMISSVLSACAELGGLELGR  330

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+H L VKACVE+N+FV S LVDMYGKCG IE+ E+ F E+PERNL+TWNA+IGGYAHQG
Sbjct  331  SVHALAVKACVEDNIFVGSALVDMYGKCGSIENAEQVFSELPERNLVTWNAMIGGYAHQG  390

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              +MAL LFE+MT  +  + P+YVT + +L+ CSR GAVE G+ IFE+M+  YGIEPGAE
Sbjct  391  DIDMALRLFEEMTLGSHGIRPSYVTLISILSVCSRVGAVERGIQIFESMRLNYGIEPGAE  450

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            H+ACVVD+LGR+G+V+RAYEFI+ M I+PT+SVWGALLGACR+HGK ELGKIAA+ LF++
Sbjct  451  HFACVVDLLGRSGLVDRAYEFIQNMAIQPTISVWGALLGACRMHGKTELGKIAAEKLFEL  510

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            D  DSGNHV+LSNM AS+GRWEEA +VRKEMKDIGIKK
Sbjct  511  DHVDSGNHVVLSNMLASAGRWEEATVVRKEMKDIGIKK  548


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 94/218 (43%), Gaps = 3/218 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R  V+W SL++    N     AL  F   R + ++P +F    V  A A +     G+ I
Sbjct  71   RTVVTWTSLISGCVHNRRFLPALLHFTNMRRDNVQPNDFTFPCVFKASAFVQIPMTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL +K  +  +VFV     DMY K G   D    F EMP+RNL TWNA I        +
Sbjct  131  HGLALKGGMIYDVFVGCSCFDMYCKTGFRGDACNMFDEMPQRNLATWNAYISNAVQDRRS  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+  F++      +  PN +TF   L AC     +  G  +  A   + G +      
Sbjct  191  LDAIVAFKEFLCVHGE--PNSITFCAFLNACVDMVRLNLGRQL-HAFIVRCGYKEDVSVA  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+ G +  A     R+  R  V  W ++L A
Sbjct  248  NGLIDFYGKCGDIVSAEMVFNRIGNRKNVVSWCSMLAA  285


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 76/184 (41%), Gaps = 6/184 (3%)
 Frame = +2

Query  107  IEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDC  283
            I P   + S + SA +   +  LGR+IH  +++  V     F+ + LV+MY K   +   
Sbjct  3    IHPQNLLGSLLESAVSTHCSI-LGRTIHAHIIRTHVTPLPSFLSNHLVNMYSKLDLLNSA  61

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
            +        R ++TW +LI G  H      AL  F +M R   +V PN  TF CV  A +
Sbjct  62   QHVLSLTHLRTVVTWTSLISGCVHNRRFLPALLHFTNMRR--DNVQPNDFTFPCVFKASA  119

Query  464  RAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVW  643
                  TG  I   +  K G+           DM  + G    A      MP R  ++ W
Sbjct  120  FVQIPMTGKQI-HGLALKGGMIYDVFVGCSCFDMYCKTGFRGDACNMFDEMPQR-NLATW  177

Query  644  GALL  655
             A +
Sbjct  178  NAYI  181



>ref|XP_010440383.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Camelina sativa]
Length=684

 Score =   401 bits (1031),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/276 (67%), Positives = 228/276 (83%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCSL+A Y QN   EKA  ++L++R++ +E +++M+SS LSACAG+A  ELGRSI
Sbjct  273  RNAVSWCSLVAAYVQNHEDEKASMLYLRSRKDIVETSDYMISSALSACAGMAGLELGRSI  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  333  HAHAVKACVERTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTLNSLIGGYAHQGQV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE+M  +     PNY+TFV +L+ACSRAG VE GM IF++MK  YGIEPGAEHY
Sbjct  393  DMALALFEEMAPRGCGPAPNYMTFVSLLSACSRAGDVENGMKIFDSMKSTYGIEPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +C+VDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+HGKP LG +AA++L+++DP
Sbjct  453  SCIVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHGKPHLGILAAESLYKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN  A++GRW EAN VR+EMK +GIKK
Sbjct  513  KDSGNHVLLSNTLAAAGRWAEANTVREEMKGVGIKK  548


 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 96/218 (44%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++    N     AL  F + R EG+ P +F       A   L     G+ I
Sbjct  71   RNVVSWTSLVSGLVNNGHFSTALFEFFEMRREGVAPNDFTFPCAFKAVGSLRLPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL VK     +VFV     DMY K    +D  + F E+PERN  TWNA +      G  
Sbjct  131  HGLAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPERNCETWNAYLSNSVTDGKP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  R      PN +TF   L +CS    ++ G  +   +  ++G +     Y
Sbjct  191  REAIEAFIEFRRIGGQ--PNSITFCGFLNSCSDGLHLDLGKQL-HGLVFRFGFDSDVSVY  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+   +  +      M  R  VS W +L+ A
Sbjct  248  NGLIDFYGKCKQILCSEIVFAEMGTRNAVS-WCSLVAA  284


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 110/229 (48%), Gaps = 4/229 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + L+    +    +A++ F++ R  G +P        L++C+     +LG+ 
Sbjct  171  ERNCETWNAYLSNSVTDGKPREAIEAFIEFRRIGGQPNSITFCGFLNSCSDGLHLDLGKQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV +   + +V V + L+D YGKC  I   E  F EM  RN ++W +L+  Y  Q H
Sbjct  231  LHGLVFRFGFDSDVSVYNGLIDFYGKCKQILCSEIVFAEMGTRNAVSWCSLVAAYV-QNH  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +    +    +RK      +Y+     L+AC+    +E G  I  A   K  +E     
Sbjct  290  EDEKASMLYLRSRKDIVETSDYM-ISSALSACAGMAGLELGRSI-HAHAVKACVERTIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
             + +VDM G+ G +E + +    MP +  V++  +L+G     G+ ++ 
Sbjct  348  GSALVDMYGKCGCIEDSEQAFDEMPEKNLVTL-NSLIGGYAHQGQVDMA  395


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 72/184 (39%), Gaps = 5/184 (3%)
 Frame = +2

Query  137  VLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER  313
            +L      ++  LGR +H  VVK        F+ + L+ +Y K    E         P R
Sbjct  12   LLKNAISTSSLRLGRVVHARVVKTLNSPPPPFLANYLISLYSKLDHPESARIVLRLTPAR  71

Query  314  NLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMD  493
            N+++W +L+ G  + GH + AL  F +M R  + V PN  TF C   A        TG  
Sbjct  72   NVVSWTSLVSGLVNNGHFSTALFEFFEMRR--EGVAPNDFTFPCAFKAVGSLRLPVTGKQ  129

Query  494  IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            I   +  K G            DM  +  + + A +    +P R     W A L      
Sbjct  130  I-HGLAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPER-NCETWNAYLSNSVTD  187

Query  674  GKPE  685
            GKP 
Sbjct  188  GKPR  191



>ref|XP_006414633.1| hypothetical protein EUTSA_v10024593mg [Eutrema salsugineum]
 gb|ESQ56086.1| hypothetical protein EUTSA_v10024593mg [Eutrema salsugineum]
Length=680

 Score =   400 bits (1029),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 186/277 (67%), Positives = 229/277 (83%), Gaps = 4/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSWCSL+A + QN   EKA  ++L++R++ +E +EFM+SS LSACAG+A  ELGRS
Sbjct  272  ERNVVSWCSLVAAFVQNHEDEKASLLYLRSRKDIVETSEFMISSTLSACAGMAGLELGRS  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   VKAC+E ++FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG 
Sbjct  332  VHAHAVKACIERSLFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTLNSLIGGYAHQGQ  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +MAL LFE+M   T    PNY+TFV +L+ACSRAG VE GM IF++MK  YG+EPGAEH
Sbjct  392  VDMALALFEEMAPLT----PNYMTFVSLLSACSRAGNVENGMKIFDSMKSSYGVEPGAEH  447

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y+CVVDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+H KP+LG IAA+NLF++D
Sbjct  448  YSCVVDMLGRAGMVERAYEFIKKMPIKPTISVWGALQNACRMHSKPDLGIIAAENLFKLD  507

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGNHV+LSN   ++GRW EAN VR+EMK +GIKK
Sbjct  508  PKDSGNHVLLSNTLVAAGRWVEANTVREEMKGVGIKK  544


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 100/219 (46%), Gaps = 6/219 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++   QN     AL  FL+ R EG+ P +F    V  + A L     G+ I
Sbjct  71   RNVVSWTSLVSGLVQNGHYYSALFEFLEMRREGVFPNDFTFPCVFKSAALLRLPVTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK     +VFV     DMY K    +D  + F EMP+RNL TWNA +      G  
Sbjct  131  HALAVKCGRVMDVFVGCSAFDMYCKTRLRDDARKVFDEMPKRNLETWNAYMSNSVIDGRP  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A++ F +  +      PN +TF   L ACS    +  G  +   +  + G +      
Sbjct  191  KEAIEAFIEFRKIGGH--PNSITFCAFLNACSDKLLLSLGEQL-HGLVFRSGFDRDVSVC  247

Query  548  ACVVDMLGRAGMVERAYEFI-KRMPIRPTVSVWGALLGA  661
              ++D  G+   V R  EF+   M  R  VS W +L+ A
Sbjct  248  NGLIDFYGKCKKV-RCSEFVFGEMGERNVVS-WCSLVAA  284


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 126/260 (48%), Gaps = 10/260 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN  +W + ++    +   ++A++ F++ R+ G  P      + L+AC+      LG  
Sbjct  171  KRNLETWNAYMSNSVIDGRPKEAIEAFIEFRKIGGHPNSITFCAFLNACSDKLLLSLGEQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV ++  + +V V + L+D YGKC  +   E  F EM ERN+++W +L+  +  Q H
Sbjct  231  LHGLVFRSGFDRDVSVCNGLIDFYGKCKKVRCSEFVFGEMGERNVVSWCSLVAAFV-QNH  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFV-CVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             +    L    +RK  D+V      +   L+AC+    +E G  +  A   K  IE    
Sbjct  290  EDEKASLLYLRSRK--DIVETSEFMISSTLSACAGMAGLELGRSV-HAHAVKACIERSLF  346

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
              + +VDM G+ G +E + +    MP +  V++  +L+G     G+ ++     + +  +
Sbjct  347  VGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTL-NSLIGGYAHQGQVDMALALFEEMAPL  405

Query  722  DPQDSGNHVILSNMFASSGR  781
             P    N++   ++ ++  R
Sbjct  406  TP----NYMTFVSLLSACSR  421


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 78/184 (42%), Gaps = 5/184 (3%)
 Frame = +2

Query  137  VLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER  313
            +L      ++   GR +H  +VK       +F+ + LV+MY K    E      +  P R
Sbjct  12   LLKNAISTSSLRSGRVVHARIVKTLDSPPPLFLTNYLVNMYSKLDQPESARLVLHLEPSR  71

Query  314  NLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMD  493
            N+++W +L+ G    GH   A  LFE +  + + V PN  TF CV  + +      TG  
Sbjct  72   NVVSWTSLVSGLVQNGHYYSA--LFEFLEMRREGVFPNDFTFPCVFKSAALLRLPVTGKQ  129

Query  494  IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            I  A+  K G            DM  +  + + A +    MP R  +  W A +    + 
Sbjct  130  I-HALAVKCGRVMDVFVGCSAFDMYCKTRLRDDARKVFDEMPKR-NLETWNAYMSNSVID  187

Query  674  GKPE  685
            G+P+
Sbjct  188  GRPK  191



>gb|KFK43734.1| hypothetical protein AALP_AA1G165800 [Arabis alpina]
Length=842

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/276 (68%), Positives = 228/276 (83%), Gaps = 0/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSL+A Y QN   EKA  ++ ++R+E +E ++FM+SS LSACAG+A  ELGRSI
Sbjct  273  KNAVSWCSLVAAYVQNHEDEKASMLYRRSRKEIVETSDFMISSGLSACAGMAGLELGRSI  332

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG  VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  333  HGHAVKACVERTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTLNSLIGGYAHQGQV  392

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE M  + +   PNY+TFV +L+ACSRAGAVETGM IF++MK  Y IEPGAEHY
Sbjct  393  DMALALFEKMAPRGRGPSPNYMTFVSLLSACSRAGAVETGMKIFDSMKSIYSIEPGAEHY  452

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +CVVDMLGRAGMVERAYE IK+MPI+PT+SVWGAL  ACR+HGK  LG +AA+NLF++DP
Sbjct  453  SCVVDMLGRAGMVERAYELIKKMPIKPTISVWGALQNACRMHGKQHLGILAAENLFKLDP  512

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+EMK +GIKK
Sbjct  513  KDSGNHVLLSNTFAAAGRWAEANSVREEMKGVGIKK  548


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 96/219 (44%), Gaps = 4/219 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN VSW SL++    N     AL  F++ R +G+ P EF    V  A A L     G+ 
Sbjct  70   SRNVVSWTSLISGLVHNGHFSSALFEFIEMRRDGVFPNEFTFPCVFKATASLRVPFTGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L VK     +VF      DMY K    ED  + F E+PERNL TWNA +      G 
Sbjct  130  IHALAVKCGRILDVFGGCSCFDMYCKSRLKEDARKLFDEIPERNLETWNAFMSNSVMDGS  189

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  F +  R   +  PN +TF   L ACS    +  G  + + +  + G +     
Sbjct  190  FREAIGAFVEFRRIGGN--PNSITFCAFLNACSDGLLLSLGEQL-QGLMFRIGFDRDVSV  246

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
               ++D  G+   V  +      M  +  VS W +L+ A
Sbjct  247  CNGLIDFYGKCKQVRCSEVVFGEMGTKNAVS-WCSLVAA  284


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 116/259 (45%), Gaps = 4/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +    +A+  F++ R  G  P      + L+AC+      LG  
Sbjct  171  ERNLETWNAFMSNSVMDGSFREAIGAFVEFRRIGGNPNSITFCAFLNACSDGLLLSLGEQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            + GL+ +   + +V V + L+D YGKC  +   E  F EM  +N ++W +L+  Y  Q H
Sbjct  231  LQGLMFRIGFDRDVSVCNGLIDFYGKCKQVRCSEVVFGEMGTKNAVSWCSLVAAYV-QNH  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +    +    +RK + V  +       L+AC+    +E G  I      K  +E     
Sbjct  290  EDEKASMLYRRSRK-EIVETSDFMISSGLSACAGMAGLELGRSI-HGHAVKACVERTIFV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E + +    MP +  V++  +L+G     G+ ++     + +    
Sbjct  348  GSALVDMYGKCGCIEDSEQAFDEMPEKNLVTL-NSLIGGYAHQGQVDMALALFEKMAPRG  406

Query  725  PQDSGNHVILSNMFASSGR  781
               S N++   ++ ++  R
Sbjct  407  RGPSPNYMTFVSLLSACSR  425


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 69/165 (42%), Gaps = 5/165 (3%)
 Frame = +2

Query  164  AFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALI  340
            +  LGR +H  + K        F+ + L++ Y K    E         P RN+++W +LI
Sbjct  21   SMRLGRVVHARIFKTLDSPPPPFLANYLINFYSKLDKPESARIVLRLTPSRNVVSWTSLI  80

Query  341  GGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKY  520
             G  H GH + AL  F +M R    V PN  TF CV  A +      TG  I  A+  K 
Sbjct  81   SGLVHNGHFSSALFEFIEMRR--DGVFPNEFTFPCVFKATASLRVPFTGKQI-HALAVKC  137

Query  521  GIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
            G            DM  ++ + E A +    +P R  +  W A +
Sbjct  138  GRILDVFGGCSCFDMYCKSRLKEDARKLFDEIPER-NLETWNAFM  181



>gb|KEH43872.1| PPR containing plant-like protein [Medicago truncatula]
Length=684

 Score =   398 bits (1022),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/278 (67%), Positives = 230/278 (83%), Gaps = 1/278 (0%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + +N VSWCS+L    QN   E+A  VFL+ R+E +EPT+FM+SSVLSACA L   ELGR
Sbjct  272  NRKNVVSWCSMLTALVQNHEEERACMVFLQVRKE-VEPTDFMISSVLSACAELGGLELGR  330

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+H L VKACV++N+FV S LVD+YGKCG IE+ E+ F E+PE NL+TWNA+IGGYAHQG
Sbjct  331  SVHALAVKACVKDNIFVGSALVDLYGKCGSIENAEQVFSELPESNLVTWNAMIGGYAHQG  390

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              +MAL LFE+MT  ++ + P+YVT V +L+ CSR GAVE G+ IFE+M+  YGIEPGAE
Sbjct  391  DIDMALRLFEEMTLGSRGIRPSYVTLVSILSVCSRVGAVERGIQIFESMRLNYGIEPGAE  450

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            H+ACVVD+LGR+G+V+RAYEFI+ MPI+PT+SVWGALLGACR+HGK ELGKIAA+ LF++
Sbjct  451  HFACVVDLLGRSGLVDRAYEFIQNMPIQPTISVWGALLGACRMHGKTELGKIAAEKLFEL  510

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            D  DSGNHV+LSNM AS+GRWEEA +VRKEMKDIGIKK
Sbjct  511  DHVDSGNHVVLSNMLASAGRWEEATVVRKEMKDIGIKK  548


 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/218 (29%), Positives = 92/218 (42%), Gaps = 3/218 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R  V+W SL++    N     AL  F   R + ++P +F    V  A A +     G+ I
Sbjct  71   RTVVTWTSLISGCVHNRRFLPALLHFTNMRRDNVQPNDFTFPCVFKASALMQIPMTGKQI  130

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL +K  +  +VFV     DMY K G   D    F EMP RNL TWNA I        +
Sbjct  131  HGLALKGGMIYDVFVGCSCFDMYCKTGFHGDACNMFDEMPHRNLATWNAYISNAVQDRRS  190

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               +  F++      +  PN +TF   L AC     +  G  +  A   + G +      
Sbjct  191  LDVIAAFKEFLCVHGE--PNSITFCAFLNACVDMMRLNLGRQL-HAFIVRCGYKEDVSVA  247

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D  G+ G +  A     R+  R  V  W ++L A
Sbjct  248  NGLIDFYGKCGDIVSAEMVFSRIGNRKNVVSWCSMLTA  285


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 73/178 (41%), Gaps = 6/178 (3%)
 Frame = +2

Query  173  LGRSIHGLVVKACVEE-NVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGY  349
            LGR+IH  +++  V     F+ + LV+MY K   +   +        R ++TW +LI G 
Sbjct  24   LGRTIHAHIIRTHVTPLPSFLSNHLVNMYSKLDLLNSAQHVLSFTHLRTVVTWTSLISGC  83

Query  350  AHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIE  529
             H      AL  F +M R   +V PN  TF CV  A +      TG  I   +  K G+ 
Sbjct  84   VHNRRFLPALLHFTNMRR--DNVQPNDFTFPCVFKASALMQIPMTGKQI-HGLALKGGMI  140

Query  530  PGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAA  703
                      DM  + G    A      MP R  ++ W A +    V  +  L  IAA
Sbjct  141  YDVFVGCSCFDMYCKTGFHGDACNMFDEMPHR-NLATWNAYISNA-VQDRRSLDVIAA  196



>ref|XP_009394794.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Musa acuminata subsp. malaccensis]
Length=685

 Score =   394 bits (1012),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/276 (66%), Positives = 225/276 (82%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCS++ VY QN   E+A +V+L AR+EGI PT+F+VSSVL+ CAGL+  +LGRS+
Sbjct  275  KNDVSWCSMVVVYAQNGAEEEAFRVYLDARKEGIRPTDFIVSSVLTTCAGLSGLDLGRSL  334

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   +++C+  N+FV S LVDMYGKCG I D E+AF EMPERNLI+WNALIGGY   G+A
Sbjct  335  HAAAIRSCINGNIFVGSALVDMYGKCGSIRDAEQAFEEMPERNLISWNALIGGYTQLGNA  394

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL +F++M     +V P+YVT V V+TACSR G  + G+D+FE MK+++GIEP  EHY
Sbjct  395  HMALTVFDEMI-GCGEVAPSYVTLVNVITACSRGGLTKEGLDLFETMKERFGIEPRLEHY  453

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM ERAYEFIK MPIRP++S+WGALLGACR+HGK  LG+IAA  LF+IDP
Sbjct  454  ACVVDLLGRAGMEERAYEFIKTMPIRPSISIWGALLGACRLHGKTALGRIAAHKLFEIDP  513

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNMFAS+GRW EA  VRKEMKD+GIKK
Sbjct  514  QDSGNHVLLSNMFASAGRWVEATEVRKEMKDVGIKK  549


 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 123/262 (47%), Gaps = 11/262 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN V+W +++     +   ++A+K F+K R  G  P    + + L+ACAG +   LG  
Sbjct  173  QRNIVAWNAVMTNAVFDGRPDEAIKAFIKLRLHGGIPNTISLCAFLNACAGASYSSLGSQ  232

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  ++++  + +V V + L+D YGKC  + +    F EM  +N ++W +++  YA  G 
Sbjct  233  LHAFMIQSGFDLDVSVGNGLIDFYGKCHWVHEARAVFDEMHIKNDVSWCSMVVVYAQNGA  292

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  ++ D   + + + P       VLT C+    ++ G  +  A   +  I      
Sbjct  293  EEEAFRVYLDA--RKEGIRPTDFIVSSVLTTCAGLSGLDLGRSL-HAAAIRSCINGNIFV  349

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF---  715
             + +VDM G+ G +  A +  + MP R  +S W AL+G     G   +     D +    
Sbjct  350  GSALVDMYGKCGSIRDAEQAFEEMPERNLIS-WNALIGGYTQLGNAHMALTVFDEMIGCG  408

Query  716  QIDPQDSGNHVILSNMFASSGR  781
            ++ P    ++V L N+  +  R
Sbjct  409  EVAP----SYVTLVNVITACSR  426


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 87/207 (42%), Gaps = 3/207 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W +L++   QN     AL  F       + P +F   S   A A      +GR IH  
Sbjct  76   VTWTALISGSAQNGRPLSALAHFAAMLRASVRPNDFTFPSAFKAAAAARKPLVGRQIHAS  135

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
              K+ + ++ FV    +DMY K G   D    F EMP+RN++ WNA++      G  + A
Sbjct  136  SFKSGLIDDAFVACGALDMYYKTGLTFDARILFDEMPQRNIVAWNAVMTNAVFDGRPDEA  195

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +  F  +  +    +PN ++    L AC+ A     G  +  A   + G +        +
Sbjct  196  IKAFIKL--RLHGGIPNTISLCAFLNACAGASYSSLGSQL-HAFMIQSGFDLDVSVGNGL  252

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVS  637
            +D  G+   V  A      M I+  VS
Sbjct  253  IDFYGKCHWVHEARAVFDEMHIKNDVS  279


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 71/174 (41%), Gaps = 6/174 (3%)
 Frame = +2

Query  170  ELGRSIHGLVVKACVEENV--FVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIG  343
             LGR+ H   VK      +  F+ + LV+MY K              P+ +++TW ALI 
Sbjct  24   RLGRAAHATAVKHLSPRPLPAFLSNHLVNMYSKLDLPTAAATLLSLDPDPSVVTWTALIS  83

Query  344  GYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYG  523
            G A  G    AL  F  M R +  V PN  TF     A + A     G  I  A   K G
Sbjct  84   GSAQNGRPLSALAHFAAMLRAS--VRPNDFTFPSAFKAAAAARKPLVGRQI-HASSFKSG  140

Query  524  IEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +   A      +DM  + G+   A      MP R  V+ W A++      G+P+
Sbjct  141  LIDDAFVACGALDMYYKTGLTFDARILFDEMPQRNIVA-WNAVMTNAVFDGRPD  193



>emb|CDY06488.1| BnaC06g11560D [Brassica napus]
Length=581

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 181/277 (65%), Positives = 222/277 (80%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN  +W + L+     D  EKA  +FL++R+E ++ ++FM+SS LSACAG+A  ELGRS
Sbjct  171  HRNLATWNAFLSNSNHED--EKASLLFLRSRKEIVQTSDFMISSTLSACAGMAGLELGRS  228

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG 
Sbjct  229  VHAHAVKACVESTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTMNSLIGGYAHQGQ  288

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             +MAL LF+ M  +     PNY+TFV VL+ACSRAG VE GM IF++MK  YGIEPGAEH
Sbjct  289  VDMALALFDQMAPRGSGPAPNYMTFVSVLSACSRAGDVENGMKIFDSMKSCYGIEPGAEH  348

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y+CVVDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+H KP LG +AA+NLF++D
Sbjct  349  YSCVVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHSKPHLGVLAAENLFKLD  408

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSGNHV+LSN FA++GRW EAN VR+EMK +GIKK
Sbjct  409  PKDSGNHVLLSNTFAAAGRWAEANTVREEMKGVGIKK  445


 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 120/263 (46%), Gaps = 14/263 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN VSW SL++   QN     AL  FL+ R EG+ P +F       A A L +   G+ 
Sbjct  70   SRNVVSWTSLVSGLVQNGHFSSALLEFLEMRREGVFPNDFTFPCAFKAAASLRSPVTGKQ  129

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L VK     +VFV     DMY K     D  + F E+P RNL TWNA +    H+  
Sbjct  130  IHALSVKCGRILDVFVGCSAFDMYCKTKLRGDARKMFDEIPHRNLATWNAFLSNSNHEDE  189

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFV-CVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                L L     R  +++V      +   L+AC+    +E G  +  A   K  +E    
Sbjct  190  KASLLFL-----RSRKEIVQTSDFMISSTLSACAGMAGLELGRSV-HAHAVKACVESTIF  243

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
              + +VDM G+ G +E + +    MP +  V++  +L+G     G+ ++     D   Q+
Sbjct  244  VGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTM-NSLIGGYAHQGQVDMALALFD---QM  299

Query  722  DPQDSG---NHVILSNMFASSGR  781
             P+ SG   N++   ++ ++  R
Sbjct  300  APRGSGPAPNYMTFVSVLSACSR  322


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 75/177 (42%), Gaps = 5/177 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEM  304
            + S+L      ++  LGR +H  +VK        F+ + L++MY K    +         
Sbjct  9    LGSLLGNAISTSSMRLGRVVHARIVKTLDSPPPPFLANYLINMYSKLDHPDSARLLLRLT  68

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
            P RN+++W +L+ G    GH + AL  F +M R  + V PN  TF C   A +   +  T
Sbjct  69   PSRNVVSWTSLVSGLVQNGHFSSALLEFLEMRR--EGVFPNDFTFPCAFKAAASLRSPVT  126

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
            G  I  A+  K G            DM  +  +   A +    +P R  ++ W A L
Sbjct  127  GKQI-HALSVKCGRILDVFVGCSAFDMYCKTKLRGDARKMFDEIPHR-NLATWNAFL  181



>ref|XP_006651923.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like, 
partial [Oryza brachyantha]
Length=663

 Score =   385 bits (989),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 222/276 (80%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++A Y QN   E+A  V+ +AR  G EPTEFM+S VL+ CAGL   +LGR++
Sbjct  253  RNSVSWCSMIAAYAQNGAEEEAFAVYQRARCAGEEPTEFMISCVLTTCAGLLGLDLGRTL  312

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCGC+ED E+ F+E+P+RNL+TWNA++GGYAH G A
Sbjct  313  HAVAVRSCIDANIFVASALVDMYGKCGCVEDAEQIFFEIPQRNLVTWNAMVGGYAHIGDA  372

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F+DM R + +  PNY+T V V+TACSR G  + G ++FE MK+K+GIEP  EHY
Sbjct  373  QNALSVFDDMIR-SGETAPNYITLVNVITACSRGGLTKEGYELFETMKEKFGIEPRIEHY  431

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM ERAYE I  MPIRP++SVWGALLGAC++HGK ELG+IAA+ LF++DP
Sbjct  432  ACVVDLLGRAGMEERAYEVICGMPIRPSISVWGALLGACKMHGKTELGRIAAEKLFELDP  491

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QD GNHV+LSNMFAS+GRW EA  +RKEMK++GIKK
Sbjct  492  QDPGNHVLLSNMFASAGRWAEATYIRKEMKNVGIKK  527


 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/259 (26%), Positives = 115/259 (44%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN V+W +++     +    + ++ +    E G  P    V +  +ACAG     LG  
Sbjct  151  NRNVVAWNAVMTNAVLDGRPLETIEAYFGLWEAGGLPNVVSVCAFFNACAGAMFLSLGEQ  210

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG  VK   E +V V + +VD YGKC C       F  M  RN ++W ++I  YA  G 
Sbjct  211  FHGFAVKCGFEMDVSVLNSMVDFYGKCRCAGKARLVFDGMGVRNSVSWCSMIAAYAQNGA  270

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  +++      ++  P      CVLT C+    ++ G  +  A+  +  I+     
Sbjct  271  EEEAFAVYQRARCAGEE--PTEFMISCVLTTCAGLLGLDLGRTL-HAVAVRSCIDANIFV  327

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G VE A +    +P R  V+ W A++G     G  +      D++ +  
Sbjct  328  ASALVDMYGKCGCVEDAEQIFFEIPQRNLVT-WNAMVGGYAHIGDAQNALSVFDDMIR-S  385

Query  725  PQDSGNHVILSNMFASSGR  781
             + + N++ L N+  +  R
Sbjct  386  GETAPNYITLVNVITACSR  404


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 92/225 (41%), Gaps = 6/225 (3%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFE-LGRSIHG  193
            VS+ + ++   Q+     AL  F      G+ P +F   S   A A       +G  IH 
Sbjct  52   VSFTAFISGAAQHARPLPALSAFAGMLRLGLRPNDFTFPSAFKAAASAPPRSTIGPQIHS  111

Query  194  LVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
            L +K   +  + FV    +DMY K G +      F EMP RN++ WNA++      G   
Sbjct  112  LAIKFGYLPGDPFVSCAALDMYFKTGRLMLARHLFGEMPNRNVVAWNAVMTNAVLDGRPL  171

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
              ++ +  +       +PN V+      AC+ A  +  G + F     K G E       
Sbjct  172  ETIEAYFGLWEAGG--LPNVVSVCAFFNACAGAMFLSLG-EQFHGFAVKCGFEMDVSVLN  228

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
             +VD  G+     +A      M +R +VS W +++ A   +G  E
Sbjct  229  SMVDFYGKCRCAGKARLVFDGMGVRNSVS-WCSMIAAYAQNGAEE  272



>gb|EAZ18852.1| hypothetical protein OsJ_34389 [Oryza sativa Japonica Group]
Length=587

 Score =   383 bits (983),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 221/276 (80%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++A Y QN   E+A   +L AR  G EPT+FMVSS L+ CAGL    LGR++
Sbjct  177  RNSVSWCSMVAAYAQNGAEEEAFAAYLGARRSGEEPTDFMVSSALTTCAGLLGLHLGRAL  236

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCGC+ED E+ FYE P+RNL+TWNA+IGGYAH G A
Sbjct  237  HAVAVRSCIDANIFVASALVDMYGKCGCVEDAEQIFYETPQRNLVTWNAMIGGYAHIGDA  296

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F+DM R + +  PNY+T V V+T+CSR G  + G ++FE M++++GIEP  EHY
Sbjct  297  QNALLVFDDMIR-SGETAPNYITLVNVITSCSRGGLTKDGYELFETMRERFGIEPRTEHY  355

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM E+AYE I+ MP+RP++SVWGALLGAC++HGK ELG+IAA+ LF++DP
Sbjct  356  ACVVDLLGRAGMEEQAYEVIQGMPMRPSISVWGALLGACKMHGKTELGRIAAEKLFELDP  415

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNMFAS+GRW EA  +RKEMK++GIKK
Sbjct  416  QDSGNHVLLSNMFASAGRWAEATDIRKEMKNVGIKK  451


 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/259 (26%), Positives = 112/259 (43%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN V+W +++     +    + ++ +   RE G  P      +  +ACAG     LG  
Sbjct  75   NRNVVAWNAVMTNAVLDGRPLETIEAYFGLREAGGLPNVVSACAFFNACAGAMYLSLGEQ  134

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG VVK   E +V V + +VD YGKC C       F  M  RN ++W +++  YA  G 
Sbjct  135  FHGFVVKCGFEMDVSVLNSMVDFYGKCRCAGKARAVFDGMGVRNSVSWCSMVAAYAQNGA  194

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A   +    R  ++  P        LT C+    +  G  +  A+  +  I+     
Sbjct  195  EEEAFAAYLGARRSGEE--PTDFMVSSALTTCAGLLGLHLGRAL-HAVAVRSCIDANIFV  251

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G VE A +     P R  V+ W A++G     G  +   +  D++ +  
Sbjct  252  ASALVDMYGKCGCVEDAEQIFYETPQRNLVT-WNAMIGGYAHIGDAQNALLVFDDMIR-S  309

Query  725  PQDSGNHVILSNMFASSGR  781
             + + N++ L N+  S  R
Sbjct  310  GETAPNYITLVNVITSCSR  328


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 83/196 (42%), Gaps = 6/196 (3%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFE-LGRSIHGLVVK-ACVEENVFVRSVLVDMYGKCGCIE  277
            G+ P +F   S   A A       +G  IH L ++   +  + FV    +DMY K G ++
Sbjct  5    GLRPNDFTFPSAFKAAASAPPRSTIGPQIHSLAIRFGYLPVDPFVSCAALDMYFKTGRLK  64

Query  278  DCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTA  457
                 F EMP RN++ WNA++      G     ++ +  +  +    +PN V+      A
Sbjct  65   LARHLFGEMPNRNVVAWNAVMTNAVLDGRPLETIEAYFGL--REAGGLPNVVSACAFFNA  122

Query  458  CSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVS  637
            C+ A  +  G + F     K G E        +VD  G+     +A      M +R +VS
Sbjct  123  CAGAMYLSLG-EQFHGFVVKCGFEMDVSVLNSMVDFYGKCRCAGKARAVFDGMGVRNSVS  181

Query  638  VWGALLGACRVHGKPE  685
             W +++ A   +G  E
Sbjct  182  -WCSMVAAYAQNGAEE  196



>ref|NP_001068161.1| Os11g0583200 [Oryza sativa Japonica Group]
 dbj|BAF28524.1| Os11g0583200 [Oryza sativa Japonica Group]
Length=703

 Score =   385 bits (990),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 221/276 (80%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++A Y QN   E+A   +L AR  G EPT+FMVSS L+ CAGL    LGR++
Sbjct  284  RNSVSWCSMVAAYAQNGAEEEAFAAYLGARRSGEEPTDFMVSSALTTCAGLLGLHLGRAL  343

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCGC+ED E+ FYE P+RNL+TWNA+IGGYAH G A
Sbjct  344  HAVAVRSCIDANIFVASALVDMYGKCGCVEDAEQIFYETPQRNLVTWNAMIGGYAHIGDA  403

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F+DM R + +  PNY+T V V+T+CSR G  + G ++FE M++++GIEP  EHY
Sbjct  404  QNALLVFDDMIR-SGETAPNYITLVNVITSCSRGGLTKDGYELFETMRERFGIEPRTEHY  462

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM E+AYE I+ MP+RP++SVWGALLGAC++HGK ELG+IAA+ LF++DP
Sbjct  463  ACVVDLLGRAGMEEQAYEVIQGMPMRPSISVWGALLGACKMHGKTELGRIAAEKLFELDP  522

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNMFAS+GRW EA  +RKEMK++GIKK
Sbjct  523  QDSGNHVLLSNMFASAGRWAEATDIRKEMKNVGIKK  558


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 67/259 (26%), Positives = 112/259 (43%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN V+W +++     +    + ++ +   RE G  P      +  +ACAG     LG  
Sbjct  182  NRNVVAWNAVMTNAVLDGRPLETIEAYFGLREAGGLPNVVSACAFFNACAGAMYLSLGEQ  241

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG VVK   E +V V + +VD YGKC C       F  M  RN ++W +++  YA  G 
Sbjct  242  FHGFVVKCGFEMDVSVLNSMVDFYGKCRCAGKARAVFDGMGVRNSVSWCSMVAAYAQNGA  301

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A   +    R  ++  P        LT C+    +  G  +  A+  +  I+     
Sbjct  302  EEEAFAAYLGARRSGEE--PTDFMVSSALTTCAGLLGLHLGRAL-HAVAVRSCIDANIFV  358

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G VE A +     P R  V+ W A++G     G  +   +  D++ +  
Sbjct  359  ASALVDMYGKCGCVEDAEQIFYETPQRNLVT-WNAMIGGYAHIGDAQNALLVFDDMIR-S  416

Query  725  PQDSGNHVILSNMFASSGR  781
             + + N++ L N+  S  R
Sbjct  417  GETAPNYITLVNVITSCSR  435


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/225 (25%), Positives = 94/225 (42%), Gaps = 6/225 (3%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFE-LGRSIHG  193
            VS+ + ++   Q+     AL  F      G+ P +F   S   A A       +G  IH 
Sbjct  83   VSYTAFISGAAQHGRPLPALSAFAGMLRLGLRPNDFTFPSAFKAAASAPPRSTIGPQIHS  142

Query  194  LVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
            L ++   +  + FV    +DMY K G ++     F EMP RN++ WNA++      G   
Sbjct  143  LAIRFGYLPVDPFVSCAALDMYFKTGRLKLARHLFGEMPNRNVVAWNAVMTNAVLDGRPL  202

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
              ++ +  +  +    +PN V+      AC+ A  +  G + F     K G E       
Sbjct  203  ETIEAYFGL--REAGGLPNVVSACAFFNACAGAMYLSLG-EQFHGFVVKCGFEMDVSVLN  259

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
             +VD  G+     +A      M +R +VS W +++ A   +G  E
Sbjct  260  SMVDFYGKCRCAGKARAVFDGMGVRNSVS-WCSMVAAYAQNGAEE  303



>gb|ABA94388.1| PPR986-12, putative, expressed [Oryza sativa Japonica Group]
Length=694

 Score =   384 bits (985),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 221/276 (80%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++A Y QN   E+A   +L AR  G EPT+FMVSS L+ CAGL    LGR++
Sbjct  284  RNSVSWCSMVAAYAQNGAEEEAFAAYLGARRSGEEPTDFMVSSALTTCAGLLGLHLGRAL  343

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCGC+ED E+ FYE P+RNL+TWNA+IGGYAH G A
Sbjct  344  HAVAVRSCIDANIFVASALVDMYGKCGCVEDAEQIFYETPQRNLVTWNAMIGGYAHIGDA  403

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F+DM R + +  PNY+T V V+T+CSR G  + G ++FE M++++GIEP  EHY
Sbjct  404  QNALLVFDDMIR-SGETAPNYITLVNVITSCSRGGLTKDGYELFETMRERFGIEPRTEHY  462

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM E+AYE I+ MP+RP++SVWGALLGAC++HGK ELG+IAA+ LF++DP
Sbjct  463  ACVVDLLGRAGMEEQAYEVIQGMPMRPSISVWGALLGACKMHGKTELGRIAAEKLFELDP  522

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNMFAS+GRW EA  +RKEMK++GIKK
Sbjct  523  QDSGNHVLLSNMFASAGRWAEATDIRKEMKNVGIKK  558


 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 67/259 (26%), Positives = 112/259 (43%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN V+W +++     +    + ++ +   RE G  P      +  +ACAG     LG  
Sbjct  182  NRNVVAWNAVMTNAVLDGRPLETIEAYFGLREAGGLPNVVSACAFFNACAGAMYLSLGEQ  241

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG VVK   E +V V + +VD YGKC C       F  M  RN ++W +++  YA  G 
Sbjct  242  FHGFVVKCGFEMDVSVLNSMVDFYGKCRCAGKARAVFDGMGVRNSVSWCSMVAAYAQNGA  301

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A   +    R  ++  P        LT C+    +  G  +  A+  +  I+     
Sbjct  302  EEEAFAAYLGARRSGEE--PTDFMVSSALTTCAGLLGLHLGRAL-HAVAVRSCIDANIFV  358

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G VE A +     P R  V+ W A++G     G  +   +  D++ +  
Sbjct  359  ASALVDMYGKCGCVEDAEQIFYETPQRNLVT-WNAMIGGYAHIGDAQNALLVFDDMIR-S  416

Query  725  PQDSGNHVILSNMFASSGR  781
             + + N++ L N+  S  R
Sbjct  417  GETAPNYITLVNVITSCSR  435


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/225 (25%), Positives = 94/225 (42%), Gaps = 6/225 (3%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFE-LGRSIHG  193
            VS+ + ++   Q+     AL  F      G+ P +F   S   A A       +G  IH 
Sbjct  83   VSYTAFISGAAQHGRPLPALSAFAGMLRLGLRPNDFTFPSAFKAAASAPPRSTIGPQIHS  142

Query  194  LVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
            L ++   +  + FV    +DMY K G ++     F EMP RN++ WNA++      G   
Sbjct  143  LAIRFGYLPVDPFVSCAALDMYFKTGRLKLARHLFGEMPNRNVVAWNAVMTNAVLDGRPL  202

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
              ++ +  +  +    +PN V+      AC+ A  +  G + F     K G E       
Sbjct  203  ETIEAYFGL--REAGGLPNVVSACAFFNACAGAMYLSLG-EQFHGFVVKCGFEMDVSVLN  259

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
             +VD  G+     +A      M +R +VS W +++ A   +G  E
Sbjct  260  SMVDFYGKCRCAGKARAVFDGMGVRNSVS-WCSMVAAYAQNGAEE  303



>ref|XP_004980647.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Setaria italica]
Length=695

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/276 (62%), Positives = 220/276 (80%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWC ++  Y QN   E+A  V+L+AR  G EPT+FMVSSVL+ CAGL   +LGR++
Sbjct  285  RNSVSWCCMVVAYAQNGGEEEAFSVYLRARRAGEEPTDFMVSSVLTTCAGLLGLDLGRAL  344

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCG IED E+ F+EMP+RNL+TWNA++GGYAH G A
Sbjct  345  HAVAVRSCIDANIFVASALVDMYGKCGGIEDAEQVFFEMPQRNLVTWNAMVGGYAHIGDA  404

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F+DM  K  +  PNY+T V VL ACSR G  + G ++F+ M D++GI+P  EHY
Sbjct  405  RNALAVFDDMI-KCGETAPNYITLVNVLAACSRGGLTKEGYELFKTMNDRFGIKPQIEHY  463

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM E+AYE I+ MP+RP++SVWGALLGAC++HGK ELGKIAA+ LF++DP
Sbjct  464  ACVVDLLGRAGMEEQAYEIIQGMPMRPSISVWGALLGACKMHGKTELGKIAAEKLFELDP  523

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNMFAS+GRW EA  VRKEMK++GIKK
Sbjct  524  QDSGNHVLLSNMFASAGRWAEATDVRKEMKNVGIKK  559


 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 127/280 (45%), Gaps = 9/280 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN V+W +++     +    + ++ +   RE G  P    V +  +ACAG     LG  
Sbjct  183  NRNVVAWNAVMTNALLDGRPLETVEAYFGLREAGGMPNVVSVCAFFNACAGATYLSLGEQ  242

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG VVK  +E +V V + +VD YGKC C+   +  F  M  RN ++W  ++  YA  G 
Sbjct  243  FHGFVVKCGLERDVSVSNSMVDFYGKCRCVGKAKVVFDGMGVRNSVSWCCMVVAYAQNGG  302

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  ++    R  ++  P       VLT C+    ++ G  +  A+  +  I+     
Sbjct  303  EEEAFSVYLRARRAGEE--PTDFMVSSVLTTCAGLLGLDLGRAL-HAVAVRSCIDANIFV  359

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A +    MP R  V+ W A++G     G         D++ +  
Sbjct  360  ASALVDMYGKCGGIEDAEQVFFEMPQRNLVT-WNAMVGGYAHIGDARNALAVFDDMIKCG  418

Query  725  PQDSGNHVILSNMFASSGR---WEEANLVRKEMKD-IGIK  832
             + + N++ L N+ A+  R    +E   + K M D  GIK
Sbjct  419  -ETAPNYITLVNVLAACSRGGLTKEGYELFKTMNDRFGIK  457


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 88/209 (42%), Gaps = 5/209 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFEL-GRSIHG  193
            VS+ + ++   ++     AL  F      G+ P +F   S   A A        G  +H 
Sbjct  84   VSYTAFISGAAKHGRPAPALSAFAAMLRLGLRPNDFTFPSAFKAAAIAPPSSAIGPQVHS  143

Query  194  LVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
            L ++   + ++ FV    +DMY K G +    R F EMP RN++ WNA++      G   
Sbjct  144  LALRFGYLPDDAFVSCAALDMYFKTGRLALARRLFEEMPNRNVVAWNAVMTNALLDGRPL  203

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
              ++ +  +  +    +PN V+      AC+ A  +  G + F     K G+E       
Sbjct  204  ETVEAYFGL--REAGGMPNVVSVCAFFNACAGATYLSLG-EQFHGFVVKCGLERDVSVSN  260

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVS  637
             +VD  G+   V +A      M +R +VS
Sbjct  261  SMVDFYGKCRCVGKAKVVFDGMGVRNSVS  289



>gb|EMT05102.1| hypothetical protein F775_08604 [Aegilops tauschii]
Length=650

 Score =   375 bits (963),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 218/276 (79%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++  Y QN   E A  V+L AR  G EPT+FMVSSVL+ CAGL   +LGR++
Sbjct  122  RNSVSWCSMVVAYAQNGAEEDAFAVYLGARRAGEEPTDFMVSSVLTTCAGLLGLDLGRAL  181

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCG +ED +  F +MP+RNL+TWNA+IGG+A+ G A
Sbjct  182  HAVAVRSCIDANIFVASALVDMYGKCGGVEDAQHVFSDMPQRNLVTWNAMIGGHANIGDA  241

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F DM   + +  PNY+T V V+TACSR G  + G ++FE M++++GIEP  EHY
Sbjct  242  INALAVFSDMI-ASGETAPNYITLVNVITACSRGGLTKEGYELFETMRERFGIEPRTEHY  300

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM ERAYE I+RMP+RP++S+WGALLGAC++HGK ELG+IAA+ LF++DP
Sbjct  301  ACVVDLLGRAGMEERAYEIIQRMPMRPSISLWGALLGACKMHGKTELGRIAAEKLFELDP  360

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNM AS+GRW EA  VRKEMKD+GIKK
Sbjct  361  QDSGNHVLLSNMLASAGRWAEATYVRKEMKDVGIKK  396


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 100/217 (46%), Gaps = 4/217 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN V+W +++     +    + ++ +   RE G  P    V +  +ACAG      G   
Sbjct  21   RNVVAWNAVMTNAVLDGRPLETVQAYFGLREAGGMPNVVSVCAFFNACAGALLLLPGSQF  80

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG VVK   + +V V + +VD YGKC C E  +  F  M  RN ++W +++  YA  G  
Sbjct  81   HGFVVKCGFDMDVSVSNAMVDFYGKCRCAEKAKMVFDAMRVRNSVSWCSMVVAYAQNGAE  140

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A  ++    R  ++  P       VLT C+    ++ G  +  A+  +  I+      
Sbjct  141  EDAFAVYLGARRAGEE--PTDFMVSSVLTTCAGLLGLDLGRAL-HAVAVRSCIDANIFVA  197

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
            + +VDM G+ G VE A      MP R  V+ W A++G
Sbjct  198  SALVDMYGKCGGVEDAQHVFSDMPQRNLVT-WNAMIG  233



>emb|CAB10264.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78527.1| hypothetical protein [Arabidopsis thaliana]
Length=587

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/276 (64%), Positives = 218/276 (79%), Gaps = 19/276 (7%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSWCSL+A Y QN   EKA  ++L++R++ +E ++FM+SSVLSACAG+A  ELGRSI
Sbjct  195  KNAVSWCSLVAAYVQNHEDEKASVLYLRSRKDIVETSDFMISSVLSACAGMAGLELGRSI  254

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VKACVE  +FV S LVDMYGKCGCIED E+AF EMPE+NL+T N+LIGGYAHQG  
Sbjct  255  HAHAVKACVERTIFVGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTRNSLIGGYAHQGQV  314

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            +MAL LFE+M  +                 C   GAVE GM IF++M+  YGIEPGAEHY
Sbjct  315  DMALALFEEMAPR----------------GC---GAVENGMKIFDSMRSTYGIEPGAEHY  355

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +C+VDMLGRAGMVERAYEFIK+MPI+PT+SVWGAL  ACR+HGKP+LG +AA+NLF++DP
Sbjct  356  SCIVDMLGRAGMVERAYEFIKKMPIQPTISVWGALQNACRMHGKPQLGLLAAENLFKLDP  415

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DSGNHV+LSN FA++GRW EAN VR+E+K +GIKK
Sbjct  416  KDSGNHVLLSNTFAAAGRWAEANTVREELKGVGIKK  451


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 72/163 (44%), Gaps = 16/163 (10%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW SL++   QN     AL  F + R E +      V+              G+ I
Sbjct  21   RNVVSWTSLISGLAQNGHFSTALVEFFEMRREAVASLRLPVT--------------GKQI  66

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK     +VFV     DMY K    +D  + F E+PERNL TWNA I      G  
Sbjct  67   HALAVKCGRILDVFVGCSAFDMYCKTRLRDDARKLFDEIPERNLETWNAFISNSVTDGRP  126

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
              A++ F +  R   D  PN +TF   L ACS    +  GM +
Sbjct  127  REAIEAFIEFRR--IDGHPNSITFCAFLNACSDWLHLNLGMQL  167


 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 55/230 (24%), Positives = 101/230 (44%), Gaps = 20/230 (9%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  +W + ++    +    +A++ F++ R     P      + L+AC+      LG  
Sbjct  107  ERNLETWNAFISNSVTDGRPREAIEAFIEFRRIDGHPNSITFCAFLNACSDWLHLNLGMQ  166

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGLV+++  + +V +RS               E  F EM  +N ++W +L+  Y     
Sbjct  167  LHGLVLRSGFDTDVSIRS--------------SEIIFTEMGTKNAVSWCSLVAAYVQNHE  212

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFV-CVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
               A  L+    R  +D+V      +  VL+AC+    +E G  I  A   K  +E    
Sbjct  213  DEKASVLY---LRSRKDIVETSDFMISSVLSACAGMAGLELGRSI-HAHAVKACVERTIF  268

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELG  691
              + +VDM G+ G +E + +    MP +  V+   +L+G     G+ ++ 
Sbjct  269  VGSALVDMYGKCGCIEDSEQAFDEMPEKNLVTR-NSLIGGYAHQGQVDMA  317



>gb|EPS73044.1| hypothetical protein M569_01710 [Genlisea aurea]
Length=684

 Score =   374 bits (960),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/279 (63%), Positives = 217/279 (78%), Gaps = 4/279 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R  VSW ++LA+YEQN +GEKA ++FL+A   G EPTEFM+S+ +SACAGLAA E G++
Sbjct  272  DRTTVSWSTMLAIYEQNHMGEKACELFLEATRAGFEPTEFMLSAAISACAGLAALESGKA  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H L VKA VE +V+V S LVDMYGKCG ++DCERAF +M  RN + WNA+IG YAHQG 
Sbjct  332  AHALAVKARVEGSVYVGSALVDMYGKCGSVDDCERAFQQMRSRNSVCWNAMIGAYAHQGR  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  AL LF  M    +   PNYVTFV VL  CSR+G V+ GM IF  M   YGI PGAEH
Sbjct  392  AESALRLFRRM--GGEGARPNYVTFVSVLAGCSRSGMVDEGMAIFSEMTPVYGIRPGAEH  449

Query  545  YACVVDMLGRAGMVERAYEFIKRM--PIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            YAC+VDMLGRAG VERA+  I+ M   I PT+S+WGALLGAC++HGKPELGK+AA+NLF+
Sbjct  450  YACIVDMLGRAGQVERAHRIIEEMMPDIPPTISIWGALLGACKMHGKPELGKVAAENLFR  509

Query  719  IDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DP DSGNHV+LSNM A+ GRW+EA+LVR+EMKD+GIKK
Sbjct  510  LDPMDSGNHVLLSNMLAAEGRWDEASLVREEMKDVGIKK  548


 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 104/224 (46%), Gaps = 16/224 (7%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D R+ V W +L+A   QN     A+      R +GI+P +F +  +  A A L +  LG+
Sbjct  71   DSRSVVIWTALIAGNIQNGHSASAISNLADMRRDGIQPNDFTLPCLFKAAAALRSPLLGQ  130

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H L +K  +  + FV     DMY K G ++D  + F EMP RN+ TWNA I       
Sbjct  131  QLHDLSIKLLLIHDAFVACSAFDMYSKTGLLQDAGKMFDEMPRRNIATWNAAISN-----  185

Query  362  HANMALDLFEDMTR-----KTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
                A D  E ++R     +T D  PN ++    LTACS AG ++ G  +   +  K G 
Sbjct  186  ----AADPPESISRYIALLRTGDASPNSISLCASLTACSAAGFLQEGQQLHGHLV-KQGH  240

Query  527  EPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
            +        +VD  G+   V+ +      +  R TVS W  +L 
Sbjct  241  DADTSVLNTLVDFYGKCRHVDHSERVFHSIRDRTTVS-WSTMLA  283


 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 104/227 (46%), Gaps = 6/227 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN  +W +  A+    D  E   +     R     P    + + L+AC+     + G+ 
Sbjct  173  RRNIATWNA--AISNAADPPESISRYIALLRTGDASPNSISLCASLTACSAAGFLQEGQQ  230

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG +VK   + +  V + LVD YGKC  ++  ER F+ + +R  ++W+ ++  Y     
Sbjct  231  LHGHLVKQGHDADTSVLNTLVDFYGKCRHVDHSERVFHSIRDRTTVSWSTMLAIYEQNHM  290

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A +LF + TR   +  P        ++AC+   A+E+G     A+  K  +E     
Sbjct  291  GEKACELFLEATRAGFE--PTEFMLSAAISACAGLAALESG-KAAHALAVKARVEGSVYV  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
             + +VDM G+ G V+      ++M  R +V  W A++GA    G+ E
Sbjct  348  GSALVDMYGKCGSVDDCERAFQQMRSRNSV-CWNAMIGAYAHQGRAE  393



>ref|XP_008667737.1| PREDICTED: uncharacterized protein LOC100278220 isoform X4 [Zea 
mays]
 ref|XP_008667738.1| PREDICTED: uncharacterized protein LOC100278220 isoform X4 [Zea 
mays]
 ref|XP_008667739.1| PREDICTED: uncharacterized protein LOC100278220 isoform X4 [Zea 
mays]
 ref|XP_008667740.1| PREDICTED: uncharacterized protein LOC100278220 isoform X4 [Zea 
mays]
 tpg|DAA42180.1| TPA: hypothetical protein ZEAMMB73_073969 [Zea mays]
Length=696

 Score =   374 bits (960),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 218/276 (79%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++  Y QN   E+A  V+L AR  G EPT+FMVSSVL+ CAGL   +LGR++
Sbjct  286  RNNVSWCSMVVAYAQNGAEEEAFFVYLGARRAGEEPTDFMVSSVLTTCAGLLGLDLGRAL  345

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCG IED E+ F+EMP+RNL+TWNA+IGGYAH G A
Sbjct  346  HAVAVRSCIDSNIFVASALVDMYGKCGGIEDAEQVFFEMPQRNLVTWNAMIGGYAHIGDA  405

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            + AL +F+ M    Q+  PNY+T V VLTACSR G  + G ++F+ MK ++GIEP  EHY
Sbjct  406  HNALSVFDKMI-MGQETAPNYITLVNVLTACSRGGLTKEGYELFQTMKWRFGIEPRIEHY  464

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+L RAGM ERAY+ I+ MP+RP++SVWGALLG C++HGK ELG+IAA+ LF++DP
Sbjct  465  ACVVDLLCRAGMEERAYKIIQGMPMRPSISVWGALLGGCKMHGKTELGRIAAEKLFELDP  524

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNM AS+GRW EA  VRKEMK++GIKK
Sbjct  525  QDSGNHVLLSNMLASAGRWAEATDVRKEMKNVGIKK  560


 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 114/259 (44%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN V+W +++     +    + ++ +   R  G  P    V +  +ACAG+    LG  
Sbjct  184  NRNVVAWNAVMTNAVLDGRPLETVEAYFGLRGAGGMPNVVSVCAFFNACAGMTNLSLGEQ  243

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             +G V K    ++V V + +VD YGKC C+      F  M  RN ++W +++  YA  G 
Sbjct  244  FYGFVAKCGFGKDVSVSNSVVDFYGKCRCVGKARAVFDGMGVRNNVSWCSMVVAYAQNGA  303

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  ++    R  ++  P       VLT C+    ++ G  +  A+  +  I+     
Sbjct  304  EEEAFFVYLGARRAGEE--PTDFMVSSVLTTCAGLLGLDLGRAL-HAVAVRSCIDSNIFV  360

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A +    MP R  V+ W A++G     G         D +  + 
Sbjct  361  ASALVDMYGKCGGIEDAEQVFFEMPQRNLVT-WNAMIGGYAHIGDAHNALSVFDKMI-MG  418

Query  725  PQDSGNHVILSNMFASSGR  781
             + + N++ L N+  +  R
Sbjct  419  QETAPNYITLVNVLTACSR  437


 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 94/225 (42%), Gaps = 6/225 (3%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFEL-GRSIHG  193
            VS+ + ++   Q+    +AL  F      G+ P +F   S   A A        G  +H 
Sbjct  85   VSYTAFISGAAQHARPLQALSAFAAMLRLGLRPNDFTFPSAFKAAASAPPRSAAGTQLHA  144

Query  194  LVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
            L ++   + ++ FV    +DMY K GC+    R F EMP RN++ WNA++      G   
Sbjct  145  LALRFGYLPDDAFVSCAALDMYFKTGCLALARRLFDEMPNRNVVAWNAVMTNAVLDGRPL  204

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
              ++ +  +  +    +PN V+      AC+    +  G + F     K G         
Sbjct  205  ETVEAYFGL--RGAGGMPNVVSVCAFFNACAGMTNLSLG-EQFYGFVAKCGFGKDVSVSN  261

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
             VVD  G+   V +A      M +R  VS W +++ A   +G  E
Sbjct  262  SVVDFYGKCRCVGKARAVFDGMGVRNNVS-WCSMVVAYAQNGAEE  305



>ref|XP_002456912.1| hypothetical protein SORBIDRAFT_03g045330 [Sorghum bicolor]
 gb|EES02032.1| hypothetical protein SORBIDRAFT_03g045330 [Sorghum bicolor]
Length=648

 Score =   371 bits (953),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 218/276 (79%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++  Y QN   E+A  V+L AR  G EPT+FMVSS+L+ CAGL   +LGR++
Sbjct  284  RNSVSWCSMVVAYAQNGAEEEAFLVYLGARRAGEEPTDFMVSSLLTTCAGLLGLDLGRAL  343

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H +  ++C++ N+FV S LVDMYGKCG I+D E+ F+EMP+RNL+TWNA+IGGYAH G A
Sbjct  344  HAVAARSCIDANIFVASALVDMYGKCGGIQDAEQVFFEMPQRNLVTWNAMIGGYAHIGDA  403

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F++M    ++  PNY+T V VLTACSR G  + G ++F+ MK ++GIEP  EHY
Sbjct  404  WNALAVFDEMI-MGRETAPNYITIVNVLTACSRGGLTKEGYELFQTMKQRFGIEPRIEHY  462

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM E+AYE I+ MP+RP++SVWGALLG C++HGK ELG++AA+ LF++DP
Sbjct  463  ACVVDLLGRAGMEEQAYEIIQGMPMRPSISVWGALLGGCKMHGKTELGRVAAEKLFELDP  522

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNM AS+GRW EA  VRKEMK++GIKK
Sbjct  523  QDSGNHVLLSNMLASAGRWAEATDVRKEMKNVGIKK  558


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 101/217 (47%), Gaps = 4/217 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN V+W +++     +    + ++ +   R  G  P    V +  +ACAG+    LG   
Sbjct  183  RNVVAWNAVMTNAVLDGRPIETVEAYFGLRGAGGMPNVVSVCAFFNACAGMTCLSLGEQF  242

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG V K   +++V V + +VD YGKC C+      F  M  RN ++W +++  YA  G  
Sbjct  243  HGFVAKCGFDKDVSVSNSMVDFYGKCRCMGKARLVFDGMGVRNSVSWCSMVVAYAQNGAE  302

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A  ++    R  ++  P       +LT C+    ++ G  +  A+  +  I+      
Sbjct  303  EEAFLVYLGARRAGEE--PTDFMVSSLLTTCAGLLGLDLGRAL-HAVAARSCIDANIFVA  359

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
            + +VDM G+ G ++ A +    MP R  V+ W A++G
Sbjct  360  SALVDMYGKCGGIQDAEQVFFEMPQRNLVT-WNAMIG  395


 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 97/227 (43%), Gaps = 8/227 (4%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLA---AFELGRSI  187
            VS+ + ++   Q+    +AL  F      G+ P +F   S   A A      A  +G  +
Sbjct  81   VSYTAFISGAAQHARPLQALSAFAAMLRLGLRPNDFTFPSAFKAAASAPPRCAAAVGPQV  140

Query  188  HGLVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            H L ++   + ++ FV    +DMY K G +    R F EMP RN++ WNA++      G 
Sbjct  141  HALALRFGYLPDDAFVSCAALDMYFKTGRLALARRLFDEMPNRNVVAWNAVMTNAVLDGR  200

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                ++ +  +  +    +PN V+      AC+    +  G + F     K G +     
Sbjct  201  PIETVEAYFGL--RGAGGMPNVVSVCAFFNACAGMTCLSLG-EQFHGFVAKCGFDKDVSV  257

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
               +VD  G+   + +A      M +R +VS W +++ A   +G  E
Sbjct  258  SNSMVDFYGKCRCMGKARLVFDGMGVRNSVS-WCSMVVAYAQNGAEE  303



>ref|XP_003575959.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 
[Brachypodium distachyon]
Length=689

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 218/276 (79%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWCS++  Y Q+   E AL V++ AR  G EPT+FMVSSVL+ CAGL     GR++
Sbjct  279  RNSVSWCSMIVAYAQHGAEEDALAVYMGARNTGEEPTDFMVSSVLTTCAGLLGLNFGRAL  338

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCG +ED E+ F +MPERNL+TWNA+IGGYAH G A
Sbjct  339  HAVAVRSCIDANIFVASALVDMYGKCGGVEDAEQVFLDMPERNLVTWNAMIGGYAHIGDA  398

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F+ M R +    PN++T V V+TACSR G  + G ++F+ M++++G+EP  EHY
Sbjct  399  QNALAVFDAMIR-SGGTSPNHITLVNVITACSRGGLTKDGYELFDTMRERFGVEPRTEHY  457

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM ERAYE I+RMP+RP++SVWGALLGAC++HGK ELG+IA++ LF++DP
Sbjct  458  ACVVDLLGRAGMEERAYEIIQRMPMRPSISVWGALLGACKMHGKTELGRIASEKLFELDP  517

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+LSNM AS+GRW EA  VRKEMK++GIKK
Sbjct  518  QDSGNHVLLSNMLASAGRWAEATDVRKEMKNVGIKK  553


 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 111/259 (43%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN ++W +++     +    +  K +   RE G  P    V +  +ACAG     LG  
Sbjct  177  NRNVIAWNAVMTNAVIDGRPLETFKAYFGLREAGGMPNVVSVCAFFNACAGAMFLSLGEQ  236

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG VV    + +V V + +VD YGKC C       F  M  RN ++W ++I  YA  G 
Sbjct  237  FHGFVVTCGFDMDVSVSNAMVDFYGKCRCAGKARAVFDGMRVRNSVSWCSMIVAYAQHGA  296

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL ++  M  +     P       VLT C+    +  G  +  A+  +  I+     
Sbjct  297  EEDALAVY--MGARNTGEEPTDFMVSSVLTTCAGLLGLNFGRAL-HAVAVRSCIDANIFV  353

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G VE A +    MP R  V+ W A++G     G  +      D + +  
Sbjct  354  ASALVDMYGKCGGVEDAEQVFLDMPERNLVT-WNAMIGGYAHIGDAQNALAVFDAMIR-S  411

Query  725  PQDSGNHVILSNMFASSGR  781
               S NH+ L N+  +  R
Sbjct  412  GGTSPNHITLVNVITACSR  430


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/227 (27%), Positives = 96/227 (42%), Gaps = 9/227 (4%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVL--SACAGLAAFELGRSIH  190
            VS+ + ++   Q+     AL  F      G+ P +F   S    +ACA      +G  IH
Sbjct  77   VSFTAFISGAAQHARPLAALSAFAAMLRVGLRPNDFTFPSAFKAAACAPPRCSTVGPQIH  136

Query  191  GLVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
             L ++   +  + FV    +DMY K GC+    R F EMP RN+I WNA++      G  
Sbjct  137  ALALRFGYLPGDPFVSCAAMDMYFKTGCLGLARRLFEEMPNRNVIAWNAVMTNAVIDGR-  195

Query  368  NMALDLFED-MTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               L+ F+     +    +PN V+      AC+ A  +  G + F       G +     
Sbjct  196  --PLETFKAYFGLREAGGMPNVVSVCAFFNACAGAMFLSLG-EQFHGFVVTCGFDMDVSV  252

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
               +VD  G+     +A      M +R +VS W +++ A   HG  E
Sbjct  253  SNAMVDFYGKCRCAGKARAVFDGMRVRNSVS-WCSMIVAYAQHGAEE  298



>ref|XP_004954668.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Setaria italica]
Length=691

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 217/276 (79%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSWC ++  Y QN   E+A  ++L AR  G EPT+FMVSSVL+ CAGL   +LGR++
Sbjct  281  RNSVSWCCMVVAYAQNGGEEEAFSLYLGARRAGEEPTDFMVSSVLTTCAGLLGLDLGRAL  340

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + V++C++ N+FV S LVDMYGKCG IE+ E+ F+EMP+RNL+TWNA++GGYAH G A
Sbjct  341  HAVAVRSCIDANIFVASALVDMYGKCGDIENAEQVFFEMPQRNLVTWNAMVGGYAHIGDA  400

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL +F+ M  K  +  PNY+T V VLTACSR G  + G ++F+ M +++GI+P  EHY
Sbjct  401  RNALAVFDGMM-KCGETAPNYITLVNVLTACSRGGLTKEGYELFKTMHERFGIKPRIEHY  459

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAGM E+AYE I+ MP+RP++SVWGALLGAC++HGK ELGKIAA+ LF++DP
Sbjct  460  ACVVDLLGRAGMEEQAYEIIQGMPMRPSISVWGALLGACKMHGKTELGKIAAEKLFELDP  519

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            QDSGNHV+L NMFAS+ RW EA  VRKEMK++GIKK
Sbjct  520  QDSGNHVLLYNMFASASRWAEATDVRKEMKNVGIKK  555


 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 115/259 (44%), Gaps = 5/259 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN V+W +++     +    + ++ +   R+ G  P    V +  +ACAG     LG  
Sbjct  179  NRNVVAWNAVMTNAVLDGRPLETVEAYFGLRKAGGMPNVVSVCAFFNACAGATYLSLGEQ  238

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG VVK   E +V V + +VD YGKC C+   +  F  M  RN ++W  ++  YA  G 
Sbjct  239  FHGFVVKCGFEMDVSVSNSMVDFYGKCRCVGKAKAVFDGMRVRNSVSWCCMVVAYAQNGG  298

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A  L+    R  ++  P       VLT C+    ++ G  +  A+  +  I+     
Sbjct  299  EEEAFSLYLGARRAGEE--PTDFMVSSVLTTCAGLLGLDLGRAL-HAVAVRSCIDANIFV  355

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + +VDM G+ G +E A +    MP R  V+ W A++G     G         D + +  
Sbjct  356  ASALVDMYGKCGDIENAEQVFFEMPQRNLVT-WNAMVGGYAHIGDARNALAVFDGMMKCG  414

Query  725  PQDSGNHVILSNMFASSGR  781
             + + N++ L N+  +  R
Sbjct  415  -ETAPNYITLVNVLTACSR  432


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 88/209 (42%), Gaps = 5/209 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFE-LGRSIHG  193
            VS+ + ++   Q+     AL  F      G+ P +F   S   A A   ++  +G  +H 
Sbjct  80   VSYTAFISGAAQHGRPATALSAFAAMLRLGLRPNDFTFPSAFKAAASAPSWSTIGPQVHA  139

Query  194  LVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
            L ++   + ++ FV    +DM  K   +    R F EMP RN++ WNA++      G   
Sbjct  140  LALRFGYLPDDPFVACAALDMCFKTDRLALARRLFEEMPNRNVVAWNAVMTNAVLDGRPL  199

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
              ++ +  + +     +PN V+      AC+ A  +  G + F     K G E       
Sbjct  200  ETVEAYFGLRKAGG--MPNVVSVCAFFNACAGATYLSLG-EQFHGFVVKCGFEMDVSVSN  256

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVS  637
             +VD  G+   V +A      M +R +VS
Sbjct  257  SMVDFYGKCRCVGKAKAVFDGMRVRNSVS  285



>ref|XP_010928025.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Elaeis guineensis]
 ref|XP_010928026.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Elaeis guineensis]
 ref|XP_010928027.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Elaeis guineensis]
Length=658

 Score =   281 bits (720),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 190/278 (68%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D +N VSW +L+A Y + + GE ALK F + +  G E T F  SSV SACA + A E G+
Sbjct  248  DSKNEVSWNALIAGYARKENGEIALKQFWEMQRSGFEATHFTYSSVFSACASIGALEQGK  307

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  ++K+  +   FV + L+DMY K G I+D  + F  + +R++++WN+++ G A  G
Sbjct  308  WVHAHMIKSGQKLTAFVGNTLLDMYAKSGSIKDARKVFERLDKRDIVSWNSMLTGCAQHG  367

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            H    + LFE+M R    V PN++TF+CVLTACS  G V  G   FE MK KY +EP  E
Sbjct  368  HGKETVCLFEEMRR--LGVQPNHITFLCVLTACSHGGLVSEGRHYFELMK-KYKLEPEVE  424

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            H+  +VD+LGRAG++++A EFI  MPI+PT +VWGALLGACR+H   ELGK AA+ +F++
Sbjct  425  HFVTIVDLLGRAGLLDQALEFINDMPIQPTAAVWGALLGACRMHKNAELGKFAAERVFEL  484

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP D+G HV+L N++AS+GRW++A  VR+ MK+ G+KK
Sbjct  485  DPHDAGPHVLLYNIYASAGRWDDAAKVRRMMKESGVKK  522


 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 119/224 (53%), Gaps = 5/224 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC-AGLAAFELGRS  184
            ++ V+W +L+  Y QND  ++AL +F +    G++P  F  +S+L AC A     E    
Sbjct  148  KDMVTWTALITGYSQNDRPKEALTLFPRMLRLGLKPNGFTFASLLKACGAATPGDESCEQ  207

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH   +K   + +V+V S L+DMY + G +++    F  +  +N ++WNALI GYA + +
Sbjct  208  IHAACIKYGCQSDVYVGSSLLDMYARHGKMDEACLVFDRLDSKNEVSWNALIAGYARKEN  267

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
              +AL  F +M R   +    + T+  V +AC+  GA+E G  +   M  K G +  A  
Sbjct  268  GEIALKQFWEMQRSGFEAT--HFTYSSVFSACASIGALEQGKWVHAHMI-KSGQKLTAFV  324

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               ++DM  ++G ++ A +  +R+  R  VS W ++L  C  HG
Sbjct  325  GNTLLDMYAKSGSIKDARKVFERLDKRDIVS-WNSMLTGCAQHG  367


 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 120/249 (48%), Gaps = 19/249 (8%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDC  283
             +EPT  + + +L  C  L     GR +H   + +  ++++F  + ++++Y KCG +ED 
Sbjct  79   SLEPTAAIYTQLLKKCTQLKRLNEGRLVHAHFLTSRFKDDLFFHNSIINLYSKCGSLEDA  138

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
              AF EM  ++++TW ALI GY+       AL LF  M R    + PN  TF  +L AC 
Sbjct  139  RNAFDEMRVKDMVTWTALITGYSQNDRPKEALTLFPRMLR--LGLKPNGFTFASLLKACG  196

Query  464  RAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVW  643
             A   +   +   A   KYG +      + ++DM  R G ++ A     R+  +  VS W
Sbjct  197  AATPGDESCEQIHAACIKYGCQSDVYVGSSLLDMYARHGKMDEACLVFDRLDSKNEVS-W  255

Query  644  GALLGACRVHGKPELGKIAADNLFQIDPQDSG---NHVILSNMFAS--------SGRWEE  790
             AL+     + + E G+IA    +++  Q SG    H   S++F++         G+W  
Sbjct  256  NALIAG---YARKENGEIALKQFWEM--QRSGFEATHFTYSSVFSACASIGALEQGKWVH  310

Query  791  ANLVRKEMK  817
            A++++   K
Sbjct  311  AHMIKSGQK  319



>ref|XP_008373195.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Malus domestica]
 ref|XP_008373196.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Malus domestica]
 ref|XP_008373197.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Malus domestica]
 ref|XP_008373198.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Malus domestica]
Length=682

 Score =   277 bits (708),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 186/278 (67%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D +N VSW +L+A + +   GE AL++F K   EG +PT F  SSVL+ACA   + E G+
Sbjct  272  DTKNEVSWNALIAGHARKAQGEHALRLFWKMLREGFKPTHFTYSSVLTACASAGSLEQGK  331

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  ++K+ V    FV + L+DMY K G IED ++ F  M  R++++WN+++ GYA  G
Sbjct  332  WVHAHMIKSVVTLVAFVGNTLLDMYAKSGSIEDAKKVFDRMVRRDVVSWNSMLTGYAQHG  391

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                 +  FE+M R    + PN +TF+CVLTACS AG ++ G   F+ MK +Y IEP   
Sbjct  392  FGKETVQRFEEMLRI--GIQPNDITFLCVLTACSHAGLLDEGQYYFDLMK-QYNIEPQVS  448

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY  +VD+LGR  +++RA +FI+ MPI PT +VWGALLGACR+H   ELG  AA+  F++
Sbjct  449  HYVTIVDLLGRGNLLDRAEKFIREMPIEPTAAVWGALLGACRMHKNIELGAYAAERSFEL  508

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP DSG HVILSN++AS+GRW +A  VRK MK+ G+KK
Sbjct  509  DPHDSGPHVILSNIYASAGRWIDAAKVRKMMKEGGVKK  546


 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 122/224 (54%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             ++ V+W +L++ Y Q+D  + AL +F +    G+EP +F +SS+L A   ++    GR 
Sbjct  172  HKDLVTWTALISGYSQHDRPQDALVLFPEMLRHGLEPNQFTLSSLLKASGAVSDDNHGRQ  231

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H    K  ++ NV+V + LVDMY +CG +++ +  F  +  +N ++WNALI G+A +  
Sbjct  232  LHTYCFKYGLDSNVYVGTALVDMYARCGHMDESQLVFDALDTKNEVSWNALIAGHARKAQ  291

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL LF  M R  +   P + T+  VLTAC+ AG++E G  +   M  K  +   A  
Sbjct  292  GEHALRLFWKMLR--EGFKPTHFTYSSVLTACASAGSLEQGKWVHAHMI-KSVVTLVAFV  348

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               ++DM  ++G +E A +   RM  R  VS W ++L     HG
Sbjct  349  GNTLLDMYAKSGSIEDAKKVFDRMVRRDVVS-WNSMLTGYAQHG  391


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/241 (25%), Positives = 107/241 (44%), Gaps = 11/241 (5%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDC  283
             +E    + + +L  C   A  +  R +H  ++ +  ++++ +R+ ++ MY KCG ++D 
Sbjct  104  SLEADRTLYNKLLHRCTQTAQLKQARIVHSHILTSQFKDDLPIRNTILHMYVKCGSLDDA  163

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
               F +MP ++L+TW ALI GY+       AL LF +M R    + PN  T   +L A  
Sbjct  164  RNLFNQMPHKDLVTWTALISGYSQHDRPQDALVLFPEMLR--HGLEPNQFTLSSLLKASG  221

Query  464  RAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVW  643
                   G  +      KYG++        +VDM  R G ++ +      +  +  VS W
Sbjct  222  AVSDDNHGRQL-HTYCFKYGLDSNVYVGTALVDMYARCGHMDESQLVFDALDTKNEVS-W  279

Query  644  GALLGACRVHGKPELGKIAADNLFQIDPQD-SGNHVILSNMF---ASSGRWEEANLVRKE  811
             AL+     H +   G+ A    +++  +     H   S++    AS+G  E+   V   
Sbjct  280  NALIAG---HARKAQGEHALRLFWKMLREGFKPTHFTYSSVLTACASAGSLEQGKWVHAH  336

Query  812  M  814
            M
Sbjct  337  M  337



>ref|XP_010243118.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Nelumbo nucifera]
Length=685

 Score =   277 bits (708),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 192/278 (69%), Gaps = 3/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +++A Y QN+   +AL++F + +E G+ P E  +  VLSACA     +LGR 
Sbjct  345  ERNVVSWNAMIAGYSQNNQPNEALELFHEMKELGVVPIESTLVCVLSACAQSECLDLGRW  404

Query  185  IHGLVV-KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            IH   V +  ++ +V + + ++DMY KCG I+   + F EM +++L+TWN++I GYA  G
Sbjct  405  IHQHYVGQKRIQPSVILTNAIIDMYAKCGDIDAAAKLFNEMQDKDLVTWNSMIAGYAAHG  464

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            +A+ AL LFE M  +  ++VP+ +TFV VL+ACS  G V  G   FE M+ +YGIEP AE
Sbjct  465  YADQALGLFEQM--RNLELVPDDITFVGVLSACSHGGLVTQGKKYFEDMRVEYGIEPKAE  522

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC++D+LGR G+VE A E +KRMP+ P  + WGALL AC++HG  ELGK+AAD L  +
Sbjct  523  HYACMIDLLGRVGLVEEAKELLKRMPMEPDEAAWGALLNACKMHGNVELGKLAADKLLDL  582

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSG + +L+N++AS  RW++  +VR  M+D G+KK
Sbjct  583  DPKDSGIYALLANLYASRRRWDDVRMVRSMMRDRGVKK  620


 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/254 (30%), Positives = 122/254 (48%), Gaps = 34/254 (13%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW +++  + Q +L  +AL +F      GI P E  + +VLSAC+ +    LG+ +
Sbjct  214  RDVVSWTTMIDGFAQKNLPNEALNLFYAMLSSGITPNEVTMITVLSACSQMGDIGLGKIV  273

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIED-----------------------------  280
            H  + K  V  N+ + + L DMY KCGC+                               
Sbjct  274  HEYIEKNRVNCNLNLLNALADMYVKCGCLNTAREIFEKMEVRDAFSWTIMINGYAKQGDL  333

Query  281  --CERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
                + F EMPERN+++WNA+I GY+     N AL+LF +M  K   VVP   T VCVL+
Sbjct  334  NFARKLFDEMPERNVVSWNAMIAGYSQNNQPNEALELFHEM--KELGVVPIESTLVCVLS  391

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC+++  ++ G  I +    +  I+P       ++DM  + G ++ A +    M  +  V
Sbjct  392  ACAQSECLDLGRWIHQHYVGQKRIQPSVILTNAIIDMYAKCGDIDAAAKLFNEMQDKDLV  451

Query  635  SVWGALLGACRVHG  676
            + W +++     HG
Sbjct  452  T-WNSMIAGYAAHG  464


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 124/278 (45%), Gaps = 13/278 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N   W +++  Y +  L +  L +F +  +E +E         L AC        G  
Sbjct  112  EPNTYIWNTMIRGYCKAKLPKLGLPLFRQMVQEQVEMDNRTFVFALKACEQSPGAVEGEQ  171

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L+ K   + N+ V++ L+ +Y + G +      F     R++++W  +I G+A +  
Sbjct  172  LHCLINKLGFDTNLLVQNGLIHLYVRYGFLSSARLLFDTSFVRDVVSWTTMIDGFAQKNL  231

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N AL+LF  M   +  + PN VT + VL+ACS+ G +  G  + E + +K  +      
Sbjct  232  PNEALNLFYAML--SSGITPNEVTMITVLSACSQMGDIGLGKIVHEYI-EKNRVNCNLNL  288

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
               + DM  + G +  A E  ++M +R   S W  ++      G     +     LF   
Sbjct  289  LNALADMYVKCGCLNTAREIFEKMEVRDAFS-WTIMINGYAKQGDLNFAR----KLFDEM  343

Query  725  PQD---SGNHVILSNMFASSGRWEEANLVRKEMKDIGI  829
            P+    S N +I    ++ + +  EA  +  EMK++G+
Sbjct  344  PERNVVSWNAMIAG--YSQNNQPNEALELFHEMKELGV  379



>gb|KCW82874.1| hypothetical protein EUGRSUZ_C04243 [Eucalyptus grandis]
Length=705

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 191/277 (69%), Gaps = 3/277 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKARE-EGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++ +SW +L+  Y QN L  +A++ +    E EGI P E    S+L+ACA   A + G  
Sbjct  295  KDVISWNTLITGYAQNGLASEAIEAYHLMEECEGIPPNEGTWVSILTACASAGALKEGMR  354

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L+ +  +  ++FV + L+DMYGKCG ++D    FY++P    + WNA+I  +   GH
Sbjct  355  IHALISRNGLIADIFVGTCLIDMYGKCGRLDDAMSLFYDIPRNTSVPWNAIISCHGLHGH  414

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL LFE+M +  + V P+++TFV +L+ACS AG V+ G   F+ M++KYGI+PG +H
Sbjct  415  GDKALKLFEEMQK--EGVEPDHITFVSLLSACSHAGLVDEGQRSFQVMQEKYGIKPGLKH  472

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+L RAG++E+AY+FI+ MPIRP  SVWGALLGACR+HG  ELG +A+D LF++D
Sbjct  473  YGCMVDLLARAGLIEKAYDFIQNMPIRPDASVWGALLGACRIHGNAELGTLASDRLFEVD  532

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P++ G HV+LSN++A++G+W+    VR   +D G++K
Sbjct  533  PENVGYHVLLSNIYANAGKWDVMGEVRSFARDRGLRK  569


 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 123/224 (55%), Gaps = 4/224 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW S++A YEQN+    A   F + +  G++P    V S+ S+ A +      +S+
Sbjct  193  KDVVSWNSIIAAYEQNNDPVTACLFFKEMQSTGLKPDLLTVVSLASSFAQVNDSRNSKSL  252

Query  188  HGLVV-KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            H   + +  V ++V + + +VDMY K G +    + F E+P +++I+WN LI GYA  G 
Sbjct  253  HCFTLRRGWVLKDVVLGNAVVDMYAKLGYVGYALQVFEELPAKDVISWNTLITGYAQNGL  312

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+ A++ +  M  + + + PN  T+V +LTAC+ AGA++ GM I  A+  + G+      
Sbjct  313  ASEAIEAYHLM-EECEGIPPNEGTWVSILTACASAGALKEGMRI-HALISRNGLIADIFV  370

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              C++DM G+ G ++ A      +P R T   W A++    +HG
Sbjct  371  GTCLIDMYGKCGRLDDAMSLFYDIP-RNTSVPWNAIISCHGLHG  413


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 93/195 (48%), Gaps = 7/195 (4%)
 Frame = +2

Query  98   EEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIE  277
              G+ P  +    +L AC  +     G+  H  ++K   + +VFV + LV MY + G + 
Sbjct  24   SSGLRPDFYTFPPLLKACGHVLE---GKRFHCSIMKLGFQSDVFVAASLVHMYARHGYLG  80

Query  278  DCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTA  457
               + F +MP R++ +WNA+I GY   G+A  ALD+   M  K+Q +  + VT   +L  
Sbjct  81   VARQVFDDMPFRDIGSWNAMISGYCQNGNAAEALDILSAM--KSQGIKMDSVTVCSLLAI  138

Query  458  CSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVS  637
             ++     +G+ +      K+G+E        +++M  +   +  A +  + M ++  VS
Sbjct  139  FAQFDDALSGI-LIHVYIIKHGLEFDLFVNNALINMYAKFSNLGDALQIFESMVVKDVVS  197

Query  638  VWGALLGACRVHGKP  682
             W +++ A   +  P
Sbjct  198  -WNSIIAAYEQNNDP  211


 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/216 (23%), Positives = 100/216 (46%), Gaps = 3/216 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+  SW ++++ Y QN    +AL +    + +GI+     V S+L+  A       G  I
Sbjct  92   RDIGSWNAMISGYCQNGNAAEALDILSAMKSQGIKMDSVTVCSLLAIFAQFDDALSGILI  151

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  ++K  +E ++FV + L++MY K   + D  + F  M  +++++WN++I  Y      
Sbjct  152  HVYIIKHGLEFDLFVNNALINMYAKFSNLGDALQIFESMVVKDVVSWNSIIAAYEQNNDP  211

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A   F++M  ++  + P+ +T V + ++ ++         +      +  +       
Sbjct  212  VTACLFFKEM--QSTGLKPDLLTVVSLASSFAQVNDSRNSKSLHCFTLRRGWVLKDVVLG  269

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
              VVDM  + G V  A +  + +P +  +S W  L+
Sbjct  270  NAVVDMYAKLGYVGYALQVFEELPAKDVIS-WNTLI  304



>ref|XP_008775674.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Phoenix dactylifera]
Length=658

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 190/278 (68%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D +N VSW +L+A Y + + GE ALK F + +  G E T F  SSVLSACA + A E G+
Sbjct  248  DSKNEVSWNALIAGYARRENGETALKQFREMQRSGFEATHFTYSSVLSACASIGALEQGK  307

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  ++K+  +   FV + L+DMY K G I+D  + F  + +R++++WN+++ G A  G
Sbjct  308  WVHAHMIKSGQKLTAFVGNTLLDMYAKSGNIKDARKVFERLGKRDVVSWNSMLTGCAQHG  367

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                 + LFE+M  +   V PN++TF+CVLTACS  G V  G   FE MK KY +EP  E
Sbjct  368  LGKETVCLFEEM--RQLGVQPNHITFLCVLTACSHGGLVSEGRHYFELMK-KYKLEPEVE  424

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY  +VD+LGRAG++++A +FI  MPI+PT +VWGALLGACR+H   ELGK AA+ +F++
Sbjct  425  HYVTIVDLLGRAGLLDQALKFINDMPIQPTAAVWGALLGACRMHKNAELGKYAAERVFEL  484

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP D+G HV+L N++AS+GRW++A  VR+ MK+ G+KK
Sbjct  485  DPNDAGPHVLLYNIYASAGRWDDAAKVRRMMKENGVKK  522


 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 122/230 (53%), Gaps = 8/230 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLA-AFELGRS  184
            ++ V+W +L+  Y QND  ++ALK+F      G++P  F  +S+L AC   A   E  + 
Sbjct  148  KDMVTWTALITGYSQNDRPKEALKLFPSMLRLGLKPNGFTFASLLKACGEAAPGDESCQQ  207

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH   +K     +V+V S L+DMY + G +++    F  +  +N ++WNALI GYA + +
Sbjct  208  IHAACIKYGCHSDVYVGSSLLDMYARHGRMDEACLVFDRLDSKNEVSWNALIAGYARREN  267

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL  F +M R   +    + T+  VL+AC+  GA+E G  +   M  K G +  A  
Sbjct  268  GETALKQFREMQRSGFEAT--HFTYSSVLSACASIGALEQGKWVHAHMI-KSGQKLTAFV  324

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGK  694
               ++DM  ++G ++ A +  +R+  R  VS W ++L  C  HG   LGK
Sbjct  325  GNTLLDMYAKSGNIKDARKVFERLGKRDVVS-WNSMLTGCAQHG---LGK  370


 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/276 (28%), Positives = 129/276 (47%), Gaps = 25/276 (9%)
 Frame = +2

Query  41   VYEQNDLGEKALKV-----FLKAREEG-IEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            + ++ DL  K+LK       L   + G +EPT  + S ++  C  +     GR +H   +
Sbjct  52   IIQEKDLLRKSLKSQPGLHVLDLIDAGCLEPTAAIYSQLVKKCTQVKRLNEGRLVHAHFL  111

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
             +  ++N+F  + +++MY KCG +ED  +AF EMP ++++TW ALI GY+       AL 
Sbjct  112  TSRFKDNLFFHNSIINMYCKCGGLEDARKAFDEMPVKDMVTWTALITGYSQNDRPKEALK  171

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            LF  M R    + PN  TF  +L AC  A   +       A   KYG        + ++D
Sbjct  172  LFPSMLR--LGLKPNGFTFASLLKACGEAAPGDESCQQIHAACIKYGCHSDVYVGSSLLD  229

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSG-  739
            M  R G ++ A     R+  +  VS W AL+     + + E G+ A     ++  Q SG 
Sbjct  230  MYARHGRMDEACLVFDRLDSKNEVS-WNALIAG---YARRENGETALKQFREM--QRSGF  283

Query  740  --NHVILSNMFAS--------SGRWEEANLVRKEMK  817
               H   S++ ++         G+W  A++++   K
Sbjct  284  EATHFTYSSVLSACASIGALEQGKWVHAHMIKSGQK  319



>ref|XP_010050039.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 
[Eucalyptus grandis]
 ref|XP_010050040.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 
[Eucalyptus grandis]
Length=761

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 191/277 (69%), Gaps = 3/277 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKARE-EGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++ +SW +L+  Y QN L  +A++ +    E EGI P E    S+L+ACA   A + G  
Sbjct  351  KDVISWNTLITGYAQNGLASEAIEAYHLMEECEGIPPNEGTWVSILTACASAGALKEGMR  410

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L+ +  +  ++FV + L+DMYGKCG ++D    FY++P    + WNA+I  +   GH
Sbjct  411  IHALISRNGLIADIFVGTCLIDMYGKCGRLDDAMSLFYDIPRNTSVPWNAIISCHGLHGH  470

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL LFE+M +  + V P+++TFV +L+ACS AG V+ G   F+ M++KYGI+PG +H
Sbjct  471  GDKALKLFEEMQK--EGVEPDHITFVSLLSACSHAGLVDEGQRSFQVMQEKYGIKPGLKH  528

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+L RAG++E+AY+FI+ MPIRP  SVWGALLGACR+HG  ELG +A+D LF++D
Sbjct  529  YGCMVDLLARAGLIEKAYDFIQNMPIRPDASVWGALLGACRIHGNAELGTLASDRLFEVD  588

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P++ G HV+LSN++A++G+W+    VR   +D G++K
Sbjct  589  PENVGYHVLLSNIYANAGKWDVMGEVRSFARDRGLRK  625


 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 123/224 (55%), Gaps = 4/224 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW S++A YEQN+    A   F + +  G++P    V S+ S+ A +      +S+
Sbjct  249  KDVVSWNSIIAAYEQNNDPVTACLFFKEMQSTGLKPDLLTVVSLASSFAQVNDSRNSKSL  308

Query  188  HGLVV-KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            H   + +  V ++V + + +VDMY K G +    + F E+P +++I+WN LI GYA  G 
Sbjct  309  HCFTLRRGWVLKDVVLGNAVVDMYAKLGYVGYALQVFEELPAKDVISWNTLITGYAQNGL  368

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+ A++ +  M  + + + PN  T+V +LTAC+ AGA++ GM I  A+  + G+      
Sbjct  369  ASEAIEAYHLM-EECEGIPPNEGTWVSILTACASAGALKEGMRI-HALISRNGLIADIFV  426

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              C++DM G+ G ++ A      +P R T   W A++    +HG
Sbjct  427  GTCLIDMYGKCGRLDDAMSLFYDIP-RNTSVPWNAIISCHGLHG  469


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/221 (24%), Positives = 103/221 (47%), Gaps = 8/221 (4%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLK-AREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            W  +++ Y +      A+  + K     G+ P  +    +L AC  +     G+  H  +
Sbjct  54   WNCMMSSYVRCGFFSAAIDCYRKFLLSSGLRPDFYTFPPLLKACGHVLE---GKRFHCSI  110

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            +K   + +VFV + LV MY + G +    + F +MP R++ +WNA+I GY   G+A  AL
Sbjct  111  MKLGFQSDVFVAASLVHMYARHGYLGVARQVFDDMPFRDIGSWNAMISGYCQNGNAAEAL  170

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
            D+   M  K+Q +  + VT   +L   ++     +G+ +      K+G+E        ++
Sbjct  171  DILSAM--KSQGIKMDSVTVCSLLAIFAQFDDALSGI-LIHVYIIKHGLEFDLFVNNALI  227

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKP  682
            +M  +   +  A +  + M ++  VS W +++ A   +  P
Sbjct  228  NMYAKFSNLGDALQIFESMVVKDVVS-WNSIIAAYEQNNDP  267


 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/216 (23%), Positives = 100/216 (46%), Gaps = 3/216 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+  SW ++++ Y QN    +AL +    + +GI+     V S+L+  A       G  I
Sbjct  148  RDIGSWNAMISGYCQNGNAAEALDILSAMKSQGIKMDSVTVCSLLAIFAQFDDALSGILI  207

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  ++K  +E ++FV + L++MY K   + D  + F  M  +++++WN++I  Y      
Sbjct  208  HVYIIKHGLEFDLFVNNALINMYAKFSNLGDALQIFESMVVKDVVSWNSIIAAYEQNNDP  267

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A   F++M  ++  + P+ +T V + ++ ++         +      +  +       
Sbjct  268  VTACLFFKEM--QSTGLKPDLLTVVSLASSFAQVNDSRNSKSLHCFTLRRGWVLKDVVLG  325

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
              VVDM  + G V  A +  + +P +  +S W  L+
Sbjct  326  NAVVDMYAKLGYVGYALQVFEELPAKDVIS-WNTLI  360



>ref|XP_010272360.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
isoform X2 [Nelumbo nucifera]
Length=858

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 183/272 (67%), Gaps = 2/272 (1%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            S+ S++  Y Q   GE+ALK+FLK  + G+ P  F+ SS+L+ACA L+A+E G+ IH  +
Sbjct  453  SFTSMITAYSQYGQGEEALKLFLKMLDMGLRPDGFVCSSLLNACANLSAYEQGKQIHVHI  512

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            +K+    +VF  + LV+MY KCG ++D +RAF E+PER +++W+A+IGG A  G    AL
Sbjct  513  LKSGFISDVFAGNALVNMYAKCGSVDDADRAFLEIPERGIVSWSAMIGGLAQHGQGREAL  572

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
             LF  M    + V PN++T V VL AC+ AG +      FE+M  ++GIEP  EHYAC+V
Sbjct  573  SLFHQMLE--EGVFPNHITLVSVLCACNHAGLIAEAKQYFESMDKQFGIEPMQEHYACMV  630

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSG  739
            D+LGRAG ++ A E + +MP     SVWGALLGA R+HG  ELG+ AA+ LF ++P+ SG
Sbjct  631  DLLGRAGRLDEAVELVNKMPFEANASVWGALLGASRIHGNLELGRHAAEMLFTLEPEKSG  690

Query  740  NHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             HV+L+NM+AS G WE    VR+ MKD  +KK
Sbjct  691  THVLLANMYASVGMWENVAKVRRLMKDSKVKK  722


 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 118/224 (53%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN  G++AL  F++    G++  EF   SVL AC+     + G+ 
Sbjct  44   EPDLVSWSALISGYAQNGFGKEALSAFIEMHSSGVKCNEFTFPSVLKACSITKDLKGGKQ  103

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG+VV    E +VFV + LV MY KCG +EDC+R F E+PERN+I+WNAL  GY     
Sbjct  104  IHGIVVVTGYESDVFVANTLVVMYAKCGELEDCKRLFDEIPERNVISWNALFSGYVQNDC  163

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+D F++M    +   PN  +   +L AC+ +     G  +   +  K G +     
Sbjct  164  YGEAVDQFKEMV--AEGTKPNEFSLSSILNACTGSEDYSQGKRVHGYLV-KLGYDSDLYS  220

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               +VDM  + G  E +    + + + P +  W A +  C +HG
Sbjct  221  NNALVDMYSKLGDFEASMAIFQNIAL-PDIVSWNAAIAGCVLHG  263


 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 128/271 (47%), Gaps = 12/271 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN +SW +L + Y QND   +A+  F +   EG +P EF +SS+L+AC G   +  G+ 
Sbjct  145  ERNVISWNALFSGYVQNDCYGEAVDQFKEMVAEGTKPNEFSLSSILNACTGSEDYSQGKR  204

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG +VK   + +++  + LVDMY K G  E     F  +   ++++WNA I G    G 
Sbjct  205  VHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDIVSWNAAIAGCVLHGC  264

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL+L   M  K     PN  T   +L AC+  G  E G  +   +  K   E     
Sbjct  265  HDWALELLGQM--KDAGTFPNKFTLSSILKACAGIGMKELGKQVHSNLI-KMDTESDTFV  321

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
               ++DM  +  +V  A      MP    +S W A++     +G+ +     A +LF ID
Sbjct  322  SVGLIDMYSKCTLVHDARMVFDLMPEHDVIS-WNAIISGYSQNGEDK----EAISLF-ID  375

Query  725  PQDSG---NHVILSNMFASSGRWEEANLVRK  808
                G   N   LS +  S+   + + +V++
Sbjct  376  MLKEGFGFNRTTLSVILKSTAVLQASEVVKQ  406


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 83/308 (27%), Positives = 136/308 (44%), Gaps = 42/308 (14%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW + +A    +   + AL++  + ++ G  P +F +SS+L ACAG+   ELG+ +H  
Sbjct  250  VSWNAAIAGCVLHGCHDWALELLGQMKDAGTFPNKFTLSSILKACAGIGMKELGKQVHSN  309

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K   E + FV   L+DMY KC  + D    F  MPE ++I+WNA+I GY+  G    A
Sbjct  310  LIKMDTESDTFVSVGLIDMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYSQNGEDKEA  369

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + LF DM ++      N  T   +L + +   A E    +  A+  K G E  +     +
Sbjct  370  ISLFIDMLKEGFGF--NRTTLSVILKSTAVLQASEVVKQV-HALAMKAGFEYDSYVVNSL  426

Query  557  VDMLGRAGMVERAYEFIKRMP----------------------------------IRPTV  634
            +D  G+   +E A    +  P                                  +RP  
Sbjct  427  IDSYGKCSHIEDATRIFEECPFGDVASFTSMITAYSQYGQGEEALKLFLKMLDMGLRPDG  486

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQ---IDPQDSGNHVILSNMFASSGRWEEANLVR  805
             V  +LL AC      E GK    ++ +   I    +GN ++  NM+A  G  ++A+   
Sbjct  487  FVCSSLLNACANLSAYEQGKQIHVHILKSGFISDVFAGNALV--NMYAKCGSVDDADRAF  544

Query  806  KEMKDIGI  829
             E+ + GI
Sbjct  545  LEIPERGI  552


 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/227 (31%), Positives = 113/227 (50%), Gaps = 8/227 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + +SW ++++ Y QN   ++A+ +F+   +EG       +S +L + A L A E+ + 
Sbjct  347  EHDVISWNAIISGYSQNGEDKEAISLFIDMLKEGFGFNRTTLSVILKSTAVLQASEVVKQ  406

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +KA  E + +V + L+D YGKC  IED  R F E P  ++ ++ ++I  Y+  G 
Sbjct  407  VHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDATRIFEECPFGDVASFTSMITAYSQYGQ  466

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL LF  M      + P+   FVC  +L AC+   A E G  I   +  K G     
Sbjct  467  GEEALKLFLKML--DMGLRPD--GFVCSSLLNACANLSAYEQGKQIHVHIL-KSGFISDV  521

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
                 +V+M  + G V+ A      +P R  VS W A++G    HG+
Sbjct  522  FAGNALVNMYAKCGSVDDADRAFLEIPERGIVS-WSAMIGGLAQHGQ  567


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 71/157 (45%), Gaps = 4/157 (3%)
 Frame = +2

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH  ++K+   E+  +R+ L+++Y K            E+PE +L++W+ALI GYA  G 
Sbjct  3    IHAHIIKSGFSEDTALRNHLINLYSKRQIFCFARNLIDEIPEPDLVSWSALISGYAQNGF  62

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL  F +M   +  V  N  TF  VL ACS    ++ G  I   +    G E     
Sbjct  63   GKEALSAFIEM--HSSGVKCNEFTFPSVLKACSITKDLKGGKQI-HGIVVVTGYESDVFV  119

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               +V M  + G +E        +P R  +S W AL 
Sbjct  120  ANTLVVMYAKCGELEDCKRLFDEIPERNVIS-WNALF  155


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 65/128 (51%), Gaps = 6/128 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAAFELG  178
            ER  VSW +++    Q+  G +AL +F +  EEG+ P    + SVL AC  AGL A E  
Sbjct  549  ERGIVSWSAMIGGLAQHGQGREALSLFHQMLEEGVFPNHITLVSVLCACNHAGLIA-EAK  607

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAH  355
            +    +  +  +E      + +VD+ G+ G +++      +MP E N   W AL+G  A 
Sbjct  608  QYFESMDKQFGIEPMQEHYACMVDLLGRAGRLDEAVELVNKMPFEANASVWGALLG--AS  665

Query  356  QGHANMAL  379
            + H N+ L
Sbjct  666  RIHGNLEL  673



>ref|XP_010272359.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
isoform X1 [Nelumbo nucifera]
Length=942

 Score =   276 bits (706),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 183/272 (67%), Gaps = 2/272 (1%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            S+ S++  Y Q   GE+ALK+FLK  + G+ P  F+ SS+L+ACA L+A+E G+ IH  +
Sbjct  537  SFTSMITAYSQYGQGEEALKLFLKMLDMGLRPDGFVCSSLLNACANLSAYEQGKQIHVHI  596

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            +K+    +VF  + LV+MY KCG ++D +RAF E+PER +++W+A+IGG A  G    AL
Sbjct  597  LKSGFISDVFAGNALVNMYAKCGSVDDADRAFLEIPERGIVSWSAMIGGLAQHGQGREAL  656

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
             LF  M    + V PN++T V VL AC+ AG +      FE+M  ++GIEP  EHYAC+V
Sbjct  657  SLFHQMLE--EGVFPNHITLVSVLCACNHAGLIAEAKQYFESMDKQFGIEPMQEHYACMV  714

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSG  739
            D+LGRAG ++ A E + +MP     SVWGALLGA R+HG  ELG+ AA+ LF ++P+ SG
Sbjct  715  DLLGRAGRLDEAVELVNKMPFEANASVWGALLGASRIHGNLELGRHAAEMLFTLEPEKSG  774

Query  740  NHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             HV+L+NM+AS G WE    VR+ MKD  +KK
Sbjct  775  THVLLANMYASVGMWENVAKVRRLMKDSKVKK  806


 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 118/224 (53%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN  G++AL  F++    G++  EF   SVL AC+     + G+ 
Sbjct  128  EPDLVSWSALISGYAQNGFGKEALSAFIEMHSSGVKCNEFTFPSVLKACSITKDLKGGKQ  187

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG+VV    E +VFV + LV MY KCG +EDC+R F E+PERN+I+WNAL  GY     
Sbjct  188  IHGIVVVTGYESDVFVANTLVVMYAKCGELEDCKRLFDEIPERNVISWNALFSGYVQNDC  247

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+D F++M    +   PN  +   +L AC+ +     G  +   +  K G +     
Sbjct  248  YGEAVDQFKEMV--AEGTKPNEFSLSSILNACTGSEDYSQGKRVHGYLV-KLGYDSDLYS  304

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               +VDM  + G  E +    + + + P +  W A +  C +HG
Sbjct  305  NNALVDMYSKLGDFEASMAIFQNIAL-PDIVSWNAAIAGCVLHG  347


 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 128/271 (47%), Gaps = 12/271 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN +SW +L + Y QND   +A+  F +   EG +P EF +SS+L+AC G   +  G+ 
Sbjct  229  ERNVISWNALFSGYVQNDCYGEAVDQFKEMVAEGTKPNEFSLSSILNACTGSEDYSQGKR  288

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG +VK   + +++  + LVDMY K G  E     F  +   ++++WNA I G    G 
Sbjct  289  VHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDIVSWNAAIAGCVLHGC  348

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL+L   M  K     PN  T   +L AC+  G  E G  +   +  K   E     
Sbjct  349  HDWALELLGQM--KDAGTFPNKFTLSSILKACAGIGMKELGKQVHSNLI-KMDTESDTFV  405

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
               ++DM  +  +V  A      MP    +S W A++     +G+ +     A +LF ID
Sbjct  406  SVGLIDMYSKCTLVHDARMVFDLMPEHDVIS-WNAIISGYSQNGEDK----EAISLF-ID  459

Query  725  PQDSG---NHVILSNMFASSGRWEEANLVRK  808
                G   N   LS +  S+   + + +V++
Sbjct  460  MLKEGFGFNRTTLSVILKSTAVLQASEVVKQ  490


 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 83/308 (27%), Positives = 136/308 (44%), Gaps = 42/308 (14%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW + +A    +   + AL++  + ++ G  P +F +SS+L ACAG+   ELG+ +H  
Sbjct  334  VSWNAAIAGCVLHGCHDWALELLGQMKDAGTFPNKFTLSSILKACAGIGMKELGKQVHSN  393

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K   E + FV   L+DMY KC  + D    F  MPE ++I+WNA+I GY+  G    A
Sbjct  394  LIKMDTESDTFVSVGLIDMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYSQNGEDKEA  453

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + LF DM ++      N  T   +L + +   A E    +  A+  K G E  +     +
Sbjct  454  ISLFIDMLKEGFGF--NRTTLSVILKSTAVLQASEVVKQV-HALAMKAGFEYDSYVVNSL  510

Query  557  VDMLGRAGMVERAYEFIKRMP----------------------------------IRPTV  634
            +D  G+   +E A    +  P                                  +RP  
Sbjct  511  IDSYGKCSHIEDATRIFEECPFGDVASFTSMITAYSQYGQGEEALKLFLKMLDMGLRPDG  570

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQ---IDPQDSGNHVILSNMFASSGRWEEANLVR  805
             V  +LL AC      E GK    ++ +   I    +GN ++  NM+A  G  ++A+   
Sbjct  571  FVCSSLLNACANLSAYEQGKQIHVHILKSGFISDVFAGNALV--NMYAKCGSVDDADRAF  628

Query  806  KEMKDIGI  829
             E+ + GI
Sbjct  629  LEIPERGI  636


 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/227 (31%), Positives = 112/227 (49%), Gaps = 8/227 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + +SW ++++ Y QN   ++A+ +F+   +EG       +S +L + A L A E+ + 
Sbjct  431  EHDVISWNAIISGYSQNGEDKEAISLFIDMLKEGFGFNRTTLSVILKSTAVLQASEVVKQ  490

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +KA  E + +V + L+D YGKC  IED  R F E P  ++ ++ ++I  Y+  G 
Sbjct  491  VHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDATRIFEECPFGDVASFTSMITAYSQYGQ  550

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL LF  M     D+      FVC  +L AC+   A E G  I   +  K G     
Sbjct  551  GEEALKLFLKML----DMGLRPDGFVCSSLLNACANLSAYEQGKQIHVHIL-KSGFISDV  605

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
                 +V+M  + G V+ A      +P R  VS W A++G    HG+
Sbjct  606  FAGNALVNMYAKCGSVDDADRAFLEIPERGIVS-WSAMIGGLAQHGQ  651


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 82/181 (45%), Gaps = 4/181 (2%)
 Frame = +2

Query  113  PTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERA  292
            PT  + S +L  C+   + + G  IH  ++K+   E+  +R+ L+++Y K          
Sbjct  63   PTSNVYSKLLVECSSSKSLKQGMQIHAHIIKSGFSEDTALRNHLINLYSKRQIFCFARNL  122

Query  293  FYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAG  472
              E+PE +L++W+ALI GYA  G    AL  F +M   +  V  N  TF  VL ACS   
Sbjct  123  IDEIPEPDLVSWSALISGYAQNGFGKEALSAFIEM--HSSGVKCNEFTFPSVLKACSITK  180

Query  473  AVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGAL  652
             ++ G  I   +    G E        +V M  + G +E        +P R  +S W AL
Sbjct  181  DLKGGKQI-HGIVVVTGYESDVFVANTLVVMYAKCGELEDCKRLFDEIPERNVIS-WNAL  238

Query  653  L  655
             
Sbjct  239  F  239


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 65/128 (51%), Gaps = 6/128 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAAFELG  178
            ER  VSW +++    Q+  G +AL +F +  EEG+ P    + SVL AC  AGL A E  
Sbjct  633  ERGIVSWSAMIGGLAQHGQGREALSLFHQMLEEGVFPNHITLVSVLCACNHAGLIA-EAK  691

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAH  355
            +    +  +  +E      + +VD+ G+ G +++      +MP E N   W AL+G  A 
Sbjct  692  QYFESMDKQFGIEPMQEHYACMVDLLGRAGRLDEAVELVNKMPFEANASVWGALLG--AS  749

Query  356  QGHANMAL  379
            + H N+ L
Sbjct  750  RIHGNLEL  757



>ref|XP_006655248.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Oryza brachyantha]
Length=584

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 180/277 (65%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSW S++A   QN    +A+ +F + + EGIEP    +  V+ A A +AA   GRS
Sbjct  174  ELNVVSWTSIVACCVQNGKDLEAVDIFREMQSEGIEPNSVTIPCVVPAFANVAALMHGRS  233

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H   ++     +++V S LVDMY KCG + D    F  MP RN+++WNA+IGGYA  G 
Sbjct  234  AHCFSLRKGFVHDIYVGSSLVDMYAKCGKVRDARMIFDAMPSRNVVSWNAMIGGYAMHGE  293

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  AL+LF  M    +   P+ VTF CVL ACS+AG  E G   F  M+DK+GI P  EH
Sbjct  294  ATNALELFHSMQSSKEK--PDLVTFTCVLGACSQAGRTEEGRHYFNEMQDKHGISPRMEH  351

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+V +LGRAG ++ AY+ I +MP  P   +WG+LLG+CRVHG   L +IAA+NLFQ++
Sbjct  352  YACMVTLLGRAGKLDDAYDVINQMPFEPDSCIWGSLLGSCRVHGNVVLAEIAAENLFQLE  411

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+++GN+V+LSN++AS   W+  N VR  MK++G+KK
Sbjct  412  PENAGNYVLLSNIYASKKMWDGVNRVRDMMKNVGLKK  448


 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/260 (27%), Positives = 109/260 (42%), Gaps = 39/260 (15%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N ++W  +++   ++     A+   ++   EG  P    VS  LSA   +    +G  
Sbjct  38   EPNVITWNGIVSGLNRSGRARDAVLTLVRMHAEGFLPDATGVSCALSAVGDVGDVSVGEQ  97

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG  VKA    +  V + L+DMYGKCG   +  R F E    ++ + NALI G +    
Sbjct  98   LHGCAVKAGCRVDACVATALIDMYGKCGRAGEIVRVFDESSHMDVASCNALIAGLSRNAQ  157

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL LF +   +  ++  N V++  ++  C + G     +DIF  M+ + GIEP +  
Sbjct  158  VSEALRLFREFVGRGVEL--NVVSWTSIVACCVQNGKDLEAVDIFREMQSE-GIEPNSVT  214

Query  545  YACV-----------------------------------VDMLGRAGMVERAYEFIKRMP  619
              CV                                   VDM  + G V  A      MP
Sbjct  215  IPCVVPAFANVAALMHGRSAHCFSLRKGFVHDIYVGSSLVDMYAKCGKVRDARMIFDAMP  274

Query  620  IRPTVSVWGALLGACRVHGK  679
             R  VS W A++G   +HG+
Sbjct  275  SRNVVS-WNAMIGGYAMHGE  293



>gb|ADE77505.1| unknown [Picea sitchensis]
Length=514

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 184/277 (66%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ VSW +++A Y QN  G+++L VF + R+ G++   F++ SVLSACA LAA ELGR 
Sbjct  104  ERDVVSWTAVIAGYAQNGYGDESLNVFNQMRKTGMKSDRFIMGSVLSACADLAALELGRQ  163

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H  VV++    ++ V S LVDMY K G +ED  + F +MP+RN ++WN++I G A  G 
Sbjct  164  FHAYVVQSGFALDIVVGSALVDMYAKSGSMEDACQVFDKMPQRNEVSWNSIITGCAQHGR  223

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N A+ LFE M +    + PN ++FV VL+ACS  G V  G   F  M   YGI P   H
Sbjct  224  GNDAVLLFEQMLQA--GIKPNEISFVGVLSACSHTGLVNEGRGYFNLMTQNYGIVPDVSH  281

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C++D+LGRAG ++ A  FI  MP+ P VSVWGALLGACR+HG  EL K  A++L  ++
Sbjct  282  YTCMIDLLGRAGCLDEAENFINGMPVEPDVSVWGALLGACRIHGNTELAKRIAEHLLGME  341

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             Q +G +V+LSN++A++G+W++A  VRK MKD G+ K
Sbjct  342  VQIAGIYVLLSNIYAAAGQWDDAAKVRKLMKDRGVMK  378


 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/247 (28%), Positives = 119/247 (48%), Gaps = 43/247 (17%)
 Frame = +2

Query  101  EGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIED  280
            +G++P +F +S+V+ ACA +A+ E G+  H  ++K   E +V V++ LV MY +CG +ED
Sbjct  4    KGVKPNQFTLSTVVKACASIASLEQGKQAHNYIIKMGFESDVVVQTALVHMYARCGSLED  63

Query  281  CERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTAC  460
                F +M ER+  TWNA+I G+A       AL LF +M+ +      + V++  V+   
Sbjct  64   AGHVFDKMSERSTRTWNAMITGHAQNRDMKKALKLFYEMSER------DVVSWTAVIAGY  117

Query  461  SRAGAVETGMDIFEAMK-------------------DKYGIEPGAEHYACV---------  556
            ++ G  +  +++F  M+                   D   +E G + +A V         
Sbjct  118  AQNGYGDESLNVFNQMRKTGMKSDRFIMGSVLSACADLAALELGRQFHAYVVQSGFALDI  177

Query  557  ------VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                  VDM  ++G +E A +   +MP R  VS W +++  C  HG+     +  + + Q
Sbjct  178  VVGSALVDMYAKSGSMEDACQVFDKMPQRNEVS-WNSIITGCAQHGRGNDAVLLFEQMLQ  236

Query  719  --IDPQD  733
              I P +
Sbjct  237  AGIKPNE  243



>ref|XP_010270910.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Nelumbo nucifera]
 ref|XP_010270911.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Nelumbo nucifera]
 ref|XP_010270912.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Nelumbo nucifera]
 ref|XP_010270913.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Nelumbo nucifera]
 ref|XP_010270914.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Nelumbo nucifera]
Length=658

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 183/276 (66%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW +L+A + +   GE  L++F +   E  +PT F  SSV S CA + A E G+ +
Sbjct  250  RNEVSWNALIAGHARKGEGENTLRLFWEMLREDYKPTHFTYSSVFSGCASVGALEQGKWV  309

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  ++K+  +   F+ + LVDMY K G I+D  + F  +  R++++WN+++ G A  G A
Sbjct  310  HAYMIKSGGKLIAFLGNTLVDMYAKSGSIDDARKVFNRLETRDVVSWNSILTGCAQHGLA  369

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              +L  FE+M R    V PN +TF+CVLTACS  G +  G   FE MK KY +EP  EHY
Sbjct  370  RESLSRFEEMLR--IGVKPNEITFLCVLTACSHGGLLNEGQHYFELMK-KYQVEPKVEHY  426

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              +VD+LGRAG++++A EFI  MPI PT +VWGALLGACR+HG  ELG  AA+ +F++DP
Sbjct  427  VTIVDLLGRAGLLDQAKEFIGEMPIEPTAAVWGALLGACRMHGNMELGTFAAERVFELDP  486

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSG HV+L N++AS+GRW +A  VRK MK+ G+KK
Sbjct  487  HDSGPHVLLYNIYASAGRWVDAATVRKMMKESGVKK  522


 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 123/227 (54%), Gaps = 12/227 (5%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ V+W +++  Y QND  E+A+++F +  + G++P ++  SS+L A     + + GR I
Sbjct  149  KDMVTWTAMITGYSQNDKAEEAIELFPQMLKLGLKPNQYTFSSLLKASGAAPSDKNGRQI  208

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H    K   E NV+V S L+DMY + G +E+ +  F  M  RN ++WNALI G+A +G  
Sbjct  209  HAFCTKYGYESNVYVGSSLLDMYARFGKMEEAQLVFDGMVTRNEVSWNALIAGHARKGEG  268

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               L LF +M R  +D  P + T+  V + C+  GA+E G  +       Y I+ G +  
Sbjct  269  ENTLRLFWEMLR--EDYKPTHFTYSSVFSGCASVGALEQGKWV-----HAYMIKSGGKLI  321

Query  548  A----CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            A     +VDM  ++G ++ A +   R+  R  VS W ++L  C  HG
Sbjct  322  AFLGNTLVDMYAKSGSIDDARKVFNRLETRDVVS-WNSILTGCAQHG  367


 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 117/242 (48%), Gaps = 16/242 (7%)
 Frame = +2

Query  107  IEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCE  286
            I+P   + + +L  C  L   + G+ +H  ++ +  + ++++++ ++ MY KCGC++D  
Sbjct  81   IDPDPMLYNKLLKKCTQLKRVKEGKIVHAHILNSKFKSDLYIQNSILHMYAKCGCLDDAR  140

Query  287  RAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSR  466
              F EMP ++++TW A+I GY+    A  A++LF  M +    + PN  TF  +L A   
Sbjct  141  SLFNEMPLKDMVTWTAMITGYSQNDKAEEAIELFPQMLK--LGLKPNQYTFSSLLKASGA  198

Query  467  AGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWG  646
            A + + G  I  A   KYG E      + ++DM  R G +E A      M  R  VS W 
Sbjct  199  APSDKNGRQI-HAFCTKYGYESNVYVGSSLLDMYARFGKMEEAQLVFDGMVTRNEVS-WN  256

Query  647  ALLGACRVHGKPELGKIAADNLFQIDPQD-SGNHVILSNMFA--------SSGRWEEANL  799
            AL+     H +   G+      +++  +D    H   S++F+          G+W  A +
Sbjct  257  ALIAG---HARKGEGENTLRLFWEMLREDYKPTHFTYSSVFSGCASVGALEQGKWVHAYM  313

Query  800  VR  805
            ++
Sbjct  314  IK  315


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + R+ VSW S+L    Q+ L  ++L  F +    G++P E     VL+AC+       G+
Sbjct  349  ETRDVVSWNSILTGCAQHGLARESLSRFEEMLRIGVKPNEITFLCVLTACSHGGLLNEGQ  408

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAHQ  358
                L+ K  VE  V     +VD+ G+ G ++  +    EMP E     W AL+G  A +
Sbjct  409  HYFELMKKYQVEPKVEHYVTIVDLLGRAGLLDQAKEFIGEMPIEPTAAVWGALLG--ACR  466

Query  359  GHANMALDLF  388
             H NM L  F
Sbjct  467  MHGNMELGTF  476



>ref|XP_008386604.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Malus domestica]
Length=496

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 184/278 (66%), Gaps = 5/278 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +++A Y QN+    ALK+F    E G+ PTE  +   LSAC  L    LG+ 
Sbjct  205  ERNVVSWNAMIAGYTQNNRPNDALKLFYGMVESGMVPTEDSLVCALSACGQLGCLYLGQW  264

Query  185  IHGLVV-KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            IH   + +  +  +V + + L+DMY KCG I    + F EMPERN+++WN +I  YA  G
Sbjct  265  IHNYYIDQKRILRSVILGNALMDMYAKCGGINXAAQLFNEMPERNVVSWNTMIAAYA--G  322

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HA  AL LF+ M  K+  + P+ +TFV VL+ACS  G V  G D FE+M   +GIEP  E
Sbjct  323  HAKQALTLFDQM--KSTGLKPDSITFVAVLSACSHGGLVSEGKDHFESMARDHGIEPKKE  380

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC++D+LGR G++E AYE I +MP+ PT S WGALL AC++HG  E+ K++A+ L ++
Sbjct  381  HYACMIDLLGRVGLLEEAYELINKMPMEPTESAWGALLNACKIHGNVEMAKLSAERLLEL  440

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSG +V+L+N+ A++ RW++  +VR  MK+ G+KK
Sbjct  441  DPEDSGIYVLLANLCANTKRWDDVQIVRSMMKERGVKK  478


 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/258 (28%), Positives = 117/258 (45%), Gaps = 34/258 (13%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +++  Y  ++  ++A+++F       +EP E  + +V SAC+      +G+S+
Sbjct  74   RDVVTWTAMIDGYAGSNCSDEAMELFGSMLLSNVEPNEVTMIAVXSACSEKGGIGMGKSV  133

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCI------------------------------E  277
            H  + K  V  ++ + + L+DMY KCGC+                               
Sbjct  134  HZYIQKKSVNCSLNLLNALLDMYVKCGCLLAAQETFDNMKVRDVFSWTSMVNGYAKCGDL  193

Query  278  DCERAFY-EMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
            D  R F+ +MPERN+++WNA+I GY      N AL LF  M      +VP   + VC L+
Sbjct  194  DSARKFFDDMPERNVVSWNAMIAGYTQNNRPNDALKLFYGMVE--SGMVPTEDSLVCALS  251

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC + G +  G  I     D+  I         ++DM  + G +  A +    MP R  V
Sbjct  252  ACGQLGCLYLGQWIHNYYIDQKRILRSVILGNALMDMYAKCGGINXAAQLFNEMPERNVV  311

Query  635  SVWGALLGACRVHGKPEL  688
            S W  ++ A   H K  L
Sbjct  312  S-WNTMIAAYAGHAKQAL  328


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 87/185 (47%), Gaps = 4/185 (2%)
 Frame = +2

Query  101  EGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIED  280
            EG+E         L AC        G SIH ++ K   + ++ VR+ L+  Y + G +  
Sbjct  4    EGVEMDGRSFVFALXACGQFGRVLEGDSIHCVIWKMGFDSDLLVRNGLLHYYAEGGFLSL  63

Query  281  CERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTAC  460
              + F E   R+++TW A+I GYA    ++ A++LF  M     +V PN VT + V +AC
Sbjct  64   ARKVFDESSXRDVVTWTAMIDGYAGSNCSDEAMELFGSML--LSNVEPNEVTMIAVXSAC  121

Query  461  SRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSV  640
            S  G +  G  + + ++ K  +         ++DM  + G +  A E    M +R   S 
Sbjct  122  SEKGGIGMGKSVHZYIQKK-SVNCSLNLLNALLDMYVKCGCLLAAQETFDNMKVRDVFS-  179

Query  641  WGALL  655
            W +++
Sbjct  180  WTSMV  184



>gb|KDO78644.1| hypothetical protein CISIN_1g047067mg, partial [Citrus sinensis]
Length=566

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 183/278 (66%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + +N VSW +L+A + +   GEKAL+ F +   EG EPT F  SSV +A A   + E G+
Sbjct  156  ESKNEVSWNALIAGHARKSEGEKALRTFSEMLREGFEPTHFSYSSVFTALASTGSLEQGK  215

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  V+K+  +   FV + LVDMY K G IED E+ F  + +R++++WN+++ G A  G
Sbjct  216  WVHAHVIKSGGQLVAFVGNTLVDMYAKSGSIEDAEKVFNRLLKRDVVSWNSMLTGCAQHG  275

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                 +  FE M R    + PN VTF+CVLTACS AG ++ G   F  MK K+G+EP   
Sbjct  276  LGKATVRWFEKMLR--NGIAPNQVTFLCVLTACSHAGLLDEGQGYFALMK-KHGVEPEEA  332

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY   VD+LGRAG+++RA +FI+ MPI PT +VWGALLGACR+H   ELG  AA+ +F++
Sbjct  333  HYVTFVDLLGRAGLLDRALKFIREMPIEPTAAVWGALLGACRMHKNVELGAYAAERIFEL  392

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP DSG H++L+N++AS+GR  +A   RK MK+ G+KK
Sbjct  393  DPHDSGPHILLANIYASAGRLNDAARARKMMKESGVKK  430


 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 123/234 (53%), Gaps = 16/234 (7%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC-AGLAAFELGRS  184
            ++ V+W +L++ Y QND  E A+ +F +    G++P +F +SSVL A  AG    + GR 
Sbjct  56   KDMVTWTALISGYSQNDQPENAIILFSQMLRLGLKPNQFTLSSVLKASGAGATDDKFGRQ  115

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   +K   + NV+V S L+DMY +   ++D    F  +  +N ++WNALI G+A +  
Sbjct  116  VHAFCLKYGYDWNVYVGSSLLDMYARFDQMDDAWFLFTALESKNEVSWNALIAGHARKSE  175

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL  F +M R  +   P + ++  V TA +  G++E G  +       + I+ G + 
Sbjct  176  GEKALRTFSEMLR--EGFEPTHFSYSSVFTALASTGSLEQGKWV-----HAHVIKSGGQL  228

Query  545  YACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGK  694
             A V    VDM  ++G +E A +   R+  R  VS W ++L  C  HG   LGK
Sbjct  229  VAFVGNTLVDMYAKSGSIEDAEKVFNRLLKRDVVS-WNSMLTGCAQHG---LGK  278


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 108/232 (47%), Gaps = 23/232 (10%)
 Frame = +2

Query  149  CAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITW  328
            C  L   +  R +H  ++ +  + ++ +++ +++ Y KCGC+++  + F EMP ++++TW
Sbjct  2    CTHLKKLKEARIVHAHILGSAFKNDIAMQNTILNAYAKCGCLDEARKLFDEMPVKDMVTW  61

Query  329  NALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF---  499
             ALI GY+       A+ LF  M R    + PN  T   VL A S AGA +   D F   
Sbjct  62   TALISGYSQNDQPENAIILFSQMLR--LGLKPNQFTLSSVLKA-SGAGATD---DKFGRQ  115

Query  500  -EAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              A   KYG +      + ++DM  R   ++ A+     +  +  VS W AL+     H 
Sbjct  116  VHAFCLKYGYDWNVYVGSSLLDMYARFDQMDDAWFLFTALESKNEVS-WNALIAG---HA  171

Query  677  KPELGKIAADNLFQIDPQD-SGNHVILSNMFAS--------SGRWEEANLVR  805
            +   G+ A     ++  +     H   S++F +         G+W  A++++
Sbjct  172  RKSEGEKALRTFSEMLREGFEPTHFSYSSVFTALASTGSLEQGKWVHAHVIK  223



>ref|XP_008245349.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Prunus mume]
Length=672

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 186/278 (67%), Gaps = 5/278 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +++A Y QN+   +ALK+F +  E G+ PTE  +  VLSAC  L   +LG+ 
Sbjct  338  ERNVVSWNAMIAGYTQNNRPSEALKLFHEMVETGLVPTENSLVCVLSACGQLGCLDLGQW  397

Query  185  IHGLVV-KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            IH   + + C++ +V + + L+DMY KCG I      F EMPERNL++WN +I GYA  G
Sbjct  398  IHHHYLNRRCIQPSVILGNALMDMYAKCGSINLATELFGEMPERNLVSWNTMIAGYA--G  455

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HAN AL  F  M  KT  + P+ +TFV VL+ACS  G V  G + FE+M   Y +EP  E
Sbjct  456  HANQALTSFNQM--KTMGLKPDDITFVAVLSACSHGGLVSQGREHFESMARDYDVEPKEE  513

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC++D+LGR G +E AY+ I +MP+   VS WGALL AC++HG  EL K++A+ L ++
Sbjct  514  HYACMIDLLGRVGRLEEAYQLINKMPMEAGVSAWGALLNACKIHGNVELAKLSAEKLLEL  573

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSG +V+L+N++A+  RW++  +VR  MK+ G++K
Sbjct  574  DPEDSGIYVLLANLYANKKRWDDVRIVRSLMKERGVRK  611


 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 123/281 (44%), Gaps = 34/281 (12%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +++  Y      ++A+K+F       +EP E  + +VLSAC+      +G++I
Sbjct  207  RDVVTWTTMIDGYATRTCSDEAMKLFGSMLVSDVEPNEVTIIAVLSACSDKGNVGVGKTI  266

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGC-------------------------------I  274
            H  V K  V  ++ + + L+DMY KCGC                               +
Sbjct  267  HEYVQKKNVNCSLNLLNALLDMYVKCGCLTVAKETFDNMKVRDVFSWTSMVNGYAKLGDL  326

Query  275  EDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
                + F +MPERN+++WNA+I GY      + AL LF +M      +VP   + VCVL+
Sbjct  327  NSARKFFNDMPERNVVSWNAMIAGYTQNNRPSEALKLFHEMVET--GLVPTENSLVCVLS  384

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC + G ++ G  I     ++  I+P       ++DM  + G +  A E    MP R  V
Sbjct  385  ACGQLGCLDLGQWIHHHYLNRRCIQPSVILGNALMDMYAKCGSINLATELFGEMPERNLV  444

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNHVILS  757
            S W  ++     H    L          + P D     +LS
Sbjct  445  S-WNTMIAGYAGHANQALTSFNQMKTMGLKPDDITFVAVLS  484


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 124/280 (44%), Gaps = 15/280 (5%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            ++ N   W +++  Y +  +       F +   + +E         L AC        G 
Sbjct  104  EKPNTYMWNTMIRGYCKVQIPTIGFSFFGQMVRQRVEMDSRSFIFALKACEQFTRILEGH  163

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+H L+ K   + ++ VR+ LV  Y + G +    + F E   R+++TW  +I GYA + 
Sbjct  164  SVHCLIWKMGFDSDLLVRNGLVHYYAEGGFLSLARKVFDESFVRDVVTWTTMIDGYATRT  223

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             ++ A+ LF  M     DV PN VT + VL+ACS  G V  G  I E ++ K  +     
Sbjct  224  CSDEAMKLFGSML--VSDVEPNEVTIIAVLSACSDKGNVGVGKTIHEYVQKK-NVNCSLN  280

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKI-AADNLFQ  718
                ++DM  + G +  A E    M +R   S W ++     V+G  +LG + +A   F 
Sbjct  281  LLNALLDMYVKCGCLTVAKETFDNMKVRDVFS-WTSM-----VNGYAKLGDLNSARKFFN  334

Query  719  IDPQD---SGNHVILSNMFASSGRWEEANLVRKEMKDIGI  829
              P+    S N +I    +  + R  EA  +  EM + G+
Sbjct  335  DMPERNVVSWNAMIAG--YTQNNRPSEALKLFHEMVETGL  372



>ref|XP_008678753.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Zea mays]
 gb|AFW62799.1| putative pentatricopeptide repeat family protein [Zea mays]
Length=882

 Score =   272 bits (696),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 183/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            +S  +++    Q D GE A+K+F++   +G+EP  F++SS+L+AC  L+A+E G+ +H  
Sbjct  476  ISSTTMMTALSQCDHGEDAIKLFVQMLRKGLEPDSFVLSSLLNACTSLSAYEQGKQVHAH  535

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     +VF  + LV  Y KCG IED + AF  +PER +++W+A+IGG A  GH   A
Sbjct  536  LIKRQFTSDVFAGNALVYAYAKCGSIEDADMAFSGLPERGIVSWSAMIGGLAQHGHGKRA  595

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            LDLF  M    + V PN++T   VL+AC+ AG V+     FE+MK+ +GI+   EHYAC+
Sbjct  596  LDLFHRML--DEGVAPNHITLTSVLSACNHAGLVDDAKKYFESMKETFGIDRTEEHYACM  653

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +E A E +  MP +   +VWGALLGA RVH  PELG++AA+ LF ++P+ S
Sbjct  654  IDILGRAGKLEDAMELVNNMPFQANAAVWGALLGASRVHRDPELGRMAAEKLFTLEPEKS  713

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N +AS+G W+E   VRK MKD  +KK
Sbjct  714  GTHVLLANTYASAGMWDEMAKVRKLMKDSNVKK  746


 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 118/226 (52%), Gaps = 6/226 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW ++++ Y +ND    A+ VF +    G  P EF  S V++AC G    E GR 
Sbjct  167  ERNAVSWNTMISAYVKNDQSGDAIGVFREMVWSGERPNEFGFSCVVNACTGSRDLEAGRQ  226

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG VV+   E++VF  + LVDMY K G IE     F +MP  ++++WNA I G    GH
Sbjct  227  VHGAVVRTGYEKDVFTANALVDMYSKLGDIEMAATVFEKMPAADVVSWNAFISGCVTHGH  286

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL+L   M  K+  +VPN  T   VL AC+ AGA   G  I   M     +    E 
Sbjct  287  DHRALELLLQM--KSSGLVPNVFTLSSVLKACAGAGAFNLGRQIHGFMVK--AVADFDEF  342

Query  545  YAC-VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
             A  +VDM  + G ++ A +    MP R  + +W AL+  C   G+
Sbjct  343  VAVGLVDMYAKHGFLDDARKVFDFMPRRDLI-LWNALISGCSHDGR  387


 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 106/198 (54%), Gaps = 1/198 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW + ++    +    +AL++ L+ +  G+ P  F +SSVL ACAG  AF LGR IHG 
Sbjct  272  VSWNAFISGCVTHGHDHRALELLLQMKSSGLVPNVFTLSSVLKACAGAGAFNLGRQIHGF  331

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            +VKA  + + FV   LVDMY K G ++D  + F  MP R+LI WNALI G +H G     
Sbjct  332  MVKAVADFDEFVAVGLVDMYAKHGFLDDARKVFDFMPRRDLILWNALISGCSHDGRHGEV  391

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF  M ++  D+  N  T   VL + + + A+     +  A+ +K G+   +     +
Sbjct  392  LSLFHRMRKEGLDLDVNRTTLASVLKSTASSEAICHTRQV-HALAEKIGLLSDSHVINGL  450

Query  557  VDMLGRAGMVERAYEFIK  610
            +D   + G ++ A +  K
Sbjct  451  IDSYWKCGQLDYAIKVFK  468


 Score =   105 bits (263),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 104/224 (46%), Gaps = 11/224 (5%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW SL+  Y  N +   AL  F   R  G+   EF +  VL  CA    F  G  +H L
Sbjct  69   VSWSSLVTAYSNNGMPRDALLAFRAMRGRGVPCNEFALPVVLK-CAPDVRF--GAQVHAL  125

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEM----PERNLITWNALIGGYAHQGH  364
             V   +  +VFV + LV +YG  G +++  R F E      ERN ++WN +I  Y     
Sbjct  126  AVATRLVHDVFVANALVAVYGGFGMVDEARRMFDEYVGVGGERNAVSWNTMISAYVKNDQ  185

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            +  A+ +F +M    +   PN   F CV+ AC+ +  +E G  +  A+  + G E     
Sbjct  186  SGDAIGVFREMVWSGER--PNEFGFSCVVNACTGSRDLEAGRQVHGAVV-RTGYEKDVFT  242

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               +VDM  + G +E A    ++MP    VS W A +  C  HG
Sbjct  243  ANALVDMYSKLGDIEMAATVFEKMPAADVVS-WNAFISGCVTHG  285


 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 132/286 (46%), Gaps = 18/286 (6%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIE--PTEFMVSSVLSACAGLAAFELG  178
             R+ + W +L++    +    + L +F + R+EG++       ++SVL + A   A    
Sbjct  369  RRDLILWNALISGCSHDGRHGEVLSLFHRMRKEGLDLDVNRTTLASVLKSTASSEAICHT  428

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            R +H L  K  +  +  V + L+D Y KCG ++   + F E    ++I+   ++   +  
Sbjct  429  RQVHALAEKIGLLSDSHVINGLIDSYWKCGQLDYAIKVFKESRSDDIISSTTMMTALSQC  488

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPG  535
             H   A+ LF  M RK  +  P+      +L AC+   A E G  +    +K ++  +  
Sbjct  489  DHGEDAIKLFVQMLRKGLE--PDSFVLSSLLNACTSLSAYEQGKQVHAHLIKRQFTSDVF  546

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF  715
            A +   +V    + G +E A      +P R  VS W A++G    HG    GK A D LF
Sbjct  547  AGN--ALVYAYAKCGSIEDADMAFSGLPERGIVS-WSAMIGGLAQHGH---GKRALD-LF  599

Query  716  Q--IDPQDSGNHVILSNMFAS---SGRWEEANLVRKEMKD-IGIKK  835
               +D   + NH+ L+++ ++   +G  ++A    + MK+  GI +
Sbjct  600  HRMLDEGVAPNHITLTSVLSACNHAGLVDDAKKYFESMKETFGIDR  645


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 14/122 (11%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLA-----  163
            ER  VSW +++    Q+  G++AL +F +  +EG+ P    ++SVLSAC  AGL      
Sbjct  573  ERGIVSWSAMIGGLAQHGHGKRALDLFHRMLDEGVAPNHITLTSVLSACNHAGLVDDAKK  632

Query  164  AFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALI  340
             FE  +   G+      EE+    + ++D+ G+ G +ED       MP + N   W AL+
Sbjct  633  YFESMKETFGI---DRTEEHY---ACMIDILGRAGKLEDAMELVNNMPFQANAAVWGALL  686

Query  341  GG  346
            G 
Sbjct  687  GA  688



>ref|XP_006467236.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Citrus sinensis]
Length=670

 Score =   268 bits (685),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 184/278 (66%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + +N VSW +L+A + +   GEKAL+ F +   EG EPT F  SSV +A A   + E G+
Sbjct  260  ESKNEVSWNALIAGHARKSEGEKALRTFSEMLREGFEPTHFSYSSVFTALASTGSLEQGK  319

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  V+K+  +   FV + LVDMY K G IED E+ F  + +R++++WN+++ G A  G
Sbjct  320  WVHAHVIKSGGQLVAFVGNTLVDMYAKSGSIEDAEKVFNRLLKRDVVSWNSMLTGCAQHG  379

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                 +  FE M R    + PN VTF+CVLTACS AG ++ G   F  MK K+G+EP   
Sbjct  380  LGKATVRWFEKMLR--NGIAPNQVTFLCVLTACSHAGLLDEGQGYFALMK-KHGVEPEEA  436

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY   VD+LGRAG+++RA +FI+ MPI PT +VWGALLGACR+H   ELG  AA+++F++
Sbjct  437  HYVTFVDLLGRAGLLDRALKFIREMPIEPTAAVWGALLGACRMHKNVELGAYAAEHIFEL  496

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP DSG H++L+N++AS+GR  +A   RK MK+ G+KK
Sbjct  497  DPHDSGPHILLANIYASAGRLNDAARARKMMKESGVKK  534


 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 123/234 (53%), Gaps = 16/234 (7%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC-AGLAAFELGRS  184
            ++ V+W +L++ Y QND  E A+ +F +    G++P +F +SSVL A  AG    + GR 
Sbjct  160  KDMVTWTALISGYSQNDQPENAIILFSQMLRLGLKPNQFTLSSVLKASGAGATDDKFGRQ  219

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   +K   + NV+V S L+DMY +   ++D    F  +  +N ++WNALI G+A +  
Sbjct  220  VHAFCLKYGYDWNVYVGSSLLDMYARFDQMDDAWFLFTALESKNEVSWNALIAGHARKSE  279

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL  F +M R  +   P + ++  V TA +  G++E G  +   +     I+ G + 
Sbjct  280  GEKALRTFSEMLR--EGFEPTHFSYSSVFTALASTGSLEQGKWVHAHV-----IKSGGQL  332

Query  545  YACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGK  694
             A V    VDM  ++G +E A +   R+  R  VS W ++L  C  HG   LGK
Sbjct  333  VAFVGNTLVDMYAKSGSIEDAEKVFNRLLKRDVVS-WNSMLTGCAQHG---LGK  382


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 122/265 (46%), Gaps = 24/265 (9%)
 Frame = +2

Query  50   QNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVF  229
            Q+D G   L V        +EP   + +++L  C  L   +  R +H  ++ +  + ++ 
Sbjct  74   QHDSG-TGLHVLDLINRGSLEPDRSIYNTLLKKCTHLKKLKEARIVHAHILGSAFKNDIA  132

Query  230  VRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKT  409
            +++ +++ Y KCGC+++  + F EMP ++++TW ALI GY+       A+ LF  M R  
Sbjct  133  MQNTILNAYAKCGCLDEARKLFDEMPVKDMVTWTALISGYSQNDQPENAIILFSQMLR--  190

Query  410  QDVVPNYVTFVCVLTACSRAGAVETGMDIF----EAMKDKYGIEPGAEHYACVVDMLGRA  577
              + PN  T   VL A S AGA +   D F     A   KYG +      + ++DM  R 
Sbjct  191  LGLKPNQFTLSSVLKA-SGAGATD---DKFGRQVHAFCLKYGYDWNVYVGSSLLDMYARF  246

Query  578  GMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQD-SGNHVIL  754
              ++ A+     +  +  VS W AL+     H +   G+ A     ++  +     H   
Sbjct  247  DQMDDAWFLFTALESKNEVS-WNALIAG---HARKSEGEKALRTFSEMLREGFEPTHFSY  302

Query  755  SNMFAS--------SGRWEEANLVR  805
            S++F +         G+W  A++++
Sbjct  303  SSVFTALASTGSLEQGKWVHAHVIK  327



>emb|CDP09094.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 179/264 (68%), Gaps = 1/264 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW S+++ + QN   ++A   F +  + G  P+   +S +L ACA  A  + G+ 
Sbjct  266  EPDMVSWTSVISGFVQNFRNKEAFDTFKRMLDAGTRPSTATISGLLPACATAADIKHGKE  325

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  +   +E+++FVRS L+DMY KCG I +    F  MPERN +TWN++I GYA+ GH
Sbjct  326  IHGYTIVMEMEKDIFVRSALIDMYAKCGYINEARGLFDNMPERNTVTWNSMIFGYANHGH  385

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            ++ A++LF  M R+ +  + N++TF   LTACS AG V  G  +F+ M++KYGIEP  EH
Sbjct  386  SDKAIELFNKMLREEEREL-NHLTFTAALTACSHAGMVPLGESLFQLMQEKYGIEPRLEH  444

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LG+AG +  AY FI+RMP+ P + VWGALLGACR HG  +L +IAAD L +++
Sbjct  445  YACVVDLLGKAGKLAEAYGFIQRMPVEPDLFVWGALLGACRQHGNVDLAEIAADQLVKLE  504

Query  725  PQDSGNHVILSNMFASSGRWEEAN  796
            P+  G+ V+LSN++++S RW +A 
Sbjct  505  PESRGSSVLLSNLYSASSRWGKAT  528


 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/227 (31%), Positives = 117/227 (52%), Gaps = 6/227 (3%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            W +L+  Y +N L ++A+ VF + ++EG +P+EF++ S L AC  L+    G ++H LVV
Sbjct  101  WVALIGAYARNGLYQEAMHVFSEMQKEGRKPSEFVIPSALKACGHLSDMRTGETLHALVV  160

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
            K   + + FV S L+DMY KC  I+  +R F  M +++L+  NA++ GY   G    AL 
Sbjct  161  KYDFDSDAFVISALIDMYSKCVNIKSAKRVFDGMADKDLVALNAMVSGYVQHGIVKQALV  220

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            L ++M  K   +  N +T+  ++   S+        + F  M+ K G+EP    +  V+ 
Sbjct  221  LVQEM--KLLGMKTNVITWNTIIAGFSQENDEVMVWETFRLMR-KDGVEPDMVSWTSVIS  277

Query  563  MLGRAGMVERAYEFIKRM---PIRPTVSVWGALLGACRVHGKPELGK  694
               +    + A++  KRM     RP+ +    LL AC      + GK
Sbjct  278  GFVQNFRNKEAFDTFKRMLDAGTRPSTATISGLLPACATAADIKHGK  324


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 75/167 (45%), Gaps = 4/167 (2%)
 Frame = +2

Query  176  GRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAH  355
            GR++H  ++   +       S L+  Y +C  +   ++ F E+P+ N+  W ALIG YA 
Sbjct  51   GRALHAHLIINGLACKPHFASKLIAFYTECKQLSHAQKLFDEIPKSNVRRWVALIGAYAR  110

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPG  535
             G    A+ +F +M ++ +   P+       L AC     + TG +   A+  KY  +  
Sbjct  111  NGLYQEAMHVFSEMQKEGRK--PSEFVIPSALKACGHLSDMRTG-ETLHALVVKYDFDSD  167

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            A   + ++DM  +   ++ A      M  +  V++  A++     HG
Sbjct  168  AFVISALIDMYSKCVNIKSAKRVFDGMADKDLVAL-NAMVSGYVQHG  213



>ref|XP_007214219.1| hypothetical protein PRUPE_ppa023254mg [Prunus persica]
 gb|EMJ15418.1| hypothetical protein PRUPE_ppa023254mg [Prunus persica]
Length=563

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 184/278 (66%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + +N VSW +L+A + +   GE AL++F K   EG +PT F  SSV +ACA   + E G+
Sbjct  153  ETKNEVSWNALIAGHARKAQGEHALRLFWKMLREGFKPTHFTYSSVFTACASAGSMEQGK  212

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  ++K+  +   FV + L+DMY K G IED  + F  +  +++++WN+++ GYA  G
Sbjct  213  WVHAHMIKSGAKLVAFVGNTLLDMYAKSGSIEDARKVFDRLVRQDIVSWNSMLTGYAQHG  272

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                 +  FE+M R    + PN +TF+CVLTACS AG ++ G   F+ MK  Y IE    
Sbjct  273  LGQETVQRFEEMLRI--GIQPNDITFLCVLTACSHAGLLDEGQYYFDLMK-SYNIELQIS  329

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY  +VD+LGRAG+++RA +FI+ MPI PT +VWGALLGACR+H   +LG  AA+ +F++
Sbjct  330  HYVTIVDLLGRAGLLDRAAKFIREMPIEPTAAVWGALLGACRMHKNIDLGAYAAERVFEL  389

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP DSG HV+LSN++AS+GR  +A  VRK MKD G+KK
Sbjct  390  DPHDSGPHVLLSNIYASAGRLSDAARVRKLMKDCGVKK  427


 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 122/229 (53%), Gaps = 14/229 (6%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLA--AFELGR  181
            ++ V+W +L++ Y Q D  + AL +F +    G+EP +F +SS+  A   ++    + GR
Sbjct  52   KDLVTWTALISGYSQYDRPQDALVLFPQMLLRGLEPNQFTLSSLFKAAGAVSDDNNKHGR  111

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H   +K   + NV+V + LVDMY + G +++ +  F  +  +N ++WNALI G+A + 
Sbjct  112  QLHAYCLKYGFDTNVYVGTSLVDMYARWGHMDESQLIFDSLETKNEVSWNALIAGHARKA  171

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                AL LF  M R  +   P + T+  V TAC+ AG++E G  +   M     I+ GA+
Sbjct  172  QGEHALRLFWKMLR--EGFKPTHFTYSSVFTACASAGSMEQGKWVHAHM-----IKSGAK  224

Query  542  HYACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              A V    +DM  ++G +E A +   R+ +R  +  W ++L     HG
Sbjct  225  LVAFVGNTLLDMYAKSGSIEDARKVFDRL-VRQDIVSWNSMLTGYAQHG  272


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 104/233 (45%), Gaps = 17/233 (7%)
 Frame = +2

Query  158  LAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNAL  337
            +   +  R +H  ++ +  ++++ + + +++MY KCG +ED    F +MP ++L+TW AL
Sbjct  1    MGRLQQARIVHAHILTSHFKDDLPIHNTILNMYVKCGSLEDARNLFDQMPSKDLVTWTAL  60

Query  338  IGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMD----IFEA  505
            I GY+       AL LF  M  +  +  PN  T   +  A   AGAV    +       A
Sbjct  61   ISGYSQYDRPQDALVLFPQMLLRGLE--PNQFTLSSLFKA---AGAVSDDNNKHGRQLHA  115

Query  506  MKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
               KYG +        +VDM  R G ++ +      +  +  VS W AL+     H +  
Sbjct  116  YCLKYGFDTNVYVGTSLVDMYARWGHMDESQLIFDSLETKNEVS-WNALIAG---HARKA  171

Query  686  LGKIAADNLFQIDPQD-SGNHVILSNMF---ASSGRWEEANLVRKEMKDIGIK  832
             G+ A    +++  +     H   S++F   AS+G  E+   V   M   G K
Sbjct  172  QGEHALRLFWKMLREGFKPTHFTYSSVFTACASAGSMEQGKWVHAHMIKSGAK  224



>ref|XP_008799669.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 
[Phoenix dactylifera]
 ref|XP_008799670.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 
[Phoenix dactylifera]
 ref|XP_008799671.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 
[Phoenix dactylifera]
 ref|XP_008799672.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 
[Phoenix dactylifera]
Length=646

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 197/278 (71%), Gaps = 4/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ V+W S++A Y QNDL E+AL++F KA++ G+E T++ +S++LSACA LAA   G  
Sbjct  236  EKSPVTWSSMVAGYVQNDLHEEALRLFQKAQQIGVELTQYTMSAILSACASLAATIEGIQ  295

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +++++ +  +VFV + L+D+Y +CGC+E+    F  M +RN++ WNA+I G++    
Sbjct  296  LHAILIRSGLSTDVFVSTALIDVYSRCGCVEEAYLVFAYMEDRNIVLWNAMIAGFSKHAR  355

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEA-MKDKYGIEPGAE  541
             + A+ LFE M  +   + PN VT++ VL+AC  AG +E G   F+  M+D Y ++P   
Sbjct  356  FHEAMILFEKM--QQLGMHPNEVTYISVLSACGHAGLIEKGHHYFDLLMRDNY-VQPNVL  412

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY+C+VD LGRAG ++ A+E I++MP + T S+WG+LL +CR+HG  +L K AA++LF++
Sbjct  413  HYSCMVDALGRAGHIDEAWELIQKMPFKATASMWGSLLSSCRIHGNLKLAKTAAEHLFEL  472

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +P ++GNHV+LSN++A++ +W + ++ RK +KD G KK
Sbjct  473  EPNNAGNHVLLSNIYATNKKWGDVSMARKLLKDSGAKK  510


 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 122/241 (51%), Gaps = 10/241 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW +++A +       +ALK+FL+   EG   +EF +SSVL ACA   A    + +
Sbjct  136  RSIVSWNTMIAGHTHYGEDREALKLFLQMHREGTMLSEFTLSSVLCACASRCAVTESKQL  195

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L +K  ++ NVFV + ++D+Y KC  I D  R F +MPE++ +TW++++ GY      
Sbjct  196  HALALKTAMDSNVFVGTAVLDVYAKCNMINDACRVFEKMPEKSPVTWSSMVAGYVQNDLH  255

Query  368  NMALDLFEDMTRKTQDV---VPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
              AL LF+    K Q +   +  Y T   +L+AC+   A   G+ +  A+  + G+    
Sbjct  256  EEALRLFQ----KAQQIGVELTQY-TMSAILSACASLAATIEGIQL-HAILIRSGLSTDV  309

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                 ++D+  R G VE AY     M  R  V +W A++     H +     I  + + Q
Sbjct  310  FVSTALIDVYSRCGCVEEAYLVFAYMEDRNIV-LWNAMIAGFSKHARFHEAMILFEKMQQ  368

Query  719  I  721
            +
Sbjct  369  L  369


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 87/177 (49%), Gaps = 4/177 (2%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP  307
            +  +L  CA      LGRS HGL ++A    ++   ++L+++Y KCG I    R F  MP
Sbjct  75   LQDLLHLCAKKNLIVLGRSCHGLAIQAGQLTDILTCNILINLYSKCGHIGSARRVFDRMP  134

Query  308  ERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETG  487
             R++++WN +I G+ H G    AL LF  M R  +  + +  T   VL AC+   AV   
Sbjct  135  VRSIVSWNTMIAGHTHYGEDREALKLFLQMHR--EGTMLSEFTLSSVLCACASRCAVTES  192

Query  488  MDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              +  A+  K  ++        V+D+  +  M+  A    ++MP +  V+ W +++ 
Sbjct  193  KQL-HALALKTAMDSNVFVGTAVLDVYAKCNMINDACRVFEKMPEKSPVT-WSSMVA  247


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/169 (24%), Positives = 76/169 (45%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            ++RN V W +++A + ++    +A+ +F K ++ G+ P E    SVLSAC      E G 
Sbjct  336  EDRNIVLWNAMIAGFSKHARFHEAMILFEKMQQLGMHPNEVTYISVLSACGHAGLIEKGH  395

Query  182  SIHGLVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLIT-WNALIGGYAH  355
                L+++   V+ NV   S +VD  G+ G I++      +MP +   + W +L+     
Sbjct  396  HYFDLLMRDNYVQPNVLHYSCMVDALGRAGHIDEAWELIQKMPFKATASMWGSLLSSCRI  455

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFE  502
             G+  +A    E +     +   N+V    +     + G V     + +
Sbjct  456  HGNLKLAKTAAEHLFELEPNNAGNHVLLSNIYATNKKWGDVSMARKLLK  504



>ref|XP_008350106.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g22410, mitochondrial-like [Malus domestica]
Length=664

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 184/278 (66%), Gaps = 5/278 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +++A Y QN+    ALK+F    E G+ PTE  +   LSAC  L    LG+ 
Sbjct  334  ERNVVSWNAMIAGYTQNNRPNDALKLFYGMVESGMVPTEDSLVCALSACGQLGCLYLGQW  393

Query  185  IHGLVV-KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            IH   + +  +  +V + + L+DMY KCG I    + F EMPERN+++WN +I  YA  G
Sbjct  394  IHNYYIDQKRILRSVILGNALMDMYAKCGGINXAAQLFNEMPERNVVSWNTMIAAYA--G  451

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HA  AL LF+ M  K+  + P+ +TFV VL+ACS  G V  G D FE+M   +GIEP  E
Sbjct  452  HAKQALTLFDQM--KSTGLKPDSITFVAVLSACSHGGLVSEGKDHFESMARDHGIEPKKE  509

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC++D+LGR G++E AYE I +MP+ PT S WGALL AC++HG  E+ K++A+ L ++
Sbjct  510  HYACMIDLLGRVGLLEEAYELINKMPMEPTESAWGALLNACKIHGNVEMAKLSAERLLEL  569

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSG +V+L+N+ A++ RW++  +VR  MK+ G+KK
Sbjct  570  DPEDSGIYVLLANLCANTKRWDDVQIVRSMMKEXGVKK  607


 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/258 (28%), Positives = 117/258 (45%), Gaps = 34/258 (13%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +++  Y  ++  ++A+++F       +EP E  + +V SAC+      +G+S+
Sbjct  203  RDVVTWTAMIDGYAGSNCSDEAMELFGSMLLSNVEPNEVTMIAVXSACSEKGGIGMGKSV  262

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCI------------------------------E  277
            H  + K  V  ++ + + L+DMY KCGC+                               
Sbjct  263  HZYIQKKSVNCSLNLLNALLDMYVKCGCLLAAQETFDNMKVRDVFSWTSMVNGYAKCGDL  322

Query  278  DCERAFY-EMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
            D  R F+ +MPERN+++WNA+I GY      N AL LF  M      +VP   + VC L+
Sbjct  323  DSARKFFDDMPERNVVSWNAMIAGYTQNNRPNDALKLFYGMVE--SGMVPTEDSLVCALS  380

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC + G +  G  I     D+  I         ++DM  + G +  A +    MP R  V
Sbjct  381  ACGQLGCLYLGQWIHNYYIDQKRILRSVILGNALMDMYAKCGGINXAAQLFNEMPERNVV  440

Query  635  SVWGALLGACRVHGKPEL  688
            S W  ++ A   H K  L
Sbjct  441  S-WNTMIAAYAGHAKQAL  457


 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 98/215 (46%), Gaps = 4/215 (2%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N   W +++  Y +  + E     F +   EG+E         L AC        G SIH
Sbjct  103  NTYMWNTMIRGYSKAQIPEIGFSFFGRMVREGVEMDGRSFVFALXACGQFGRVLEGDSIH  162

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
             ++ K   + ++ VR+ L+  Y + G +    + F E   R+++TW A+I GYA    ++
Sbjct  163  CVIWKMGFDSDLLVRNGLLHYYAEGGFLSLARKVFDESSXRDVVTWTAMIDGYAGSNCSD  222

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
             A++LF  M     +V PN VT + V +ACS  G +  G  + + ++ K  +        
Sbjct  223  EAMELFGSML--LSNVEPNEVTMIAVXSACSEKGGIGMGKSVHZYIQKK-SVNCSLNLLN  279

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
             ++DM  + G +  A E    M +R   S W +++
Sbjct  280  ALLDMYVKCGCLLAAQETFDNMKVRDVFS-WTSMV  313



>ref|XP_010908711.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Elaeis guineensis]
Length=682

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 190/278 (68%), Gaps = 3/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEG-IEPTEFMVSSVLSACAGLAAFELGR  181
            ER+ VSW S++A+Y QN L  +AL+++ K   +G +  +   +S+VL ACA   A ++G+
Sbjct  271  ERDVVSWNSMIALYAQNGLSAEALELYCKMLSDGGVRYSAVTLSAVLLACAHAGALQIGK  330

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             IH  VV+  +EE+V+V + +VDMY KCG +E   +AF  M ERN+++W+A++ GY   G
Sbjct  331  CIHDQVVRIGLEEDVYVGTSVVDMYCKCGRVEIARKAFNRMKERNILSWSAMVAGYGMHG  390

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            H   AL++F +M  +   V PN++TFV VL ACS AG V+ G   F AMK ++GI PG E
Sbjct  391  HGREALEVFYEM--RGSGVKPNHITFVSVLAACSHAGLVDDGRCWFHAMKKEFGIHPGVE  448

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY C+VD+LGRAG ++ AY  IK M I+P   VWGALL ACR+H   ELG+I+A  LF++
Sbjct  449  HYGCIVDLLGRAGCLDEAYGLIKEMTIKPDFVVWGALLSACRIHKNVELGEISAKKLFEL  508

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP++ G +V+LSN++A +GRW++   +R  MK+ G+ K
Sbjct  509  DPKNCGYYVLLSNIYADAGRWDDVQKMRVLMKNRGLVK  546


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/312 (26%), Positives = 126/312 (40%), Gaps = 49/312 (16%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            SW S +A   +     +AL  F   R   + P        L + A L++   GR +H L 
Sbjct  72   SWNSAIADLARAGDSAEALAAFASMRRLRLRPDRSSFPCALKSAAALSSLRSGRQLHLLA  131

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
             +  +  ++FV S LVDMY KC    D  RAF E P RN + W A+I GY     A  AL
Sbjct  132  FRLGLHPDLFVASALVDMYSKCREPVDARRAFDETPHRNAVLWTAMIVGYIWNDAAREAL  191

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSR-------------------------------  466
             LF++   K   +  + V  V  L+ACSR                               
Sbjct  192  SLFKEFLAKEGALSLDTVAAVAALSACSRILDRKATGGVHGLAVKVGLDMDVGVGNTLMD  251

Query  467  ----AGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRM----PI  622
                 G +E G  +F+ M ++  +      +  ++ +  + G+   A E   +M     +
Sbjct  252  AYAKGGNLEVGRKVFDGMAERDVVS-----WNSMIALYAQNGLSAEALELYCKMLSDGGV  306

Query  623  RPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS---GNHVILSNMFASSGRWEEA  793
            R +     A+L AC   G  ++GK   D + +I  ++    G  V+  +M+   GR E A
Sbjct  307  RYSAVTLSAVLLACAHAGALQIGKCIHDQVVRIGLEEDVYVGTSVV--DMYCKCGRVEIA  364

Query  794  NLVRKEMKDIGI  829
                  MK+  I
Sbjct  365  RKAFNRMKERNI  376



>ref|XP_007153023.1| hypothetical protein PHAVU_003G001300g [Phaseolus vulgaris]
 gb|ESW25017.1| hypothetical protein PHAVU_003G001300g [Phaseolus vulgaris]
Length=858

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 183/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q   GE+ALK++L+ ++  I+P  F+ SS+L+ACA L+A+E G+ +H  
Sbjct  452  VAYTSMITAYSQYGDGEEALKLYLQMQDADIKPDPFICSSLLNACAKLSAYEKGKQLHVH  511

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K     ++F  + LV+MY KCG IED +RAF+E+P R +++W+A+IGGYA  GH   A
Sbjct  512  AIKFGFMGDIFASNSLVNMYAKCGSIEDADRAFFEIPNRGIVSWSAMIGGYAQHGHGKEA  571

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF  M R    V PN++T V VL AC+ AG V  G   FE M++ +GI+P  EHYAC+
Sbjct  572  LQLFNQMLR--DGVPPNHITLVSVLCACNHAGLVNEGRQYFEKMEEMFGIKPTQEHYACM  629

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGR+G +  A E +  +P     SVWGALLGA R+H   ELG+ AA+ LF ++P  S
Sbjct  630  IDILGRSGKLNEAMELVNSIPFEADGSVWGALLGAARIHKNIELGQKAAEMLFDLEPDKS  689

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G WE    VRK MKD  +KK
Sbjct  690  GTHVLLANIYASAGMWENVAKVRKLMKDSKVKK  722


 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 119/237 (50%), Gaps = 6/237 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW SLL+ Y QN   E+AL VF +    G++  E+   SVL AC+      +GR 
Sbjct  44   EPDVVSWSSLLSGYVQNGFVEEALLVFNEMFLLGVKCNEYTFPSVLKACSMKRDLNMGRK  103

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+ V    E + FV + LV MY KCG ++D +R F  + E+N+++WNAL   Y     
Sbjct  104  VHGMAVVTGFESDGFVGNTLVVMYAKCGLLDDSKRLFGGIVEQNVVSWNALFSSYVQSEL  163

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM-DIFEAMKDKYGIEPGAE  541
               A+DLF++M R    + PN  +   +L  C  AG  + G+      +  K G++    
Sbjct  164  RGEAVDLFKEMVR--SGIRPNEFSISIILNVC--AGLQDGGLGKTLHGLMLKMGLDLDQF  219

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNL  712
                +VD   +AG +  A    + +   P V  W A++  C +H + +L  +  D +
Sbjct  220  SANALVDTYSKAGEIVGAVAVFQEIA-HPDVVSWNAVIAGCVLHDRNDLALVLLDEM  275


 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 86/311 (28%), Positives = 143/311 (46%), Gaps = 48/311 (15%)
 Frame = +2

Query  17   VSWCSLLA---VYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            VSW +++A   ++++NDL   AL +  +    G  P  F +SS L ACA +   ELGR +
Sbjct  250  VSWNAVIAGCVLHDRNDL---ALVLLDEMNSSGTSPNMFTLSSALKACAAIGCKELGRQL  306

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  ++K   + ++F    L+DMY KC  ++D  RA+  MP++++I WNALI GY+  G  
Sbjct  307  HSSLIKMDADSDLFASVGLIDMYSKCEMMDDARRAYDSMPKKDVIAWNALISGYSQCGDD  366

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE---------------TGMDIFE  502
            + A+ LF  M    +D+  N+ T   VL + +   A++               +   +  
Sbjct  367  SEAVSLFSKMY--NEDIDFNHTTISTVLKSVASLQAIKVCKQIHTISIKSGIYSDFYVIN  424

Query  503  AMKDKYG----IEPGAE-----------HYACVVDMLGRAGMVERAYEFIKRMP---IRP  628
            ++ D YG    ++  ++            Y  ++    + G  E A +   +M    I+P
Sbjct  425  SLLDTYGKCNHMDEASKIFQERTWEDLVAYTSMITAYSQYGDGEEALKLYLQMQDADIKP  484

Query  629  TVSVWGALLGACRVHGKPELGKI----AADNLFQIDPQDSGNHVILSNMFASSGRWEEAN  796
               +  +LL AC      E GK     A    F  D   S +   L NM+A  G  E+A+
Sbjct  485  DPFICSSLLNACAKLSAYEKGKQLHVHAIKFGFMGDIFASNS---LVNMYAKCGSIEDAD  541

Query  797  LVRKEMKDIGI  829
                E+ + GI
Sbjct  542  RAFFEIPNRGI  552


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 114/226 (50%), Gaps = 8/226 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ ++W +L++ Y Q     +A+ +F K   E I+     +S+VL + A L A ++ + 
Sbjct  347  KKDVIAWNALISGYSQCGDDSEAVSLFSKMYNEDIDFNHTTISTVLKSVASLQAIKVCKQ  406

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH + +K+ +  + +V + L+D YGKC  +++  + F E    +L+ + ++I  Y+  G 
Sbjct  407  IHTISIKSGIYSDFYVINSLLDTYGKCNHMDEASKIFQERTWEDLVAYTSMITAYSQYGD  466

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL L+  M  +  D+ P+   F+C  +L AC++  A E G  +      K+G     
Sbjct  467  GEEALKLYLQM--QDADIKPD--PFICSSLLNACAKLSAYEKGKQL-HVHAIKFGFMGDI  521

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
                 +V+M  + G +E A      +P R  VS W A++G    HG
Sbjct  522  FASNSLVNMYAKCGSIEDADRAFFEIPNRGIVS-WSAMIGGYAQHG  566



>ref|XP_010912584.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Elaeis guineensis]
Length=585

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/283 (45%), Positives = 183/283 (65%), Gaps = 8/283 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L++ YEQN  GE AL++F +  EEG+ PT F + SVLSACAGL     G+ 
Sbjct  239  ERNAVSWTALISGYEQNGEGEAALELFRRMMEEGVGPTPFTLVSVLSACAGLGFIARGKQ  298

Query  185  IHGLVVKACV---EENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAH  355
            +HG +V+ C+     N+F  + L+DMY K G +      F EMPER++++WN+++ G+A 
Sbjct  299  VHGFMVRRCIGLDSFNIFTSNALIDMYAKFGDMAAAGTLFDEMPERDIVSWNSMVTGFAQ  358

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPG  535
             GH   +L +FE M +    + PN+ TF+CVL+ACS AG V  G    ++M+ KYG++P 
Sbjct  359  NGHGKQSLAVFEQMMKA--GITPNHTTFLCVLSACSHAGLVLEGRRFLDSMEKKYGVQPR  416

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIR---PTVSVWGALLGACRVHGKPELGKIAAD  706
             EHYA  VD LGR   +E A EFIK +  +    +V  WGALLGACRVHG  EL + A+ 
Sbjct  417  PEHYAAFVDALGRNCQLEEAMEFIKYLHSKHEPSSVGTWGALLGACRVHGNLELAERASK  476

Query  707  NLFQIDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             LF+++P++   +V+LSN++A++GRW+    VR  MK  G +K
Sbjct  477  YLFELEPENGARYVMLSNIYAAAGRWDNVRQVRLLMKGKGFRK  519


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/268 (28%), Positives = 113/268 (42%), Gaps = 47/268 (18%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R  VS+ + ++    +    +AL +F + RE      +F V  V +ACA L A +  R 
Sbjct  108  HRGLVSYNTRISTLIHHGHHTEALNLFTRMRENH-SFDKFTVVGVATACANLGALKSLRQ  166

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCG-------------------------------C  271
            +HG  + + +E N+ + +V++D YGKCG                                
Sbjct  167  LHGAAIVSGLEFNLIMSNVMIDAYGKCGDAEVSREFFDRMGTRDVISWTSLVVAYASAHR  226

Query  272  IEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVL  451
            +E+    F  MPERN ++W ALI GY   G    AL+LF  M    + V P   T V VL
Sbjct  227  LEEAWLVFDRMPERNAVSWTALISGYEQNGEGEAALELFRRMME--EGVGPTPFTLVSVL  284

Query  452  TACSRAGAVETGMDIFEAM------KDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKR  613
            +AC+  G +  G  +   M       D + I         ++DM  + G +  A      
Sbjct  285  SACAGLGFIARGKQVHGFMVRRCIGLDSFNIFTS----NALIDMYAKFGDMAAAGTLFDE  340

Query  614  MPIRPTVSVWGALLG--ACRVHGKPELG  691
            MP R  VS W +++   A   HGK  L 
Sbjct  341  MPERDIVS-WNSMVTGFAQNGHGKQSLA  367


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 85/207 (41%), Gaps = 36/207 (17%)
 Frame = +2

Query  134  SVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYG------------------  259
            S++  C       LGR +H  ++K  +  +  V + LV +Y                   
Sbjct  19   SLIERCIATKDLRLGRHLHTHLLKTALNHHTVVANRLVHLYSLAGVLPSAVSAFTDLPFK  78

Query  260  -------------KCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMT  400
                         + G +    + F +MP R L+++N  I    H GH   AL+LF   T
Sbjct  79   NHHSYNTLLAAFCRAGHLPSARQLFDQMPHRGLVSYNTRISTLIHHGHHTEALNLF---T  135

Query  401  RKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAG  580
            R  ++   +  T V V TAC+  GA+++   +  A     G+E        ++D  G+ G
Sbjct  136  RMRENHSFDKFTVVGVATACANLGALKSLRQLHGAAIVS-GLEFNLIMSNVMIDAYGKCG  194

Query  581  MVERAYEFIKRMPIRPTVSVWGALLGA  661
              E + EF  RM  R  +S W +L+ A
Sbjct  195  DAEVSREFFDRMGTRDVIS-WTSLVVA  220



>ref|XP_010931098.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 
[Elaeis guineensis]
 ref|XP_010931099.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 
[Elaeis guineensis]
Length=646

 Score =   265 bits (678),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 195/278 (70%), Gaps = 4/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ V+W S++A Y QNDL E+AL++F KA++ G+E T++ +S++LSACA LAA   G  
Sbjct  236  EKSSVTWSSMVAGYVQNDLHEEALRLFHKAQQIGLELTQYTLSAILSACASLAATIEGTQ  295

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + +++ +  +VFV + L+D+Y +CGC+E+    F  M ++N++ WNA+I G++    
Sbjct  296  LHAISIRSGLNTDVFVATALIDVYSRCGCVEEAYLVFAHMEDKNIVLWNAMIAGFSRHAR  355

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEA-MKDKYGIEPGAE  541
             + A+ LFE M  +   + PN VT++ VL+AC  AG VE G   F+  M+D Y ++    
Sbjct  356  FHEAMILFEKM--QQLGMHPNEVTYISVLSACGHAGLVEKGHHYFDLLMRDNY-VQHNVL  412

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY+C+VD+LGRAG ++ A+E I++MP + T SVWG+LL +CR+HG  +L K AA +LF++
Sbjct  413  HYSCMVDVLGRAGHIDEAWELIQKMPFKATASVWGSLLSSCRIHGNLKLAKTAAKHLFEL  472

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +P ++GNHV+LSN++A++ +W + ++ RK +KD G KK
Sbjct  473  EPNNAGNHVLLSNIYAANKKWGDVSMARKLLKDTGAKK  510


 Score =   119 bits (299),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 121/241 (50%), Gaps = 10/241 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW +++A +       +ALK+FL+   EG   +EF +SSVL ACA  +A    + +
Sbjct  136  RSIVSWNTMIAGHTHYGEDREALKLFLQMHREGTTLSEFTLSSVLCACASRSAVIESKQL  195

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L +K  V+ NVFV + ++D+Y KC  I+D    F EMPE++ +TW++++ GY      
Sbjct  196  HALALKTAVDSNVFVGTAVLDVYAKCNMIDDACLVFDEMPEKSSVTWSSMVAGYVQNDLH  255

Query  368  NMALDLFEDMTRKTQDV---VPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
              AL LF     K Q +   +  Y T   +L+AC+   A   G  +  A+  + G+    
Sbjct  256  EEALRLFH----KAQQIGLELTQY-TLSAILSACASLAATIEGTQL-HAISIRSGLNTDV  309

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                 ++D+  R G VE AY     M  +  V +W A++     H +     I  + + Q
Sbjct  310  FVATALIDVYSRCGCVEEAYLVFAHMEDKNIV-LWNAMIAGFSRHARFHEAMILFEKMQQ  368

Query  719  I  721
            +
Sbjct  369  L  369


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 90/178 (51%), Gaps = 6/178 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP  307
            +  +L  CA      LGRS HGL ++A +  ++   ++L+++Y KCG IE   R F  MP
Sbjct  75   LQDLLHLCARKKLIVLGRSCHGLAIQAGLLTDILTCNILINLYSKCGHIEFARRVFDRMP  134

Query  308  ERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTAC-SRAGAVET  484
             R++++WN +I G+ H G    AL LF  M R  +    +  T   VL AC SR+  +E+
Sbjct  135  VRSIVSWNTMIAGHTHYGEDREALKLFLQMHR--EGTTLSEFTLSSVLCACASRSAVIES  192

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
                  A+  K  ++        V+D+  +  M++ A      MP + +V+ W +++ 
Sbjct  193  KQ--LHALALKTAVDSNVFVGTAVLDVYAKCNMIDDACLVFDEMPEKSSVT-WSSMVA  247


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 78/169 (46%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +++N V W +++A + ++    +A+ +F K ++ G+ P E    SVLSAC      E G 
Sbjct  336  EDKNIVLWNAMIAGFSRHARFHEAMILFEKMQQLGMHPNEVTYISVLSACGHAGLVEKGH  395

Query  182  SIHGLVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLIT-WNALIGGYAH  355
                L+++   V+ NV   S +VD+ G+ G I++      +MP +   + W +L+     
Sbjct  396  HYFDLLMRDNYVQHNVLHYSCMVDVLGRAGHIDEAWELIQKMPFKATASVWGSLLSSCRI  455

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFE  502
             G+  +A    + +     +   N+V    +  A  + G V     + +
Sbjct  456  HGNLKLAKTAAKHLFELEPNNAGNHVLLSNIYAANKKWGDVSMARKLLK  504



>ref|XP_009413319.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   270 bits (689),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 179/272 (66%), Gaps = 3/272 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW ++++ Y Q +   +ALK+FLK   EGI P    ++SVLSAC  LAA  LGR 
Sbjct  519  KRDVVSWTAIISAYTQAENWNEALKLFLKMLNEGILPNSLTITSVLSACGSLAATNLGRQ  578

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL  K   +  +FV + L+ MY KCGC  D    FYEM E +++TWN+++ G A  G 
Sbjct  579  IHGLTFKMGYDLELFVGNALITMYFKCGC-ADSFWVFYEMFECDIVTWNSMLAGCAQHGL  637

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+++FE M  K++ V+PN VTF+ +L ACS  G V+ G   F++M   YGI P  EH
Sbjct  638  GREAVEIFEQM--KSEQVLPNAVTFLVLLCACSHGGLVDEGWHYFKSMSKVYGIMPSREH  695

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YA +VD+LGRAG +  A EFI+ MPI P   VW ALLGACR+H   ELG+  A+ LF +D
Sbjct  696  YASMVDLLGRAGYLSEAEEFIENMPIEPDSVVWAALLGACRIHQNVELGRRVAERLFDMD  755

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKD  820
            PQDSGN+V+LSN++AS G W+E   VRK M D
Sbjct  756  PQDSGNYVLLSNLYASLGLWDEVEEVRKLMID  787


 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/227 (26%), Positives = 115/227 (51%), Gaps = 13/227 (6%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW  +++ Y   +   KA + FL+   E + P +   ++V+SA   L   +L  ++
Sbjct  193  KDLVSWTVMISGYVMVNEHGKAWRTFLRMHREVVRPDQSNFTAVISAVVALGNLKLLENL  252

Query  188  HGLVVKACVEENVFVRSVLVDMYGK-CGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
              LV+K   E +V V + +++ Y K  G +++  + F +MPERN  +W+ +I  +AH G 
Sbjct  253  RTLVIKTNFEGDVVVGTAILNAYTKDGGGLDEAVKFFEQMPERNEYSWSTMIATFAHTGL  312

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A+ ++E      +D V +  +   +LT  ++ G +     +FE + +     P    
Sbjct  313  LDDAISIYE------RDPVKSLASQTAMLTGYAQNGRISAAKILFEQIPN-----PSVVS  361

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +  ++    +  M++ A +   RMP+R  VS W A++  C  +G+ E
Sbjct  362  WNAMIAGYAQNNMLDEAKQLFHRMPMRNAVS-WSAMIAGCAQNGENE  407


 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 116/272 (43%), Gaps = 39/272 (14%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW +++A   QN   E+AL +  +    G+ P+   ++S   A   + A E GR +
Sbjct  388  RNAVSWSAMIAGCAQNGENEEALHLLSELHRLGMLPSLSSLTSGFFASGNIGALEFGRQL  447

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCI-------------------------------  274
            H L +KA  + N +V + L+ MY KC  I                               
Sbjct  448  HSLSLKAGSQFNSYVNNGLITMYAKCKNIEAVSGVFRWMKARDTVSWNSLITALSQNNMM  507

Query  275  EDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
            ED   AF +M +R++++W A+I  Y    + N AL LF  M    + ++PN +T   VL+
Sbjct  508  EDARIAFDKMSKRDVVSWTAIISAYTQAENWNEALKLFLKML--NEGILPNSLTITSVLS  565

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC    A   G  I   +  K G +        ++ M  + G  +  + F +       +
Sbjct  566  ACGSLAATNLGRQI-HGLTFKMGYDLELFVGNALITMYFKCGCADSFWVFYEMFEC--DI  622

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQIDPQ  730
              W ++L  C  HG   LG+ A +   Q+  +
Sbjct  623  VTWNSMLAGCAQHG---LGREAVEIFEQMKSE  651


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/277 (23%), Positives = 126/277 (45%), Gaps = 19/277 (7%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAF-ELGR  181
            ERN  SW +++A +    L + A+ ++ +      +P    V S+ S  A L  + + GR
Sbjct  294  ERNEYSWSTMIATFAHTGLLDDAISIYER------DP----VKSLASQTAMLTGYAQNGR  343

Query  182  -SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
             S   ++ +     +V   + ++  Y +   +++ ++ F+ MP RN ++W+A+I G A  
Sbjct  344  ISAAKILFEQIPNPSVVSWNAMIAGYAQNNMLDEAKQLFHRMPMRNAVSWSAMIAGCAQN  403

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G    AL L  ++ R    ++P+  +      A    GA+E G  +  ++  K G +  +
Sbjct  404  GENEEALHLLSELHR--LGMLPSLSSLTSGFFASGNIGALEFGRQL-HSLSLKAGSQFNS  460

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                 ++ M  +   +E      + M  R TVS W +L+ A   +   E  +IA D   +
Sbjct  461  YVNNGLITMYAKCKNIEAVSGVFRWMKARDTVS-WNSLITALSQNNMMEDARIAFD---K  516

Query  719  IDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGI  829
            +  +D  +   + + +  +  W EA  +  +M + GI
Sbjct  517  MSKRDVVSWTAIISAYTQAENWNEALKLFLKMLNEGI  553


 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 81/178 (46%), Gaps = 14/178 (8%)
 Frame = +2

Query  173  LGRSIHGL------VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNA  334
             G S++G+      +  A    N    ++LV  Y + GC+E+ +  F  MPERN ++WNA
Sbjct  79   FGYSLNGMMDDARRLFDAFAGRNTRTWTILVSGYARSGCLEEAQLLFDLMPERNTVSWNA  138

Query  335  LIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKD  514
            LI GYA  G+  MA  LF+ M       + +  ++  ++T    A  +    ++FE M  
Sbjct  139  LISGYAQNGYVGMARRLFDTMP------MHDIASWNAIITGYCHAHQMVEAKELFEQMHM  192

Query  515  KYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPEL  688
            K  +         V  M+   G   R +  + R  +RP  S + A++ A    G  +L
Sbjct  193  KDLVSWTVMISGYV--MVNEHGKAWRTFLRMHREVVRPDQSNFTAVISAVVALGNLKL  248


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 64/143 (45%), Gaps = 13/143 (9%)
 Frame = +2

Query  260  KCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTF  439
            + G + +    F  MP R+ ITWN++I GY+  G  + A  LF+    +      N  T+
Sbjct  52   RLGYVSEARSVFDTMPHRDTITWNSMIFGYSLNGMMDDARRLFDAFAGR------NTRTW  105

Query  440  VCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMP  619
              +++  +R+G +E    +F+ M ++  +      +  ++    + G V  A      MP
Sbjct  106  TILVSGYARSGCLEEAQLLFDLMPERNTVS-----WNALISGYAQNGYVGMARRLFDTMP  160

Query  620  IRPTVSVWGALL-GACRVHGKPE  685
            +    S W A++ G C  H   E
Sbjct  161  MHDIAS-WNAIITGYCHAHQMVE  182



>ref|XP_009347115.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Pyrus x bretschneideri]
Length=676

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 183/278 (66%), Gaps = 5/278 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +++A Y QN+    ALK+F    E G+ PTE  +   LSAC  L    LG+ 
Sbjct  334  ERNVVSWNAMIAGYTQNNRPNDALKLFYDMVESGMVPTEDSLVCALSACGQLGCLYLGQW  393

Query  185  IHGLVV-KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            IH   + +  +  +V + + L+DMY KCG I    + F EMPERN+++WN +I  YA  G
Sbjct  394  IHNYYIDQKRILRSVILGNALMDMYAKCGGINSAAQLFNEMPERNVVSWNTMIAAYA--G  451

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HA  AL LF+ M  K+  + P+ +TFV VL+ACS  G V  G + FE+M   +GIEP  E
Sbjct  452  HAKQALTLFDQM--KSTGLKPDSITFVAVLSACSHGGLVSEGKEHFESMARDHGIEPKKE  509

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC++D+LGR G++E AYE I +MP+ P  S WGALL AC++HG  E+ K++A+ L ++
Sbjct  510  HYACMIDLLGRVGLLEEAYELINKMPMEPRESAWGALLNACKIHGNVEMAKLSAERLLEL  569

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DPQDSG +V+L+N+ A+S RW++  +VR  MK+ G+KK
Sbjct  570  DPQDSGIYVLLANLCANSKRWDDVRIVRSMMKERGVKK  607


 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 118/258 (46%), Gaps = 34/258 (13%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +++  Y  ++  ++A+++F       +EP E  + +VLSAC+      +G+ +
Sbjct  203  RDVVTWTAMIDGYAGSNCSDEAMELFGSMLLSNVEPNEVTMIAVLSACSEGGDIGMGKRV  262

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCI------------------------------E  277
            H  + K  V  ++ + + L+DMY KCGC+                               
Sbjct  263  HEYIQKKSVNCSLNLLNALLDMYVKCGCLLAAQETFDNMKVRDVFSWTSMVNGYAKCGDL  322

Query  278  DCERAFY-EMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
            D  R F+ +MPERN+++WNA+I GY      N AL LF DM      +VP   + VC L+
Sbjct  323  DSARKFFDDMPERNVVSWNAMIAGYTQNNRPNDALKLFYDMVE--SGMVPTEDSLVCALS  380

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC + G +  G  I     D+  I         ++DM  + G +  A +    MP R  V
Sbjct  381  ACGQLGCLYLGQWIHNYYIDQKRILRSVILGNALMDMYAKCGGINSAAQLFNEMPERNVV  440

Query  635  SVWGALLGACRVHGKPEL  688
            S W  ++ A   H K  L
Sbjct  441  S-WNTMIAAYAGHAKQAL  457


 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/215 (27%), Positives = 98/215 (46%), Gaps = 4/215 (2%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N   W +++  Y +  +       F +   EG+E         L AC        G SIH
Sbjct  103  NTYMWNTMIRGYSKAQIPAIGFSFFGRMVREGVEMDSRSFVFALKACGQFGRVLEGDSIH  162

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
             ++ K   + ++ VR+ L+  Y + G +    + F E   R+++TW A+I GYA    ++
Sbjct  163  CVIWKMGFDSDLLVRNGLLHYYAEGGFLSLARKVFDESSARDVVTWTAMIDGYAGSNCSD  222

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
             A++LF  M     +V PN VT + VL+ACS  G +  G  + E ++ K  +        
Sbjct  223  EAMELFGSML--LSNVEPNEVTMIAVLSACSEGGDIGMGKRVHEYIQKK-SVNCSLNLLN  279

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
             ++DM  + G +  A E    M +R   S W +++
Sbjct  280  ALLDMYVKCGCLLAAQETFDNMKVRDVFS-WTSMV  313



>ref|XP_008804906.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Phoenix dactylifera]
Length=519

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 186/276 (67%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ V+W +++  Y QN + ++AL+ F + RE G++  E  +   +S CA L A +    +
Sbjct  108  KDMVAWTAMVTGYAQNSMPKEALETFDRMREAGVKIDEVSLIGAISGCAQLGAVKHAGFV  167

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
              +  +   + NV + S +VDMY KCG +++  + F  M ERN+ T++A+I G A  G A
Sbjct  168  REIAERYEFKRNVVMGSAMVDMYAKCGLVDEARKVFDGMVERNVYTYSAMIVGLAAHGRA  227

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ LF++M  +T+ V PN VTF+ VLTACS AG VE G   F  MKD+YGI P A+HY
Sbjct  228  QEAIALFKEMVERTE-VKPNRVTFIGVLTACSHAGMVEEGRSYFAQMKDEYGISPSADHY  286

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            AC+VD+LGR+G+VE A E +K MP+ P   VWGALLGACR+HGK ++ KIAAD+LF ++P
Sbjct  287  ACMVDLLGRSGLVEEALELVKSMPVEPHGGVWGALLGACRIHGKTQIAKIAADHLFVLEP  346

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
               GN+V+LSN++AS+G WEE + VRK M+  G++K
Sbjct  347  DGIGNYVLLSNIYASAGMWEEVSKVRKLMRGRGLRK  382


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 93/221 (42%), Gaps = 32/221 (14%)
 Frame = +2

Query  113  PTEFMVSSVLSACAGLAAFELGRSIHG-LVVKACVEENVFVRSVLVDMYGKCGCIEDCER  289
            P  F  S++L AC       +G  +H   +     + ++FV++ L+  Y +C  +    +
Sbjct  10   PLPFTFSALLKACGAARCLPMGTQVHAQALATGGFDSDLFVQNTLISFYVECSDLSSARK  69

Query  290  AFYEMPERNLITWNALIGGYAHQGHANMALDLFE-----DM-------TRKTQDVVP---  424
             F  M  R+ I+W +LI  Y   G    A  LFE     DM       T   Q+ +P   
Sbjct  70   LFDRMSVRDAISWTSLIVAYTKTGDMGSAEGLFEKTPVKDMVAWTAMVTGYAQNSMPKEA  129

Query  425  --------------NYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
                          + V+ +  ++ C++ GAV+    + E + ++Y  +      + +VD
Sbjct  130  LETFDRMREAGVKIDEVSLIGAISGCAQLGAVKHAGFVRE-IAERYEFKRNVVMGSAMVD  188

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            M  + G+V+ A +    M +   V  + A++     HG+ +
Sbjct  189  MYAKCGLVDEARKVFDGM-VERNVYTYSAMIVGLAAHGRAQ  228



>ref|XP_007224413.1| hypothetical protein PRUPE_ppa021206mg [Prunus persica]
 gb|EMJ25612.1| hypothetical protein PRUPE_ppa021206mg [Prunus persica]
Length=597

 Score =   264 bits (674),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 185/278 (67%), Gaps = 5/278 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +++A Y QN+   +ALK+F +  E G+ PTE  +  VLSAC  L   +LG+ 
Sbjct  276  ERNVVSWNAMIAGYTQNNRPGEALKLFHEMVETGLVPTENSLVCVLSACGQLGCLDLGQW  335

Query  185  IHGLVV-KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            IH   + + C++ +V + + L+DMY KCG I      F EMPERNL++WN +I GYA  G
Sbjct  336  IHQHYLNRRCIQPSVILGNALMDMYAKCGSINSATELFGEMPERNLVSWNTMIAGYA--G  393

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             A  AL +F  M  KT  + P+ +TFV VL+ACS  G V  G + F++M   Y +EP  E
Sbjct  394  DAKQALTIFNQM--KTMGLKPDDITFVAVLSACSHGGLVSQGREHFKSMTRDYDVEPKEE  451

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC++D+LGR G +E AY+ I +MP+   VS WGALL AC++HG  EL K++A+ L ++
Sbjct  452  HYACMIDLLGRVGQLEEAYQLINKMPMEAGVSAWGALLNACKIHGNVELAKLSAEKLLEL  511

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP+DSG +V+L+N++A+  RW++  +VR  MK+ G++K
Sbjct  512  DPEDSGIYVLLANLYANKKRWDDVRIVRSLMKERGVRK  549


 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/250 (28%), Positives = 115/250 (46%), Gaps = 8/250 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +++  Y      ++A+K+F       +EP E  + +VLSAC+         + 
Sbjct  181  RDVVTWTTMIDGYATRTCSDEAMKLFGSMLVSDVEPNEVTIIAVLSACSDKGNGAAKETF  240

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
              + V+     +VF  + +V+ Y K G +    + F +MPERN+++WNA+I GY      
Sbjct  241  DNMKVR-----DVFSWTSMVNGYAKLGDLNSARKFFNDMPERNVVSWNAMIAGYTQNNRP  295

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF +M      +VP   + VCVL+AC + G ++ G  I +   ++  I+P     
Sbjct  296  GEALKLFHEMVET--GLVPTENSLVCVLSACGQLGCLDLGQWIHQHYLNRRCIQPSVILG  353

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              ++DM  + G +  A E    MP R  VS W  ++       K  L          + P
Sbjct  354  NALMDMYAKCGSINSATELFGEMPERNLVS-WNTMIAGYAGDAKQALTIFNQMKTMGLKP  412

Query  728  QDSGNHVILS  757
             D     +LS
Sbjct  413  DDITFVAVLS  422


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 101/227 (44%), Gaps = 9/227 (4%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            ++ N   W +++  Y +  +       F +   + +E         L AC        G 
Sbjct  78   EKPNTYMWNTMIRGYCKVQIPTIGFSFFGQMVRQHVEMDGRSFIFALKACEQFTRILEGH  137

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S+H L+ K   + ++ VR+ LV  Y + G +    + F E   R+++TW  +I GYA + 
Sbjct  138  SVHCLIWKLGFDSDLLVRNGLVHYYAEGGFLSLARKVFDETFVRDVVTWTTMIDGYATRT  197

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             ++ A+ LF  M     DV PN VT + VL+ACS  G      + F+ MK +        
Sbjct  198  CSDEAMKLFGSML--VSDVEPNEVTIIAVLSACSDKGN-GAAKETFDNMKVR-----DVF  249

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKP  682
             +  +V+   + G +  A +F   MP R  VS W A++     + +P
Sbjct  250  SWTSMVNGYAKLGDLNSARKFFNDMPERNVVS-WNAMIAGYTQNNRP  295



>ref|XP_010260583.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Nelumbo nucifera]
Length=721

 Score =   266 bits (681),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 188/279 (67%), Gaps = 7/279 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVF---LKAREEGIEPTEFMVSSVLSACAGLAAFELG  178
            ++ +SW S++AVY QN L  +AL++F   LK+R+  +      +SSVL  CA   A +LG
Sbjct  311  KDVISWNSMIAVYAQNGLSTEALEIFYEMLKSRD--VSYNAVTLSSVLLGCAHSGALQLG  368

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            + IH  V+K  +E++VFV + ++DMY KCG +E   RAF  M E+N+ +W A++ GY   
Sbjct  369  KCIHDQVIKMGLEDDVFVGTSVIDMYCKCGRVEMARRAFERMKEKNVKSWTAMVAGYGMH  428

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G A  AL++F +M  +   V PNY+TFV VL ACS  G VE G   F+AM  ++ IEPG 
Sbjct  429  GRAKEALEVFYEM--QNAGVKPNYITFVSVLAACSHGGLVEEGWHWFKAMTQEFEIEPGV  486

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            EHYAC+VD+LGRAG +++AY  IK M +RP   VWGALLGACR+H   ELG+++A  LF+
Sbjct  487  EHYACMVDLLGRAGYLDQAYNLIKGMKMRPDFVVWGALLGACRIHKNVELGEVSARKLFE  546

Query  719  IDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DP + G +V+LSN++A +GRWE+   +R  MKD G+ K
Sbjct  547  LDPSNCGYYVLLSNIYADAGRWEDVERMRVFMKDRGLIK  585


 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 122/235 (52%), Gaps = 11/235 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKAL---KVFLKAREEGIEPTEFMVS-----SVLSACAGL  160
             RN VSW S++    QN    +AL   K FL    +G    E  V      SVLSAC+ +
Sbjct  201  HRNVVSWTSMITGCVQNGNAHEALFLFKEFLMEESDGRGEREVSVDAVALVSVLSACSQV  260

Query  161  AAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALI  340
            +   + + +HG ++K   +E++ V + L+D Y KCG +    + F  M  +++I+WN++I
Sbjct  261  SEKGVTKGVHGFLIKRGFQEDLGVGNTLLDAYAKCGDLGISRKVFDGMKNKDVISWNSMI  320

Query  341  GGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKY  520
              YA  G +  AL++F +M  K++DV  N VT   VL  C+ +GA++ G  I + +  K 
Sbjct  321  AVYAQNGLSTEALEIFYEML-KSRDVSYNAVTLSSVLLGCAHSGALQLGKCIHDQVI-KM  378

Query  521  GIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            G+E        V+DM  + G VE A    +RM     V  W A++    +HG+ +
Sbjct  379  GLEDDVFVGTSVIDMYCKCGRVEMARRAFERMK-EKNVKSWTAMVAGYGMHGRAK  432


 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/325 (25%), Positives = 140/325 (43%), Gaps = 55/325 (17%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D  +  SW S++A   ++    +AL+ FL  R+  + P        + +C+ L     G+
Sbjct  99   DRTSVSSWNSVIAELARSGDSVEALRAFLSMRKISLNPDRSTFPCAIKSCSALLDLASGK  158

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H   +    E ++FV S L+DMY KCG +    + F E+P RN+++W ++I G    G
Sbjct  159  QVHQQALVFGFEFDLFVSSALIDMYSKCGELVSARKLFDEIPHRNVVSWTSMITGCVQNG  218

Query  362  HANMALDLFEDMT------RKTQDVVPNYVTFVCVLTACSRA------------------  469
            +A+ AL LF++        R  ++V  + V  V VL+ACS+                   
Sbjct  219  NAHEALFLFKEFLMEESDGRGEREVSVDAVALVSVLSACSQVSEKGVTKGVHGFLIKRGF  278

Query  470  ----GAVETGMD-------------IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERA-  595
                G   T +D             +F+ MK+K  I      +  ++ +  + G+   A 
Sbjct  279  QEDLGVGNTLLDAYAKCGDLGISRKVFDGMKNKDVIS-----WNSMIAVYAQNGLSTEAL  333

Query  596  ---YEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS---GNHVILS  757
               YE +K   +        ++L  C   G  +LGK   D + ++  +D    G  VI  
Sbjct  334  EIFYEMLKSRDVSYNAVTLSSVLLGCAHSGALQLGKCIHDQVIKMGLEDDVFVGTSVI--  391

Query  758  NMFASSGRWEEANLVRKEMKDIGIK  832
            +M+   GR E A    + MK+  +K
Sbjct  392  DMYCKCGRVEMARRAFERMKEKNVK  416


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 87/182 (48%), Gaps = 13/182 (7%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELG-R  181
            E+N  SW +++A Y  +   ++AL+VF + +  G++P      SVL+AC+     E G  
Sbjct  412  EKNVKSWTAMVAGYGMHGRAKEALEVFYEMQNAGVKPNYITFVSVLAACSHGGLVEEGWH  471

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER-NLITWNALIGGYAHQ  358
                +  +  +E  V   + +VD+ G+ G ++        M  R + + W AL+G  A +
Sbjct  472  WFKAMTQEFEIEPGVEHYACMVDLLGRAGYLDQAYNLIKGMKMRPDFVVWGALLG--ACR  529

Query  359  GHANMALDLFEDMTRKTQDVVPN----YVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
             H N  ++L E   RK  ++ P+    YV    +     R   VE  M +F  MKD+  I
Sbjct  530  IHKN--VELGEVSARKLFELDPSNCGYYVLLSNIYADAGRWEDVER-MRVF--MKDRGLI  584

Query  527  EP  532
            +P
Sbjct  585  KP  586



>ref|XP_008813688.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Phoenix dactylifera]
 ref|XP_008813689.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Phoenix dactylifera]
 ref|XP_008813691.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Phoenix dactylifera]
 ref|XP_008813692.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Phoenix dactylifera]
Length=650

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 188/278 (68%), Gaps = 3/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEG-IEPTEFMVSSVLSACAGLAAFELGR  181
            ER+ VSW S++A+Y Q+ L  +AL+++ K    G +      +S+VL ACA   A ++G+
Sbjct  239  ERDVVSWNSMIALYAQDGLSAEALELYCKMLSGGGVRYNAVTLSAVLFACAHAGALQIGK  298

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             IH  VV+  +EE+V+V + +VDMY KCG +E   +AF  M +RN+++W+A++ GY   G
Sbjct  299  CIHNQVVRIGLEEDVYVGTSVVDMYCKCGRVEMARKAFNRMKKRNILSWSAMVAGYGMHG  358

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            H   AL++F +M R    V PN++TFV VL ACS AG V+ G   F AMK ++GI+PG E
Sbjct  359  HGREALEVFSEMRR--SGVKPNHITFVSVLAACSHAGLVDEGRHWFHAMKKEFGIDPGME  416

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY C+VD+LGRAG ++ AY  IK M I+P   VWGALL ACR+H   ELG+I+A  LF++
Sbjct  417  HYGCIVDLLGRAGCLDEAYGLIKEMTIKPDFVVWGALLSACRIHKNVELGEISAKKLFEL  476

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP++ G +V+LSN++A +GRW+    +R  MK+ G+ K
Sbjct  477  DPKNCGYYVLLSNIYADAGRWDNVEKMRVLMKNRGLVK  514


 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 111/226 (49%), Gaps = 5/226 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVF--LKAREEGIEPTEFMVSSVLSACAGLAAFELG  178
             RN V W +++A    N    +A  +F    A+E  +        + LSAC+ +   +  
Sbjct  136  HRNAVLWTAMIAGSVWNGAAREAFSLFKEFLAKEGALSLDTVAAVAALSACSRVLDRKAT  195

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
              +HGL VK  +E +V V + LVD Y K G +    + F  M ER++++WN++I  YA  
Sbjct  196  GGVHGLAVKVGLEMDVGVGNTLVDAYAKGGDLGMGRKMFDGMAERDVVSWNSMIALYAQD  255

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G +  AL+L+  M      V  N VT   VL AC+ AGA++ G  I   +  + G+E   
Sbjct  256  GLSAEALELYCKML-SGGGVRYNAVTLSAVLFACAHAGALQIGKCIHNQVV-RIGLEEDV  313

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
                 VVDM  + G VE A +   RM  R  +S W A++    +HG
Sbjct  314  YVGTSVVDMYCKCGRVEMARKAFNRMKKRNILS-WSAMVAGYGMHG  358


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 124/307 (40%), Gaps = 39/307 (13%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            SW + +A   ++    +AL  F   R   + P        L A A L++   GR +H L 
Sbjct  40   SWNAAIADLARSGDSAEALAAFASMRRLRLRPDCSSFPCALKAAAALSSLRSGRQLHLLA  99

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
             +  +  ++FV S LVDMY KC    D  RAF E P RN + W A+I G    G A  A 
Sbjct  100  FRLGLHPDLFVASALVDMYSKCREPVDARRAFDETPHRNAVLWTAMIAGSVWNGAAREAF  159

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSR-----------AGAVETGMD----IFEAMKD  514
             LF++   K   +  + V  V  L+ACSR             AV+ G++    +   + D
Sbjct  160  SLFKEFLAKEGALSLDTVAAVAALSACSRVLDRKATGGVHGLAVKVGLEMDVGVGNTLVD  219

Query  515  KYG---------------IEPGAEHYACVVDMLGRAGMVERAYEFIKRM----PIRPTVS  637
             Y                 E     +  ++ +  + G+   A E   +M     +R    
Sbjct  220  AYAKGGDLGMGRKMFDGMAERDVVSWNSMIALYAQDGLSAEALELYCKMLSGGGVRYNAV  279

Query  638  VWGALLGACRVHGKPELGKIAADNLFQIDPQDS---GNHVILSNMFASSGRWEEANLVRK  808
               A+L AC   G  ++GK   + + +I  ++    G  V+  +M+   GR E A     
Sbjct  280  TLSAVLFACAHAGALQIGKCIHNQVVRIGLEEDVYVGTSVV--DMYCKCGRVEMARKAFN  337

Query  809  EMKDIGI  829
             MK   I
Sbjct  338  RMKKRNI  344



>ref|XP_002308737.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE92260.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=590

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 183/276 (66%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW +L+A Y +   G+KA  +F     E ++PT F  SSVL ACA + + E G+ +
Sbjct  182  KNEVSWNALIAGYARKGQGDKAFCLFSNMLRENVKPTHFTYSSVLCACASMGSLEQGKWV  241

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L++K   +   FV + L+DMY K G IED ++ F  + +R++++WN+++ GY+  G  
Sbjct  242  HALMIKWGEKLVAFVGNTLLDMYAKSGSIEDAKKVFDRLAKRDVVSWNSMLTGYSQHGLG  301

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
             +AL  FE+M R    + PN +TF+CVLTACS AG ++ G   F+ MK KY +EP   HY
Sbjct  302  KVALQRFEEMLRTR--IAPNDITFLCVLTACSHAGLLDEGRHYFDMMK-KYNVEPQISHY  358

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              +VD+LGRAG ++RA +FI  MPI+PT +VWGALLGACR+H   ELG  AA+ +F++D 
Sbjct  359  VTMVDLLGRAGHLDRAIQFISEMPIKPTAAVWGALLGACRMHKNMELGGYAAECIFELDS  418

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
               G HV+L N++A +GRW +A  VRK MK+ G+KK
Sbjct  419  HYPGTHVLLYNIYALAGRWNDAAKVRKMMKESGVKK  454


 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 134/233 (58%), Gaps = 9/233 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFEL--GR  181
            R+ V+W +L+  Y Q+D  + AL +  +    G++P +F ++S+L A +G+ + ++  GR
Sbjct  79   RDVVTWTALITGYSQHDRPQDALLLLPEMLRIGLKPNQFTLASLLKAASGVGSTDVLQGR  138

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HGL ++   + NV+V   ++DMY +C  +E+ +  F  M  +N ++WNALI GYA +G
Sbjct  139  QLHGLCLRYGYDSNVYVSCAILDMYARCHHLEEAQLIFDVMVSKNEVSWNALIAGYARKG  198

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              + A  LF +M R  ++V P + T+  VL AC+  G++E G  +  A+  K+G +  A 
Sbjct  199  QGDKAFCLFSNMLR--ENVKPTHFTYSSVLCACASMGSLEQGKWV-HALMIKWGEKLVAF  255

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIA  700
                ++DM  ++G +E A +   R+  R  VS W ++L     HG   LGK+A
Sbjct  256  VGNTLLDMYAKSGSIEDAKKVFDRLAKRDVVS-WNSMLTGYSQHG---LGKVA  304


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 106/238 (45%), Gaps = 11/238 (5%)
 Frame = +2

Query  134  SVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER  313
            ++L  C  L     G+ IH L++ +   +++ +++ L+++Y KCG +    + F EM  R
Sbjct  20   TLLKRCTHLNKLNEGKIIHALLLNSRFRDDLVMQNTLLNLYAKCGDLVYARKLFDEMSSR  79

Query  314  NLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET--G  487
            +++TW ALI GY+       AL L  +M R    + PN  T   +L A S  G+ +   G
Sbjct  80   DVVTWTALITGYSQHDRPQDALLLLPEMLRI--GLKPNQFTLASLLKAASGVGSTDVLQG  137

Query  488  MDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACR  667
              +   +  +YG +        ++DM  R   +E A      M  +  VS W AL+    
Sbjct  138  RQL-HGLCLRYGYDSNVYVSCAILDMYARCHHLEEAQLIFDVMVSKNEVS-WNALIAGYA  195

Query  668  VHGKPELGKIAADNLFQIDPQDSGNHVILSNMF---ASSGRWEEANLVRKEMKDIGIK  832
              G+ +       N+ + + + +  H   S++    AS G  E+   V   M   G K
Sbjct  196  RKGQGDKAFCLFSNMLRENVKPT--HFTYSSVLCACASMGSLEQGKWVHALMIKWGEK  251


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 63/126 (50%), Gaps = 3/126 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW S+L  Y Q+ LG+ AL+ F +     I P +     VL+AC+     + GR 
Sbjct  282  KRDVVSWNSMLTGYSQHGLGKVALQRFEEMLRTRIAPNDITFLCVLTACSHAGLLDEGRH  341

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER-NLITWNALIGGYAHQG  361
               ++ K  VE  +     +VD+ G+ G ++   +   EMP +     W AL+G  A + 
Sbjct  342  YFDMMKKYNVEPQISHYVTMVDLLGRAGHLDRAIQFISEMPIKPTAAVWGALLG--ACRM  399

Query  362  HANMAL  379
            H NM L
Sbjct  400  HKNMEL  405



>ref|XP_010271319.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16470 
[Nelumbo nucifera]
Length=439

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 170/276 (62%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW ++++ Y Q  L E  L ++ K R+ G+ P ++  +SV  ACA LA  E G+ +
Sbjct  115  RSLVSWNAMISGYVQKGLDETGLNLYHKMRQSGLIPDQYTFASVFRACASLATLEQGKRV  174

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H +++K+ + ENV V S L DMY KC    D  R F +  ERN++TW ALI GY   G  
Sbjct  175  HAVMIKSQLTENVVVNSALTDMYFKCSSPHDGHRVFDKTSERNVVTWTALISGYGQHGRV  234

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            N  LDLF  M    +   PNYVTF+ VLTACS  G +  G   F +M   YGI P  +HY
Sbjct  235  NEVLDLFNRMLH--EGFRPNYVTFLAVLTACSHGGLINEGWKYFTSMSRDYGIRPRGKHY  292

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            A +VD+LGRAG +  AYEF+   P      +WGALLGACR+HG  EL K+AA   F+++P
Sbjct  293  AAMVDLLGRAGRLNEAYEFVLNSPCEDHSVIWGALLGACRIHGNLELVKLAAKKFFELEP  352

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +++G +V+LSN +A+ G W+    VRK MK  G++K
Sbjct  353  ENAGKYVVLSNAYAAYGLWKHVAEVRKVMKVSGVRK  388


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 87/195 (45%), Gaps = 5/195 (3%)
 Frame = +2

Query  95   REEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCI  274
            R E +  TE + + +L  C     F+ GR IH  +V      + ++++ L  +Y K G +
Sbjct  44   RTESLLDTE-IYALLLQECIFRKEFKKGRRIHAQMVIVGFAPDEYLQTKLAILYAKNGDL  102

Query  275  EDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
            E     F ++  R+L++WNA+I GY  +G     L+L+  M  +   ++P+  TF  V  
Sbjct  103  ETAHIMFDKISNRSLVSWNAMISGYVQKGLDETGLNLYHKM--RQSGLIPDQYTFASVFR  160

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC+    +E G  +   M  K  +       + + DM  +       +    +   R  V
Sbjct  161  ACASLATLEQGKRVHAVMI-KSQLTENVVVNSALTDMYFKCSSPHDGHRVFDKTSERNVV  219

Query  635  SVWGALLGACRVHGK  679
            + W AL+     HG+
Sbjct  220  T-WTALISGYGQHGR  233



>ref|XP_008224655.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Prunus mume]
Length=668

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 183/278 (66%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + +N VSW +L+A + +   GE AL++  K   EG +PT F  SSV  ACA   + E G+
Sbjct  258  ETKNEVSWNALIAGHARKAQGEHALRLLGKMLREGFKPTHFTYSSVFIACASAGSMEQGK  317

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  ++K+  +   FV + L+DMY K G IED  + F  +  +++++WN+++ GYA  G
Sbjct  318  WVHAHMIKSGAKLVAFVGNTLLDMYAKSGSIEDARKVFDRLVRQDIVSWNSMLTGYAQHG  377

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                 +  FE+M R    + PN +TF+CVLTACS AG ++ G   F+ MK  Y IEP   
Sbjct  378  LGQETVQRFEEMLRI--GIQPNDITFLCVLTACSHAGLLDEGQYYFDLMK-SYNIEPQIS  434

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY  +VD+LGRAG+++RA +FI+ MPI PT +VWGALLGACR+H   +LG  AA+ +F++
Sbjct  435  HYVTIVDLLGRAGLLDRAEKFIREMPIEPTAAVWGALLGACRMHKNIDLGAYAAERVFEL  494

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP DSG HV+LSN++AS+GR  +A  VRK MKD G+KK
Sbjct  495  DPHDSGPHVLLSNIYASAGRLSDAARVRKLMKDCGVKK  532


 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 121/229 (53%), Gaps = 14/229 (6%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLA--AFELGR  181
            ++ V+W +L++ Y QND  + AL +F +    G+EP +F +SS+  A   ++    E GR
Sbjct  157  KDLVTWTALISGYSQNDRPQDALVLFPQMLLRGLEPNQFTLSSLFKAAGAVSDDNNEHGR  216

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H   +K   + NV+V + LVDMY + G +++ +  F  +  +N ++WNALI G+A + 
Sbjct  217  QLHTYCLKYGFDTNVYVGTSLVDMYARWGHMDESQLIFDSLETKNEVSWNALIAGHARKA  276

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                AL L   M R  +   P + T+  V  AC+ AG++E G  +   M     I+ GA+
Sbjct  277  QGEHALRLLGKMLR--EGFKPTHFTYSSVFIACASAGSMEQGKWVHAHM-----IKSGAK  329

Query  542  HYACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              A V    +DM  ++G +E A +   R+ +R  +  W ++L     HG
Sbjct  330  LVAFVGNTLLDMYAKSGSIEDARKVFDRL-VRQDIVSWNSMLTGYAQHG  377


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 113/252 (45%), Gaps = 19/252 (8%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDC  283
             +E    + + +L+ C  +   +  R +H  ++ +  ++++ + + +++MY KCG +ED 
Sbjct  88   SLEADRTLYNKLLNRCTQMGRLQQARIVHAHILTSHFKDDLPIHNTILNMYVKCGSLEDA  147

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
               F +MP ++L+TW ALI GY+       AL LF  M  +  +  PN  T   +  A  
Sbjct  148  RNLFDQMPCKDLVTWTALISGYSQNDRPQDALVLFPQMLLRGLE--PNQFTLSSLFKA--  203

Query  464  RAGAV-----ETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRP  628
             AGAV     E G  +      KYG +        +VDM  R G ++ +      +  + 
Sbjct  204  -AGAVSDDNNEHGRQLHTYCL-KYGFDTNVYVGTSLVDMYARWGHMDESQLIFDSLETKN  261

Query  629  TVSVWGALLGACRVHGKPELGKIAADNLFQIDPQD-SGNHVILSNMF---ASSGRWEEAN  796
             VS W AL+     H +   G+ A   L ++  +     H   S++F   AS+G  E+  
Sbjct  262  EVS-WNALIAG---HARKAQGEHALRLLGKMLREGFKPTHFTYSSVFIACASAGSMEQGK  317

Query  797  LVRKEMKDIGIK  832
             V   M   G K
Sbjct  318  WVHAHMIKSGAK  329



>emb|CBI21289.3| unnamed protein product [Vitis vinifera]
Length=581

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 189/278 (68%), Gaps = 3/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEG-IEPTEFMVSSVLSACAGLAAFELGR  181
            ER+ +SW S++AVY QN +  +++++F +  ++G I      +S+VL ACA   +  LG+
Sbjct  170  ERDVISWNSIIAVYAQNGMSTESMEIFHRMVKDGEINYNAVTLSAVLLACAHSGSQRLGK  229

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             IH  V+K  +E NVFV + ++DMY KCG +E   +AF  M E+N+ +W+A++ GY   G
Sbjct  230  CIHDQVIKMGLESNVFVGTSIIDMYCKCGKVEMARKAFDRMREKNVKSWSAMVAGYGMHG  289

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HA  AL++F +M      V PNY+TFV VL ACS AG +E G   F+AM  ++ +EPG E
Sbjct  290  HAKEALEVFYEMN--MAGVKPNYITFVSVLAACSHAGLLEEGWHWFKAMSHEFDVEPGVE  347

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY C+VD+LGRAG ++ A++ IK M +RP   VWGALLGACR+H   +LG+I+A  LF++
Sbjct  348  HYGCMVDLLGRAGYLKEAFDLIKGMKLRPDFVVWGALLGACRMHKNVDLGEISARKLFEL  407

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP++ G +V+LSN++A +GRWE+   +R  MK+ G+ K
Sbjct  408  DPKNCGYYVLLSNIYADAGRWEDVERMRILMKNSGLVK  445


 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/258 (28%), Positives = 112/258 (43%), Gaps = 32/258 (12%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+ N  SW S++A   ++    +AL+ F   R+  ++P        + +C+ L     GR
Sbjct  37   DKTNVFSWNSVIAELARSGDSVEALRAFSSMRKLSLKPNRSTFPCAIKSCSALLDLHSGR  96

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
              H   +    E ++FV S LVDMY KCG + D    F E+  RN+++W ++I GY    
Sbjct  97   QAHQQALIFGFEPDLFVSSALVDMYSKCGELRDARTLFDEISHRNIVSWTSMITGYVQND  156

Query  362  HANMALDLFEDMT----------------------------RKTQDVVPNY--VTFVCVL  451
             A+ AL +F+ M                             R  +D   NY  VT   VL
Sbjct  157  DAHRALRVFDGMAERDVISWNSIIAVYAQNGMSTESMEIFHRMVKDGEINYNAVTLSAVL  216

Query  452  TACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPT  631
             AC+ +G+   G  I + +  K G+E        ++DM  + G VE A +   RM     
Sbjct  217  LACAHSGSQRLGKCIHDQVI-KMGLESNVFVGTSIIDMYCKCGKVEMARKAFDRMR-EKN  274

Query  632  VSVWGALLGACRVHGKPE  685
            V  W A++    +HG  +
Sbjct  275  VKSWSAMVAGYGMHGHAK  292



>ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Cicer arietinum]
Length=814

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 186/276 (67%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +  V+W +++  Y QN    +AL +F   + +G++P  F   SV++A A L+     + I
Sbjct  405  KTNVTWNAMILGYAQNGCVNEALNLFCTMQSQGVKPDSFTFVSVITALADLSVTRQAKWI  464

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL ++  +++NVFV + LVDMY KCG IE     F +M ER++ITWNA+I GY   G  
Sbjct  465  HGLAMRTNMDKNVFVATALVDMYAKCGAIETARELFNKMQERHVITWNAMIDGYGTHGLG  524

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              ALDLFE+M R    V PN +TF+ V++ACS +G VE G+  F+ MK+ YG+EPG +HY
Sbjct  525  KAALDLFENM-RNEVSVKPNEITFLSVISACSHSGFVEEGLYYFKIMKEDYGLEPGMDHY  583

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              +VD+LGRAG ++ A+ FI+ +PI+P ++V GA+LGAC++H   ELG+ AAD LF++DP
Sbjct  584  GAMVDLLGRAGKLDSAWNFIQEIPIKPGITVLGAMLGACKIHKNVELGEKAADKLFELDP  643

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++ G HV+L+NM+AS+  W++   VR  M+  G++K
Sbjct  644  EEGGYHVLLANMYASASMWDKVAKVRTAMEKKGLQK  679


 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 108/217 (50%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ VSW ++++ Y QN    KALK+ L  +E G +P    + S+L A A +    +GRS
Sbjct  202  QKDLVSWNTVVSGYAQNGFARKALKLVLDMQEAGQKPDSITLVSILPAVADIKGLRIGRS  261

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  V++  E  V V + L+DMY KCG +E     F  M  +N+++WN +I G A  G 
Sbjct  262  IHGYAVRSGFESYVNVSTALLDMYFKCGSVETGRLVFRRMSSKNVVSWNTVIDGLAQNGE  321

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            +  A   F  M    + V P  VT +  L ACS  G +E G  +   + D+  ++     
Sbjct  322  SEEAFATFLKML--DEKVEPTNVTMMGALHACSNLGDLERGRFVHRLL-DERKLDSNVSV  378

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               ++ M  +   V+ A      +  +  V+ W A++
Sbjct  379  MNSLISMYSKCKRVDVAASIFDNLKGKTNVT-WNAMI  414


 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 109/227 (48%), Gaps = 12/227 (5%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V + ++L  Y +N     +L  + + + + ++P  +  + +L  C      + GR IHG+
Sbjct  105  VLYHTMLKGYAKNLTLCDSLVFYKRMQCDEVKPVVYDFTYLLQLCGDNLDLKKGREIHGM  164

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++    E N+F  + +V++Y KC  I+D  + F  MP+++L++WN ++ GYA  G A  A
Sbjct  165  LIVNGYESNLFAMTAVVNLYAKCRQIDDAYKMFDRMPQKDLVSWNTVVSGYAQNGFARKA  224

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L L  DM    Q   P+ +T V +L A +    +  G  I       Y +  G E Y  V
Sbjct  225  LKLVLDMQEAGQK--PDSITLVSILPAVADIKGLRIGRSI-----HGYAVRSGFESYVNV  277

Query  557  ----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
                +DM  + G VE      +RM  +  VS W  ++     +G+ E
Sbjct  278  STALLDMYFKCGSVETGRLVFRRMSSKNVVS-WNTVIDGLAQNGESE  323



>gb|KHG29369.1| Pentatricopeptide repeat-containing -like protein [Gossypium 
arboreum]
Length=642

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 189/276 (68%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW +L+  Y QN L  +A++VF   ++E I P +    S+L A + + A + G  +
Sbjct  235  KDVVSWNTLITGYTQNGLASEAIEVFDMMQKE-IAPNQATWVSILPAYSNIGALQQGMRV  293

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL+VK+ +  ++FV + L+DMYGKCG ++D    FYE+P+   + WNA+I  +   GHA
Sbjct  294  HGLLVKSSLYLDIFVGTCLIDMYGKCGKLDDAMSLFYEVPKMTSVPWNAIISCHGIHGHA  353

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ LF +M  + + V P++VTFV +L+ACS +G VE G   F  M+++YGIEP  +HY
Sbjct  354  EKAIKLFREM--REERVKPDHVTFVSLLSACSHSGLVEEGQWCFNVMREEYGIEPILKHY  411

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
             C+VDM GRAG +E+AY FIK MP++P  SVWGALLGACR+HG  +LG  A++ LFQ+D 
Sbjct  412  GCMVDMFGRAGHLEKAYNFIKDMPVKPDASVWGALLGACRIHGNIDLGAFASERLFQVDS  471

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++ G +V++SN++A+ G+WE  + VR   +D+G++K
Sbjct  472  ENVGYYVLMSNIYANIGKWEGVDKVRTLARDMGLRK  507


 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 116/232 (50%), Gaps = 21/232 (9%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKA-REEGIEPTEFMVSSVLSACAG-LAAFELG-RSIH  190
            +W S+++ Y +     +A+  F +     G+ P  +  + VL AC   L    +   S+H
Sbjct  134  TWNSMVSAYVRTGHFREAVDCFYQFFLTSGLRPDFYTFAPVLKACKNPLDGMRIHCLSVH  193

Query  191  GLVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            G V++   + ++V   + +VDMY K G +      F  +P +++++WN LI GY   G A
Sbjct  194  GFVMRRGWILKDVISGNSVVDMYSKLGDMSSAGAVFEALPVKDVVSWNTLITGYTQNGLA  253

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            + A+++F DM +K  ++ PN  T+V +L A S  GA++ GM +       +G+   +  Y
Sbjct  254  SEAIEVF-DMMQK--EIAPNQATWVSILPAYSNIGALQQGMRV-------HGLLVKSSLY  303

Query  548  ------ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
                   C++DM G+ G ++ A      +P   +V  W A++    +HG  E
Sbjct  304  LDIFVGTCLIDMYGKCGKLDDAMSLFYEVPKMTSVP-WNAIISCHGIHGHAE  354


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 72/162 (44%), Gaps = 4/162 (2%)
 Frame = +2

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            VV A    ++F  + LV++Y   G +    R F ++P +++ TWN+++  Y   GH   A
Sbjct  92   VVVAGKARSIFFSAKLVNVYAYLGDVSFSRRTFDQIPNKDVYTWNSMVSAYVRTGHFREA  151

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRA--GAVETGMDIFEAMKDKYGIEPGAEHYA  550
            +D F      T  + P++ TF  VL AC     G     + +   +  +  I        
Sbjct  152  VDCFYQFFL-TSGLRPDFYTFAPVLKACKNPLDGMRIHCLSVHGFVMRRGWILKDVISGN  210

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
             VVDM  + G +  A    + +P++  VS W  L+     +G
Sbjct  211  SVVDMYSKLGDMSSAGAVFEALPVKDVVS-WNTLITGYTQNG  251



>ref|XP_009407242.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=661

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 185/278 (67%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D +N VSW +L+A Y + +  + A+K+F + +  G E T F  SS+ SACA + A E G+
Sbjct  251  DSKNEVSWNALIAGYARREDCKTAMKMFWEMQRSGFEATHFTYSSIFSACASIGALEQGK  310

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  ++K       FV + L+DMY K G I D  + F  + +++L++WN+++  YA  G
Sbjct  311  WVHAQMIKCGQVLTAFVGNTLLDMYAKSGSIRDARKIFDRVNKKDLVSWNSMLTAYAQHG  370

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              + A+  FE+M  +   V PN +TF+C+L ACS  G ++ G   F+ MK +Y +EP  E
Sbjct  371  LVSEAIHWFEEM--RKLGVQPNQITFLCILNACSHGGLLKEGQYYFDMMK-RYKVEPEIE  427

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY  +VD+LGRAG+++RA +FI  MP++P+ +VWGALLGACR+H   ELGK AA+ +F++
Sbjct  428  HYVTIVDLLGRAGLLDRAQKFINEMPVQPSAAVWGALLGACRMHKNAELGKFAAERVFEL  487

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP D+G HV+L N++AS+GRW +A  VRK MKD G+KK
Sbjct  488  DPYDAGPHVLLYNIYASTGRWTDAAKVRKMMKDGGVKK  525


 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/248 (29%), Positives = 123/248 (50%), Gaps = 26/248 (10%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDC  283
             +EP+  + S ++  C      + GR +H  ++++  + ++F+++ +V+MY KCG ++D 
Sbjct  83   SLEPSADLYSDLVKRCTQFKKLKEGRLVHAHLMRSEFKSDIFLQNSIVNMYCKCGSLDDA  142

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTAC-  460
             +AF EMP R+++TW ALI GYA     N A+++   M R    +VPN  TF  +  AC 
Sbjct  143  RKAFDEMPARDMVTWTALITGYAQNDRPNEAVEMLPRMLRLR--LVPNAFTFGSLFKACG  200

Query  461  --SRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
              SR G  E       A+  K G  P     + ++DM  R G +E A     ++  +  V
Sbjct  201  AASRNGHCEE----VHALSVKCGCSPDVYVGSAILDMYARHGRMEEACLVFDQLDSKNEV  256

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQIDPQDSG---NHVILSNMFAS--------SGR  781
            S W AL+     + + E  K A    +++  Q SG    H   S++F++         G+
Sbjct  257  S-WNALIAG---YARREDCKTAMKMFWEM--QRSGFEATHFTYSSIFSACASIGALEQGK  310

Query  782  WEEANLVR  805
            W  A +++
Sbjct  311  WVHAQMIK  318


 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 110/223 (49%), Gaps = 4/223 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ V+W +L+  Y QND   +A+++  +     + P  F   S+  AC   +       +
Sbjct  152  RDMVTWTALITGYAQNDRPNEAVEMLPRMLRLRLVPNAFTFGSLFKACGAASRNGHCEEV  211

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK     +V+V S ++DMY + G +E+    F ++  +N ++WNALI GYA +   
Sbjct  212  HALSVKCGCSPDVYVGSAILDMYARHGRMEEACLVFDQLDSKNEVSWNALIAGYARREDC  271

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ +F +M R   +    + T+  + +AC+  GA+E G  +   M  K G    A   
Sbjct  272  KTAMKMFWEMQRSGFEA--THFTYSSIFSACASIGALEQGKWVHAQMI-KCGQVLTAFVG  328

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              ++DM  ++G +  A +   R+  +  VS W ++L A   HG
Sbjct  329  NTLLDMYAKSGSIRDARKIFDRVNKKDLVS-WNSMLTAYAQHG  370



>ref|XP_010243611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Nelumbo nucifera]
Length=829

 Score =   267 bits (683),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 186/276 (67%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW ++++ Y QN    +AL  F K ++E ++P  F + SV+ A A L+     R I
Sbjct  421  KNLVSWNAMISGYAQNGRVNEALSYFCKMQQENVKPDSFTMVSVIPAIADLSILRQARWI  480

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL +++C++ NVFV + LVDMY KCG +    + F  M ER++ TWNA+I GY   G  
Sbjct  481  HGLTIRSCLDTNVFVMTALVDMYAKCGGVHTARKLFDMMDERHVTTWNAMIDGYGTHGLG  540

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ LFE+M  +T  V PN VTF+C+L+ACS +G VE G   F  MK  Y IEPG +HY
Sbjct  541  KHAVQLFEEM--RTGVVRPNGVTFLCILSACSHSGLVEDGRRYFTVMKHDYEIEPGTDHY  598

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            A +VD+LGRAG ++ A++FI++MPI P +SV+GA+LGAC++H   ELG+ AA  LF+++P
Sbjct  599  ATMVDLLGRAGHLDEAWDFIQKMPIEPEISVFGAMLGACKIHKNVELGEKAAKRLFELEP  658

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++ G HV+LSN++A++  W++   VR  M+  G++K
Sbjct  659  KEGGYHVLLSNIYATASMWDDVAKVRTMMERRGLQK  694


 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 124/225 (55%), Gaps = 4/225 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ V+W +++A Y QN+   +AL++ ++ ++EG  P    + S+L ACA + +  +G++
Sbjct  218  QRDLVAWNAIIAGYAQNNCARRALELVVQMQQEGQRPDSITIVSILPACADIGSLRIGKA  277

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG V++A  +  V + + LVDMY KCG ++     +  M  RN+++WN++I GYA  G 
Sbjct  278  VHGYVIRAGFQSLVNISTALVDMYSKCGSVKTARLIYDGMHIRNVVSWNSMIDGYAQNGD  337

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            +  A+++F+ M    + V P  VT +  L AC+  G ++ G  I E + ++ G+      
Sbjct  338  SEEAMEIFQKMM--DEGVEPTDVTIMAALHACADLGDLQRGSYIHELL-NQNGLGSDVSV  394

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
               ++ M  +   V+ A +    +  +  VS W A++     +G+
Sbjct  395  VNSLISMYSKCKQVDVAAKIFHNLQGKNLVS-WNAMISGYAQNGR  438


 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 106/221 (48%), Gaps = 4/221 (2%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            + +LL  + +N   E A+  F + + + + P  +  + +L  C   +    G+ IH  ++
Sbjct  123  YHTLLKGHAKNSSLEDAVSFFCRMKYDDVRPVVYNFTYLLKGCGDNSDLRRGKEIHAQLI  182

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
                  NVF  + +V+MY KC  I +  + F  MP+R+L+ WNA+I GYA    A  AL+
Sbjct  183  SNGFSSNVFAMTAVVNMYAKCRQIGEACKMFDRMPQRDLVAWNAIIAGYAQNNCARRALE  242

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            L   M ++ Q   P+ +T V +L AC+  G++  G  +      + G +        +VD
Sbjct  243  LVVQMQQEGQR--PDSITIVSILPACADIGSLRIGKAV-HGYVIRAGFQSLVNISTALVD  299

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            M  + G V+ A      M IR  VS W +++     +G  E
Sbjct  300  MYSKCGSVKTARLIYDGMHIRNVVS-WNSMIDGYAQNGDSE  339



>ref|XP_002298341.1| hypothetical protein POPTR_0001s25060g [Populus trichocarpa]
 gb|EEE83146.1| hypothetical protein POPTR_0001s25060g [Populus trichocarpa]
Length=429

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 178/264 (67%), Gaps = 1/264 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + +SW S+++   QN   E A   F +    G  PT   +S+VL+ACA +A    GR 
Sbjct  143  EPDVISWTSVISGLVQNFRNEAAFDAFKQMLGRGFLPTSATISTVLAACATMANVRRGRE  202

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  V   VE++++VRS LVDMY KCG I +    FY MPERN +TWN++I GYA+ G+
Sbjct  203  IHGYAVVIRVEDDIYVRSALVDMYAKCGFISEASVLFYMMPERNTVTWNSMIFGYANHGY  262

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A++LF+ M  K++    +++TF  VLTACS AG VE G  +F  M+ KY I P  EH
Sbjct  263  CDEAIELFDQM-EKSEGNKLDHLTFTAVLTACSHAGMVEHGQSLFLLMQQKYKIVPRLEH  321

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAG +  AY+ IK+MP++P + VWGALLGACR HG   L ++AA +L +++
Sbjct  322  YACMVDLLGRAGNLNEAYDMIKKMPVKPDLFVWGALLGACRNHGDIGLAEVAARHLAELE  381

Query  725  PQDSGNHVILSNMFASSGRWEEAN  796
            P+++GN++++SN++A +G WE  +
Sbjct  382  PENAGNNMLMSNLYADAGSWENVS  405


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 102/203 (50%), Gaps = 6/203 (3%)
 Frame = +2

Query  95   REEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCI  274
            +++G+   +F++ SVL  C  +   + GR +H +++K  +E +V+V S L+DMY KCG +
Sbjct  2    QKQGLGANKFVIPSVLKCCGHVYDVQTGRILHSVILKYSIESDVYVISSLIDMYSKCGEV  61

Query  275  EDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
            E   R F  M E++L+  NA++ GY   G A     L + M +    + PN +T+  +++
Sbjct  62   EKARRVFDRMVEKDLVALNAMLSGYGQHGFAKEGFALMDKMEK--LGIKPNVITWNSLIS  119

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIR---  625
              ++ G       +FE M    G+EP    +  V+  L +    E A++  K+M  R   
Sbjct  120  GFAQKGDDAMVSKMFELMISN-GVEPDVISWTSVISGLVQNFRNEAAFDAFKQMLGRGFL  178

Query  626  PTVSVWGALLGACRVHGKPELGK  694
            PT +    +L AC        G+
Sbjct  179  PTSATISTVLAACATMANVRRGR  201



>ref|XP_007031998.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY02924.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=659

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 187/278 (67%), Gaps = 3/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFL-KAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +++ VSW S++AVY QN L  +AL+VF    R++ +      +S+VL ACA   A + G+
Sbjct  248  DKDEVSWNSMIAVYAQNGLSNEALEVFHGMVRDDNVNYNAVTLSAVLLACAHSGALQAGK  307

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             IH  V+K  +E++V V + ++DMY KCG +E   +AF  + E+N+ +W ALI GY   G
Sbjct  308  CIHDQVIKMGLEDDVIVGTSIIDMYCKCGRVEMARKAFSCIKEKNVRSWTALIAGYGMHG  367

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HA  AL++F +M R    V PNY+TFV VL +CS AG V+ G   F AMKD++ +EPG E
Sbjct  368  HAKEALEVFYNMIR--TGVRPNYITFVSVLASCSHAGLVQEGWHWFNAMKDEFNVEPGVE  425

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY C+VD+LGRAG + +AY+ IK+M + P + +WG+LL ACR+H   EL +I+A+ LF++
Sbjct  426  HYGCMVDLLGRAGYLSQAYKLIKQMKVTPDIVIWGSLLAACRIHKNVELAEISANKLFEL  485

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            D  + G +V+LSN++A +GRWE+   +R  MKD G+ K
Sbjct  486  DSNNCGYYVLLSNIYADAGRWEDVERMRLLMKDRGLIK  523


 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 78/315 (25%), Positives = 137/315 (43%), Gaps = 58/315 (18%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+ +  SW S++A   +     +AL+ F   R+  ++P        + +C+ L     G+
Sbjct  34   DKSSVWSWNSIIAELARAGDSAEALRAFSSMRKLSLKPNRSTFPCAIKSCSALLDLNSGK  93

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
              H   +      ++FV S L+DMY KCG + D    F ++P+RN+++W ++I GY    
Sbjct  94   QTHQQALIFGYGSDLFVSSALIDMYSKCGQLRDARILFDQIPQRNIVSWTSMITGYVQNN  153

Query  362  HANMALDLFED-MTRKTQD--------VVPNYVTFVCVLTACSRA---GA--------VE  481
             A+ AL LF++ + +K+++        V+ + V  V VL+ACSR    GA        ++
Sbjct  154  SADQALLLFKELLIQKSENGGNDAIGQVLIDPVAIVSVLSACSRVPIKGASGGVHGMIIK  213

Query  482  TGMD------------------------IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVE  589
             G D                        +F+AM DK  +      +  ++ +  + G+  
Sbjct  214  KGFDGEVSVGNTLLDAYAKSEDVGLSRKVFDAMVDKDEVS-----WNSMIAVYAQNGLSN  268

Query  590  RAYEFIKRMPIRPTVS----VWGALLGACRVHGKPELGKIAADNLFQIDPQDS---GNHV  748
             A E    M     V+       A+L AC   G  + GK   D + ++  +D    G  +
Sbjct  269  EALEVFHGMVRDDNVNYNAVTLSAVLLACAHSGALQAGKCIHDQVIKMGLEDDVIVGTSI  328

Query  749  ILSNMFASSGRWEEA  793
            I  +M+   GR E A
Sbjct  329  I--DMYCKCGRVEMA  341



>ref|XP_002280683.1| PREDICTED: pentatricopeptide repeat-containing protein At5g59600 
[Vitis vinifera]
Length=545

 Score =   260 bits (664),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 175/263 (67%), Gaps = 2/263 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW S+++ + QN    +    F +  ++G  P+   +SS+L AC  +A    G+ 
Sbjct  261  EPDVVSWTSVISGFVQNFHNHEGFDAFKEMLDQGFCPSSVTISSLLPACTNVANLRHGKE  320

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  +   VE++V+VRS LVDMY KCG I + +  FY MPERN +TWN+LI GYA+ G+
Sbjct  321  IHGYAMVIGVEKDVYVRSALVDMYAKCGYISEAKILFYMMPERNTVTWNSLIFGYANHGY  380

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N A++LF  M  +  D   +++TF  VL ACS AG VE G  +F  M++KY IEP  EH
Sbjct  381  CNEAIELFNQM--EESDTKLDHLTFTAVLNACSHAGMVELGESLFRKMQEKYRIEPRLEH  438

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAG +  AY+ IK MP+ P   VWGALLGACR HG  EL ++AA++LF+++
Sbjct  439  YACMVDLLGRAGKLSEAYDLIKAMPVEPDKFVWGALLGACRNHGNIELAEVAAEHLFELE  498

Query  725  PQDSGNHVILSNMFASSGRWEEA  793
            P+  G+ ++LSN++A +GRW  A
Sbjct  499  PESPGSSLLLSNLYADAGRWGNA  521


 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 107/217 (49%), Gaps = 6/217 (3%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            W  L     +    E+AL  F + ++EG+ P +F++ S+L AC  L+    G ++H +++
Sbjct  96   WIVLTGACARRGFYEEALSAFSEMQKEGLRPNQFVLPSILKACGHLSDRRTGENMHTVIL  155

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
            K   E + ++ S L+ MY KCG +E   R F  + +++L+  NA++ GYA  G  + AL+
Sbjct  156  KNSFESDAYIISALIYMYSKCGHVEKACRVFDWIVDKDLVVMNAMVSGYAQHGFVHEALN  215

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            L + M  +   V PN V++  ++   S+ G      ++F  M    G+EP    +  V+ 
Sbjct  216  LVQKM--QQAGVKPNVVSWNTLIAGFSQVGDKSMVSEVFRLMTAN-GVEPDVVSWTSVIS  272

Query  563  MLGRAGMVERAYEFIKRMPIR---PTVSVWGALLGAC  664
               +       ++  K M  +   P+     +LL AC
Sbjct  273  GFVQNFHNHEGFDAFKEMLDQGFCPSSVTISSLLPAC  309


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 64/144 (44%), Gaps = 3/144 (2%)
 Frame = +2

Query  164  AFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIG  343
            A   GR++H  +V   +    +  + L+  Y +CG + +  + F ++P  N+  W  L G
Sbjct  42   ALYRGRALHAHLVIIGLARLTYFAAKLMSFYTECGQLSNARKLFDKIPNTNIRRWIVLTG  101

Query  344  GYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYG  523
              A +G    AL  F +M +  + + PN      +L AC       TG ++   +  K  
Sbjct  102  ACARRGFYEEALSAFSEMQK--EGLRPNQFVLPSILKACGHLSDRRTGENMHTVIL-KNS  158

Query  524  IEPGAEHYACVVDMLGRAGMVERA  595
             E  A   + ++ M  + G VE+A
Sbjct  159  FESDAYIISALIYMYSKCGHVEKA  182



>ref|XP_006857535.1| hypothetical protein AMTR_s00061p00035580 [Amborella trichopoda]
 gb|ERN19002.1| hypothetical protein AMTR_s00061p00035580 [Amborella trichopoda]
Length=629

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 183/277 (66%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             ++ VSW ++L+ Y QN   ++AL++F + +  G+   E  +   ++ACA L    L R 
Sbjct  224  HKDMVSWTAMLSGYAQNAKPQEALQLFEEMKAAGVPIDEVTLVGAINACAQLGVLHLARQ  283

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH LV+     E+V V S L+DMY KCG +++  + F +M  +N+ +++A+IG +A  GH
Sbjct  284  IHSLVMDYGGPESVVVGSALIDMYAKCGSLKEAYQVFEKMTVKNVFSYSAMIGSFAMHGH  343

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL LF  M  +  D+ PN VTF+ VL ACS  G VE G+  F  M+D+Y I P A+H
Sbjct  344  GRAALRLFSQM--QATDIPPNSVTFIGVLAACSHTGLVEEGVQCFATMQDEYRISPSADH  401

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAG +E A+E +K MPI+P   VWGALLGACR+HG   L ++AA +LF+++
Sbjct  402  YACMVDLLGRAGRLEEAHELLKTMPIKPHAGVWGALLGACRIHGNANLAEVAAKHLFEVE  461

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P   GN+V+LSN++A++ RW++   VRKEM+  G++K
Sbjct  462  PDGIGNYVLLSNIYAAAKRWDDVRRVRKEMRGRGLRK  498


 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 123/273 (45%), Gaps = 43/273 (16%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGI-EPTEFMVSSVLSACAGLAAFELGRSI  187
            N   W +L+  Y     G +A  ++ +    G   P  F  S++  AC+   A + G+ I
Sbjct  97   NAFLWTTLIRAYALRG-GPEAFLLYNRMAALGTPRPISFTFSALFKACS---ASQQGKDI  152

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG--  361
                +K   + +++V++ L+D+Y +CGC+ D  R F  MP R++I+W A+I  YA  G  
Sbjct  153  QAHTLKLGFDSDLYVQNTLIDLYVRCGCVNDARRVFDTMPTRDIISWTAMIVAYAKGGDM  212

Query  362  -----------HANM------------------ALDLFEDMTRKTQDVVPNYVTFVCVLT  454
                       H +M                  AL LFE+M  K   V  + VT V  + 
Sbjct  213  EAARCLFDSLPHKDMVSWTAMLSGYAQNAKPQEALQLFEEM--KAAGVPIDEVTLVGAIN  270

Query  455  ACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            AC++ G +     I   + D YG        + ++DM  + G ++ AY+  ++M ++   
Sbjct  271  ACAQLGVLHLARQIHSLVMD-YGGPESVVVGSALIDMYAKCGSLKEAYQVFEKMTVKNVF  329

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQIDPQD  733
            S + A++G+  +HG    G+ A     Q+   D
Sbjct  330  S-YSAMIGSFAMHGH---GRAALRLFSQMQATD  358



>ref|XP_010090626.1| hypothetical protein L484_003942 [Morus notabilis]
 gb|EXB40230.1| hypothetical protein L484_003942 [Morus notabilis]
Length=810

 Score =   266 bits (679),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 178/277 (64%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ VSW SL+  Y  N   EKA+ +F   R  G+ P +F+++S+LSACA LA  E G+ 
Sbjct  400  DKDVVSWTSLVTGYAHNGFPEKAIGLFRDMRVAGVYPDQFVIASILSACAALAVLEFGQQ  459

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH    K+ +  ++ V + LV MY KCGCIE+  R F  M  RN+ITW ALI GYA  G 
Sbjct  460  IHANCTKSGLRSSLSVDNALVTMYAKCGCIEEANRIFDSMHARNVITWTALIVGYAQNGR  519

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               +L  +  M     D  P+++TF+ +L ACS AG  E G   FE+M   YGI+PG EH
Sbjct  520  GRESLKFYNQMIATGID--PDFITFIGLLFACSHAGLEENGRSYFESMDKVYGIKPGPEH  577

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC++D+LGRA  ++ A E + RM + P  +VW  LL ACRVHG  ELG+ AA NL +++
Sbjct  578  YACMIDLLGRAAKLDEAEELLNRMTVEPDATVWKTLLAACRVHGNVELGERAAKNLLELE  637

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P ++  +V+LSNM++++GRWE+A  +R+ MK +GI K
Sbjct  638  PSNAVPYVLLSNMYSAAGRWEDAARIRRLMKSVGISK  674


 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 116/232 (50%), Gaps = 12/232 (5%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + RN V W +++  Y QN  G KA++ F   R EG++  +F    +L+ACA ++A   G 
Sbjct  197  NSRNHVMWAAMVTGYSQNGEGLKAIRCFQAMRAEGVDCNQFTFPGILTACAAVSALIFGA  256

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  +V++    NVFV+S LVDMY KCG     +R   +M   ++++WN+LI G     
Sbjct  257  QVHACIVRSGFGANVFVQSALVDMYSKCGDFSSAQRMLEDMEVDDVVSWNSLIVGCVRCE  316

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                AL LFE M  + +D+  ++ T+  VL   +    +E    +   +     I+ G E
Sbjct  317  LFREALGLFEKM--RVKDMKTDHFTYPSVLNCLAVMKEIENSKSVHCLI-----IKTGFE  369

Query  542  HYACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
             Y  V    VDM  + G +  AY+    +  +  VS W +L+     +G PE
Sbjct  370  AYVLVGNALVDMYAKQGNLNWAYQMFTLILDKDVVS-WTSLVTGYAHNGFPE  420


 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 110/220 (50%), Gaps = 5/220 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ ++W +L++ Y +++   +A ++F + + EG +P++F + S L  C+ L  F+ G  I
Sbjct  97   KSPITWSTLISGYCRHERETEAFELFWQMQMEGQKPSQFTLGSALRLCSTLGLFKRGEQI  156

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAF-YEMPERNLITWNALIGGYAHQGH  364
            HG  +K   +   FV + LVDMY KC  I D E  F      RN + W A++ GY+  G 
Sbjct  157  HGYTIKTSFDSCDFVLAGLVDMYAKCKRILDAEYLFGMSSNSRNHVMWAAMVTGYSQNGE  216

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  F+ M  + + V  N  TF  +LTAC+   A+  G  +  A   + G       
Sbjct  217  GLKAIRCFQAM--RAEGVDCNQFTFPGILTACAAVSALIFGAQV-HACIVRSGFGANVFV  273

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
             + +VDM  + G    A   ++ M +   VS W +L+  C
Sbjct  274  QSALVDMYSKCGDFSSAQRMLEDMEVDDVVS-WNSLIVGC  312


 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 105/213 (49%), Gaps = 4/213 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW SL+    + +L  +AL +F K R + ++   F   SVL+  A +   E  +S+H L
Sbjct  303  VSWNSLIVGCVRCELFREALGLFEKMRVKDMKTDHFTYPSVLNCLAVMKEIENSKSVHCL  362

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K   E  V V + LVDMY K G +    + F  + ++++++W +L+ GYAH G    A
Sbjct  363  IIKTGFEAYVLVGNALVDMYAKQGNLNWAYQMFTLILDKDVVSWTSLVTGYAHNGFPEKA  422

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + LF DM  +   V P+      +L+AC+    +E G  I  A   K G+         +
Sbjct  423  IGLFRDM--RVAGVYPDQFVIASILSACAALAVLEFGQQI-HANCTKSGLRSSLSVDNAL  479

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
            V M  + G +E A      M  R  ++ W AL+
Sbjct  480  VTMYAKCGCIEEANRIFDSMHARNVIT-WTALI  511



>ref|XP_011035271.1| PREDICTED: pentatricopeptide repeat-containing protein At5g59600 
[Populus euphratica]
Length=557

 Score =   260 bits (664),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 179/264 (68%), Gaps = 1/264 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + +SW S+++   QN   E A   F +   +G  PT   +S+VL+ACA +A    GR 
Sbjct  271  EPDVISWTSVISGLVQNFRNEAAFDAFKQMLGQGFLPTSATISTVLAACATMANVRRGRE  330

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  V   VE++++VRS LVDMY KCG I +    FY MPERN +TWN++I GYA+ G+
Sbjct  331  IHGYAVVIRVEDDIYVRSALVDMYAKCGFISEASMLFYMMPERNTVTWNSMIFGYANHGY  390

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A++LF+ M +   D + +++TF  VLTACS AG VE G  +F  M+ KY I P  EH
Sbjct  391  CDEAIELFDQMEKSEGDKL-DHLTFTAVLTACSHAGMVEHGQSLFLLMQQKYKIVPRLEH  449

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAG +  AY+ IK+MP++P + VWGALLGACR HG   L ++AA +L +++
Sbjct  450  YACMVDLLGRAGNLNEAYDVIKKMPVKPDLFVWGALLGACRNHGDIGLAEVAARHLAELE  509

Query  725  PQDSGNHVILSNMFASSGRWEEAN  796
            P+++GN++++SN++A +G WE  +
Sbjct  510  PENAGNNMLMSNLYADAGSWENVS  533


 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 114/233 (49%), Gaps = 6/233 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N   W  L+  Y +  L ++AL VF + +++G    +F++ SVL  C  +     GR 
Sbjct  100  ESNIRRWIVLIGAYSRRGLIQEALSVFYEMQKQGFGANKFVIPSVLKCCGHVYDVHTGRI  159

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +++K  +E +V+V S L+DMY KCG +E   R F  M E++L+  NA++ GY   G 
Sbjct  160  LHSVILKYSIESDVYVISSLIDMYSKCGEVEKARRVFDRMVEKDLVALNAMLSGYGQHGF  219

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A     L + M +    + PN +T+  +++  ++ G       +FE M  K G EP    
Sbjct  220  AKEGFALMDKMEK--LGIKPNVITWNSLISGFAQKGDDAMVSKMFELMISK-GAEPDVIS  276

Query  545  YACVVDMLGRAGMVERAYEFIKRM---PIRPTVSVWGALLGACRVHGKPELGK  694
            +  V+  L +    E A++  K+M      PT +    +L AC        G+
Sbjct  277  WTSVISGLVQNFRNEAAFDAFKQMLGQGFLPTSATISTVLAACATMANVRRGR  329


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 80/183 (44%), Gaps = 4/183 (2%)
 Frame = +2

Query  164  AFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIG  343
            A + G+ +H  ++   +       S L+  Y +   I D  + F ++PE N+  W  LIG
Sbjct  52   ALQQGKKLHAHLIINGLARLTHFASKLISFYVETKQISDARKLFDKIPESNIRRWIVLIG  111

Query  344  GYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYG  523
             Y+ +G    AL +F +M +  Q    N      VL  C     V TG  I  ++  KY 
Sbjct  112  AYSRRGLIQEALSVFYEMQK--QGFGANKFVIPSVLKCCGHVYDVHTG-RILHSVILKYS  168

Query  524  IEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAA  703
            IE      + ++DM  + G VE+A     RM  +  V++  A+L     HG  + G    
Sbjct  169  IESDVYVISSLIDMYSKCGEVEKARRVFDRMVEKDLVAL-NAMLSGYGQHGFAKEGFALM  227

Query  704  DNL  712
            D +
Sbjct  228  DKM  230



>emb|CBI30291.3| unnamed protein product [Vitis vinifera]
Length=616

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 179/276 (65%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VS+  L+  Y + +  EK L VF++ R +GIEP EF  SS++ ACA  AA E G  +
Sbjct  207  RNVVSYTCLIDGYVETEQIEKGLSVFVELRRQGIEPNEFTFSSLIKACANQAALEQGTQL  266

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  V+K   +E+ FV S+LVDMYGKCG +E   +AF E+ +   I WN+L+  +   G  
Sbjct  267  HAQVMKINFDEDPFVSSILVDMYGKCGLLEQAIQAFDEIGDPTEIAWNSLVSVFGQHGLG  326

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ +FE M  +   V PN +TF+ +LT CS AG VE G+D F +M   YG+ PG EHY
Sbjct  327  KDAIKIFERMVDR--GVKPNAITFISLLTGCSHAGLVEEGLDYFYSMDKTYGVVPGEEHY  384

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +CV+D+LGRAG ++ A EFI RMP  P    W + LGACR+HG  E+GK+AA+ L +++P
Sbjct  385  SCVIDLLGRAGRLKEAKEFINRMPFEPNAFGWCSFLGACRIHGDKEMGKLAAEKLVKLEP  444

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++SG  V+LSN++A+  +WE+   VR  M+D  +KK
Sbjct  445  KNSGALVLLSNIYANERQWEDVRSVRMRMRDGNVKK  480


 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 84/305 (28%), Positives = 139/305 (46%), Gaps = 33/305 (11%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW ++++   QN    +A++ F   R  G  PT+F  SS + ACA L + E+G+ 
Sbjct  3    QRNLVSWTAMISGLSQNSKFSEAIRTFCGMRICGEVPTQFAFSSAIRACASLGSIEMGKQ  62

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +K  +   +FV S L DMY KCG + D  + F EMP ++ ++W A+I GY+  G 
Sbjct  63   MHCLALKFGIGSELFVGSNLEDMYSKCGAMFDACKVFEEMPCKDEVSWTAMIDGYSKIGE  122

Query  365  ANMALDLFEDMTRK----TQDVVPNYVTFVCVLTACSRAGAVETGM-------DIF----  499
               AL  F+ M  +     Q V+ + +     L AC    +V + +       DIF    
Sbjct  123  FEEALLAFKKMIDEEVTIDQHVLCSTLGACGALKACKFGRSVHSSVVKLGFESDIFVGNA  182

Query  500  -----------EAMKDKYGIEPGAEH---YACVVDMLGRAGMVERAYEF---IKRMPIRP  628
                       E+  + +GI+    +   Y C++D       +E+       ++R  I P
Sbjct  183  LTDMYSKAGDMESASNVFGIDSECRNVVSYTCLIDGYVETEQIEKGLSVFVELRRQGIEP  242

Query  629  TVSVWGALLGACRVHGKPELGKIAADNLFQID-PQDSGNHVILSNMFASSGRWEEANLVR  805
                + +L+ AC      E G      + +I+  +D     IL +M+   G  E+A    
Sbjct  243  NEFTFSSLIKACANQAALEQGTQLHAQVMKINFDEDPFVSSILVDMYGKCGLLEQAIQAF  302

Query  806  KEMKD  820
             E+ D
Sbjct  303  DEIGD  307


 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/233 (32%), Positives = 118/233 (51%), Gaps = 10/233 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW +++  Y +    E+AL  F K  +E +   + ++ S L AC  L A + GRS+
Sbjct  105  KDEVSWTAMIDGYSKIGEFEEALLAFKKMIDEEVTIDQHVLCSTLGACGALKACKFGRSV  164

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE-RNLITWNALIGGYAHQGH  364
            H  VVK   E ++FV + L DMY K G +E     F    E RN++++  LI GY     
Sbjct  165  HSSVVKLGFESDIFVGNALTDMYSKAGDMESASNVFGIDSECRNVVSYTCLIDGYVETEQ  224

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPGAE  541
                L +F ++ R  Q + PN  TF  ++ AC+   A+E G  +  + MK  +  +P   
Sbjct  225  IEKGLSVFVELRR--QGIEPNEFTFSSLIKACANQAALEQGTQLHAQVMKINFDEDPFVS  282

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIA  700
              + +VDM G+ G++E+A +    +   PT   W +L+     HG   LGK A
Sbjct  283  --SILVDMYGKCGLLEQAIQAFDEIG-DPTEIAWNSLVSVFGQHG---LGKDA  329


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 77/161 (48%), Gaps = 10/161 (6%)
 Frame = +2

Query  302  MPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE  481
            MP+RNL++W A+I G +     + A+  F  M  +    VP    F   + AC+  G++E
Sbjct  1    MPQRNLVSWTAMISGLSQNSKFSEAIRTFCGM--RICGEVPTQFAFSSAIRACASLGSIE  58

Query  482  TGMDIFEAMKDKYGIEPGAEHY--ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
             G  +   +  K+GI  G+E +  + + DM  + G +  A +  + MP +  VS W A++
Sbjct  59   MGKQM-HCLALKFGI--GSELFVGSNLEDMYSKCGAMFDACKVFEEMPCKDEVS-WTAMI  114

Query  656  GACRVHGKPELGKIAADNLFQIDPQDSGNHVILSNMFASSG  778
                  G+ E   +A   +  ID + + +  +L +   + G
Sbjct  115  DGYSKIGEFEEALLAFKKM--IDEEVTIDQHVLCSTLGACG  153



>ref|XP_009388285.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=649

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 185/277 (67%), Gaps = 3/277 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEG-IEPTEFMVSSVLSACAGLAAFELGRS  184
            R+ VSW S++A+Y QN L  +AL+++ K    G I+     +S+VL ACA   A ++G+ 
Sbjct  239  RDVVSWNSMIALYAQNGLSAEALELYTKMLTNGSIQHNAVTLSAVLLACAHAGALQIGKC  298

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH  VV+  +E++V+V + +VDMY KCG +   ++AF  M E+N+++W+A++ GY   GH
Sbjct  299  IHNQVVRMGLEKDVYVGTSVVDMYCKCGRVRMAKKAFDRMKEKNILSWSAMVAGYGMHGH  358

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL +F +MTR  +   PNY+TFV VL ACS AG V  G    +AMK K+ IEPG EH
Sbjct  359  GQEALKVFHEMTRSGEK--PNYITFVSVLAACSHAGLVNEGRYWLDAMKRKFNIEPGVEH  416

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+LGRAG +  AY  IK M ++P   VWGALL ACR+H   ELG+I+A  LF++D
Sbjct  417  YGCMVDLLGRAGCLNEAYRLIKDMKVKPDFVVWGALLSACRIHKNVELGEISARKLFELD  476

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P++ G +V+LSN++A +GRW +   +R  +K+ G+ K
Sbjct  477  PKNCGYYVLLSNIYADAGRWNDVQRLRVIIKNKGLVK  513


 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 114/226 (50%), Gaps = 5/226 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVF--LKAREEGIEPTEFMVSSVLSACAGLAAFELG  178
             RN V W +++A Y  ND  E A+ +F    A E G         +VLSAC+ ++  ++ 
Sbjct  135  HRNAVLWTAMVAGYVWNDAPEDAIFLFKDFLADEGGAGIDSVAAVAVLSACSRVSGKKVA  194

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
              IHGLV+K  +E +V V + L D Y K G +    + F  M  R++++WN++I  YA  
Sbjct  195  EGIHGLVMKVGLEMDVGVGNTLTDAYAKGGDLSLGRKVFEGMAARDVVSWNSMIALYAQN  254

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G +  AL+L+  M      +  N VT   VL AC+ AGA++ G  I   +  + G+E   
Sbjct  255  GLSAEALELYTKML-TNGSIQHNAVTLSAVLLACAHAGALQIGKCIHNQVV-RMGLEKDV  312

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
                 VVDM  + G V  A +   RM  +  +S W A++    +HG
Sbjct  313  YVGTSVVDMYCKCGRVRMAKKAFDRMKEKNILS-WSAMVAGYGMHG  357


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 73/161 (45%), Gaps = 2/161 (1%)
 Frame = +2

Query  176  GRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAH  355
            GR +H   ++  +  ++FV S LVDMY KC  + D  RAF E P RN + W A++ GY  
Sbjct  91   GRQLHLFALRLGLLPDLFVASSLVDMYAKCRELSDARRAFDESPHRNAVLWTAMVAGYVW  150

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPG  535
                  A+ LF+D          + V  V VL+ACSR    +    I   +  K G+E  
Sbjct  151  NDAPEDAIFLFKDFLADEGGAGIDSVAAVAVLSACSRVSGKKVAEGI-HGLVMKVGLEMD  209

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
                  + D   + G +    +  + M  R  VS W +++ 
Sbjct  210  VGVGNTLTDAYAKGGDLSLGRKVFEGMAARDVVS-WNSMIA  249


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 76/152 (50%), Gaps = 6/152 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N +SW +++A Y  +  G++ALKVF +    G +P      SVL+AC+       GR 
Sbjct  340  EKNILSWSAMVAGYGMHGHGQEALKVFHEMTRSGEKPNYITFVSVLAACSHAGLVNEGRY  399

Query  185  -IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER-NLITWNALIGGYAHQ  358
             +  +  K  +E  V     +VD+ G+ GC+ +  R   +M  + + + W AL+   A +
Sbjct  400  WLDAMKRKFNIEPGVEHYGCMVDLLGRAGCLNEAYRLIKDMKVKPDFVVWGALLS--ACR  457

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLT  454
             H N  ++L E   RK  ++ P    +  +L+
Sbjct  458  IHKN--VELGEISARKLFELDPKNCGYYVLLS  487



>gb|KDO55063.1| hypothetical protein CISIN_1g040643mg [Citrus sinensis]
Length=968

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 188/278 (68%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D ++ +SW  L++ + Q+   E AL+VF +  + G++   +   SV+SA A LA  + G+
Sbjct  557  DAKDNISWNGLISGFAQSGYCEGALQVFSQMTQVGVQANLYTFGSVVSAAANLANIKQGK  616

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H +++K   +      + L+ +Y KCG I+D +R F EMPE+N ++WNA+I G++  G
Sbjct  617  QVHAMIIKTGYDSETEASNSLITLYAKCGSIDDAKREFLEMPEKNEVSWNAMITGFSQHG  676

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            +A  A++LFE M  K  DV+PN+VTFV VL+ACS  G V  G+  FE+M  +YG+ P  E
Sbjct  677  YALEAINLFEKM--KKHDVMPNHVTFVGVLSACSHVGLVNEGLRYFESMSTEYGLVPKPE  734

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACVVD+LGRAG + RA EF ++MPI P   VW  LL ACRVH   E+G+ AA++L ++
Sbjct  735  HYACVVDLLGRAGCLSRAREFTEQMPIEPDAMVWRTLLSACRVHKNMEIGEYAANHLLEL  794

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +P+DS  +V+LSN++A++G+W+  + +R+ MKD G+KK
Sbjct  795  EPEDSATYVLLSNIYAAAGKWDCRDQIRQIMKDRGVKK  832


 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 115/218 (53%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW ++++ + QN    +A+ +F +    G  PT + +SS LSAC  +  FE+G   
Sbjct  177  KDSVSWVAMISGFSQNGYEREAILLFCQMHILGTVPTPYAISSALSACTKIELFEIGEQF  236

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL+ K       FV + LV +Y + G +   E+ F +M +R+ +T+N+LI G A  G++
Sbjct  237  HGLIFKWGFSSETFVCNALVTLYSRSGNLTSAEQIFSKMQQRDGVTYNSLISGLAQCGYS  296

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            + AL+LFE M  +   + P+ VT   +++AC+  GA  TG  +  +   K GI       
Sbjct  297  DKALELFEKM--QLDCLKPDCVTVASLVSACASVGAFRTGEQL-HSYAIKVGISKDIIVE  353

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D+  +   VE AY+F         V +W  +L A
Sbjct  354  GSMLDLYVKCSDVETAYKFFLTTETENVV-LWNVMLVA  390


 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 120/238 (50%), Gaps = 8/238 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +++  + Q+ +  +AL++F +   +GI+      SS +SACAG+ A   GR 
Sbjct  457  EDDVVSWTAMIVGFVQHGMFGEALELFEEMENQGIQSDNIGFSSAISACAGIQALNQGRQ  516

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH     +   +++ + + L+ +Y +CG I++    F ++  ++ I+WN LI G+A  G+
Sbjct  517  IHAQSYISGFSDDLSIGNALISLYARCGRIQEAYLVFNKIDAKDNISWNGLISGFAQSGY  576

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL +F  MT+    V  N  TF  V++A +    ++ G  +  AM  K G +   E 
Sbjct  577  CEGALQVFSQMTQV--GVQANLYTFGSVVSAAANLANIKQGKQV-HAMIIKTGYDSETEA  633

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
               ++ +  + G ++ A      MP +  VS W A++     HG      + A NLF+
Sbjct  634  SNSLITLYAKCGSIDDAKREFLEMPEKNEVS-WNAMITGFSQHGYA----LEAINLFE  686


 Score = 99.8 bits (247),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 107/224 (48%), Gaps = 26/224 (12%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+GV++ SL++   Q    +KAL++F K + + ++P    V+S++SACA + AF  G  
Sbjct  277  QRDGVTYNSLISGLAQCGYSDKALELFEKMQLDCLKPDCVTVASLVSACASVGAFRTGEQ  336

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   +K  + +++ V   ++D+Y KC  +E   + F      N++ WN ++  Y     
Sbjct  337  LHSYAIKVGISKDIIVEGSMLDLYVKCSDVETAYKFFLTTETENVVLWNVMLVAYGQLND  396

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + +  +F+ M  +T+ + PN  T+  +L  C+  GA+  G  I   +            
Sbjct  397  LSESFQIFKQM--QTEGLTPNQYTYPTILRTCTSLGALSLGEQIHTQL------------  442

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
                       G +  A E ++R+P    VS W A++     HG
Sbjct  443  -----------GNLNTAQEILRRLPEDDVVS-WTAMIVGFVQHG  474


 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 102/215 (47%), Gaps = 9/215 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAAFELG  178
            +R   SW  L++ +    L  + L +FL+  ++ + P E     VL AC  +G  A +  
Sbjct  73   KRTVFSWNKLISGFVAKKLSGRVLGLFLQMIDDDVIPNEATFVGVLRACIGSGNVAVQCV  132

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
              IHGL++      +  + + L+D+Y K G I+  ++ F  +  ++ ++W A+I G++  
Sbjct  133  NQIHGLIISHGFGGSPLISNPLIDLYAKNGFIDSAKKVFNNLCFKDSVSWVAMISGFSQN  192

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G+   A+ LF  M       VP        L+AC++    E G + F  +  K+G    +
Sbjct  193  GYEREAILLFCQM--HILGTVPTPYAISSALSACTKIELFEIG-EQFHGLIFKWGFS--S  247

Query  539  EHYAC--VVDMLGRAGMVERAYEFIKRMPIRPTVS  637
            E + C  +V +  R+G +  A +   +M  R  V+
Sbjct  248  ETFVCNALVTLYSRSGNLTSAEQIFSKMQQRDGVT  282


 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/219 (24%), Positives = 94/219 (43%), Gaps = 28/219 (13%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQ-NDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELG  178
            +  N V W  +L  Y Q NDL E + ++F + + EG+ P ++   ++L  C  L A  LG
Sbjct  377  ETENVVLWNVMLVAYGQLNDLSE-SFQIFKQMQTEGLTPNQYTYPTILRTCTSLGALSLG  435

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
              IH                       + G +   +     +PE ++++W A+I G+   
Sbjct  436  EQIH----------------------TQLGNLNTAQEILRRLPEDDVVSWTAMIVGFVQH  473

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G    AL+LFE+M  + Q +  + + F   ++AC+   A+  G  I  A     G     
Sbjct  474  GMFGEALELFEEM--ENQGIQSDNIGFSSAISACAGIQALNQGRQI-HAQSYISGFSDDL  530

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
                 ++ +  R G ++ AY    ++  +  +S W  L+
Sbjct  531  SIGNALISLYARCGRIQEAYLVFNKIDAKDNIS-WNGLI  568


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 84/194 (43%), Gaps = 4/194 (2%)
 Frame = +2

Query  98   EEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIE  277
            E GI+        +L  C    +    + IHG ++K   +    +     ++Y   G ++
Sbjct  3    ERGIQANSQTFVWLLEGCLSYGSLLEAKKIHGKILKLGFDGEQVLCDKFFNIYLTSGDLD  62

Query  278  DCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTA  457
               + F +M +R + +WN LI G+  +  +   L LF  M     DV+PN  TFV VL A
Sbjct  63   SAMKIFDDMSKRTVFSWNKLISGFVAKKLSGRVLGLFLQMI--DDDVIPNEATFVGVLRA  120

Query  458  CSRAGAVETG-MDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
            C  +G V    ++    +   +G          ++D+  + G ++ A +    +  + +V
Sbjct  121  CIGSGNVAVQCVNQIHGLIISHGFGGSPLISNPLIDLYAKNGFIDSAKKVFNNLCFKDSV  180

Query  635  SVWGALLGACRVHG  676
            S W A++     +G
Sbjct  181  S-WVAMISGFSQNG  193



>ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Cicer arietinum]
Length=610

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 185/277 (67%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V+W S++  +  N    +AL +F +   EG+EP  F V S+LSACA L A ELGR 
Sbjct  200  ERDLVAWNSVINGFALNGKPNEALSLFREMSLEGVEPDGFTVVSLLSACAELGAVELGRR  259

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  ++K  + EN+ V + L+D Y KCG I   ++ F EM ERN+++W +LI G A  G 
Sbjct  260  VHVYLLKIGLTENLHVNNSLLDFYAKCGSIRQAQQVFSEMGERNVVSWTSLIVGLAVNGF  319

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL+LF+DM R  Q++VP  +TFV VL ACS  G ++ G + F  MKD+YGI P  EH
Sbjct  320  GEEALELFKDMER--QELVPGEITFVGVLYACSHCGMLDEGFNYFRRMKDEYGIMPRIEH  377

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+L RAG+V++AYE+I+ MP++P   +W  LLGAC V+G   LG+IA  +L +++
Sbjct  378  YGCMVDLLSRAGLVKQAYEYIQNMPMQPNAVIWRTLLGACTVYGDLGLGEIARSHLLKLE  437

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+ SG++V+LSN++AS  RW +  +VR+ M + G+ K
Sbjct  438  PKHSGDYVLLSNLYASERRWSDVQMVRRSMIEDGVWK  474


 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 108/222 (49%), Gaps = 4/222 (2%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N  +W +++  Y ++D    AL  + K     +EP       +L A +       G +IH
Sbjct  101  NVFTWNTMIRGYAESDNSSPALPFYRKMLVSCVEPDTHTYPFLLKAISKSLNVREGEAIH  160

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
             + ++   E  +FVR+ L+ +Y  CG  E   + F  M ER+L+ WN++I G+A  G  N
Sbjct  161  SVTIRNGFESLIFVRNSLLHIYAACGDTESAYKVFELMGERDLVAWNSVINGFALNGKPN  220

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
             AL LF +M+   + V P+  T V +L+AC+  GAVE G  +   +  K G+        
Sbjct  221  EALSLFREMS--LEGVEPDGFTVVSLLSACAELGAVELGRRVHVYLL-KIGLTENLHVNN  277

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
             ++D   + G + +A +    M  R  VS W +L+    V+G
Sbjct  278  SLLDFYAKCGSIRQAQQVFSEMGERNVVS-WTSLIVGLAVNG  318



>ref|XP_004952954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Setaria italica]
Length=883

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 183/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            +S  S++    Q+D GE A+K+F++   +G+EP  F++SS+L+ACA L+A+E G+ +H  
Sbjct  477  ISSTSMITALSQSDHGEDAIKLFVQMLRKGLEPDSFVLSSLLNACASLSAYEQGKQVHAH  536

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     +VF  + LV  Y KCG IED + AF  +PER +++W+A+IGG A  G    +
Sbjct  537  LIKRQFTSDVFAGNALVYTYAKCGSIEDADMAFSGLPERGVVSWSAMIGGLAQHGQGKRS  596

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LF  M    + V PN++T   VL+AC+ AG V+     FE+MK+ +GI+   EHY+C+
Sbjct  597  LELFHRML--DEGVAPNHITLTSVLSACNHAGLVDEAKKYFESMKEMFGIDRTEEHYSCM  654

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +E A E +  MP     +VWGALLGA RVH  PELG++AA+ LF ++P+ S
Sbjct  655  IDLLGRAGKLEDAMELVNNMPFEANAAVWGALLGASRVHQDPELGRLAAEKLFTLEPEKS  714

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N +AS+G W+E   VRK MK+  +KK
Sbjct  715  GTHVLLANTYASAGMWDEVAKVRKLMKESNLKK  747


 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 121/231 (52%), Gaps = 16/231 (7%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  +++ Y +ND    A+ VF +    G  P EF  S V++AC G    E GR 
Sbjct  168  ERNAVSWNGMMSAYVKNDRCGDAIGVFREMVWSGARPNEFGFSCVVNACTGARDSEAGRQ  227

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +VV+   +E+VF  + LVDMY K G I+     F +MP  ++++WNA I G    GH
Sbjct  228  VHAMVVRMGYDEDVFTANALVDMYSKLGDIDTAAVVFEKMPAVDVVSWNAFISGCVIHGH  287

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF------EAMKDKYGI  526
             + AL+L   M  K+  +VPN  T   +L AC+ AGA   G  I       +A+ D++ I
Sbjct  288  DHRALELLIQM--KSSGLVPNVYTLSTILKACAGAGAFNLGRQIHGFMIKADAVSDEF-I  344

Query  527  EPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
              G      +VDM  + G ++ A +    MP +  + +W AL+  C   G+
Sbjct  345  GVG------LVDMYAKDGFLDDARKVFNFMPQKNLI-LWNALISGCSHDGQ  388


 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 94/170 (55%), Gaps = 1/170 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW + ++    +    +AL++ ++ +  G+ P  + +S++L ACAG  AF LGR IHG 
Sbjct  273  VSWNAFISGCVIHGHDHRALELLIQMKSSGLVPNVYTLSTILKACAGAGAFNLGRQIHGF  332

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++KA    + F+   LVDMY K G ++D  + F  MP++NLI WNALI G +H G    A
Sbjct  333  MIKADAVSDEFIGVGLVDMYAKDGFLDDARKVFNFMPQKNLILWNALISGCSHDGQCGEA  392

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
            L LF  M  +  D+  N  T   VL + +   A+     +  A+ +K G+
Sbjct  393  LSLFRRMRMEGLDLDVNRTTLAAVLKSTASLEAISHTRQV-HALAEKIGL  441


 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 105/225 (47%), Gaps = 12/225 (5%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW SL+  Y  N +  +AL  F   R  G+   EF +  VL  CA  A   LG  +H L
Sbjct  69   VSWSSLVTAYSNNSMPREALGAFRAMRSRGVRCNEFALPVVLK-CAPDA--RLGAQVHAL  125

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYE-----MPERNLITWNALIGGYAHQG  361
             V   ++ +VFV + LV MYG  G +++  R F E       ERN ++WN ++  Y    
Sbjct  126  AVATALDGDVFVANALVAMYGGFGMVDEARRMFDESGGAISKERNAVSWNGMMSAYVKND  185

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                A+ +F +M        PN   F CV+ AC+ A   E G  +  AM  + G +    
Sbjct  186  RCGDAIGVFREMV--WSGARPNEFGFSCVVNACTGARDSEAGRQV-HAMVVRMGYDEDVF  242

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
                +VDM  + G ++ A    ++MP    VS W A +  C +HG
Sbjct  243  TANALVDMYSKLGDIDTAAVVFEKMPAVDVVS-WNAFISGCVIHG  286


 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 137/286 (48%), Gaps = 18/286 (6%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIE--PTEFMVSSVLSACAGLAAFELG  178
            ++N + W +L++    +    +AL +F + R EG++       +++VL + A L A    
Sbjct  370  QKNLILWNALISGCSHDGQCGEALSLFRRMRMEGLDLDVNRTTLAAVLKSTASLEAISHT  429

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            R +H L  K  +  +  V + L+D Y KC C+ D  R F E    ++I+  ++I   +  
Sbjct  430  RQVHALAEKIGLLSDSHVINGLIDSYWKCDCLNDAVRVFEESCPDDIISSTSMITALSQS  489

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPG  535
             H   A+ LF  M RK  +  P+      +L AC+   A E G  +    +K ++  +  
Sbjct  490  DHGEDAIKLFVQMLRKGLE--PDSFVLSSLLNACASLSAYEQGKQVHAHLIKRQFTSDVF  547

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF  715
            A +   +V    + G +E A      +P R  VS W A++G    HG+   GK + + LF
Sbjct  548  AGN--ALVYTYAKCGSIEDADMAFSGLPERGVVS-WSAMIGGLAQHGQ---GKRSLE-LF  600

Query  716  Q--IDPQDSGNHVILSNMFAS---SGRWEEANLVRKEMKDI-GIKK  835
               +D   + NH+ L+++ ++   +G  +EA    + MK++ GI +
Sbjct  601  HRMLDEGVAPNHITLTSVLSACNHAGLVDEAKKYFESMKEMFGIDR  646



>ref|XP_011087320.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like isoform X3 [Sesamum indicum]
Length=984

 Score =   268 bits (684),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 175/277 (63%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+  +W  +++ Y Q + GEKA   F + R EG+ P EF ++S L  C+G+A+ E GR 
Sbjct  574  ERDVFAWTVIISGYSQTNQGEKAAHYFNQMRREGVIPNEFTLASCLRGCSGIASLENGRQ  633

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +K+    ++FV S LVDMYGKCGCI+D E  FY+M   + + WN +I  Y+  G 
Sbjct  634  LHSLAIKSGQSADMFVASSLVDMYGKCGCIDDAETLFYDMHSGDTVLWNTIICAYSQHGE  693

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+ AL  F  M      V+P+ VTFV +L+ACS  G VE G   F +M + YGI P  EH
Sbjct  694  ADKALQAFRKMV--NTGVLPDVVTFVGILSACSHMGLVEEGRKHFYSMSESYGITPIIEH  751

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAG  +     I+ M + P   +W  +LGACRVHG  ELG+IAA  LFQI+
Sbjct  752  YACLVDILGRAGKFDEVESLIEHMELTPNALIWENVLGACRVHGNLELGEIAAQELFQIN  811

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+   N+++LSN++AS GRW + + VR  M   GIKK
Sbjct  812  PETDSNYILLSNLYASRGRWNDVSKVRALMTSKGIKK  848


 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 109/226 (48%), Gaps = 5/226 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW +LL+ +  ++  ++ ++ F +   EG  P  +   S L +C+     E G+ +
Sbjct  475  RDVVSWNALLSGF-HDETSDQGIRTFRQMLTEGFRPNMYTFISTLRSCSSFLNIEYGKQV  533

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  ++K     N +V + L+DMY KCGC+ED E  F  + ER++  W  +I GY+     
Sbjct  534  HTHIIKDNSINNGYVGTALLDMYAKCGCMEDVEAIFSRLMERDVFAWTVIISGYSQTNQG  593

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A   F  M R  + V+PN  T    L  CS   ++E G  +  ++  K G        
Sbjct  594  EKAAHYFNQMRR--EGVIPNEFTLASCLRGCSGIASLENGRQL-HSLAIKSGQSADMFVA  650

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            + +VDM G+ G ++ A      M    TV +W  ++ A   HG+ +
Sbjct  651  SSLVDMYGKCGCIDDAETLFYDMHSGDTV-LWNTIICAYSQHGEAD  695


 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 112/229 (49%), Gaps = 10/229 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW +L++ +     G +++++F + R E +   EF  ++VL   +     E G+ +
Sbjct  172  KDVVSWTALISGFVAQGYGVESVELFYEMRREDVRANEFTFATVLKGSSMSLDLEFGKQL  231

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG VVK     +V+V + L+D+Y KCG +E     F  MPE+N + WN L+ GYA +G  
Sbjct  232  HGEVVKIGCLSDVYVGAALIDLYSKCGEMEYAVDVFRMMPEKNAVMWNTLLNGYAQEGDG  291

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               L LF  MT + +    NY T   VL   + +GA   G  +  ++  K G EP     
Sbjct  292  EAVLQLFSKMT-EPEMRFSNY-TLSIVLKGIASSGAFRAGQAV-HSIAIKIGGEPDDFVT  348

Query  548  ACVVDMLGRAGMVERA---YEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
              +V+M  + G+   A   +E IK     P +  W +++      G  E
Sbjct  349  CSLVNMYSKCGVANDALKVFEMIK----SPDIVAWSSIISVLDQQGLKE  393


 Score = 99.8 bits (247),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 100/217 (46%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N V W +LL  Y Q   GE  L++F K  E  +  + + +S VL   A   AF  G++
Sbjct  272  EKNAVMWNTLLNGYAQEGDGEAVLQLFSKMTEPEMRFSNYTLSIVLKGIASSGAFRAGQA  331

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + +K   E + FV   LV+MY KCG   D  + F  +   +++ W+++I     QG 
Sbjct  332  VHSIAIKIGGEPDDFVTCSLVNMYSKCGVANDALKVFEMIKSPDIVAWSSIISVLDQQGL  391

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A   F  M  +  D+ PN  T   +++A +  G +  G  I  A   K+G E     
Sbjct  392  KEEAAKFFRLM--RCTDMTPNQFTLSSLVSAATDLGDLRYGQSI-HACAHKFGFESDDLV  448

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               ++ M  +   +   Y    +M  R  VS W ALL
Sbjct  449  SNALIGMYMKFQSIYDGYHIFSKMTNRDVVS-WNALL  484


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/235 (29%), Positives = 109/235 (46%), Gaps = 8/235 (3%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W S+++V +Q  L E+A K F   R   + P +F +SS++SA   L     G+SIH  
Sbjct  377  VAWSSIISVLDQQGLKEEAAKFFRLMRCTDMTPNQFTLSSLVSAATDLGDLRYGQSIHAC  436

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
              K   E +  V + L+ MY K   I D    F +M  R++++WNAL+ G+ H   ++  
Sbjct  437  AHKFGFESDDLVSNALIGMYMKFQSIYDGYHIFSKMTNRDVVSWNALLSGF-HDETSDQG  495

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +  F  M   T+   PN  TF+  L +CS    +E G  +   +     I  G    A +
Sbjct  496  IRTFRQML--TEGFRPNMYTFISTLRSCSSFLNIEYGKQVHTHIIKDNSINNGYVGTA-L  552

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            +DM  + G +E       R+  R  V  W  ++     + +   G+ AA    Q+
Sbjct  553  LDMYAKCGCMEDVEAIFSRLMERD-VFAWTVIISG---YSQTNQGEKAAHYFNQM  603


 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 92/185 (50%), Gaps = 4/185 (2%)
 Frame = +2

Query  131  SSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE  310
            S VL  CA       G+ IH  ++K+ +E ++ +   L++ Y KCG +E     F +MP 
Sbjct  112  SEVLRNCAAEMYLNKGKVIHCRIIKSGIEPDMHLWVSLINFYAKCGALESSYHVFDQMPL  171

Query  311  RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM  490
            +++++W ALI G+  QG+   +++LF +M R  +DV  N  TF  VL   S +  +E G 
Sbjct  172  KDVVSWTALISGFVAQGYGVESVELFYEMRR--EDVRANEFTFATVLKGSSMSLDLEFGK  229

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRV  670
             +   +  K G        A ++D+  + G +E A +  + MP +  V +W  LL     
Sbjct  230  QLHGEVV-KIGCLSDVYVGAALIDLYSKCGEMEYAVDVFRMMPEKNAV-MWNTLLNGYAQ  287

Query  671  HGKPE  685
             G  E
Sbjct  288  EGDGE  292



>ref|NP_001055349.1| Os05g0370000 [Oryza sativa Japonica Group]
 gb|AAV31228.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17263.1| Os05g0370000 [Oryza sativa Japonica Group]
Length=664

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 177/277 (64%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSW S++A   QN    +A+ +F + + EGIEP    +  VL A A +AA   GRS
Sbjct  254  ELNVVSWTSIVACCVQNGRDLEAVDLFREMQSEGIEPNSVTIPCVLPAFANIAALMHGRS  313

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H   ++     +++V S LVDMY KCG + D    F  MP RN+++WNA+IGGYA  G 
Sbjct  314  AHCFSLRKGFHHDIYVGSALVDMYAKCGRVRDARMIFEAMPYRNVVSWNAMIGGYAMHGE  373

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  A+ LF  M    +   P+ VTF CVL ACS+AG  E G   F  M+ K+GI P  EH
Sbjct  374  AENAVRLFRSMQSSKEK--PDLVTFTCVLGACSQAGWTEEGRSYFNEMQHKHGISPRMEH  431

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+V +LGRAG ++ AY+ I +MP  P   +WG+LLG+CRVHG   L ++AA+NLFQ++
Sbjct  432  YACMVTLLGRAGKLDDAYDIINQMPFEPDGCIWGSLLGSCRVHGNVVLAEVAAENLFQLE  491

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+++GN+V+LSN++AS   W+  N +R  MK +G+KK
Sbjct  492  PENAGNYVLLSNIYASKKMWDGVNRLRDMMKTVGLKK  528


 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 70/262 (27%), Positives = 113/262 (43%), Gaps = 39/262 (15%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N ++W  L++   ++     A+   ++   EG  P    VS  LSA   +    +G  
Sbjct  118  EPNVITWNGLVSGLNRSGRARDAVLALVRMHGEGFLPDATGVSCALSAVGDVGDVAVGEQ  177

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG VVKA    +  V + L+DMYGKCG  ++  R F E    ++ + NAL+ G +    
Sbjct  178  LHGYVVKAGCRLDACVATALIDMYGKCGRADEIVRVFDESSHMDVASCNALVAGLSRNAQ  237

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL LF +   +  ++  N V++  ++  C + G     +D+F  M+ + GIEP +  
Sbjct  238  VSEALRLFREFVGRGIEL--NVVSWTSIVACCVQNGRDLEAVDLFREMQSE-GIEPNSVT  294

Query  545  YACV-----------------------------------VDMLGRAGMVERAYEFIKRMP  619
              CV                                   VDM  + G V  A    + MP
Sbjct  295  IPCVLPAFANIAALMHGRSAHCFSLRKGFHHDIYVGSALVDMYAKCGRVRDARMIFEAMP  354

Query  620  IRPTVSVWGALLGACRVHGKPE  685
             R  VS W A++G   +HG+ E
Sbjct  355  YRNVVS-WNAMIGGYAMHGEAE  375


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 68/151 (45%), Gaps = 6/151 (4%)
 Frame = +2

Query  212  VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFE  391
            V  + FV S L+  Y + G   D       MP R ++ W+ALI  +A  G A  A  L E
Sbjct  51   VSRDAFVASSLLHAYLRFGATADARSVLDGMPHRTVVGWSALIAAHASHGDAEGAWGLLE  110

Query  392  DMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLG  571
             M  ++  V PN +T+  +++  +R+G     +     M  + G  P A   +C +  +G
Sbjct  111  RM--RSDGVEPNVITWNGLVSGLNRSGRARDAVLALVRMHGE-GFLPDATGVSCALSAVG  167

Query  572  RAGMV---ERAYEFIKRMPIRPTVSVWGALL  655
              G V   E+ + ++ +   R    V  AL+
Sbjct  168  DVGDVAVGEQLHGYVVKAGCRLDACVATALI  198



>ref|XP_010914194.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Elaeis guineensis]
Length=654

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 186/276 (67%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ V W +++  Y QN + ++AL+ F K RE  +E  E  +   +SACA L A +    +
Sbjct  243  KDMVGWTAMVTGYAQNAMPKEALETFDKMREAAVEIDEVSLIGAISACAQLGAVKHAELV  302

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
              +  +   E NV V S +VDMY KCG +++  + F  M ERN+ T++A+I G A  G A
Sbjct  303  REIAERHGFERNVVVGSAMVDMYAKCGLVDEARKVFGGMVERNVYTYSAMIVGLAAHGRA  362

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            + A+ LF++M  +T+ V PN VTF+ VLTACS AG V+ G   F  MKD+YGI P A+HY
Sbjct  363  HEAIALFKEMVERTE-VKPNRVTFIGVLTACSHAGMVKEGRSYFAQMKDEYGIPPSADHY  421

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            AC+VD+LGR+G+VE A E +K MP+ P   VWGALLGACR+HGK ++ K+AAD+LF+++P
Sbjct  422  ACMVDLLGRSGLVEEALELVKSMPVEPHGGVWGALLGACRIHGKTQIAKLAADHLFKLEP  481

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
               GN+V+LSN++AS+G W+E + VRK M+   ++K
Sbjct  482  DGIGNYVLLSNIYASAGMWDEVSKVRKLMRGRRLRK  517


 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/219 (23%), Positives = 94/219 (43%), Gaps = 32/219 (15%)
 Frame = +2

Query  113  PTEFMVSSVLSACAGLAAFELGRSIHG-LVVKACVEENVFVRSVLVDMYGKCGCIEDCER  289
            P  F  S++  ACA   +  +G  +H   +     +  +FV++ L+  Y +C  +    +
Sbjct  145  PLPFTFSALFKACAAARSLPMGAQVHAQALATGGFDAELFVQNTLISFYMECSDLASARK  204

Query  290  AFYEMPERNLITWNALIGGYAHQGHANMALDLFE-----DM-------TRKTQDVVP---  424
             F  M  R+ I+W +LI  Y   G    A  LFE     DM       T   Q+ +P   
Sbjct  205  VFDRMSVRDAISWTSLIVAYTKTGDMGSAEGLFEKTPVKDMVGWTAMVTGYAQNAMPKEA  264

Query  425  --------------NYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
                          + V+ +  ++AC++ GAV+   ++   + +++G E      + +VD
Sbjct  265  LETFDKMREAAVEIDEVSLIGAISACAQLGAVKHA-ELVREIAERHGFERNVVVGSAMVD  323

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
            M  + G+V+ A +    M +   V  + A++     HG+
Sbjct  324  MYAKCGLVDEARKVFGGM-VERNVYTYSAMIVGLAAHGR  361



>ref|XP_010660692.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Vitis vinifera]
Length=659

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 189/278 (68%), Gaps = 3/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEG-IEPTEFMVSSVLSACAGLAAFELGR  181
            ER+ +SW S++AVY QN +  +++++F +  ++G I      +S+VL ACA   +  LG+
Sbjct  248  ERDVISWNSIIAVYAQNGMSTESMEIFHRMVKDGEINYNAVTLSAVLLACAHSGSQRLGK  307

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             IH  V+K  +E NVFV + ++DMY KCG +E   +AF  M E+N+ +W+A++ GY   G
Sbjct  308  CIHDQVIKMGLESNVFVGTSIIDMYCKCGKVEMARKAFDRMREKNVKSWSAMVAGYGMHG  367

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            HA  AL++F +M      V PNY+TFV VL ACS AG +E G   F+AM  ++ +EPG E
Sbjct  368  HAKEALEVFYEMN--MAGVKPNYITFVSVLAACSHAGLLEEGWHWFKAMSHEFDVEPGVE  425

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HY C+VD+LGRAG ++ A++ IK M +RP   VWGALLGACR+H   +LG+I+A  LF++
Sbjct  426  HYGCMVDLLGRAGYLKEAFDLIKGMKLRPDFVVWGALLGACRMHKNVDLGEISARKLFEL  485

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP++ G +V+LSN++A +GRWE+   +R  MK+ G+ K
Sbjct  486  DPKNCGYYVLLSNIYADAGRWEDVERMRILMKNSGLVK  523


 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 119/237 (50%), Gaps = 15/237 (6%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVF--LKAREEG--------IEPTEFMVSSVLSACA  154
             RN VSW S++  Y QND   +AL +F      E G        ++P   +  SVLSAC+
Sbjct  139  HRNIVSWTSMITGYVQNDDAHRALLLFKEFLVEESGSEGDGEVCVDPIAMV--SVLSACS  196

Query  155  GLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNA  334
             ++   +   +HG ++K   E ++ V + L+D Y KCG +    R F  M ER++I+WN+
Sbjct  197  RVSEKSITEGVHGFLIKRGFEGDLGVENTLMDAYAKCGELGVSRRVFDGMAERDVISWNS  256

Query  335  LIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKD  514
            +I  YA  G +  ++++F  M  K  ++  N VT   VL AC+ +G+   G  I + +  
Sbjct  257  IIAVYAQNGMSTESMEIFHRMV-KDGEINYNAVTLSAVLLACAHSGSQRLGKCIHDQVI-  314

Query  515  KYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            K G+E        ++DM  + G VE A +   RM     V  W A++    +HG  +
Sbjct  315  KMGLESNVFVGTSIIDMYCKCGKVEMARKAFDRMR-EKNVKSWSAMVAGYGMHGHAK  370


 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 80/325 (25%), Positives = 134/325 (41%), Gaps = 55/325 (17%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+ N  SW S++A   ++    +AL+ F   R+  ++P        + +C+ L     GR
Sbjct  37   DKTNVFSWNSVIAELARSGDSVEALRAFSSMRKLSLKPNRSTFPCAIKSCSALLDLHSGR  96

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
              H   +    E ++FV S LVDMY KCG + D    F E+  RN+++W ++I GY    
Sbjct  97   QAHQQALIFGFEPDLFVSSALVDMYSKCGELRDARTLFDEISHRNIVSWTSMITGYVQND  156

Query  362  HANMALDLFEDM------TRKTQDVVPNYVTFVCVLTACSRA------------------  469
             A+ AL LF++       +    +V  + +  V VL+ACSR                   
Sbjct  157  DAHRALLLFKEFLVEESGSEGDGEVCVDPIAMVSVLSACSRVSEKSITEGVHGFLIKRGF  216

Query  470  ----GAVETGMD-------------IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAY  598
                G   T MD             +F+ M ++  I      +  ++ +  + GM   + 
Sbjct  217  EGDLGVENTLMDAYAKCGELGVSRRVFDGMAERDVIS-----WNSIIAVYAQNGMSTESM  271

Query  599  EFIKRM----PIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS---GNHVILS  757
            E   RM     I        A+L AC   G   LGK   D + ++  + +   G  +I  
Sbjct  272  EIFHRMVKDGEINYNAVTLSAVLLACAHSGSQRLGKCIHDQVIKMGLESNVFVGTSII--  329

Query  758  NMFASSGRWEEANLVRKEMKDIGIK  832
            +M+   G+ E A      M++  +K
Sbjct  330  DMYCKCGKVEMARKAFDRMREKNVK  354



>gb|KCW65849.1| hypothetical protein EUGRSUZ_G03194 [Eucalyptus grandis]
Length=760

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 191/277 (69%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+  VSW +++  + QN    +AL  F +   + ++P  F + SV+ A A L+     + 
Sbjct  351  EKTLVSWNAMILGFAQNGCVSEALNHFCQMHSQNVKPDTFTMVSVIPALAELSVTRQAKW  410

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGLVV++C+++NV+V + LVDMY KCG ++   + F  M +R++ITWNA+I GY   G 
Sbjct  411  IHGLVVRSCMDKNVYVMTALVDMYAKCGAVDTARKLFDMMEDRHVITWNAMIDGYGTHGL  470

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF+ M + T  V PN +TF+C+L+ACS +G V+ G+  F++MK  YGIEP  +H
Sbjct  471  GRSAVQLFKAMQKGT--VRPNDITFLCILSACSHSGLVDEGLRYFDSMKQDYGIEPTMDH  528

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y  VVD+LGRAG +++A++FI++MPI P ++V+GA+LGAC++H   ELG++AA+ LF+++
Sbjct  529  YGSVVDLLGRAGRLKQAWDFIQKMPIEPGITVFGAMLGACKIHKNVELGEMAANKLFELN  588

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            PQ+ G HV+L+N++A++  W E   VRK M+  G++K
Sbjct  589  PQEGGYHVLLANIYATASMWSEVAEVRKIMEKEGLQK  625


 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 113/217 (52%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ VSW ++++ Y QN     AL++ L+ +EEG  P    + +VL A A + +  +G+S
Sbjct  149  HRDLVSWNTIISGYAQNCWAAPALELVLQMQEEGQRPDSITLVTVLPAVADVGSLRIGKS  208

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  V+A  +  V V + L+DMY KC  ++     F  + +R+++TWN++I GY    +
Sbjct  209  IHGYAVRAGFDSLVNVSTALLDMYSKCKSVKTARVIFDRIEKRSVVTWNSMIDGYVENEN  268

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ +FE M    + V P  VT +  L AC+  G +E GM + + +  +  ++     
Sbjct  269  PKEAVAIFEKML--DEQVEPTNVTVMGALHACADLGDLERGMFVHKLLT-RLKLDSSVSV  325

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               ++ M  +   V+ A E    +  +  VS W A++
Sbjct  326  MNSLISMYSKCKRVDLAAEIFNDLREKTLVS-WNAMI  361


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 101/211 (48%), Gaps = 4/211 (2%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            + +LL  Y +N   ++AL  F + R + ++P  +  + +L  C   A    G+ IHG +V
Sbjct  54   YHTLLKGYAKNSSLDEALSFFCRMRRDDVKPIVYNFTYLLKVCGDNADLRRGKEIHGQLV  113

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
                  NVF  + + +MY KC  + +  + F  +P R+L++WN +I GYA    A  AL+
Sbjct  114  ANGFASNVFAMTGVANMYAKCRQVGEAYKMFDRLPHRDLVSWNTIISGYAQNCWAAPALE  173

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            L   M  + Q   P+ +T V VL A +  G++  G  I      + G +        ++D
Sbjct  174  LVLQMQEEGQR--PDSITLVTVLPAVADVGSLRIGKSI-HGYAVRAGFDSLVNVSTALLD  230

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
            M  +   V+ A     R+  R  V+ W +++
Sbjct  231  MYSKCKSVKTARVIFDRIEKRSVVT-WNSMI  260



>gb|EEE69272.1| hypothetical protein OsJ_28537 [Oryza sativa Japonica Group]
Length=784

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 180/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            ++  S++    Q D GE A+K+F++   +G+EP  F++SS+L+ACA L+A+E G+ +H  
Sbjct  378  IAVTSMITALSQCDHGEGAIKLFMEMLRKGLEPDPFVLSSLLNACASLSAYEQGKQVHAH  437

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     + F  + LV  Y KCG IED E AF  +PER +++W+A+IGG A  GH   A
Sbjct  438  LIKRQFMSDAFAGNALVYTYAKCGSIEDAELAFSSLPERGVVSWSAMIGGLAQHGHGKRA  497

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LF  M    + + PN++T   VL AC+ AG V+     F +MK+ +GI+   EHY+C+
Sbjct  498  LELFGRMV--DEGINPNHITMTSVLCACNHAGLVDEAKRYFNSMKEMFGIDRTEEHYSCM  555

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG ++ A E +  MP +   SVWGALLGA RVH  PELGK+AA+ LF ++P+ S
Sbjct  556  IDLLGRAGKLDDAMELVNSMPFQANASVWGALLGASRVHKDPELGKLAAEKLFILEPEKS  615

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N +ASSG W E   VRK MKD  IKK
Sbjct  616  GTHVLLANTYASSGMWNEVAKVRKLMKDSNIKK  648


 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 138/271 (51%), Gaps = 12/271 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  L++ Y +ND    A++VF +    GI+PTEF  S V++AC G    + GR 
Sbjct  71   ERNAVSWNGLMSAYVKNDQCGDAIQVFGEMVWSGIQPTEFGFSCVVNACTGSRNIDAGRQ  130

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +VV+   E++VF  + LVDMY K G ++     F +MP+ ++++WNALI G    GH
Sbjct  131  VHAMVVRMGYEKDVFTANALVDMYVKMGRVDIASVIFEKMPDSDVVSWNALISGCVLNGH  190

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A++L   M  K+  +VPN      +L AC+ AGA + G  I   M         ++ 
Sbjct  191  DHRAIELLLQM--KSSGLVPNVFMLSSILKACAGAGAFDLGRQIHGFM---IKANADSDD  245

Query  545  YACV--VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            Y  V  VDM  +   ++ A +    M  R  + +W AL+  C   G+ +    A    + 
Sbjct  246  YIGVGLVDMYAKNHFLDDAMKVFDWMSHRDLI-LWNALISGCSHGGRHDE---AFSIFYG  301

Query  719  IDPQDSG-NHVILSNMFASSGRWEEANLVRK  808
            +  +  G N   L+ +  S+   E A+  R+
Sbjct  302  LRKEGLGVNRTTLAAVLKSTASLEAASATRQ  332


 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 93/170 (55%), Gaps = 3/170 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +L++    N    +A+++ L+ +  G+ P  FM+SS+L ACAG  AF+LGR IHG 
Sbjct  176  VSWNALISGCVLNGHDHRAIELLLQMKSSGLVPNVFMLSSILKACAGAGAFDLGRQIHGF  235

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++KA  + + ++   LVDMY K   ++D  + F  M  R+LI WNALI G +H G  + A
Sbjct  236  MIKANADSDDYIGVGLVDMYAKNHFLDDAMKVFDWMSHRDLILWNALISGCSHGGRHDEA  295

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
              +F  + ++   V  N  T   VL + +   A      +  A+ +K G 
Sbjct  296  FSIFYGLRKEGLGV--NRTTLAAVLKSTASLEAASATRQV-HALAEKIGF  342


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 93/195 (48%), Gaps = 8/195 (4%)
 Frame = +2

Query  95   REEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCI  274
            R EG+   EF +  VL  C   A  +LG  +H + +      +VFV + LV MYG  G +
Sbjct  2    RAEGVCCNEFALPVVLK-CVPDA--QLGAQVHAMAMATGFGSDVFVANALVAMYGGFGFM  58

Query  275  EDCERAFYEM-PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVL  451
            +D  R F E   ERN ++WN L+  Y        A+ +F +M      + P    F CV+
Sbjct  59   DDARRVFDEAGSERNAVSWNGLMSAYVKNDQCGDAIQVFGEMV--WSGIQPTEFGFSCVV  116

Query  452  TACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPT  631
             AC+ +  ++ G  +  AM  + G E        +VDM  + G V+ A    ++MP    
Sbjct  117  NACTGSRNIDAGRQV-HAMVVRMGYEKDVFTANALVDMYVKMGRVDIASVIFEKMPDSDV  175

Query  632  VSVWGALLGACRVHG  676
            VS W AL+  C ++G
Sbjct  176  VS-WNALISGCVLNG  189


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 71/278 (26%), Positives = 123/278 (44%), Gaps = 13/278 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ + W +L++        ++A  +F   R+EG+      +++VL + A L A    R 
Sbjct  273  HRDLILWNALISGCSHGGRHDEAFSIFYGLRKEGLGVNRTTLAAVLKSTASLEAASATRQ  332

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L  K     +  V + L+D Y KC C+ D  R F E    ++I   ++I   +   H
Sbjct  333  VHALAEKIGFIFDAHVVNGLIDSYWKCSCLSDAIRVFEECSSGDIIAVTSMITALSQCDH  392

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF +M RK  +  P+      +L AC+   A E G  +   +  +  +      
Sbjct  393  GEGAIKLFMEMLRKGLE--PDPFVLSSLLNACASLSAYEQGKQVHAHLIKRQFMSDAFAG  450

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF--Q  718
             A V     + G +E A      +P R  VS W A++G    HG    GK A + LF   
Sbjct  451  NALVY-TYAKCGSIEDAELAFSSLPERGVVS-WSAMIGGLAQHGH---GKRALE-LFGRM  504

Query  719  IDPQDSGNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
            +D   + NH+ ++++  +   +G  +EA      MK++
Sbjct  505  VDEGINPNHITMTSVLCACNHAGLVDEAKRYFNSMKEM  542


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 60/116 (52%), Gaps = 4/116 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAAFELG  178
            ER  VSW +++    Q+  G++AL++F +  +EGI P    ++SVL AC  AGL   E  
Sbjct  475  ERGVVSWSAMIGGLAQHGHGKRALELFGRMVDEGINPNHITMTSVLCACNHAGLVD-EAK  533

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIG  343
            R  + +     ++      S ++D+ G+ G ++D       MP + N   W AL+G
Sbjct  534  RYFNSMKEMFGIDRTEEHYSCMIDLLGRAGKLDDAMELVNSMPFQANASVWGALLG  589



>ref|XP_011087319.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like isoform X2 [Sesamum indicum]
Length=1003

 Score =   267 bits (683),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 175/277 (63%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+  +W  +++ Y Q + GEKA   F + R EG+ P EF ++S L  C+G+A+ E GR 
Sbjct  593  ERDVFAWTVIISGYSQTNQGEKAAHYFNQMRREGVIPNEFTLASCLRGCSGIASLENGRQ  652

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +K+    ++FV S LVDMYGKCGCI+D E  FY+M   + + WN +I  Y+  G 
Sbjct  653  LHSLAIKSGQSADMFVASSLVDMYGKCGCIDDAETLFYDMHSGDTVLWNTIICAYSQHGE  712

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+ AL  F  M      V+P+ VTFV +L+ACS  G VE G   F +M + YGI P  EH
Sbjct  713  ADKALQAFRKMV--NTGVLPDVVTFVGILSACSHMGLVEEGRKHFYSMSESYGITPIIEH  770

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAG  +     I+ M + P   +W  +LGACRVHG  ELG+IAA  LFQI+
Sbjct  771  YACLVDILGRAGKFDEVESLIEHMELTPNALIWENVLGACRVHGNLELGEIAAQELFQIN  830

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+   N+++LSN++AS GRW + + VR  M   GIKK
Sbjct  831  PETDSNYILLSNLYASRGRWNDVSKVRALMTSKGIKK  867


 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 109/226 (48%), Gaps = 5/226 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW +LL+ +  ++  ++ ++ F +   EG  P  +   S L +C+     E G+ +
Sbjct  494  RDVVSWNALLSGF-HDETSDQGIRTFRQMLTEGFRPNMYTFISTLRSCSSFLNIEYGKQV  552

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  ++K     N +V + L+DMY KCGC+ED E  F  + ER++  W  +I GY+     
Sbjct  553  HTHIIKDNSINNGYVGTALLDMYAKCGCMEDVEAIFSRLMERDVFAWTVIISGYSQTNQG  612

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A   F  M R  + V+PN  T    L  CS   ++E G  +  ++  K G        
Sbjct  613  EKAAHYFNQMRR--EGVIPNEFTLASCLRGCSGIASLENGRQL-HSLAIKSGQSADMFVA  669

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            + +VDM G+ G ++ A      M    TV +W  ++ A   HG+ +
Sbjct  670  SSLVDMYGKCGCIDDAETLFYDMHSGDTV-LWNTIICAYSQHGEAD  714


 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 112/229 (49%), Gaps = 10/229 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW +L++ +     G +++++F + R E +   EF  ++VL   +     E G+ +
Sbjct  191  KDVVSWTALISGFVAQGYGVESVELFYEMRREDVRANEFTFATVLKGSSMSLDLEFGKQL  250

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG VVK     +V+V + L+D+Y KCG +E     F  MPE+N + WN L+ GYA +G  
Sbjct  251  HGEVVKIGCLSDVYVGAALIDLYSKCGEMEYAVDVFRMMPEKNAVMWNTLLNGYAQEGDG  310

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               L LF  MT + +    NY T   VL   + +GA   G  +  ++  K G EP     
Sbjct  311  EAVLQLFSKMT-EPEMRFSNY-TLSIVLKGIASSGAFRAGQAV-HSIAIKIGGEPDDFVT  367

Query  548  ACVVDMLGRAGMVERA---YEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
              +V+M  + G+   A   +E IK     P +  W +++      G  E
Sbjct  368  CSLVNMYSKCGVANDALKVFEMIK----SPDIVAWSSIISVLDQQGLKE  412


 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 100/217 (46%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N V W +LL  Y Q   GE  L++F K  E  +  + + +S VL   A   AF  G++
Sbjct  291  EKNAVMWNTLLNGYAQEGDGEAVLQLFSKMTEPEMRFSNYTLSIVLKGIASSGAFRAGQA  350

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + +K   E + FV   LV+MY KCG   D  + F  +   +++ W+++I     QG 
Sbjct  351  VHSIAIKIGGEPDDFVTCSLVNMYSKCGVANDALKVFEMIKSPDIVAWSSIISVLDQQGL  410

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A   F  M  +  D+ PN  T   +++A +  G +  G  I  A   K+G E     
Sbjct  411  KEEAAKFFRLM--RCTDMTPNQFTLSSLVSAATDLGDLRYGQSI-HACAHKFGFESDDLV  467

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               ++ M  +   +   Y    +M  R  VS W ALL
Sbjct  468  SNALIGMYMKFQSIYDGYHIFSKMTNRDVVS-WNALL  503


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/235 (29%), Positives = 109/235 (46%), Gaps = 8/235 (3%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W S+++V +Q  L E+A K F   R   + P +F +SS++SA   L     G+SIH  
Sbjct  396  VAWSSIISVLDQQGLKEEAAKFFRLMRCTDMTPNQFTLSSLVSAATDLGDLRYGQSIHAC  455

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
              K   E +  V + L+ MY K   I D    F +M  R++++WNAL+ G+ H   ++  
Sbjct  456  AHKFGFESDDLVSNALIGMYMKFQSIYDGYHIFSKMTNRDVVSWNALLSGF-HDETSDQG  514

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +  F  M   T+   PN  TF+  L +CS    +E G  +   +     I  G    A +
Sbjct  515  IRTFRQML--TEGFRPNMYTFISTLRSCSSFLNIEYGKQVHTHIIKDNSINNGYVGTA-L  571

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            +DM  + G +E       R+  R  V  W  ++     + +   G+ AA    Q+
Sbjct  572  LDMYAKCGCMEDVEAIFSRLMERD-VFAWTVIISG---YSQTNQGEKAAHYFNQM  622


 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 92/185 (50%), Gaps = 4/185 (2%)
 Frame = +2

Query  131  SSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE  310
            S VL  CA       G+ IH  ++K+ +E ++ +   L++ Y KCG +E     F +MP 
Sbjct  131  SEVLRNCAAEMYLNKGKVIHCRIIKSGIEPDMHLWVSLINFYAKCGALESSYHVFDQMPL  190

Query  311  RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM  490
            +++++W ALI G+  QG+   +++LF +M R  +DV  N  TF  VL   S +  +E G 
Sbjct  191  KDVVSWTALISGFVAQGYGVESVELFYEMRR--EDVRANEFTFATVLKGSSMSLDLEFGK  248

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRV  670
             +   +  K G        A ++D+  + G +E A +  + MP +  V +W  LL     
Sbjct  249  QLHGEVV-KIGCLSDVYVGAALIDLYSKCGEMEYAVDVFRMMPEKNAV-MWNTLLNGYAQ  306

Query  671  HGKPE  685
             G  E
Sbjct  307  EGDGE  311



>ref|XP_011087317.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like isoform X1 [Sesamum indicum]
 ref|XP_011087318.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like isoform X1 [Sesamum indicum]
Length=1032

 Score =   267 bits (683),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 175/277 (63%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+  +W  +++ Y Q + GEKA   F + R EG+ P EF ++S L  C+G+A+ E GR 
Sbjct  622  ERDVFAWTVIISGYSQTNQGEKAAHYFNQMRREGVIPNEFTLASCLRGCSGIASLENGRQ  681

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +K+    ++FV S LVDMYGKCGCI+D E  FY+M   + + WN +I  Y+  G 
Sbjct  682  LHSLAIKSGQSADMFVASSLVDMYGKCGCIDDAETLFYDMHSGDTVLWNTIICAYSQHGE  741

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A+ AL  F  M      V+P+ VTFV +L+ACS  G VE G   F +M + YGI P  EH
Sbjct  742  ADKALQAFRKMV--NTGVLPDVVTFVGILSACSHMGLVEEGRKHFYSMSESYGITPIIEH  799

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGRAG  +     I+ M + P   +W  +LGACRVHG  ELG+IAA  LFQI+
Sbjct  800  YACLVDILGRAGKFDEVESLIEHMELTPNALIWENVLGACRVHGNLELGEIAAQELFQIN  859

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+   N+++LSN++AS GRW + + VR  M   GIKK
Sbjct  860  PETDSNYILLSNLYASRGRWNDVSKVRALMTSKGIKK  896


 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 109/226 (48%), Gaps = 5/226 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW +LL+ +  ++  ++ ++ F +   EG  P  +   S L +C+     E G+ +
Sbjct  523  RDVVSWNALLSGF-HDETSDQGIRTFRQMLTEGFRPNMYTFISTLRSCSSFLNIEYGKQV  581

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  ++K     N +V + L+DMY KCGC+ED E  F  + ER++  W  +I GY+     
Sbjct  582  HTHIIKDNSINNGYVGTALLDMYAKCGCMEDVEAIFSRLMERDVFAWTVIISGYSQTNQG  641

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A   F  M R  + V+PN  T    L  CS   ++E G  +  ++  K G        
Sbjct  642  EKAAHYFNQMRR--EGVIPNEFTLASCLRGCSGIASLENGRQL-HSLAIKSGQSADMFVA  698

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            + +VDM G+ G ++ A      M    TV +W  ++ A   HG+ +
Sbjct  699  SSLVDMYGKCGCIDDAETLFYDMHSGDTV-LWNTIICAYSQHGEAD  743


 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 112/229 (49%), Gaps = 10/229 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW +L++ +     G +++++F + R E +   EF  ++VL   +     E G+ +
Sbjct  220  KDVVSWTALISGFVAQGYGVESVELFYEMRREDVRANEFTFATVLKGSSMSLDLEFGKQL  279

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG VVK     +V+V + L+D+Y KCG +E     F  MPE+N + WN L+ GYA +G  
Sbjct  280  HGEVVKIGCLSDVYVGAALIDLYSKCGEMEYAVDVFRMMPEKNAVMWNTLLNGYAQEGDG  339

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               L LF  MT + +    NY T   VL   + +GA   G  +  ++  K G EP     
Sbjct  340  EAVLQLFSKMT-EPEMRFSNY-TLSIVLKGIASSGAFRAGQAV-HSIAIKIGGEPDDFVT  396

Query  548  ACVVDMLGRAGMVERA---YEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
              +V+M  + G+   A   +E IK     P +  W +++      G  E
Sbjct  397  CSLVNMYSKCGVANDALKVFEMIK----SPDIVAWSSIISVLDQQGLKE  441


 Score = 99.8 bits (247),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 100/218 (46%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N V W +LL  Y Q   GE  L++F K  E  +  + + +S VL   A   AF  G++
Sbjct  320  EKNAVMWNTLLNGYAQEGDGEAVLQLFSKMTEPEMRFSNYTLSIVLKGIASSGAFRAGQA  379

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + +K   E + FV   LV+MY KCG   D  + F  +   +++ W+++I     QG 
Sbjct  380  VHSIAIKIGGEPDDFVTCSLVNMYSKCGVANDALKVFEMIKSPDIVAWSSIISVLDQQGL  439

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A   F  M  +  D+ PN  T   +++A +  G +  G  I  A   K+G E     
Sbjct  440  KEEAAKFFRLM--RCTDMTPNQFTLSSLVSAATDLGDLRYGQSI-HACAHKFGFESDDLV  496

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
               ++ M  +   +   Y    +M  R  VS W ALL 
Sbjct  497  SNALIGMYMKFQSIYDGYHIFSKMTNRDVVS-WNALLS  533


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/235 (29%), Positives = 109/235 (46%), Gaps = 8/235 (3%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W S+++V +Q  L E+A K F   R   + P +F +SS++SA   L     G+SIH  
Sbjct  425  VAWSSIISVLDQQGLKEEAAKFFRLMRCTDMTPNQFTLSSLVSAATDLGDLRYGQSIHAC  484

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
              K   E +  V + L+ MY K   I D    F +M  R++++WNAL+ G+ H   ++  
Sbjct  485  AHKFGFESDDLVSNALIGMYMKFQSIYDGYHIFSKMTNRDVVSWNALLSGF-HDETSDQG  543

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +  F  M   T+   PN  TF+  L +CS    +E G  +   +     I  G    A +
Sbjct  544  IRTFRQML--TEGFRPNMYTFISTLRSCSSFLNIEYGKQVHTHIIKDNSINNGYVGTA-L  600

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            +DM  + G +E       R+  R  V  W  ++     + +   G+ AA    Q+
Sbjct  601  LDMYAKCGCMEDVEAIFSRLMERD-VFAWTVIISG---YSQTNQGEKAAHYFNQM  651


 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 92/185 (50%), Gaps = 4/185 (2%)
 Frame = +2

Query  131  SSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE  310
            S VL  CA       G+ IH  ++K+ +E ++ +   L++ Y KCG +E     F +MP 
Sbjct  160  SEVLRNCAAEMYLNKGKVIHCRIIKSGIEPDMHLWVSLINFYAKCGALESSYHVFDQMPL  219

Query  311  RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM  490
            +++++W ALI G+  QG+   +++LF +M R  +DV  N  TF  VL   S +  +E G 
Sbjct  220  KDVVSWTALISGFVAQGYGVESVELFYEMRR--EDVRANEFTFATVLKGSSMSLDLEFGK  277

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRV  670
             +   +  K G        A ++D+  + G +E A +  + MP +  V +W  LL     
Sbjct  278  QLHGEVV-KIGCLSDVYVGAALIDLYSKCGEMEYAVDVFRMMPEKNAV-MWNTLLNGYAQ  335

Query  671  HGKPE  685
             G  E
Sbjct  336  EGDGE  340



>ref|XP_008358389.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Malus domestica]
Length=596

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 178/277 (64%), Gaps = 3/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N VSW  ++  Y Q    E+AL++F +A  E ++  +F  SSV+  C     FELGR 
Sbjct  187  EKNVVSWSGMIYGYTQLGQXEEALRLFKQAMVENLDVNDFTFSSVIRVCGNSTLFELGRQ  246

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL  K   + + FV S LV +Y KCG IE   R F E+P +NL  WNA++   A   H
Sbjct  247  IHGLCFKTNFDLSSFVGSSLVSLYSKCGVIEGAYRVFDEIPVKNLGMWNAMLIASAQHVH  306

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + ALDLF+ M  ++  + PN++TF+CVL ACS AG VE G   F  M++ YGIEPG +H
Sbjct  307  TDNALDLFKQM--ESAGMKPNFITFLCVLYACSHAGLVEKGQYYFSLMRE-YGIEPGEQH  363

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YA +VD+LGRAG ++ A + I  MPI PT S+WGALL  CR+HG  EL    AD +F++ 
Sbjct  364  YATLVDLLGRAGKLQEAVKIIDEMPIEPTESIWGALLTGCRIHGDTELAASVADRVFELG  423

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P  SG HV+LSN +A++ R+EEA  VRK ++D G+KK
Sbjct  424  PVSSGLHVLLSNAYAAAQRFEEAAKVRKMLRDRGVKK  460


 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 116/222 (52%), Gaps = 4/222 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++  +W S+++ + QN+    A++ F +     + P + +  SV  +CA L   ++G+S+
Sbjct  87   KSSTTWSSVISSFAQNEXPVLAIEYFRRMLGAQLRPDDHIYPSVAKSCAILNRLDVGQSV  146

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L VK   E +VFV S +VDMY KCG I D  + F E+PE+N+++W+ +I GY   G  
Sbjct  147  HCLAVKTGYEFDVFVGSSVVDMYAKCGEIRDARKXFDEIPEKNVVSWSGMIYGYTQLGQX  206

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF+    +  DV  N  TF  V+  C  +   E G  I   +  K   +  +   
Sbjct  207  EEALRLFKQAMVENLDV--NDFTFSSVIRVCGNSTLFELGRQI-HGLCFKTNFDLSSFVG  263

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            + +V +  + G++E AY     +P++  + +W A+L A   H
Sbjct  264  SSLVSLYSKCGVIEGAYRVFDEIPVK-NLGMWNAMLIASAQH  304



>ref|XP_010067671.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Eucalyptus grandis]
Length=817

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 191/277 (69%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+  VSW +++  + QN    +AL  F +   + ++P  F + SV+ A A L+     + 
Sbjct  408  EKTLVSWNAMILGFAQNGCVSEALNHFCQMHSQNVKPDTFTMVSVIPALAELSVTRQAKW  467

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGLVV++C+++NV+V + LVDMY KCG ++   + F  M +R++ITWNA+I GY   G 
Sbjct  468  IHGLVVRSCMDKNVYVMTALVDMYAKCGAVDTARKLFDMMEDRHVITWNAMIDGYGTHGL  527

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF+ M + T  V PN +TF+C+L+ACS +G V+ G+  F++MK  YGIEP  +H
Sbjct  528  GRSAVQLFKAMQKGT--VRPNDITFLCILSACSHSGLVDEGLRYFDSMKQDYGIEPTMDH  585

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y  VVD+LGRAG +++A++FI++MPI P ++V+GA+LGAC++H   ELG++AA+ LF+++
Sbjct  586  YGSVVDLLGRAGRLKQAWDFIQKMPIEPGITVFGAMLGACKIHKNVELGEMAANKLFELN  645

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            PQ+ G HV+L+N++A++  W E   VRK M+  G++K
Sbjct  646  PQEGGYHVLLANIYATASMWSEVAEVRKIMEKEGLQK  682


 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 113/217 (52%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ VSW ++++ Y QN     AL++ L+ +EEG  P    + +VL A A + +  +G+S
Sbjct  206  HRDLVSWNTIISGYAQNCWAAPALELVLQMQEEGQRPDSITLVTVLPAVADVGSLRIGKS  265

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  V+A  +  V V + L+DMY KC  ++     F  + +R+++TWN++I GY    +
Sbjct  266  IHGYAVRAGFDSLVNVSTALLDMYSKCKSVKTARVIFDRIEKRSVVTWNSMIDGYVENEN  325

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ +FE M    + V P  VT +  L AC+  G +E GM + + +  +  ++     
Sbjct  326  PKEAVAIFEKML--DEQVEPTNVTVMGALHACADLGDLERGMFVHKLLT-RLKLDSSVSV  382

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               ++ M  +   V+ A E    +  +  VS W A++
Sbjct  383  MNSLISMYSKCKRVDLAAEIFNDLREKTLVS-WNAMI  418


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 101/211 (48%), Gaps = 4/211 (2%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            + +LL  Y +N   ++AL  F + R + ++P  +  + +L  C   A    G+ IHG +V
Sbjct  111  YHTLLKGYAKNSSLDEALSFFCRMRRDDVKPIVYNFTYLLKVCGDNADLRRGKEIHGQLV  170

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
                  NVF  + + +MY KC  + +  + F  +P R+L++WN +I GYA    A  AL+
Sbjct  171  ANGFASNVFAMTGVANMYAKCRQVGEAYKMFDRLPHRDLVSWNTIISGYAQNCWAAPALE  230

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            L   M  + Q   P+ +T V VL A +  G++  G  I      + G +        ++D
Sbjct  231  LVLQMQEEGQR--PDSITLVTVLPAVADVGSLRIGKSI-HGYAVRAGFDSLVNVSTALLD  287

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
            M  +   V+ A     R+  R  V+ W +++
Sbjct  288  MYSKCKSVKTARVIFDRIEKRSVVT-WNSMI  317



>ref|XP_004516023.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Cicer arietinum]
Length=925

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/281 (46%), Positives = 183/281 (65%), Gaps = 5/281 (2%)
 Frame = +2

Query  2    DER---NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFE  172
            DER   + V++ S++  Y Q   GE+ALK++L+ +   I+P  F+ SS+L+ACA L+A+E
Sbjct  511  DERTWEDLVAYTSMITAYSQYGDGEEALKLYLQMQVSDIKPDSFVCSSLLNACANLSAYE  570

Query  173  LGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYA  352
             G+ +H   +K     ++F  S LV+MY KCG IED  RAF E+P+R ++ W+A+IGG A
Sbjct  571  QGKQLHVHAIKFGFMSDIFASSSLVNMYAKCGSIEDAHRAFSEIPQRGIVLWSAMIGGLA  630

Query  353  HQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEP  532
              GH   AL LF  M +    V PN++T V VL AC+ AG V  G   FE M++K+GI+P
Sbjct  631  QHGHGKEALKLFNQMLK--DGVTPNHITLVSVLCACNHAGLVSEGKQYFETMEEKFGIKP  688

Query  533  GAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNL  712
              EHYAC++D+LGR+G +  A E +  +P     SVWGALLGA R+H   ELG+ AA+ L
Sbjct  689  TQEHYACMIDLLGRSGKLNEAVELVNSIPFEGDGSVWGALLGAARIHKNVELGEKAAEML  748

Query  713  FQIDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            F ++P  SG HV+L+N++AS G WE    VRK MK+  +KK
Sbjct  749  FTLEPDKSGTHVLLANIYASVGMWENVAKVRKVMKESMVKK  789


 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 112/233 (48%), Gaps = 6/233 (3%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +L++ Y QN   ++AL  F +    G++  EF   SVL AC+      +G+ +H +
Sbjct  115  VSWSALISGYVQNGFDKEALLAFNEMCMLGVKCNEFTFPSVLKACSIKKDLNMGKKVHAM  174

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             V +  E + FV + LV MY KCG   D  + F  + ER+++ WN L+  Y        A
Sbjct  175  TVVSGFESDSFVATTLVVMYAKCGMFGDSRKLFGMVVERSVVLWNTLVSCYVQSDFLAEA  234

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM-DIFEAMKDKYGIEPGAEHYAC  553
            +DLF+ M     +V PN  +   +L AC  AG  + G+  +   +  K G          
Sbjct  235  VDLFKGMV--DAEVRPNEFSLSIILNAC--AGLRDGGLGRMVHGLLMKLGHSYDQFSTNA  290

Query  554  VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNL  712
            +VDM  +AG +E A    + + I P    W A++  C +H   +L  I  + +
Sbjct  291  LVDMYAKAGRIEDAVSVFREI-IHPDTVSWNAVIAGCVLHEYSDLALILLNEM  342


 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 110/220 (50%), Gaps = 7/220 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V W +L++ Y Q+D   +A+ +F    +  + P EF +S +L+ACAGL    LGR 
Sbjct  212  ERSVVLWNTLVSCYVQSDFLAEAVDLFKGMVDAEVRPNEFSLSIILNACAGLRDGGLGRM  271

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGL++K     + F  + LVDMY K G IED    F E+   + ++WNA+I G     +
Sbjct  272  VHGLLMKLGHSYDQFSTNALVDMYAKAGRIEDAVSVFREIIHPDTVSWNAVIAGCVLHEY  331

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            +++AL L  +M  +     PN  T    L AC+     E G  +   +     I+  ++ 
Sbjct  332  SDLALILLNEM--RNSGTCPNVFTLSSALKACAAMRLKELGRQLHSCL---VKIDSDSDL  386

Query  545  YACV--VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
            +  V  +D+  +  M++ A      MP +  ++    + G
Sbjct  387  FVAVGLIDLYSKCEMMDDARRAYDLMPKKDIIACNALITG  426


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 143/313 (46%), Gaps = 48/313 (15%)
 Frame = +2

Query  11   NGVSWCSLLA---VYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + VSW +++A   ++E +DL   AL +  + R  G  P  F +SS L ACA +   ELGR
Sbjct  315  DTVSWNAVIAGCVLHEYSDL---ALILLNEMRNSGTCPNVFTLSSALKACAAMRLKELGR  371

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H  +VK   + ++FV   L+D+Y KC  ++D  RA+  MP++++I  NALI GY+  G
Sbjct  372  QLHSCLVKIDSDSDLFVAVGLIDLYSKCEMMDDARRAYDLMPKKDIIACNALITGYSQFG  431

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS-----------RAGAVETGM----DI  496
                A+ LF +M  +  D   N  T   VL + +              ++++G+     +
Sbjct  432  DDLQAVSLFSEMHHEIIDF--NQTTLSTVLKSVASLQEIKICKQIHTLSIKSGICSDFYV  489

Query  497  FEAMKDKYG----IEPGAE-----------HYACVVDMLGRAGMVERAYEFIKRMP---I  622
              ++ D YG    I+  ++            Y  ++    + G  E A +   +M    I
Sbjct  490  INSLLDTYGKCSHIDEASKIFDERTWEDLVAYTSMITAYSQYGDGEEALKLYLQMQVSDI  549

Query  623  RPTVSVWGALLGACRVHGKPELGKI----AADNLFQIDPQDSGNHVILSNMFASSGRWEE  790
            +P   V  +LL AC      E GK     A    F  D   S +   L NM+A  G  E+
Sbjct  550  KPDSFVCSSLLNACANLSAYEQGKQLHVHAIKFGFMSDIFASSS---LVNMYAKCGSIED  606

Query  791  ANLVRKEMKDIGI  829
            A+    E+   GI
Sbjct  607  AHRAFSEIPQRGI  619


 Score = 94.0 bits (232),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 121/246 (49%), Gaps = 14/246 (6%)
 Frame = +2

Query  29   SLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKA  208
            +L+  Y Q     +A+ +F +   E I+  +  +S+VL + A L   ++ + IH L +K+
Sbjct  422  ALITGYSQFGDDLQAVSLFSEMHHEIIDFNQTTLSTVLKSVASLQEIKICKQIHTLSIKS  481

Query  209  CVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLF  388
             +  + +V + L+D YGKC  I++  + F E    +L+ + ++I  Y+  G    AL L+
Sbjct  482  GICSDFYVINSLLDTYGKCSHIDEASKIFDERTWEDLVAYTSMITAYSQYGDGEEALKLY  541

Query  389  EDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
              M  +  D+ P+  +FVC  +L AC+   A E G  +      K+G        + +V+
Sbjct  542  LQM--QVSDIKPD--SFVCSSLLNACANLSAYEQGKQL-HVHAIKFGFMSDIFASSSLVN  596

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQD--S  736
            M  + G +E A+     +P R  V +W A++G    HG    GK  A  LF    +D  +
Sbjct  597  MYAKCGSIEDAHRAFSEIPQRGIV-LWSAMIGGLAQHGH---GK-EALKLFNQMLKDGVT  651

Query  737  GNHVIL  754
             NH+ L
Sbjct  652  PNHITL  657


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 8/190 (4%)
 Frame = +2

Query  116  TEFMVS--SVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCER  289
            T F +S  ++LS C    +   G  IH  ++K     +  +R+ LV +Y K        +
Sbjct  44   TNFPISYNNLLSHCVASKSLNSGMEIHAHMIKFGFSHHPSLRNHLVTIYSKSRRFGYARK  103

Query  290  AFYEMPERNLI-TWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSR  466
             F +  E +++ +W+ALI GY   G    AL  F +M      V  N  TF  VL ACS 
Sbjct  104  LFDQSTEPSMVVSWSALISGYVQNGFDKEALLAFNEMC--MLGVKCNEFTFPSVLKACSI  161

Query  467  AGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWG  646
               +  G  +  AM    G E  +     +V M  + GM   + +    M +  +V +W 
Sbjct  162  KKDLNMGKKV-HAMTVVSGFESDSFVATTLVVMYAKCGMFGDSRKLFG-MVVERSVVLWN  219

Query  647  ALLGACRVHG  676
             L+ +C V  
Sbjct  220  TLV-SCYVQS  228



>ref|XP_006660454.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like 
[Oryza brachyantha]
Length=877

 Score =   265 bits (677),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 183/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            +++ S++    Q D GE A+K+F++   +G++P  F++SS+L+ACA L+A+E G+ +H  
Sbjct  471  IAFTSMITALSQCDHGEGAIKLFMEMLRKGLQPDPFVLSSLLNACASLSAYEQGKQVHAH  530

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     +VF  + LV  Y KCG IED E AF  +PER +++W+A+IGG A  GH   A
Sbjct  531  LIKRQFMSDVFAGNALVYTYAKCGSIEDAELAFSSLPERGVVSWSAMIGGLAQHGHGKKA  590

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LF  M  +  D  PN++T   VL AC+ AG V+     F +MK+ +GI+   EHY+C+
Sbjct  591  LELFHRMVDEGID--PNHITMTSVLCACNHAGLVDEAKQYFNSMKEMFGIDRTEEHYSCM  648

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG ++ A E +  MP +   SVWGALLGA RVH  PELG++AA+ LF ++P+ S
Sbjct  649  IDLLGRAGKLDDAMELVNSMPFQANASVWGALLGASRVHKDPELGRLAAEKLFGLEPEKS  708

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N +AS+G W+E   VRK MK+  IKK
Sbjct  709  GTHVLLANTYASAGMWDEVAKVRKLMKESNIKK  741


 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 124/227 (55%), Gaps = 9/227 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  L++ Y +ND    A++VF +    GI PTEF +S V++AC G    E GR 
Sbjct  164  ERNAVSWNGLMSAYVKNDQCSDAIQVFGEMVWSGIRPTEFGLSCVVNACTGSRNIEAGRQ  223

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+VV+   +++VF  + LVDMY K G ++     F +MP+ ++++WNALI G    GH
Sbjct  224  VHGMVVRTGYDKDVFTANALVDMYVKVGRVDIASVIFEKMPDSDVVSWNALISGCVLNGH  283

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A++L   M  K+  +VPN  T   +L ACS AGA + G  I   M         ++ 
Sbjct  284  DHRAIELLLQM--KSSGLVPNVFTLSSILKACSGAGAFDLGRQIHGFM---IKANADSDD  338

Query  545  YACV--VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
            Y  V  VDM  +   ++ A +    M  R  V +W AL+  C  HG+
Sbjct  339  YIGVGLVDMYAKHQFLDDARKVFDWMSHRDLV-LWNALISGCS-HGE  383


 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 93/170 (55%), Gaps = 3/170 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +L++    N    +A+++ L+ +  G+ P  F +SS+L AC+G  AF+LGR IHG 
Sbjct  269  VSWNALISGCVLNGHDHRAIELLLQMKSSGLVPNVFTLSSILKACSGAGAFDLGRQIHGF  328

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++KA  + + ++   LVDMY K   ++D  + F  M  R+L+ WNALI G +H      A
Sbjct  329  MIKANADSDDYIGVGLVDMYAKHQFLDDARKVFDWMSHRDLVLWNALISGCSHGERHGEA  388

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
            L LF ++ ++   V  N  T   VL + +   A+     +  A+ +K G 
Sbjct  389  LSLFCELIKEGIGV--NRTTLAAVLKSTASMEAISVTRQV-HALAEKIGF  435


 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 125/284 (44%), Gaps = 25/284 (9%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ V W +L++     +   +AL +F +  +EGI      +++VL + A + A  + R 
Sbjct  366  HRDLVLWNALISGCSHGERHGEALSLFCELIKEGIGVNRTTLAAVLKSTASMEAISVTRQ  425

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L  K     +  V + L+D Y KC C+ D    F +    ++I + ++I   +   H
Sbjct  426  VHALAEKIGFISDTHVVNGLIDSYWKCNCLNDANTVFEKCSSDDIIAFTSMITALSQCDH  485

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF------EAMKDKYGI  526
               A+ LF +M RK   + P+      +L AC+   A E G  +       + M D +  
Sbjct  486  GEGAIKLFMEMLRK--GLQPDPFVLSSLLNACASLSAYEQGKQVHAHLIKRQFMSDVFAG  543

Query  527  EPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAAD  706
                  YA       + G +E A      +P R  VS W A++G    HG    GK A +
Sbjct  544  NALVYTYA-------KCGSIEDAELAFSSLPERGVVS-WSAMIGGLAQHGH---GKKALE  592

Query  707  NLFQ--IDPQDSGNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
             LF   +D     NH+ ++++  +   +G  +EA      MK++
Sbjct  593  -LFHRMVDEGIDPNHITMTSVLCACNHAGLVDEAKQYFNSMKEM  635


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 63/119 (53%), Gaps = 8/119 (7%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLA--AFE  172
            ER  VSW +++    Q+  G+KAL++F +  +EGI+P    ++SVL AC  AGL   A +
Sbjct  568  ERGVVSWSAMIGGLAQHGHGKKALELFHRMVDEGIDPNHITMTSVLCACNHAGLVDEAKQ  627

Query  173  LGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGG  346
               S+  +      EE+    S ++D+ G+ G ++D       MP + N   W AL+G 
Sbjct  628  YFNSMKEMFGIDRTEEHY---SCMIDLLGRAGKLDDAMELVNSMPFQANASVWGALLGA  683



>ref|XP_002276764.2| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g01510 [Vitis vinifera]
Length=681

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 179/276 (65%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VS+  L+  Y + +  EK L VF++ R +GIEP EF  SS++ ACA  AA E G  +
Sbjct  272  RNVVSYTCLIDGYVETEQIEKGLSVFVELRRQGIEPNEFTFSSLIKACANQAALEQGTQL  331

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  V+K   +E+ FV S+LVDMYGKCG +E   +AF E+ +   I WN+L+  +   G  
Sbjct  332  HAQVMKINFDEDPFVSSILVDMYGKCGLLEQAIQAFDEIGDPTEIAWNSLVSVFGQHGLG  391

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ +FE M  +   V PN +TF+ +LT CS AG VE G+D F +M   YG+ PG EHY
Sbjct  392  KDAIKIFERMVDR--GVKPNAITFISLLTGCSHAGLVEEGLDYFYSMDKTYGVVPGEEHY  449

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +CV+D+LGRAG ++ A EFI RMP  P    W + LGACR+HG  E+GK+AA+ L +++P
Sbjct  450  SCVIDLLGRAGRLKEAKEFINRMPFEPNAFGWCSFLGACRIHGDKEMGKLAAEKLVKLEP  509

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++SG  V+LSN++A+  +WE+   VR  M+D  +KK
Sbjct  510  KNSGALVLLSNIYANERQWEDVRSVRMRMRDGNVKK  545


 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 84/305 (28%), Positives = 139/305 (46%), Gaps = 33/305 (11%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW ++++   QN    +A++ F   R  G  PT+F  SS + ACA L + E+G+ 
Sbjct  68   QRNLVSWTAMISGLSQNSKFSEAIRTFCGMRICGEVPTQFAFSSAIRACASLGSIEMGKQ  127

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +K  +   +FV S L DMY KCG + D  + F EMP ++ ++W A+I GY+  G 
Sbjct  128  MHCLALKFGIGSELFVGSNLEDMYSKCGAMFDACKVFEEMPCKDEVSWTAMIDGYSKIGE  187

Query  365  ANMALDLFEDMTRK----TQDVVPNYVTFVCVLTACSRAGAVETGM-------DIF----  499
               AL  F+ M  +     Q V+ + +     L AC    +V + +       DIF    
Sbjct  188  FEEALLAFKKMIDEEVTIDQHVLCSTLGACGALKACKFGRSVHSSVVKLGFESDIFVGNA  247

Query  500  -----------EAMKDKYGIEPGAEH---YACVVDMLGRAGMVERAYEF---IKRMPIRP  628
                       E+  + +GI+    +   Y C++D       +E+       ++R  I P
Sbjct  248  LTDMYSKAGDMESASNVFGIDSECRNVVSYTCLIDGYVETEQIEKGLSVFVELRRQGIEP  307

Query  629  TVSVWGALLGACRVHGKPELGKIAADNLFQID-PQDSGNHVILSNMFASSGRWEEANLVR  805
                + +L+ AC      E G      + +I+  +D     IL +M+   G  E+A    
Sbjct  308  NEFTFSSLIKACANQAALEQGTQLHAQVMKINFDEDPFVSSILVDMYGKCGLLEQAIQAF  367

Query  806  KEMKD  820
             E+ D
Sbjct  368  DEIGD  372


 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/233 (32%), Positives = 118/233 (51%), Gaps = 10/233 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW +++  Y +    E+AL  F K  +E +   + ++ S L AC  L A + GRS+
Sbjct  170  KDEVSWTAMIDGYSKIGEFEEALLAFKKMIDEEVTIDQHVLCSTLGACGALKACKFGRSV  229

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE-RNLITWNALIGGYAHQGH  364
            H  VVK   E ++FV + L DMY K G +E     F    E RN++++  LI GY     
Sbjct  230  HSSVVKLGFESDIFVGNALTDMYSKAGDMESASNVFGIDSECRNVVSYTCLIDGYVETEQ  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPGAE  541
                L +F ++ R  Q + PN  TF  ++ AC+   A+E G  +  + MK  +  +P   
Sbjct  290  IEKGLSVFVELRR--QGIEPNEFTFSSLIKACANQAALEQGTQLHAQVMKINFDEDPFVS  347

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIA  700
              + +VDM G+ G++E+A +    +   PT   W +L+     HG   LGK A
Sbjct  348  --SILVDMYGKCGLLEQAIQAFDEIG-DPTEIAWNSLVSVFGQHG---LGKDA  394


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 105/219 (48%), Gaps = 10/219 (5%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP  307
            ++ V+   A       G+ +H L++ A      F+ + LV+MY KCG ++   + F  MP
Sbjct  8    LAHVIQTYAKTKRLRRGKQLHALLICAGYTPCTFLTNHLVNMYSKCGELDHALKLFDTMP  67

Query  308  ERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETG  487
            +RNL++W A+I G +     + A+  F  M  +    VP    F   + AC+  G++E G
Sbjct  68   QRNLVSWTAMISGLSQNSKFSEAIRTFCGM--RICGEVPTQFAFSSAIRACASLGSIEMG  125

Query  488  MDIFEAMKDKYGIEPGAEHY--ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              +   +  K+GI  G+E +  + + DM  + G +  A +  + MP +  VS W A++  
Sbjct  126  KQM-HCLALKFGI--GSELFVGSNLEDMYSKCGAMFDACKVFEEMPCKDEVS-WTAMIDG  181

Query  662  CRVHGKPELGKIAADNLFQIDPQDSGNHVILSNMFASSG  778
                G+ E   +A   +  ID + + +  +L +   + G
Sbjct  182  YSKIGEFEEALLAFKKM--IDEEVTIDQHVLCSTLGACG  218



>ref|XP_010255496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nelumbo nucifera]
Length=842

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 185/277 (67%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ VSW SL+  Y  +   E ALK+F   R  GI+P +F+++S+LSACA L   E GR 
Sbjct  432  EQDVVSWTSLITGYAHHGFYENALKLFCNMRIVGIDPDQFVIASILSACAELTILEFGRQ  491

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   ++  ++ ++ V + LV MY KCGCIED  + F  M  R++++W ALI G+A  G 
Sbjct  492  VHANFIRCGLKSSLSVDNSLVTMYAKCGCIEDAHQVFDSMLMRDVVSWTALIVGHAQNGR  551

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               +L L++ M      + P+YVTF+ +L ACS AG VE G   FE+M D +GI PG EH
Sbjct  552  GEHSLKLYDQMI--LNGIRPDYVTFIGLLFACSHAGLVEDGCRYFESMGDVHGITPGPEH  609

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC++D+LGR+G + +A E +++M IRP  +VW A+L ACR+HG  ELG+ AA NLF+++
Sbjct  610  YACMIDLLGRSGKIAKAKEILEKMTIRPDATVWKAMLAACRIHGNLELGERAAMNLFELE  669

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P ++  +V+L NMF+++GRW++A  +RK MK  GI K
Sbjct  670  PANAVPYVLLCNMFSAAGRWDDAASIRKLMKSRGICK  706


 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 127/278 (46%), Gaps = 10/278 (4%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D++N V W +++  Y QN+   +A++ F   R EG+   +F   SVL+ACA L     G 
Sbjct  229  DKKNHVLWTAMVTGYSQNNYELRAMQCFRDMRAEGVRSNQFTFPSVLTACAALLERWFGM  288

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HG +++     NVFV S L+DMY KCG +    R    M   ++++WN+LI G   QG
Sbjct  289  QVHGCIIRTGFGVNVFVESALLDMYAKCGDLNSARRVLESMEVEDIVSWNSLIVGCVRQG  348

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                A+ LF+ M  +   +  +  T+  VL + +    VE    +   +  K G E    
Sbjct  349  FEREAISLFKKMHMRNMKI--DDFTYPSVLNSLASVMDVEHAKCV-HCLIVKTGFEAYKH  405

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE--LGKIAADNLF  715
                ++D+  + G +  A+    RMP +  VS W +L+     HG  E  L       + 
Sbjct  406  VSNALIDVYAKQGNLNCAFSVFHRMPEQDVVS-WTSLITGYAHHGFYENALKLFCNMRIV  464

Query  716  QIDPQDSGNHVILSN----MFASSGRWEEANLVRKEMK  817
             IDP       ILS          GR   AN +R  +K
Sbjct  465  GIDPDQFVIASILSACAELTILEFGRQVHANFIRCGLK  502


 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 115/225 (51%), Gaps = 7/225 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +  ++W +L++ + +   G  AL++F + R +G++P ++ + SVL AC+       G  I
Sbjct  129  QTSITWSALISGHARQGDGLGALELFCQMRSDGLQPNQYTLGSVLRACSVSFMLRRGEQI  188

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE-RNLITWNALIGGYAHQGH  364
            H   +K   + ++FV + LVDMY KC  I D E  F  MP+ +N + W A++ GY+   +
Sbjct  189  HAHAIKTRFDLDIFVVTGLVDMYAKCQQILDAEYLFNMMPDKKNHVLWTAMVTGYSQNNY  248

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEA-MKDKYGIEPGAE  541
               A+  F DM  + + V  N  TF  VLTAC+       GM +    ++  +G+    E
Sbjct  249  ELRAMQCFRDM--RAEGVRSNQFTFPSVLTACAALLERWFGMQVHGCIIRTGFGVNVFVE  306

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              + ++DM  + G +  A   ++ M +   VS W +L+  C   G
Sbjct  307  --SALLDMYAKCGDLNSARRVLESMEVEDIVS-WNSLIVGCVRQG  348


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 86/186 (46%), Gaps = 19/186 (10%)
 Frame = +2

Query  221  NVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMT  400
            ++FV + L+D   K G +++  + F +MP R+  +WN +I  YA  G    A  LF+   
Sbjct  68   SIFVSNRLLDDLSKSGRVDEARQLFDQMPCRDDFSWNTMISAYARLGRLTEARQLFDQTP  127

Query  401  RKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEP-----GAEHYACVVDM  565
             +T       +T+  +++  +R G     +++F  M+   G++P     G+   AC V  
Sbjct  128  TQTS------ITWSALISGHARQGDGLGALELFCQMRSD-GLQPNQYTLGSVLRACSVSF  180

Query  566  LGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNH  745
            + R G    A+    R  +   V     + G   ++ K +   + A+ LF + P D  NH
Sbjct  181  MLRRGEQIHAHAIKTRFDLDIFV-----VTGLVDMYAKCQ-QILDAEYLFNMMP-DKKNH  233

Query  746  VILSNM  763
            V+ + M
Sbjct  234  VLWTAM  239



>ref|XP_010518772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Tarenaya hassleriana]
Length=940

 Score =   266 bits (679),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 182/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VS+ S++  Y Q   GE+A+K++L  +  G+ P  F+ SS+L+ACA L+A+E G+ IH  
Sbjct  534  VSFTSVITAYSQYRQGEEAMKLYLDMQHRGLNPDAFVCSSLLNACANLSAYEQGKQIHVH  593

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            V+K     + F  + LV+MY KCG IED +RAF E+PER +I+W+A+IGG A  GH   A
Sbjct  594  VLKFGFISDGFAGNSLVNMYAKCGSIEDADRAFSEIPERGIISWSAMIGGLAQHGHGQKA  653

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L++FE M      V PN++T V VL+AC+  G V      FE+M+ ++GI+P  EHYAC+
Sbjct  654  LEMFELMLE--DGVAPNHITLVSVLSACNHTGLVSEAKRYFESMEKRFGIQPTQEHYACM  711

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +  A E +++MP  P  SVWGALLG  ++H   ELG+ AA  L  ++P+ S
Sbjct  712  IDVLGRAGKLIEAMEMVEKMPFEPDASVWGALLGTAKLHKNVELGQRAAKKLLILEPEKS  771

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G WE    +RK M++  +KK
Sbjct  772  GTHVLLANIYASAGMWENVARMRKLMREFQVKK  804


 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 115/229 (50%), Gaps = 6/229 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN   ++AL+ F +    G+   EF   SVL +CA     +LG  
Sbjct  125  EPDFVSWSALISGYSQNGFSQEALRAFQEMHCLGLRSNEFTFPSVLKSCAANKDLKLGVQ  184

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+ +    E + FV + LVDMY KCG +E   R F E+PE+ +++WNAL+  Y     
Sbjct  185  VHGVTIVTGYESDEFVGNSLVDMYAKCGELEASRRVFNELPEKGVVSWNALLSSYMQNDS  244

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM-KDKYGIEPGAE  541
                +DLF DM      V PN  +   ++ AC+  G +  G  +   + K  Y  +P + 
Sbjct  245  CAEGIDLFHDMV--NAGVRPNEFSLSSMIKACAGLGDIGEGRKLHGYLIKLGYNSDPYSS  302

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPEL  688
            +   +V+M  +AG +  A+   + +   P +  W  +L    +H   EL
Sbjct  303  N--ALVNMYAKAGSLVDAFLVFQEVE-SPDIVSWNTILAGSVLHEHYEL  348


 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 111/226 (49%), Gaps = 5/226 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+  VSW +LL+ Y QND   + + +F      G+ P EF +SS++ ACAGL     GR 
Sbjct  226  EKGVVSWNALLSSYMQNDSCAEGIDLFHDMVNAGVRPNEFSLSSMIKACAGLGDIGEGRK  285

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG ++K     + +  + LV+MY K G + D    F E+   ++++WN ++ G     H
Sbjct  286  LHGYLIKLGYNSDPYSSNALVNMYAKAGSLVDAFLVFQEVESPDIVSWNTILAGSVLHEH  345

Query  365  ANMALDLFEDMTR-KTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              ++L LF  M+R KT+   PN VT    L A +R G  E G      +     +E  + 
Sbjct  346  YELSLHLFVQMSRSKTR---PNMVTLSSALKALARIGFKELGKQFHAHLLKMNAMESDSF  402

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
                ++DM  +  M + A +  + M  +  V+ W A++      G+
Sbjct  403  IGVGIIDMYSKCLMTDDARKVFELMLEKKMVA-WNAMISGYSQKGE  447


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/260 (27%), Positives = 130/260 (50%), Gaps = 14/260 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+  V+W ++++ Y Q     +A+ +F +  +EG+   +  +S+VL + A L A  L   
Sbjct  429  EKKMVAWNAMISGYSQKGEDYEAVLLFPEMHKEGMGFNQTTLSTVLKSVAALQASGLSEQ  488

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L +K+ +  + ++ + L+D YGK G +E   + F E P  +L+++ ++I  Y+    
Sbjct  489  IHALSLKSGLMSDNYIVNSLIDAYGKSGKVEIATKVFEENPSPDLVSFTSVITAYSQYRQ  548

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               A+ L+ DM  +  +  P+   FVC  +L AC+   A E G  I   +  K+G     
Sbjct  549  GEEAMKLYLDMQHRGLN--PD--AFVCSSLLNACANLSAYEQGKQIHVHVL-KFGFISDG  603

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                 +V+M  + G +E A      +P R  +S W A++G    HG  +     A  +F+
Sbjct  604  FAGNSLVNMYAKCGSIEDADRAFSEIPERGIIS-WSAMIGGLAQHGHGQ----KALEMFE  658

Query  719  IDPQD--SGNHVILSNMFAS  772
            +  +D  + NH+ L ++ ++
Sbjct  659  LMLEDGVAPNHITLVSVLSA  678


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 131/309 (42%), Gaps = 43/309 (14%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW ++LA    ++  E +L +F++       P    +SS L A A +   ELG+  H  
Sbjct  331  VSWNTILAGSVLHEHYELSLHLFVQMSRSKTRPNMVTLSSALKALARIGFKELGKQFHAH  390

Query  197  VVKA-CVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANM  373
            ++K   +E + F+   ++DMY KC   +D  + F  M E+ ++ WNA+I GY+ +G    
Sbjct  391  LLKMNAMESDSFIGVGIIDMYSKCLMTDDARKVFELMLEKKMVAWNAMISGYSQKGEDYE  450

Query  374  ALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYAC  553
            A+ LF +M ++      N  T   VL + +   A      I  A+  K G+         
Sbjct  451  AVLLFPEMHKEGMGF--NQTTLSTVLKSVAALQASGLSEQI-HALSLKSGLMSDNYIVNS  507

Query  554  VVDMLGRAGMVERAYEFIKRMP----------------------------------IRPT  631
            ++D  G++G VE A +  +  P                                  + P 
Sbjct  508  LIDAYGKSGKVEIATKVFEENPSPDLVSFTSVITAYSQYRQGEEAMKLYLDMQHRGLNPD  567

Query  632  VSVWGALLGACRVHGKPELGKIAADNLFQ---IDPQDSGNHVILSNMFASSGRWEEANLV  802
              V  +LL AC      E GK    ++ +   I    +GN ++  NM+A  G  E+A+  
Sbjct  568  AFVCSSLLNACANLSAYEQGKQIHVHVLKFGFISDGFAGNSLV--NMYAKCGSIEDADRA  625

Query  803  RKEMKDIGI  829
              E+ + GI
Sbjct  626  FSEIPERGI  634


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 85/183 (46%), Gaps = 4/183 (2%)
 Frame = +2

Query  113  PTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERA  292
            PT      +LS  +   +   G  IHG ++   + ++   R+ L+ +YGKCG      + 
Sbjct  60   PTVVTYLRLLSESSASKSLLPGEQIHGRLIGLGLSKDSKFRNSLIGLYGKCGFFGYARKL  119

Query  293  FYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAG  472
              E PE + ++W+ALI GY+  G +  AL  F++M      +  N  TF  VL +C+   
Sbjct  120  LDESPEPDFVSWSALISGYSQNGFSQEALRAFQEM--HCLGLRSNEFTFPSVLKSCAANK  177

Query  473  AVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGAL  652
             ++ G+ +   +    G E        +VDM  + G +E +      +P +  VS W AL
Sbjct  178  DLKLGVQV-HGVTIVTGYESDEFVGNSLVDMYAKCGELEASRRVFNELPEKGVVS-WNAL  235

Query  653  LGA  661
            L +
Sbjct  236  LSS  238



>ref|XP_002272111.2| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Vitis vinifera]
Length=821

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 180/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++  Y QN    +A+  F K + + I+P  F + SV+ A A L+     + IHGL
Sbjct  416  VSWNAMILGYAQNGRINEAIDYFCKMQLQNIKPDSFTMVSVIPALAELSVLPQAKWIHGL  475

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            V++ C+++NVFV + LVDMY KCG +    + F  M ER++ TWNA+I GY   G    A
Sbjct  476  VIRTCLDKNVFVATALVDMYAKCGAVHTARKLFDMMDERHVTTWNAMIDGYGTHGLGKAA  535

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LFE M  K + + PN VTF+CVL+ACS +G VE G   F +MK  YG+EP  +HY  +
Sbjct  536  LELFEKM--KKEVIKPNEVTFLCVLSACSHSGLVEEGFQYFGSMKKDYGLEPAMDHYGAM  593

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            VD+LGRA  +  A++FI++MPI P +SV+GA+LGACR+H   ELG+ AA+ +F +DP D 
Sbjct  594  VDLLGRANRLNEAWDFIQKMPIEPAISVFGAMLGACRIHKNVELGEKAANRIFDLDPDDG  653

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++A++  W++   VR  M+  GI+K
Sbjct  654  GYHVLLANIYATASMWDKVARVRTTMEKKGIQK  686


 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 113/217 (52%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V W ++++ Y QN  G+ AL++ L+ +EEG  P    + S+L A A + +  +GRS
Sbjct  210  ERDLVCWNTIISGYAQNGFGKTALELVLRMQEEGKRPDSITIVSILPAVADVGSLRIGRS  269

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  ++A  E  V V + LVDMY KCG +      F  M  + +++WN++I GY   G 
Sbjct  270  IHGYSMRAGFESFVNVSTALVDMYSKCGSVGTARLIFDRMTGKTVVSWNSMIDGYVQNGD  329

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+++F+ M    + V    VT +  L AC+  G VE G  + + + D+  +      
Sbjct  330  PGAAMEIFQKMM--DEQVEMTNVTVMGALHACADLGDVEQGRFVHKLL-DQLELGSDVSV  386

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               ++ M  +   V+ A E  + +  +  VS W A++
Sbjct  387  MNSLISMYSKCKRVDIAAEIFENLQHKTLVS-WNAMI  422


 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/232 (29%), Positives = 109/232 (47%), Gaps = 8/232 (3%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            + ++L  Y +N   + A+  F + R +G+ P  +  + +L  C   A    G+ IH  ++
Sbjct  115  YHTMLKGYARNSSLDDAVSFFCRMRYDGVRPVVYNFTYLLKVCGDNADLRKGKEIHCQLI  174

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
                  NVF  + +V+MY KC  +E+  + F  MPER+L+ WN +I GYA  G    AL+
Sbjct  175  VNGFASNVFAMTGVVNMYAKCRLVEEAYKMFDRMPERDLVCWNTIISGYAQNGFGKTALE  234

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            L   M  + +   P+ +T V +L A +  G++  G  I      + G E        +VD
Sbjct  235  LVLRMQEEGKR--PDSITIVSILPAVADVGSLRIGRSI-HGYSMRAGFESFVNVSTALVD  291

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            M  + G V  A     RM  +  VS W +++     +G P     AA  +FQ
Sbjct  292  MYSKCGSVGTARLIFDRMTGKTVVS-WNSMIDGYVQNGDPG----AAMEIFQ  338



>ref|XP_004296321.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=465

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/277 (45%), Positives = 178/277 (64%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN  SW  +++ + Q    ++A++VFL+  E G+   E  V +VL+ACA L   +LGR 
Sbjct  55   ERNVRSWTLMISGFVQRGKPKEAVRVFLEMEEAGVRANEVTVVAVLAACADLGDLDLGRR  114

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H    ++    NV++ + L++MY KCGC+ED  R F  M +R +++W+A+I G A  G 
Sbjct  115  VHEYSSRSGFGRNVWICNTLIEMYVKCGCLEDARRVFDAMKDRTVVSWSAMISGLAMHGQ  174

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  AL LF +M     D  PN+VTFV +L ACS  G V+ G + FE M   YGI P  EH
Sbjct  175  AEEALRLFSNMVEIGMD--PNHVTFVGLLHACSHMGFVDKGREFFERMTADYGIVPRIEH  232

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+L RAG+++ AYEFI  MPI+P   VWGALLG C+VH   EL ++A  +L ++D
Sbjct  233  YGCMVDLLSRAGLLQEAYEFIMNMPIKPNGVVWGALLGGCKVHRNIELAEVATKHLAELD  292

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P + G +++LSN++A + RWEE   VRK M+D G+KK
Sbjct  293  PLNDGYYIVLSNIYAEAQRWEEVASVRKLMRDRGVKK  329



>ref|XP_009416825.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 
[Musa acuminata subsp. malaccensis]
Length=619

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 186/277 (67%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ VSW S++A Y QNDL E+A+  F  A + G+E T+F +S+ LSACA +AA   G+ 
Sbjct  209  EKSSVSWSSMVAGYVQNDLYEEAVWFFHHAHKMGVELTQFTLSAALSACASIAASTEGKQ  268

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H + ++A    N+FV + L+D+Y KCGCI +    F  + + N++ WNA+I G++    
Sbjct  269  LHSVAIRAGFAANLFVATSLIDVYSKCGCIREAYLVFCNVEDENIVLWNAMITGFSKHAR  328

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A+ LFE M  + + + PN V++V VL+ACS  G VE G   F+ +     + P   H
Sbjct  329  LHEAMMLFEKM--RQRGLQPNEVSYVSVLSACSHVGLVEEGRGYFDLLSRDAAVRPNVLH  386

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y+C+VD+LGRAG ++ A+E I+ MP R + S+WG++L +CRVHG  EL KIAA +LF+++
Sbjct  387  YSCMVDVLGRAGRIDEAWELIRSMPFRASASMWGSMLNSCRVHGNVELAKIAAQHLFELE  446

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+++GNHV+LSN++A+S +W E  + RK +KD G +K
Sbjct  447  PENAGNHVLLSNIYAASKQWGEVAVARKFLKDSGARK  483


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 94/204 (46%), Gaps = 7/204 (3%)
 Frame = +2

Query  50   QNDLGEKALKVFLKAREEG-IEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENV  226
            Q+  G +A    +  RE+G I   E  +  +L  CA       G+  HGL V+A +  + 
Sbjct  23   QSRFGFEASNKGVVVREDGAIRVLE--LQEILQLCARKQLTREGKCCHGLAVQAGLLADT  80

Query  227  FVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRK  406
               ++L++ Y KCG ++   R F  MPER+L+TWN +I  +   G    AL LF  M R 
Sbjct  81   LTCNILINFYSKCGRVDFARRLFDGMPERSLVTWNTMIATHTQHGEDMEALHLFLQMRR-  139

Query  407  TQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMV  586
             +  + +  T   VL AC+   AV     +  A+  K   +        V+D+  +  M+
Sbjct  140  -EGSLLSEFTLSSVLCACAARCAVTESQQL-HALALKTAADSNVFVGTAVLDVYAKCKMI  197

Query  587  ERAYEFIKRMPIRPTVSVWGALLG  658
              A      MP + +VS W +++ 
Sbjct  198  RDARLVFDAMPEKSSVS-WSSMVA  220


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 76/161 (47%), Gaps = 2/161 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            ++ N V W +++  + ++    +A+ +F K R+ G++P E    SVLSAC+ +   E GR
Sbjct  309  EDENIVLWNAMITGFSKHARLHEAMMLFEKMRQRGLQPNEVSYVSVLSACSHVGLVEEGR  368

Query  182  SIHGLVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER-NLITWNALIGGYAH  355
                L+ + A V  NV   S +VD+ G+ G I++       MP R +   W +++     
Sbjct  369  GYFDLLSRDAAVRPNVLHYSCMVDVLGRAGRIDEAWELIRSMPFRASASMWGSMLNSCRV  428

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAV  478
             G+  +A    + +     +   N+V    +  A  + G V
Sbjct  429  HGNVELAKIAAQHLFELEPENAGNHVLLSNIYAASKQWGEV  469



>ref|XP_007214178.1| hypothetical protein PRUPE_ppa019185mg [Prunus persica]
 gb|EMJ15377.1| hypothetical protein PRUPE_ppa019185mg [Prunus persica]
Length=858

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 184/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q + GE+ALK++L+ ++ G +P  F+ SS+L+ACA L+A+E G+ IH  
Sbjct  452  VAFTSMITAYSQYEQGEEALKLYLQMQQRGNKPDSFVCSSLLNACANLSAYEQGKQIHVH  511

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     + F  + LV+MY KCG I+D +RAF E+P+R L++W+A+IGG A  GH   A
Sbjct  512  ILKFGFMSDAFAGNSLVNMYAKCGSIDDADRAFSEVPQRGLVSWSAMIGGLAQHGHGKRA  571

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LF  M +    V PN++T V VL AC+ AG V      FE+MK+ +G+ P  EHYAC+
Sbjct  572  LNLFNQMLK--DGVSPNHITLVSVLCACNHAGLVTEARKYFESMKELFGVVPRQEHYACM  629

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +  A E +  MP +   SVWGALLGA R+H   ELG+ AA+ L  ++P+ S
Sbjct  630  IDLLGRAGKINEAMELVNTMPFQANASVWGALLGAARIHKNVELGQRAAEMLLALEPEKS  689

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G W+    +R+ M+D  +KK
Sbjct  690  GTHVLLANIYASAGMWDNVAKMRRLMRDGQVKK  722


 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 113/223 (51%), Gaps = 4/223 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN LG++AL  F +    G++  EF   SVL AC+      +G+ 
Sbjct  44   EPDLVSWSALISGYAQNGLGKEALSAFREMHSLGVKCNEFTFPSVLKACSITRDLVVGKQ  103

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+ +    E + FV + LV MY KCG   D  R F  +PERN+++WNAL   Y     
Sbjct  104  VHGIALLTGFESDEFVANTLVVMYAKCGEFGDSRRLFDAIPERNVVSWNALFSCYVQSDS  163

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+DLF++M      V PN  +   ++ AC+  G    G  I   M  K G E  +  
Sbjct  164  YGEAMDLFQEMI--LSGVRPNEYSLSSIINACTGLGDGSRGRKIHGYMV-KLGYESDSFS  220

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
               +VDM  +   +E A    +++  R  VS W A++  C +H
Sbjct  221  ANALVDMYAKVKGLEDAISVFEKIAQRDIVS-WNAVIAGCVLH  262


 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 113/225 (50%), Gaps = 4/225 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y Q+D   +A+ +F +    G+ P E+ +SS+++AC GL     GR 
Sbjct  145  ERNVVSWNALFSCYVQSDSYGEAMDLFQEMILSGVRPNEYSLSSIINACTGLGDGSRGRK  204

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG +VK   E + F  + LVDMY K   +ED    F ++ +R++++WNA+I G     +
Sbjct  205  IHGYMVKLGYESDSFSANALVDMYAKVKGLEDAISVFEKIAQRDIVSWNAVIAGCVLHEY  264

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL  F  M      + PN  T    L AC+  G  + G  +   +  K   E  +  
Sbjct  265  HDWALQFFGQMN--GSGICPNMFTLSSALKACAGLGFEKLGRQLHSFLI-KMDTESDSFV  321

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
               ++DM  +  M++ A      MP +  ++ W A++     +G+
Sbjct  322  NVGLIDMYCKCEMIDHARVLFNMMPKKEMIA-WNAVISGHSQNGE  365


 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 80/276 (29%), Positives = 139/276 (50%), Gaps = 17/276 (6%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            ++W ++++ + QN    +A+  F +  +EGIE  +  +S+VL + A + A +    IH L
Sbjct  351  IAWNAVISGHSQNGEDIEAVSQFSEMYKEGIEFNQTTLSTVLKSTASVQAIKFCEQIHAL  410

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             VK+  + +++V + L+D YGKCG +ED  + F   P  +++ + ++I  Y+       A
Sbjct  411  SVKSGFQCDMYVINSLLDAYGKCGKVEDAAKIFEGCPTEDVVAFTSMITAYSQYEQGEEA  470

Query  377  LDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
            L L+  M ++     P+  +FVC  +L AC+   A E G  I   +  K+G    A    
Sbjct  471  LKLYLQMQQRGNK--PD--SFVCSSLLNACANLSAYEQGKQIHVHIL-KFGFMSDAFAGN  525

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQ  730
             +V+M  + G ++ A      +P R  VS W A++G    HG    GK A  NLF    +
Sbjct  526  SLVNMYAKCGSIDDADRAFSEVPQRGLVS-WSAMIGGLAQHGH---GKRAL-NLFNQMLK  580

Query  731  D--SGNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
            D  S NH+ L ++  +   +G   EA    + MK++
Sbjct  581  DGVSPNHITLVSVLCACNHAGLVTEARKYFESMKEL  616


 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 106/211 (50%), Gaps = 3/211 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW +++A    ++  + AL+ F +    GI P  F +SS L ACAGL   +LGR 
Sbjct  246  QRDIVSWNAVIAGCVLHEYHDWALQFFGQMNGSGICPNMFTLSSALKACAGLGFEKLGRQ  305

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  ++K   E + FV   L+DMY KC  I+     F  MP++ +I WNA+I G++  G 
Sbjct  306  LHSFLIKMDTESDSFVNVGLIDMYCKCEMIDHARVLFNMMPKKEMIAWNAVISGHSQNGE  365

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  F +M +  + +  N  T   VL + +   A++    I  A+  K G +     
Sbjct  366  DIEAVSQFSEMYK--EGIEFNQTTLSTVLKSTASVQAIKFCEQI-HALSVKSGFQCDMYV  422

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVS  637
               ++D  G+ G VE A +  +  P    V+
Sbjct  423  INSLLDAYGKCGKVEDAAKIFEGCPTEDVVA  453


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 70/163 (43%), Gaps = 5/163 (3%)
 Frame = +2

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  +++     +  +R+ L+++Y KC       +   E  E +L++W+ALI GYA  G 
Sbjct  3    VHAHIIRCGCSGDQSIRNHLINLYSKCRFFRHARKLVDESTEPDLVSWSALISGYAQNGL  62

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL  F +M   +  V  N  TF  VL ACS    +  G  +   +    G E     
Sbjct  63   GKEALSAFREM--HSLGVKCNEFTFPSVLKACSITRDLVVGKQV-HGIALLTGFESDEFV  119

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
               +V M  + G    +      +P R  VS W AL  +C V 
Sbjct  120  ANTLVVMYAKCGEFGDSRRLFDAIPERNVVS-WNALF-SCYVQ  160



>ref|XP_006479094.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X1 [Citrus sinensis]
 ref|XP_006479095.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X2 [Citrus sinensis]
 ref|XP_006479096.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X3 [Citrus sinensis]
Length=1077

 Score =   266 bits (680),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 187/278 (67%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D ++ +SW  L++ + Q+   E AL+VF +    G++   +   SV+SA A LA  + G+
Sbjct  666  DAKDNISWNGLISGFAQSGYCEGALQVFSQMIRVGVQANLYTFGSVVSAAANLANIKQGK  725

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H +++K   +      + L+ +Y KCG I+D +R F EMPE+N ++WNA+I G++  G
Sbjct  726  QVHAMIIKTGYDSETEASNSLITLYAKCGSIDDAKRGFLEMPEKNEVSWNAMITGFSQHG  785

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            +A  A++LFE M  K  DV+PN+VTFV VL+ACS  G V  G+  FE+M  +YG+ P  E
Sbjct  786  YALEAINLFEKM--KKHDVMPNHVTFVGVLSACSHVGLVNEGLRYFESMSTEYGLVPKPE  843

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACVVD+LGRAG + RA EF ++MPI P   VW  LL ACRVH   E+G+ AA++L ++
Sbjct  844  HYACVVDLLGRAGSLSRAREFTEQMPIEPDAMVWRTLLSACRVHKNMEIGEYAANHLLEL  903

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +P+DS  +V+LSN++A++G+W+  + +R+ MKD G+KK
Sbjct  904  EPEDSATYVLLSNIYAAAGKWDCRDQIRQIMKDRGVKK  941


 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 115/218 (53%), Gaps = 4/218 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW ++++ + QN    +A+ +F +    G  PT + +SS LSAC  +  FE+G   
Sbjct  264  KDSVSWVAMISGFSQNGYEREAILLFCQMHILGTVPTPYAISSALSACTKIELFEIGEQF  323

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGL+ K       FV + LV +Y + G +   E+ F +M +R+ +T+N+LI G A  G++
Sbjct  324  HGLIFKWGFSSETFVCNALVTLYSRSGNLTSAEQIFSKMQQRDGVTYNSLISGLAQCGYS  383

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            + AL+LFE M  +   + P+ VT   +++AC+  GA  TG  +  +   K GI       
Sbjct  384  DKALELFEKM--QLDCLKPDCVTVASLVSACASVGAFRTGEQL-HSYAIKVGISKDIIVE  440

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              ++D+  +   VE AY+F         V +W  +L A
Sbjct  441  GSMLDLYVKCSDVETAYKFFLTTETENVV-LWNVMLVA  477


 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 109/219 (50%), Gaps = 6/219 (3%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQ-NDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELG  178
            +  N V W  +L  Y Q NDL E + ++F + + EG+ P ++   ++L  C  L A  LG
Sbjct  464  ETENVVLWNVMLVAYGQLNDLSE-SFQIFKQMQTEGLTPNQYTYPTILRTCTSLGALSLG  522

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
              IH  V+K   + NV+V SVL+DMY K G +   +     +PE ++++W A+I G+   
Sbjct  523  EQIHTQVIKTGFQFNVYVCSVLIDMYAKLGNLNTAQEILRRLPEDDVVSWTAMIVGFVQH  582

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G    AL+LFE+M  + Q +  + + F   ++AC+   A+  G  I  A     G     
Sbjct  583  GMFGEALELFEEM--ENQGIQSDNIGFSSAISACAGIQALNQGRQI-HAQSYISGFSDDL  639

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
                 ++ +  R G ++ AY    ++  +  +S W  L+
Sbjct  640  SIGNALISLYARCGRIQEAYLVFNKIDAKDNIS-WNGLI  677


 Score =   112 bits (281),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 116/224 (52%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+GV++ SL++   Q    +KAL++F K + + ++P    V+S++SACA + AF  G  
Sbjct  364  QRDGVTYNSLISGLAQCGYSDKALELFEKMQLDCLKPDCVTVASLVSACASVGAFRTGEQ  423

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   +K  + +++ V   ++D+Y KC  +E   + F      N++ WN ++  Y     
Sbjct  424  LHSYAIKVGISKDIIVEGSMLDLYVKCSDVETAYKFFLTTETENVVLWNVMLVAYGQLND  483

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + +  +F+ M  +T+ + PN  T+  +L  C+  GA+  G  I   +  K G +     
Sbjct  484  LSESFQIFKQM--QTEGLTPNQYTYPTILRTCTSLGALSLGEQIHTQVI-KTGFQFNVYV  540

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
             + ++DM  + G +  A E ++R+P    VS W A++     HG
Sbjct  541  CSVLIDMYAKLGNLNTAQEILRRLPEDDVVS-WTAMIVGFVQHG  583


 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 119/238 (50%), Gaps = 8/238 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +++  + Q+ +  +AL++F +   +GI+      SS +SACAG+ A   GR 
Sbjct  566  EDDVVSWTAMIVGFVQHGMFGEALELFEEMENQGIQSDNIGFSSAISACAGIQALNQGRQ  625

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH     +   +++ + + L+ +Y +CG I++    F ++  ++ I+WN LI G+A  G+
Sbjct  626  IHAQSYISGFSDDLSIGNALISLYARCGRIQEAYLVFNKIDAKDNISWNGLISGFAQSGY  685

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL +F  M R    V  N  TF  V++A +    ++ G  +  AM  K G +   E 
Sbjct  686  CEGALQVFSQMIRV--GVQANLYTFGSVVSAAANLANIKQGKQV-HAMIIKTGYDSETEA  742

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
               ++ +  + G ++ A      MP +  VS W A++     HG      + A NLF+
Sbjct  743  SNSLITLYAKCGSIDDAKRGFLEMPEKNEVS-WNAMITGFSQHGYA----LEAINLFE  795


 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 102/215 (47%), Gaps = 9/215 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAAFELG  178
            +R   SW  L++ +    L  + L +FL+  ++ + P E     VL AC  +G  A +  
Sbjct  160  KRTVFSWNKLISGFVSKKLSGRVLGLFLQMIDDDVIPNEATFVGVLRACIGSGNVAVQCV  219

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
              IHGL++      +  + + L+D+Y K G I+  ++ F  +  ++ ++W A+I G++  
Sbjct  220  NQIHGLIISHGFGGSPLISNPLIDLYAKNGFIDSAKKVFNNLCFKDSVSWVAMISGFSQN  279

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G+   A+ LF  M       VP        L+AC++    E G + F  +  K+G    +
Sbjct  280  GYEREAILLFCQM--HILGTVPTPYAISSALSACTKIELFEIG-EQFHGLIFKWGFS--S  334

Query  539  EHYAC--VVDMLGRAGMVERAYEFIKRMPIRPTVS  637
            E + C  +V +  R+G +  A +   +M  R  V+
Sbjct  335  ETFVCNALVTLYSRSGNLTSAEQIFSKMQQRDGVT  369


 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/211 (22%), Positives = 91/211 (43%), Gaps = 4/211 (2%)
 Frame = +2

Query  47   EQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENV  226
            ++ +   K +++     E GI+        +L  C    +    + IHG ++K   +   
Sbjct  73   QETEWQSKGIELLRVMEERGIQANSQTFVWLLEGCLSYGSLLEAKKIHGKILKLGFDGEQ  132

Query  227  FVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRK  406
             +   + ++Y   G ++     F +M +R + +WN LI G+  +  +   L LF  M   
Sbjct  133  VLCDKIFNIYLASGDLDSAMNIFDDMSKRTVFSWNKLISGFVSKKLSGRVLGLFLQMI--  190

Query  407  TQDVVPNYVTFVCVLTACSRAGAVETG-MDIFEAMKDKYGIEPGAEHYACVVDMLGRAGM  583
              DV+PN  TFV VL AC  +G V    ++    +   +G          ++D+  + G 
Sbjct  191  DDDVIPNEATFVGVLRACIGSGNVAVQCVNQIHGLIISHGFGGSPLISNPLIDLYAKNGF  250

Query  584  VERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            ++ A +    +  + +VS W A++     +G
Sbjct  251  IDSAKKVFNNLCFKDSVS-WVAMISGFSQNG  280



>ref|XP_002275298.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Vitis vinifera]
Length=781

 Score =   263 bits (671),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 180/272 (66%), Gaps = 2/272 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
             E++  SW ++++ Y QN L EKA+ +F + ++  + P    V+S+LSACA L A  LG+
Sbjct  370  SEKSLASWNAMISGYAQNGLTEKAISLFQEMQKCEVRPNPVTVTSILSACAQLGALSLGK  429

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +H L+ +   E N+FV + L+DMY KCG I + +R F  MPE+N +TWNA+I GY   G
Sbjct  430  WVHDLINRESFESNIFVSTALIDMYAKCGSITEAQRLFSMMPEKNAVTWNAMISGYGLHG  489

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            + + AL+LF +M      V P  VTF+ VL ACS AG V  G +IF +M   +G EP  E
Sbjct  490  YGHEALNLFNEMLH--SRVSPTGVTFLSVLYACSHAGLVREGDEIFRSMVHDHGFEPLPE  547

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC+VD+LGRAG +++A +FI++MP+ P   VWGALLGAC +H    L ++A+D LF++
Sbjct  548  HYACMVDLLGRAGNLDKALDFIRKMPVEPGPPVWGALLGACMIHKDANLARLASDKLFEL  607

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMK  817
            DPQ+ G +V+LSN++++   + EA  VR  +K
Sbjct  608  DPQNVGYYVLLSNIYSAGQNYPEAASVRGVVK  639


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/220 (27%), Positives = 106/220 (48%), Gaps = 4/220 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VS+ ++++ Y  N+  E ++++F +    G +     +  ++          L R IHG 
Sbjct  274  VSYNAMISGYTCNNETESSVRLFKELLVSGEKVNSSSIVGLIPVFFPFGHLHLTRCIHGF  333

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
              K+ V  N  V + L  +Y +   IE     F E  E++L +WNA+I GYA  G    A
Sbjct  334  CTKSGVVSNSSVSTALTTVYSRLNEIESARLLFDESSEKSLASWNAMISGYAQNGLTEKA  393

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + LF++M +   +V PN VT   +L+AC++ GA+  G  + + + ++   E        +
Sbjct  394  ISLFQEMQK--CEVRPNPVTVTSILSACAQLGALSLGKWVHDLI-NRESFESNIFVSTAL  450

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            +DM  + G +  A      MP +  V+ W A++    +HG
Sbjct  451  IDMYAKCGSITEAQRLFSMMPEKNAVT-WNAMISGYGLHG  489


 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 127/312 (41%), Gaps = 48/312 (15%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V W ++++   +N   ++A+ +F    + GI      V++VL   A L    LG  
Sbjct  169  ERDTVLWNTMVSGLVKNSCFDEAILIFGDMVKGGIGFDSTTVAAVLPGVAELQDLALGMG  228

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            I  L +K     + +V + L  +Y KCG IE     F ++ + +L+++NA+I GY     
Sbjct  229  IQCLAMKVGFHSHAYVITGLACLYSKCGEIETARLLFGQIGQPDLVSYNAMISGYTCNNE  288

Query  365  ANMALDLFEDMTRKTQDV--------VPNYVTF-------------------------VC  445
               ++ LF+++    + V        +P +  F                           
Sbjct  289  TESSVRLFKELLVSGEKVNSSSIVGLIPVFFPFGHLHLTRCIHGFCTKSGVVSNSSVSTA  348

Query  446  VLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMP--  619
            + T  SR   +E+   +F+   +K         +  ++    + G+ E+A    + M   
Sbjct  349  LTTVYSRLNEIESARLLFDESSEK-----SLASWNAMISGYAQNGLTEKAISLFQEMQKC  403

Query  620  -IRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNHVILS----NMFASSGRW  784
             +RP      ++L AC   G   LGK   D    I+ +   +++ +S    +M+A  G  
Sbjct  404  EVRPNPVTVTSILSACAQLGALSLGKWVHD---LINRESFESNIFVSTALIDMYAKCGSI  460

Query  785  EEANLVRKEMKD  820
             EA  +   M +
Sbjct  461  TEAQRLFSMMPE  472



>ref|XP_006493918.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630-like [Citrus sinensis]
Length=610

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 176/277 (64%), Gaps = 3/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  ++  Y Q+    +AL +F +A  E ++  +F  SSVL+ C      ELG+ 
Sbjct  201  ERNVVSWTGMIYGYAQSGETGEALSLFKQALYENLDVNDFTFSSVLNVCGNTTVLELGKQ  260

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL VK   + + FV S L+ +Y KCG IE   R F E+  RNL  WNA++   A   H
Sbjct  261  IHGLCVKTSFDSSSFVGSSLISLYSKCGVIEPAYRVFQEVRVRNLGMWNAMLIACAQHSH  320

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N   DLF++M R    + PN++TF+CVL ACS AG VE G   FE M +KYG+EPGA H
Sbjct  321  TNKVFDLFKEMERF--GLKPNFITFLCVLYACSHAGLVEKGKYYFELM-NKYGVEPGAHH  377

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            +A +VD+LGRAG ++ A   I++MPI PT SVWGALL  CR+HG  EL   AAD +F++ 
Sbjct  378  FASLVDVLGRAGKLQEAVSVIEKMPIAPTESVWGALLTGCRIHGNTELAAYAADRVFELG  437

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
                G +V+LSN +A++GRWE+A   RK ++D G+KK
Sbjct  438  TVSPGMNVLLSNAYAAAGRWEDAAKARKMLRDRGVKK  474


 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 116/223 (52%), Gaps = 4/223 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++  +W S+++ + QN+L   AL+ F +   E   P + +  S   +CA L  F  G SI
Sbjct  101  KSATTWSSVISSFAQNELPCLALEYFRRMIGERRFPDDHIFPSATKSCAILGDFNAGASI  160

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H LVVK   + +VFV S L+DMY KCG ++   + F EMPERN+++W  +I GYA  G  
Sbjct  161  HCLVVKIGYDFDVFVNSSLLDMYAKCGQLKTARKVFDEMPERNVVSWTGMIYGYAQSGET  220

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF+    +  DV  N  TF  VL  C     +E G  I   +  K   +  +   
Sbjct  221  GEALSLFKQALYENLDV--NDFTFSSVLNVCGNTTVLELGKQI-HGLCVKTSFDSSSFVG  277

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            + ++ +  + G++E AY   + + +R  + +W A+L AC  H 
Sbjct  278  SSLISLYSKCGVIEPAYRVFQEVRVR-NLGMWNAMLIACAQHS  319



>emb|CAN80331.1| hypothetical protein VITISV_018275 [Vitis vinifera]
Length=681

 Score =   261 bits (666),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 178/276 (64%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VS+  L+  Y + +  EK L VF++ R +GIEP EF  SS++ ACA  AA E G  +
Sbjct  272  RNVVSYTCLIDGYVETEQIEKGLSVFVELRRQGIEPNEFTFSSLIKACANQAALEQGTQL  331

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  V+K   +E+ FV S+LVDMYGKCG +E   +AF E+ +   I WN+L+  +   G  
Sbjct  332  HAQVMKINFDEDPFVSSILVDMYGKCGLLEHAIQAFDEIGDPTEIAWNSLVSVFGQHGLG  391

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+  FE M  +   V PN +TF+ +LT CS AG VE G+D F +M   YG+ PG EHY
Sbjct  392  KDAIKFFERMVDR--GVKPNAITFISLLTGCSHAGLVEEGLDYFYSMDKTYGVVPGEEHY  449

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            +CV+D+LGRAG ++ A EFI RMP  P    W + LGACR+HG  E+GK+AA+ L +++P
Sbjct  450  SCVIDLLGRAGRLKEAKEFINRMPFEPNAFGWCSFLGACRIHGDKEMGKLAAEKLVKLEP  509

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++SG  V+LSN++A+  +WE+   VR  M+D  +KK
Sbjct  510  KNSGALVLLSNIYANERQWEDVRSVRMRMRDGNVKK  545


 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/305 (28%), Positives = 138/305 (45%), Gaps = 33/305 (11%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW ++++   QN    +A++ F   R  G  PT+F  SS + ACA L + E+G+ 
Sbjct  68   QRNLVSWTAMISGLSQNSKFSEAIRTFCGMRICGEVPTQFAFSSAIRACASLGSIEMGKQ  127

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L +K  +   +FV S L DMY KCG + D  + F EMP ++ ++W A+I GY+  G 
Sbjct  128  MHCLALKFGIGSELFVGSNLEDMYSKCGAMFDACKVFEEMPCKDEVSWTAMIDGYSKIGE  187

Query  365  ANMALDLFEDMTRK----TQDVVPNYVTFVCVLTACSRAGAVETGM-------DIF----  499
               AL  F+ M  +     Q V+ + +     L AC    +V + +       DIF    
Sbjct  188  FEEALLAFKKMIDEEVTIDQHVLCSTLGACGALKACKFGRSVHSSVVKLGFESDIFVGNA  247

Query  500  -----------EAMKDKYGIEPGAEH---YACVVDMLGRAGMVERAYEF---IKRMPIRP  628
                       E+  + +GI+    +   Y C++D       +E+       ++R  I P
Sbjct  248  LTDMYSKAGDMESASNVFGIDSECRNVVSYTCLIDGYVETEQIEKGLSVFVELRRQGIEP  307

Query  629  TVSVWGALLGACRVHGKPELGKIAADNLFQID-PQDSGNHVILSNMFASSGRWEEANLVR  805
                + +L+ AC      E G      + +I+  +D     IL +M+   G  E A    
Sbjct  308  NEFTFSSLIKACANQAALEQGTQLHAQVMKINFDEDPFVSSILVDMYGKCGLLEHAIQAF  367

Query  806  KEMKD  820
             E+ D
Sbjct  368  DEIGD  372


 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/233 (32%), Positives = 117/233 (50%), Gaps = 10/233 (4%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW +++  Y +    E+AL  F K  +E +   + ++ S L AC  L A + GRS+
Sbjct  170  KDEVSWTAMIDGYSKIGEFEEALLAFKKMIDEEVTIDQHVLCSTLGACGALKACKFGRSV  229

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE-RNLITWNALIGGYAHQGH  364
            H  VVK   E ++FV + L DMY K G +E     F    E RN++++  LI GY     
Sbjct  230  HSSVVKLGFESDIFVGNALTDMYSKAGDMESASNVFGIDSECRNVVSYTCLIDGYVETEQ  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPGAE  541
                L +F ++ R  Q + PN  TF  ++ AC+   A+E G  +  + MK  +  +P   
Sbjct  290  IEKGLSVFVELRR--QGIEPNEFTFSSLIKACANQAALEQGTQLHAQVMKINFDEDPFVS  347

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIA  700
              + +VDM G+ G++E A +    +   PT   W +L+     HG   LGK A
Sbjct  348  --SILVDMYGKCGLLEHAIQAFDEIG-DPTEIAWNSLVSVFGQHG---LGKDA  394


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 105/219 (48%), Gaps = 10/219 (5%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP  307
            ++ V+   A       G+ +H L++ A      F+ + LV+MY KCG ++   + F  MP
Sbjct  8    LAHVIQTYAKTKRLRRGKQLHALLICAGYTPCTFLTNHLVNMYSKCGELDHALKLFDTMP  67

Query  308  ERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETG  487
            +RNL++W A+I G +     + A+  F  M  +    VP    F   + AC+  G++E G
Sbjct  68   QRNLVSWTAMISGLSQNSKFSEAIRTFCGM--RICGEVPTQFAFSSAIRACASLGSIEMG  125

Query  488  MDIFEAMKDKYGIEPGAEHY--ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
              +   +  K+GI  G+E +  + + DM  + G +  A +  + MP +  VS W A++  
Sbjct  126  KQM-HCLALKFGI--GSELFVGSNLEDMYSKCGAMFDACKVFEEMPCKDEVS-WTAMIDG  181

Query  662  CRVHGKPELGKIAADNLFQIDPQDSGNHVILSNMFASSG  778
                G+ E   +A   +  ID + + +  +L +   + G
Sbjct  182  YSKIGEFEEALLAFKKM--IDEEVTIDQHVLCSTLGACG  218



>ref|XP_010273499.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010273500.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010273501.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010273502.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010273503.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
Length=756

 Score =   262 bits (670),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 185/278 (67%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +E+N VSW SL++ + QN L    L+ F+    EG +P +   +S LSACA LAA ++G+
Sbjct  417  EEKNIVSWNSLISGFTQNGLYMDGLRHFVLMGREGKKPDQSTFASSLSACANLAALQIGK  476

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             IH LVVK     ++FV + L+ MY KCG I   E+ F ++   ++I+WN+LI GYA  G
Sbjct  477  QIHHLVVKIGYVNDLFVGNALITMYAKCGRILSAEQVFNDIDNTDIISWNSLISGYAFNG  536

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            +   A+ LF++M   T+ + P+ VTFV +L+ACS AG ++ G+ +F+ M +KY IEP AE
Sbjct  537  YGKDAIQLFQEML--TEGLNPDQVTFVGLLSACSHAGLIDEGLKLFKYMTEKYCIEPLAE  594

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC+VD+LGRAG +E AY+ +  MPI+     WGALLGACR+H   +LGK+AA+ L + 
Sbjct  595  HYACIVDLLGRAGRLEEAYQLVMEMPIKANAGTWGALLGACRLHKNLKLGKLAAEKLLEF  654

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +P  + N+V+LSN+ A +G W E   VR  MK+ G++K
Sbjct  655  EPYKTSNYVLLSNIHAEAGSWNEVEKVRMLMKEKGVEK  692


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 75/155 (48%), Gaps = 11/155 (7%)
 Frame = +2

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            + ++    N    + ++  Y K G I D    F +MP RNL++WN +I GY H    + A
Sbjct  39   IFESMTSRNTVTWNSMISAYAKNGRINDARNLFEQMPLRNLVSWNTMISGYLHNDKVHEA  98

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
             +LFE M+R+      +  ++  ++T  +R G +E    +F+ + DK    P    +  +
Sbjct  99   AELFERMSRR------DLFSWTLMITCYTRNGELEKARILFDQLPDKRS--PVC--WNAM  148

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
            +    + G  E A     +MP+R  VS W ++L A
Sbjct  149  IAGYAKNGRFEDARRLFDKMPVRNLVS-WNSMLAA  182


 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/217 (23%), Positives = 93/217 (43%), Gaps = 19/217 (9%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW ++++ Y  ND   +A ++F +     +     M++          A  L   +
Sbjct  77   RNLVSWNTMISGYLHNDKVHEAAELFERMSRRDLFSWTLMITCYTRNGELEKARILFDQL  136

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
                   C        + ++  Y K G  ED  R F +MP RNL++WN+++  Y      
Sbjct  137  PDKRSPVC-------WNAMIAGYAKNGRFEDARRLFDKMPVRNLVSWNSMLAAYIQNEEM  189

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
             +ALD F+ M+ +      + V++  V+    + G +++ M  F+ +       P    +
Sbjct  190  GLALDFFDKMSER------DVVSWNLVIDGFMQIGDLDSAMQFFQRIPS-----PNVISW  238

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              ++    R   ++ A     +MP+R  VS W A++ 
Sbjct  239  VTMLSGFARYSRIDEARRIFDQMPMRNVVS-WNAMIS  274


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 76/170 (45%), Gaps = 14/170 (8%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW S+LA Y QN+    AL  F K  E  +     ++   +      +A +  + I
Sbjct  171  RNLVSWNSMLAAYIQNEEMGLALDFFDKMSERDVVSWNLVIDGFMQIGDLDSAMQFFQRI  230

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
                       NV     ++  + +   I++  R F +MP RN+++WNA+I GY      
Sbjct  231  PS--------PNVISWVTMLSGFARYSRIDEARRIFDQMPMRNVVSWNAMISGYVLNYQI  282

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDK  517
            + A+ LFE MT K      N V++  ++    R G +E   ++   M  K
Sbjct  283  DEAIILFEQMTEK------NAVSWTTMINGYVRIGKLEKARELLNLMPYK  326


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 121/271 (45%), Gaps = 23/271 (8%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+R+ V W +++A Y +N   E A ++F K       P   +VS      A +   E+G 
Sbjct  138  DKRSPVCWNAMIAGYAKNGRFEDARRLFDKM------PVRNLVSWNSMLAAYIQNEEMGL  191

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            ++         E +V   ++++D + + G ++   + F  +P  N+I+W  ++ G+A   
Sbjct  192  ALD--FFDKMSERDVVSWNLVIDGFMQIGDLDSAMQFFQRIPSPNVISWVTMLSGFARYS  249

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              + A  +F+ M  +      N V++  +++       ++  + +FE M +K      A 
Sbjct  250  RIDEARRIFDQMPMR------NVVSWNAMISGYVLNYQIDEAIILFEQMTEK-----NAV  298

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
             +  +++   R G +E+A E +  MP +   +    + G  +     E  +I      ++
Sbjct  299  SWTTMINGYVRIGKLEKARELLNLMPYKNVAAQTAMISGYIQTMQMEEARQI----FDEM  354

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEM  814
            D +D      +   +A  GR +EAN + K+M
Sbjct  355  DTRDIACWNTMIAGYAQCGRMDEANKLFKQM  385


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 86/194 (44%), Gaps = 21/194 (11%)
 Frame = +2

Query  224  VFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTR  403
            VF ++  +   GK G I +  + F  M  RN +TWN++I  YA  G  N A +LFE M  
Sbjct  17   VFYQNQKITQLGKSGKINEAIKIFESMTSRNTVTWNSMISAYAKNGRINDARNLFEQMPL  76

Query  404  KTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM--KDKYGIEPGAEHYACVVDMLGRA  577
            +      N V++  +++       V    ++FE M  +D +        +  ++    R 
Sbjct  77   R------NLVSWNTMISGYLHNDKVHEAAELFERMSRRDLFS-------WTLMITCYTRN  123

Query  578  GMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNHVILS  757
            G +E+A     ++P + +   W A++     +G+ E     A  LF  D     N V  +
Sbjct  124  GELEKARILFDQLPDKRSPVCWNAMIAGYAKNGRFE----DARRLF--DKMPVRNLVSWN  177

Query  758  NMFASSGRWEEANL  799
            +M A+  + EE  L
Sbjct  178  SMLAAYIQNEEMGL  191


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 82/183 (45%), Gaps = 15/183 (8%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N VSW +++  Y +    EKA ++      + +     M+S  +         E  R 
Sbjct  294  EKNAVSWTTMINGYVRIGKLEKARELLNLMPYKNVAAQTAMISGYIQTMQ----MEEARQ  349

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            I           ++   + ++  Y +CG +++  + F +M  +N+ITWN +I GYA  G 
Sbjct  350  I----FDEMDTRDIACWNTMIAGYAQCGRMDEANKLFKQMFRKNIITWNTVIAGYAQGGE  405

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N AL +FE M  K      N V++  +++  ++ G    G+  F  M  + G +P    
Sbjct  406  MNKALRIFEKMEEK------NIVSWNSLISGFTQNGLYMDGLRHFVLM-GREGKKPDQST  458

Query  545  YAC  553
            +A 
Sbjct  459  FAS  461



>ref|XP_009386862.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Musa acuminata subsp. malaccensis]
Length=804

 Score =   263 bits (672),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/273 (43%), Positives = 182/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++  Y QND  E AL++F K + E ++P  F + SV+ A A ++  +  + IHG 
Sbjct  399  VSWNAMILGYAQNDRVEDALRLFNKMQWENVKPDSFTMVSVIPALADISVLKQAKWIHGF  458

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             ++ C ++N+F+ + LVD+Y KCG +    R F  M ER++ TWNA+I GY   G    A
Sbjct  459  AIRLCTDKNIFIMTALVDLYAKCGSVRIARRLFDAMEERHVTTWNAMIDGYGTHGFGKSA  518

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +DLFE M R +  V PN +T + VL+AC  +G V+ G   F +MK+ YG EP  +HY C+
Sbjct  519  IDLFEQMKRSS--VKPNDITLLSVLSACGHSGLVQEGKKYFASMKEDYGFEPNMDHYGCM  576

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            VD+LGRAG ++ A++FI++MPIRP +SV+GA+LGAC++H   +LG+ AA  LF+++P + 
Sbjct  577  VDLLGRAGRLDEAWDFIQKMPIRPGISVYGAMLGACKIHKNVKLGEEAAQRLFELEPDEG  636

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++A++  WE+   VR  M+  G++K
Sbjct  637  GYHVLLANIYAAASMWEDVARVRTMMEKKGLQK  669


 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 117/217 (54%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V+W ++++ Y QN + E+AL++ ++ +++G +P    + S L ACA + + ++G++
Sbjct  193  ERDLVAWNAIVSGYAQNGMAERALEMVIRLQKDGHKPDSITLVSALPACANVGSLKIGKT  252

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   +KA  +  V V + LVDMY K G IE     F  M  +N+++WN++I GY   G 
Sbjct  253  VHAFAMKAGFDSLVNVSTALVDMYSKRGAIETARLVFDSMRLKNVVSWNSMIDGYGQNGD  312

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  AL LF+ M      +    VT +  L AC   G +E G  + E +  + G E     
Sbjct  313  AEEALRLFKKMM--ADGIQATDVTIMGALYACGELGDLEEGRHVHELLT-RTGFESDVSV  369

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               ++ M  +   ++ A +  + MP++  VS W A++
Sbjct  370  LNALITMYSKCKRIDLAEDVFENMPVKSLVS-WNAMI  405


 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 75/238 (32%), Positives = 114/238 (48%), Gaps = 7/238 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW S++  Y QN   E+AL++F K   +GI+ T+  +   L AC  L   E GR +
Sbjct  295  KNVVSWNSMIDGYGQNGDAEEALRLFKKMMADGIQATDVTIMGALYACGELGDLEEGRHV  354

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L+ +   E +V V + L+ MY KC  I+  E  F  MP ++L++WNA+I GYA     
Sbjct  355  HELLTRTGFESDVSVLNALITMYSKCKRIDLAEDVFENMPVKSLVSWNAMILGYAQNDRV  414

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF  M  + ++V P+  T V V+ A +    ++    I      +   +      
Sbjct  415  EDALRLFNKM--QWENVKPDSFTMVSVIPALADISVLKQAKWI-HGFAIRLCTDKNIFIM  471

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
              +VD+  + G V  A      M  R  V+ W A++     HG    GK A D   Q+
Sbjct  472  TALVDLYAKCGSVRIARRLFDAMEER-HVTTWNAMIDGYGTHG---FGKSAIDLFEQM  525


 Score =   111 bits (278),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 113/239 (47%), Gaps = 9/239 (4%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            + SLL  + ++   + A+  F   R  G+ P     + +L AC   +    GR IH  ++
Sbjct  98   YHSLLRGHAKHSSLDDAVAFFRAMRRAGVRPAVHSFTYLLKACGDRSDLGRGREIHSQLI  157

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
             +    NVF  + +V+MY KC  IE+  R F  MPER+L+ WNA++ GYA  G A  AL+
Sbjct  158  ASGFGSNVFAMTAVVNMYAKCRRIEEARRMFDRMPERDLVAWNAIVSGYAQNGMAERALE  217

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            +   + +      P+ +T V  L AC+  G+++ G  +  A   K G +        +VD
Sbjct  218  MVIRLQKDGHK--PDSITLVSALPACANVGSLKIGKTV-HAFAMKAGFDSLVNVSTALVD  274

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE-----LGKIAADNLFQID  724
            M  + G +E A      M ++  VS W +++     +G  E       K+ AD +   D
Sbjct  275  MYSKRGAIETARLVFDSMRLKNVVS-WNSMIDGYGQNGDAEEALRLFKKMMADGIQATD  332



>ref|XP_010273754.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g11460 [Nelumbo nucifera]
Length=513

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 174/276 (63%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW +++  YEQN     A+K+F + R E +E       S++SACA + A   G+  
Sbjct  216  RNLVSWNAMIGAYEQNGASRDAIKLFRRMRNEKVEFDYITTVSLISACASMGALNTGKWA  275

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H LV    +E NV + + L+DMY KCG IE     F ++P+R++++W A+IG YA  G+ 
Sbjct  276  HELVTSKGLEINVSITNALIDMYAKCGSIESARDVFDKLPKRSVVSWTAMIGAYAAHGYG  335

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF  M  + + + PN  TF  VLTAC  +G VE G   FE+M   Y I PG E  
Sbjct  336  EDALKLFSKM--QEEGIQPNSFTFTAVLTACRHSGLVEEGRKHFESMTRDYLIAPGLEQC  393

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            AC+VD+LGRAG +  AYEFIK +P+ P   VWGALLGACR+HG  EL ++ A++L Q+DP
Sbjct  394  ACMVDLLGRAGRLTEAYEFIKGIPVEPDAGVWGALLGACRIHGNVELAELVAEHLIQLDP  453

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            Q    +V+LSN++A +GRWE+   +R+ MK+  +KK
Sbjct  454  QTVTYYVLLSNIYAEAGRWEDVARLRELMKERELKK  489


 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 123/226 (54%), Gaps = 4/226 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW ++++ Y QN   ++ L VF +    G +P    + S+L AC GL    LG+ I
Sbjct  115  RNIVSWTAMISGYVQNGFYKEGLSVFRRMVASGTQPNAVTLVSILPACGGLEVLNLGKLI  174

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG  VK  V+ +  + + L+ +YGKC  ++     F +M  RNL++WNA+IG Y   G +
Sbjct  175  HGYGVKLGVDSDTPLVNSLISLYGKCRNVDIARSLFDQMVARNLVSWNAMIGAYEQNGAS  234

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ LF  M  + + V  +Y+T V +++AC+  GA+ TG    E +  K G+E      
Sbjct  235  RDAIKLFRRM--RNEKVEFDYITTVSLISACASMGALNTGKWAHELVTSK-GLEINVSIT  291

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
              ++DM  + G +E A +   ++P R  VS W A++GA   HG  E
Sbjct  292  NALIDMYAKCGSIESARDVFDKLPKRSVVS-WTAMIGAYAAHGYGE  336


 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 103/224 (46%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+   W +L+  Y      E+   ++      G+ P  +    V+ +CA L+A   G+ 
Sbjct  13   QRDAFLWNTLIRGYADMGPCEEVFVLYRNMHLSGLLPDNYTFPFVVRSCAVLSALREGKE  72

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  ++K   + +VFV+S LV MY + G  +D E  F EM  RN+++W A+I GY   G 
Sbjct  73   VHCNIIKNGFDSDVFVQSSLVSMYSQSGETKDSESIFDEMIVRNIVSWTAMISGYVQNGF  132

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                L +F  M        PN VT V +L AC     +  G  +      K G++     
Sbjct  133  YKEGLSVFRRMV--ASGTQPNAVTLVSILPACGGLEVLNLG-KLIHGYGVKLGVDSDTPL  189

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               ++ + G+   V+ A     +M  R  VS W A++GA   +G
Sbjct  190  VNSLISLYGKCRNVDIARSLFDQMVARNLVS-WNAMIGAYEQNG  232


 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 85/174 (49%), Gaps = 7/174 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW +++  Y  +  GE ALK+F K +EEGI+P  F  ++VL+AC      E GR 
Sbjct  316  KRSVVSWTAMIGAYAAHGYGEDALKLFSKMQEEGIQPNSFTFTAVLTACRHSGLVEEGRK  375

Query  185  -IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAHQ  358
                +     +   +   + +VD+ G+ G + +       +P E +   W AL+G     
Sbjct  376  HFESMTRDYLIAPGLEQCACMVDLLGRAGRLTEAYEFIKGIPVEPDAGVWGALLGACRIH  435

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTAC-SRAGAVETGMDIFEAMKDK  517
            G+  +A  + E + +    + P  VT+  +L+   + AG  E    + E MK++
Sbjct  436  GNVELAELVAEHLIQ----LDPQTVTYYVLLSNIYAEAGRWEDVARLRELMKER  485



>ref|XP_007147940.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris]
 gb|ESW19934.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris]
Length=611

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 188/277 (68%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V+W S++  +  N    +AL +F +   EG+EP  F V S+LSACA L A ELGR 
Sbjct  201  ERDLVAWNSVINGFALNGRPNEALTLFREMSVEGVEPDGFTVVSLLSACAELGALELGRR  260

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  ++K  + EN +V + L+D+Y KCG I + ++ F EM ERN ++W +LI G A  G 
Sbjct  261  VHVYLLKVGLRENSYVTNSLLDLYAKCGTIREAQQVFGEMSERNAVSWTSLIVGLAVNGF  320

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL+LF++M  + Q +VP+ +TFV VL ACS  G ++ G + F+ M+++YGI P  EH
Sbjct  321  GEEALELFKEM--EGQGLVPSEITFVGVLYACSHCGMLDEGFNYFKRMEEEYGILPRIEH  378

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+L RAG+V++AY++I+ MP++P   +W  LLGAC +HG  +LG+IA  ++ +++
Sbjct  379  YGCMVDLLSRAGLVKQAYKYIQNMPVQPNAVIWRTLLGACTIHGHLDLGEIARSHILKLE  438

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+ SG++V+LSN++AS  RW +  +VR+ M   G+KK
Sbjct  439  PKHSGDYVLLSNLYASERRWSDVQVVRRSMLKDGVKK  475


 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 108/222 (49%), Gaps = 4/222 (2%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N  +W +++  Y ++     AL  + +     +EP       +L A +       G +IH
Sbjct  102  NVFTWNTMIRGYAESQNPSPALHFYRQMTVSCVEPDTHTYPFLLKAISKSLNVREGEAIH  161

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
             + ++   +  VFV++ L+ +Y  CG  E   + F  M ER+L+ WN++I G+A  G  N
Sbjct  162  SVTIRNGFQSLVFVQNSLLHIYAACGYTESAYKVFELMKERDLVAWNSVINGFALNGRPN  221

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
             AL LF +M+   + V P+  T V +L+AC+  GA+E G  +   +  K G+   +    
Sbjct  222  EALTLFREMS--VEGVEPDGFTVVSLLSACAELGALELGRRVHVYLL-KVGLRENSYVTN  278

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
             ++D+  + G +  A +    M  R  VS W +L+    V+G
Sbjct  279  SLLDLYAKCGTIREAQQVFGEMSERNAVS-WTSLIVGLAVNG  319



>ref|XP_010257249.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Nelumbo nucifera]
Length=616

 Score =   259 bits (662),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 174/277 (63%), Gaps = 3/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++N VSW  ++  Y Q    E+AL++F +A  E ++  +F  SSV+  C      ELGR 
Sbjct  207  DKNVVSWSGMIYGYTQLGEDEEALRLFKQALMEDLDVNDFTFSSVIRVCGNSTLLELGRQ  266

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL +K   + + FV S L+ +Y KCG IE   R F E+P +NL  WN+++   A   H
Sbjct  267  IHGLCLKTSFDSSSFVGSSLISLYSKCGVIEGAFRVFDEVPIKNLGMWNSMLIACAQHSH  326

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                  LF  M  +   + PN++TF+CVL ACS AG VE G   F  M++ YGIEPGA+H
Sbjct  327  TQKTFQLFNQM--ENDGIRPNFITFLCVLYACSHAGLVEKGQFYFHLMRE-YGIEPGAQH  383

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YA +VD+LGRAG ++ A   IK MPI PT S+WGALL  CR+HG  EL   AAD +F++ 
Sbjct  384  YASLVDVLGRAGKLQEALSVIKEMPIEPTESIWGALLTGCRIHGNTELAAFAADRVFELG  443

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P   G HV+LSN +A++G+WEEA + RK ++D G+KK
Sbjct  444  PVSPGLHVLLSNAYAAAGKWEEAAMARKMLRDRGMKK  480


 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 118/214 (55%), Gaps = 4/214 (2%)
 Frame = +2

Query  44   YEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEEN  223
            + QN+L   +L++F +  + GI P + +  S   +CA L+ +++G+S+H LVVK   + +
Sbjct  119  FAQNELPLLSLELFREMLDYGIRPDDHIFPSATKSCAVLSRYDIGQSVHSLVVKTGYDSD  178

Query  224  VFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTR  403
            VFV S +VDMY KCG I+D  R F EMP++N+++W+ +I GY   G    AL LF+    
Sbjct  179  VFVGSSMVDMYAKCGEIKDARRMFDEMPDKNVVSWSGMIYGYTQLGEDEEALRLFKQALM  238

Query  404  KTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGM  583
            +  DV  N  TF  V+  C  +  +E G  I   +  K   +  +   + ++ +  + G+
Sbjct  239  EDLDV--NDFTFSSVIRVCGNSTLLELGRQI-HGLCLKTSFDSSSFVGSSLISLYSKCGV  295

Query  584  VERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +E A+     +PI+  + +W ++L AC  H   +
Sbjct  296  IEGAFRVFDEVPIK-NLGMWNSMLIACAQHSHTQ  328



>ref|NP_001062682.1| Os09g0251500 [Oryza sativa Japonica Group]
 dbj|BAD22327.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAD22491.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAF24596.1| Os09g0251500 [Oryza sativa Japonica Group]
 dbj|BAG99625.1| unnamed protein product [Oryza sativa Japonica Group]
Length=877

 Score =   264 bits (675),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 180/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            ++  S++    Q D GE A+K+F++   +G+EP  F++SS+L+ACA L+A+E G+ +H  
Sbjct  471  IAVTSMITALSQCDHGEGAIKLFMEMLRKGLEPDPFVLSSLLNACASLSAYEQGKQVHAH  530

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     + F  + LV  Y KCG IED E AF  +PER +++W+A+IGG A  GH   A
Sbjct  531  LIKRQFMSDAFAGNALVYTYAKCGSIEDAELAFSSLPERGVVSWSAMIGGLAQHGHGKRA  590

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LF  M    + + PN++T   VL AC+ AG V+     F +MK+ +GI+   EHY+C+
Sbjct  591  LELFGRMV--DEGINPNHITMTSVLCACNHAGLVDEAKRYFNSMKEMFGIDRTEEHYSCM  648

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG ++ A E +  MP +   SVWGALLGA RVH  PELGK+AA+ LF ++P+ S
Sbjct  649  IDLLGRAGKLDDAMELVNSMPFQANASVWGALLGASRVHKDPELGKLAAEKLFILEPEKS  708

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N +ASSG W E   VRK MKD  IKK
Sbjct  709  GTHVLLANTYASSGMWNEVAKVRKLMKDSNIKK  741


 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 138/271 (51%), Gaps = 12/271 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  L++ Y +ND    A++VF +    GI+PTEF  S V++AC G    + GR 
Sbjct  164  ERNAVSWNGLMSAYVKNDQCGDAIQVFGEMVWSGIQPTEFGFSCVVNACTGSRNIDAGRQ  223

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +VV+   E++VF  + LVDMY K G ++     F +MP+ ++++WNALI G    GH
Sbjct  224  VHAMVVRMGYEKDVFTANALVDMYVKMGRVDIASVIFEKMPDSDVVSWNALISGCVLNGH  283

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A++L   M  K+  +VPN      +L AC+ AGA + G  I   M         ++ 
Sbjct  284  DHRAIELLLQM--KSSGLVPNVFMLSSILKACAGAGAFDLGRQIHGFM---IKANADSDD  338

Query  545  YACV--VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            Y  V  VDM  +   ++ A +    M  R  + +W AL+  C   G+ +    A    + 
Sbjct  339  YIGVGLVDMYAKNHFLDDAMKVFDWMSHRDLI-LWNALISGCSHGGRHDE---AFSIFYG  394

Query  719  IDPQDSG-NHVILSNMFASSGRWEEANLVRK  808
            +  +  G N   L+ +  S+   E A+  R+
Sbjct  395  LRKEGLGVNRTTLAAVLKSTASLEAASATRQ  425


 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 93/170 (55%), Gaps = 3/170 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +L++    N    +A+++ L+ +  G+ P  FM+SS+L ACAG  AF+LGR IHG 
Sbjct  269  VSWNALISGCVLNGHDHRAIELLLQMKSSGLVPNVFMLSSILKACAGAGAFDLGRQIHGF  328

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++KA  + + ++   LVDMY K   ++D  + F  M  R+LI WNALI G +H G  + A
Sbjct  329  MIKANADSDDYIGVGLVDMYAKNHFLDDAMKVFDWMSHRDLILWNALISGCSHGGRHDEA  388

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
              +F  + ++   V  N  T   VL + +   A      +  A+ +K G 
Sbjct  389  FSIFYGLRKEGLGV--NRTTLAAVLKSTASLEAASATRQV-HALAEKIGF  435


 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 106/221 (48%), Gaps = 8/221 (4%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW SL+  Y  N L   A++ F   R EG+   EF +  VL  C   A  +LG  +H +
Sbjct  69   VSWSSLVTAYSNNGLPRSAIQAFHGMRAEGVCCNEFALPVVLK-CVPDA--QLGAQVHAM  125

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEM-PERNLITWNALIGGYAHQGHANM  373
             +      +VFV + LV MYG  G ++D  R F E   ERN ++WN L+  Y        
Sbjct  126  AMATGFGSDVFVANALVAMYGGFGFMDDARRVFDEAGSERNAVSWNGLMSAYVKNDQCGD  185

Query  374  ALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYAC  553
            A+ +F +M      + P    F CV+ AC+ +  ++ G  +  AM  + G E        
Sbjct  186  AIQVFGEMV--WSGIQPTEFGFSCVVNACTGSRNIDAGRQV-HAMVVRMGYEKDVFTANA  242

Query  554  VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            +VDM  + G V+ A    ++MP    VS W AL+  C ++G
Sbjct  243  LVDMYVKMGRVDIASVIFEKMPDSDVVS-WNALISGCVLNG  282


 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/278 (26%), Positives = 124/278 (45%), Gaps = 13/278 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             R+ + W +L++        ++A  +F   R+EG+      +++VL + A L A    R 
Sbjct  366  HRDLILWNALISGCSHGGRHDEAFSIFYGLRKEGLGVNRTTLAAVLKSTASLEAASATRQ  425

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L  K     +  V + L+D Y KC C+ D  R F E    ++I   ++I   +   H
Sbjct  426  VHALAEKIGFIFDAHVVNGLIDSYWKCSCLSDAIRVFEECSSGDIIAVTSMITALSQCDH  485

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF +M RK  +  P+      +L AC+   A E G  +   +  +  +      
Sbjct  486  GEGAIKLFMEMLRKGLE--PDPFVLSSLLNACASLSAYEQGKQVHAHLIKRQFMSDAFAG  543

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF--Q  718
             A +V    + G +E A      +P R  VS W A++G    HG    GK A + LF   
Sbjct  544  NA-LVYTYAKCGSIEDAELAFSSLPERGVVS-WSAMIGGLAQHGH---GKRALE-LFGRM  597

Query  719  IDPQDSGNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
            +D   + NH+ ++++  +   +G  +EA      MK++
Sbjct  598  VDEGINPNHITMTSVLCACNHAGLVDEAKRYFNSMKEM  635


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 4/117 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAAFELG  178
            ER  VSW +++    Q+  G++AL++F +  +EGI P    ++SVL AC  AGL   E  
Sbjct  568  ERGVVSWSAMIGGLAQHGHGKRALELFGRMVDEGINPNHITMTSVLCACNHAGLVD-EAK  626

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGG  346
            R  + +     ++      S ++D+ G+ G ++D       MP + N   W AL+G 
Sbjct  627  RYFNSMKEMFGIDRTEEHYSCMIDLLGRAGKLDDAMELVNSMPFQANASVWGALLGA  683



>ref|XP_010273504.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X2 [Nelumbo nucifera]
Length=756

 Score =   262 bits (669),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 185/278 (67%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +E+N VSW SL++ + QN L    L+ F+    EG +P +   +S LSACA LAA ++G+
Sbjct  417  EEKNIVSWNSLISGFTQNGLYMDGLRHFVLMGREGKKPDQSTFASSLSACANLAALQIGK  476

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             IH LVVK     ++FV + L+ MY KCG I   E+ F ++   ++I+WN+LI GYA  G
Sbjct  477  QIHHLVVKIGYVNDLFVGNALITMYAKCGRILSAEQVFNDIDNTDIISWNSLISGYAFNG  536

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            +   A+ LF++M   T+ + P+ VTFV +L+ACS AG ++ G+ +F+ M +KY IEP AE
Sbjct  537  YGKDAIQLFQEML--TEGLNPDQVTFVGLLSACSHAGLIDEGLKLFKYMTEKYCIEPLAE  594

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC+VD+LGRAG +E AY+ +  MPI+     WGALLGACR+H   +LGK+AA+ L + 
Sbjct  595  HYACIVDLLGRAGRLEEAYQLVMEMPIKANAGTWGALLGACRLHKNLKLGKLAAEKLLEF  654

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +P  + N+V+LSN+ A +G W E   VR  MK+ G++K
Sbjct  655  EPYKTSNYVLLSNIHAEAGSWNEVEKVRMLMKEKGVEK  692


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 75/155 (48%), Gaps = 11/155 (7%)
 Frame = +2

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            + ++    N    + ++  Y K G I D    F +MP RNL++WN +I GY H    + A
Sbjct  39   IFESMTSRNTVTWNSMISAYAKNGRINDARNLFEQMPLRNLVSWNTMISGYLHNDKVHEA  98

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
             +LFE M+R+      +  ++  ++T  +R G +E    +F+ + DK    P    +  +
Sbjct  99   AELFERMSRR------DLFSWTLMITCYTRNGELEKARILFDQLPDKRS--PVC--WNAM  148

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
            +    + G  E A     +MP+R  VS W ++L A
Sbjct  149  IAGYAKNGRFEDARRLFDKMPVRNLVS-WNSMLAA  182


 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/217 (23%), Positives = 93/217 (43%), Gaps = 19/217 (9%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW ++++ Y  ND   +A ++F +     +     M++          A  L   +
Sbjct  77   RNLVSWNTMISGYLHNDKVHEAAELFERMSRRDLFSWTLMITCYTRNGELEKARILFDQL  136

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
                   C        + ++  Y K G  ED  R F +MP RNL++WN+++  Y      
Sbjct  137  PDKRSPVC-------WNAMIAGYAKNGRFEDARRLFDKMPVRNLVSWNSMLAAYIQNEEM  189

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
             +ALD F+ M+ +      + V++  V+    + G +++ M  F+ +       P    +
Sbjct  190  GLALDFFDKMSER------DVVSWNLVIDGFMQIGDLDSAMQFFQRIPS-----PNVISW  238

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              ++    R   ++ A     +MP+R  VS W A++ 
Sbjct  239  VTMLSGFARYSRIDEARRIFDQMPMRNVVS-WNAMIS  274


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 76/170 (45%), Gaps = 14/170 (8%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW S+LA Y QN+    AL  F K  E  +     ++   +      +A +  + I
Sbjct  171  RNLVSWNSMLAAYIQNEEMGLALDFFDKMSERDVVSWNLVIDGFMQIGDLDSAMQFFQRI  230

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
                       NV     ++  + +   I++  R F +MP RN+++WNA+I GY      
Sbjct  231  PS--------PNVISWVTMLSGFARYSRIDEARRIFDQMPMRNVVSWNAMISGYVLNYQI  282

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDK  517
            + A+ LFE MT K      N V++  ++    R G +E   ++   M  K
Sbjct  283  DEAIILFEQMTEK------NAVSWTTMINGYVRIGKLEKARELLNLMPYK  326


 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 121/271 (45%), Gaps = 23/271 (8%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+R+ V W +++A Y +N   E A ++F K       P   +VS      A +   E+G 
Sbjct  138  DKRSPVCWNAMIAGYAKNGRFEDARRLFDKM------PVRNLVSWNSMLAAYIQNEEMGL  191

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            ++         E +V   ++++D + + G ++   + F  +P  N+I+W  ++ G+A   
Sbjct  192  ALD--FFDKMSERDVVSWNLVIDGFMQIGDLDSAMQFFQRIPSPNVISWVTMLSGFARYS  249

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              + A  +F+ M  +      N V++  +++       ++  + +FE M +K      A 
Sbjct  250  RIDEARRIFDQMPMR------NVVSWNAMISGYVLNYQIDEAIILFEQMTEK-----NAV  298

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
             +  +++   R G +E+A E +  MP +   +    + G  +     E  +I      ++
Sbjct  299  SWTTMINGYVRIGKLEKARELLNLMPYKNVAAQTAMISGYIQTMQMEEARQI----FDEM  354

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEM  814
            D +D      +   +A  GR +EAN + K+M
Sbjct  355  DTRDIACWNTMIAGYAQCGRMDEANKLFKQM  385


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 86/194 (44%), Gaps = 21/194 (11%)
 Frame = +2

Query  224  VFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTR  403
            VF ++  +   GK G I +  + F  M  RN +TWN++I  YA  G  N A +LFE M  
Sbjct  17   VFYQNQKITQLGKSGKINEAIKIFESMTSRNTVTWNSMISAYAKNGRINDARNLFEQMPL  76

Query  404  KTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM--KDKYGIEPGAEHYACVVDMLGRA  577
            +      N V++  +++       V    ++FE M  +D +        +  ++    R 
Sbjct  77   R------NLVSWNTMISGYLHNDKVHEAAELFERMSRRDLFS-------WTLMITCYTRN  123

Query  578  GMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNHVILS  757
            G +E+A     ++P + +   W A++     +G+ E     A  LF  D     N V  +
Sbjct  124  GELEKARILFDQLPDKRSPVCWNAMIAGYAKNGRFE----DARRLF--DKMPVRNLVSWN  177

Query  758  NMFASSGRWEEANL  799
            +M A+  + EE  L
Sbjct  178  SMLAAYIQNEEMGL  191


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 82/183 (45%), Gaps = 15/183 (8%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N VSW +++  Y +    EKA ++      + +     M+S  +         E  R 
Sbjct  294  EKNAVSWTTMINGYVRIGKLEKARELLNLMPYKNVAAQTAMISGYIQTMQ----MEEARQ  349

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            I           ++   + ++  Y +CG +++  + F +M  +N+ITWN +I GYA  G 
Sbjct  350  I----FDEMDTRDIACWNTMIAGYAQCGRMDEANKLFKQMFRKNIITWNTVIAGYAQGGE  405

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N AL +FE M  K      N V++  +++  ++ G    G+  F  M  + G +P    
Sbjct  406  MNKALRIFEKMEEK------NIVSWNSLISGFTQNGLYMDGLRHFVLM-GREGKKPDQST  458

Query  545  YAC  553
            +A 
Sbjct  459  FAS  461



>gb|KDP38705.1| hypothetical protein JCGZ_04058 [Jatropha curcas]
Length=791

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 174/273 (64%), Gaps = 2/273 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
             E+   SW +++A Y QN L E A+ +F + +   I P    V+S+LSACA L A  LG+
Sbjct  380  SEKTLASWNAMIAGYTQNGLTETAISLFREMQMSNISPNPITVASILSACAQLGALSLGK  439

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HGL+     E N++V + L+DMY KCG I +  + F  MP +N +TWNA+I GY   G
Sbjct  440  WVHGLIKGKSFESNIYVSTALIDMYAKCGSILEARQLFDLMPLKNEVTWNAMISGYGLHG  499

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            H   AL LF DM      + P  VTF+ VL ACS AG V  G ++F  M   +G EP AE
Sbjct  500  HGQRALRLFYDMLE--SGIPPTRVTFLSVLYACSHAGLVRDGNEVFHCMVHDFGFEPLAE  557

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC+VD+LGRAG +E A EFIK+MP+ P   VWGALLGAC +H   +L  +A++ LF++
Sbjct  558  HYACMVDILGRAGRLEHALEFIKKMPVEPGPPVWGALLGACMIHKDTKLASMASEKLFEL  617

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKD  820
            DPQ+ G +V++SN++++   + +A LVR+  K+
Sbjct  618  DPQNMGYYVLMSNIYSTERNYPQAALVRQTAKN  650


 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 105/224 (47%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             ++ +S  ++++ +  N   E ++++F +    G +     +  ++  C       L   
Sbjct  280  RKDLISCNAMISGFTSNGDTESSVRLFQEWLSSGEKVNSSSIVGLIPVCFPFGHLSLTNC  339

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  VK+    +  V + L  +Y +   +E   + F E  E+ L +WNA+I GY   G 
Sbjct  340  IHGFCVKSGTASHSSVSTALTTVYSRLNEMESARQLFDESSEKTLASWNAMIAGYTQNGL  399

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF +M  +  ++ PN +T   +L+AC++ GA+  G  +   +K K   E     
Sbjct  400  TETAISLFREM--QMSNISPNPITVASILSACAQLGALSLGKWVHGLIKGK-SFESNIYV  456

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               ++DM  + G +  A +    MP++  V+ W A++    +HG
Sbjct  457  STALIDMYAKCGSILEARQLFDLMPLKNEVT-WNAMISGYGLHG  499


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/220 (22%), Positives = 85/220 (39%), Gaps = 31/220 (14%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP  307
            V +VL A A L    LG  I  L +K     ++ V + L+ +Y KCG +      F ++ 
Sbjct  220  VIAVLPAVAELQELRLGMGIQCLTIKRGFHSHISVLTDLISLYSKCGDVGTASILFRDIG  279

Query  308  ERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDV-------------------VPNY  430
             ++LI+ NA+I G+   G    ++ LF++     + V                   + N 
Sbjct  280  RKDLISCNAMISGFTSNGDTESSVRLFQEWLSSGEKVNSSSIVGLIPVCFPFGHLSLTNC  339

Query  431  VTFVCVLTACSRAGAVETGMDI-------FEAMKDKY--GIEPGAEHYACVVDMLGRAGM  583
            +   CV +  +   +V T +          E+ +  +    E     +  ++    + G+
Sbjct  340  IHGFCVKSGTASHSSVSTALTTVYSRLNEMESARQLFDESSEKTLASWNAMIAGYTQNGL  399

Query  584  VERAYEFIKRMP---IRPTVSVWGALLGACRVHGKPELGK  694
             E A    + M    I P      ++L AC   G   LGK
Sbjct  400  TETAISLFREMQMSNISPNPITVASILSACAQLGALSLGK  439


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 78/176 (44%), Gaps = 12/176 (7%)
 Frame = +2

Query  53   NDLGEKALKVFLKAREEG-IEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVF  229
            N+    A+ +F   R+   + P  F  + ++SA        +G  +HG  +      +++
Sbjct  92   NNSPLSAISIFTHLRKSTDLYPDNFTYAFIISAATSFGDMRVGLVLHGKGIVDGFGSDLY  151

Query  230  VRSVLVDMYGKCGCIED-CERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRK  406
            V S LVDMY K  C +D   + F  +P R+ +  N +I G +       +++LF+DM   
Sbjct  152  VGSALVDMYFKL-CRDDLAHKVFDGLPHRDTVLCNTMISGLSRMCCFEGSINLFKDMVSG  210

Query  407  TQDVVPNY--VTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDML  568
                 P +   T + VL A +    +  GM I + +  K G      H + + D++
Sbjct  211  NG---PRFDSTTVIAVLPAVAELQELRLGMGI-QCLTIKRGFH---SHISVLTDLI  259



>ref|XP_002316490.2| hypothetical protein POPTR_0010s24750g [Populus trichocarpa]
 gb|EEF02661.2| hypothetical protein POPTR_0010s24750g [Populus trichocarpa]
Length=522

 Score =   256 bits (655),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 181/277 (65%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN V+W S++A + QN+L E+ L +F + +E G+E  +FM+SSV+ ACAGLAA   GR 
Sbjct  192  ERNDVTWSSIVAGFVQNELYEEGLVLFARGKEMGLENNQFMISSVIRACAGLAALIEGRQ  251

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +V +     N FV S LVDMY KCG IE+    F  + ++N++ WNA+I G+A    
Sbjct  252  VHAIVCRTGFGPNNFVASALVDMYAKCGSIEEAYVLFCNIEKKNVVLWNAIISGFAKHAC  311

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            ++  ++LFE+M +      P+ VT+V VL+AC   G V+ G   F+ M  ++ + P   H
Sbjct  312  SSEVMNLFEEMQQTGMQ--PDEVTYVAVLSACVHVGLVDKGRSYFDLMTREHNVSPNVLH  369

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y+C+VD+LGR G+V  A+E + +MP   T S+WG+LL +CR+HG  EL +IAA NLF+++
Sbjct  370  YSCMVDILGRGGLVHEAHELMTKMPFAATASMWGSLLASCRIHGNLELAEIAAKNLFEME  429

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P   GN+V+L+N +A+S +WEEA   RK +K   I K
Sbjct  430  PDRGGNYVLLANTYAASKKWEEAAKARKSLKGSEILK  466


 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 111/224 (50%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ VSW  ++    QN   EKA+ +FL+ + EG   +EF VSSV+ ACA        R 
Sbjct  91   ERSMVSWNIMIGTCVQNGEEEKAIDIFLEMQREGSPCSEFTVSSVVCACAAKGDVFFCRQ  150

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   +KA V+ +VFV + L+D+Y KCG IED    F  MPERN +TW++++ G+     
Sbjct  151  LHAFAIKAVVDADVFVGTSLIDVYAKCGSIEDASCVFEGMPERNDVTWSSIVAGFVQNEL  210

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                L LF     K   +  N      V+ AC+   A+  G  +  A+  + G  P    
Sbjct  211  YEEGLVLFA--RGKEMGLENNQFMISSVIRACAGLAALIEGRQV-HAIVCRTGFGPNNFV  267

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
             + +VDM  + G +E AY     +  +  V +W A++     H 
Sbjct  268  ASALVDMYAKCGSIEEAYVLFCNIE-KKNVVLWNAIISGFAKHA  310


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 87/177 (49%), Gaps = 4/177 (2%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP  307
            + S+L  CA       G++ HG V++  +E +    ++L++MY KCG I    + F E+P
Sbjct  31   LHSLLQFCAKNREPITGKACHGQVIRLGLETDTLTSNMLMNMYSKCGLIRRACKVFDEIP  90

Query  308  ERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETG  487
            ER++++WN +IG     G    A+D+F +M R+      +  T   V+ AC+  G V   
Sbjct  91   ERSMVSWNIMIGTCVQNGEEEKAIDIFLEMQREGSPC--SEFTVSSVVCACAAKGDVFFC  148

Query  488  MDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              +  A   K  ++        ++D+  + G +E A    + MP R  V+ W +++ 
Sbjct  149  RQL-HAFAIKAVVDADVFVGTSLIDVYAKCGSIEDASCVFEGMPERNDVT-WSSIVA  203


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 70/146 (48%), Gaps = 2/146 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +++N V W ++++ + ++    + + +F + ++ G++P E    +VLSAC  +   + GR
Sbjct  292  EKKNVVLWNAIISGFAKHACSSEVMNLFEEMQQTGMQPDEVTYVAVLSACVHVGLVDKGR  351

Query  182  SIHGLVVKA-CVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAH  355
            S   L+ +   V  NV   S +VD+ G+ G + +      +MP       W +L+     
Sbjct  352  SYFDLMTREHNVSPNVLHYSCMVDILGRGGLVHEAHELMTKMPFAATASMWGSLLASCRI  411

Query  356  QGHANMALDLFEDMTRKTQDVVPNYV  433
             G+  +A    +++     D   NYV
Sbjct  412  HGNLELAEIAAKNLFEMEPDRGGNYV  437



>gb|EMT03352.1| hypothetical protein F775_15521 [Aegilops tauschii]
Length=446

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 182/276 (66%), Gaps = 1/276 (0%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ V+W ++L  Y QN +  KAL+VF +    G+   E  ++  +SACA L A      +
Sbjct  35   KDMVAWTAMLTGYAQNSMPAKALEVFDRMATIGMGIDEVSLTGAISACAQLGAVRRAAWV  94

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
              +  +    +NV V S LVDMY KCG I++    F  M E+N+ T++++I G A  G A
Sbjct  95   QEIAERNGFGQNVIVGSGLVDMYAKCGLIDEARSVFDGMQEKNVYTYSSMIVGLASHGRA  154

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ LF+DM R+  DVVPN+VTF+ +LTACS AG V  G   F  MKDKYGI P A+HY
Sbjct  155  KEAIALFKDMVRRA-DVVPNHVTFIGLLTACSHAGMVRDGHFYFAQMKDKYGILPSADHY  213

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
             C+VD+LGRAG+V+ A + ++ M + P   VWGALLGACR+HG  ++ K+AA++LF+++P
Sbjct  214  TCMVDLLGRAGLVDEALDLVRSMIVEPHGGVWGALLGACRIHGNTDVAKVAAEHLFKLEP  273

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +  GN+V+LSN  AS+G+W+E + VRK M+  G+KK
Sbjct  274  EGIGNYVLLSNTLASAGKWDEVSKVRKLMRTRGLKK  309



>gb|KGN58242.1| hypothetical protein Csa_3G598390 [Cucumis sativus]
Length=659

 Score =   260 bits (664),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 177/274 (65%), Gaps = 3/274 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFL-KAREEGIEPTEFMVSSVLSACAGLAAFELG  178
            +E++ +SW S++AVY Q+ L  +AL+VF    R  G+      +S+VL ACA   A   G
Sbjct  247  EEKDDISWNSMIAVYAQSGLSGEALEVFHGMVRHVGVRYNAVTLSAVLLACAHAGALRAG  306

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            + IH  V+K  +E NV V + ++DMY KCG +E  ++ F  M E+N+ +W A++ GY   
Sbjct  307  KCIHDQVIKMDLEYNVCVGTSIIDMYCKCGRVEMAKKTFDRMKEKNVKSWTAMVAGYGMH  366

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G A  ALD+F  M R    V PNY+TFV VL ACS AG VE G   F AMK KY IEPG 
Sbjct  367  GRAKEALDIFYKMVR--AGVKPNYITFVSVLAACSHAGLVEEGWHWFNAMKHKYDIEPGI  424

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            EHY C+VD+ GRAG +  AY  IKRM ++P   VWG+LLGACR+H   +LG+IAA  LF+
Sbjct  425  EHYGCMVDLFGRAGCLNEAYNLIKRMKMKPDFVVWGSLLGACRIHKNVDLGEIAAQKLFE  484

Query  719  IDPQDSGNHVILSNMFASSGRWEEANLVRKEMKD  820
            +DP + G +V+LSN++A +GRW +   +R  MK+
Sbjct  485  LDPDNCGYYVLLSNLYADAGRWADVERMRMLMKN  518


 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 121/238 (51%), Gaps = 19/238 (8%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIE-------PTEFMVS-SVLSACAGLA  163
            RN VSW S++  Y QN+  + AL +F    EE  E       P + +V  SVLSAC+ ++
Sbjct  140  RNVVSWTSMITGYVQNEQADNALLLFKDFLEEETEVEDGNNVPLDSVVMVSVLSACSRVS  199

Query  164  AFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIG  343
               +   +HG VVK   + ++ V + L+D Y KCG     ++ F  M E++ I+WN++I 
Sbjct  200  GKGITEGVHGFVVKKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIA  259

Query  344  GYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYG  523
             YA  G +  AL++F  M R    V  N VT   VL AC+ AGA+  G  I + +     
Sbjct  260  VYAQSGLSGEALEVFHGMVRHV-GVRYNAVTLSAVLLACAHAGALRAGKCIHDQV-----  313

Query  524  IEPGAEHYACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            I+   E+  CV    +DM  + G VE A +   RM     V  W A++    +HG+ +
Sbjct  314  IKMDLEYNVCVGTSIIDMYCKCGRVEMAKKTFDRMK-EKNVKSWTAMVAGYGMHGRAK  370


 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 141/325 (43%), Gaps = 55/325 (17%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D+ N  SW S++A   +     +AL+ F   R+ G+ PT       + +C+ L     GR
Sbjct  37   DKSNVHSWNSVIADLARGGDSVEALRAFSSLRKLGLIPTRSSFPCTIKSCSALCDLVSGR  96

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
              H        E ++FV S L+DMY KCG ++D    F E+P RN+++W ++I GY    
Sbjct  97   MSHQQAFVFGFETDLFVSSALIDMYSKCGQLKDARALFDEIPLRNVVSWTSMITGYVQNE  156

Query  362  HANMALDLFEDMTRKTQDV-----VP-NYVTFVCVLTACSRAGA-----------VETGM  490
             A+ AL LF+D   +  +V     VP + V  V VL+ACSR              V+ G 
Sbjct  157  QADNALLLFKDFLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFVVKKGF  216

Query  491  D------------------------IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAY  598
            D                        +F+ M++K  I      +  ++ +  ++G+   A 
Sbjct  217  DGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDIS-----WNSMIAVYAQSGLSGEAL  271

Query  599  E----FIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS---GNHVILS  757
            E     ++ + +R       A+L AC   G    GK   D + ++D + +   G  +I  
Sbjct  272  EVFHGMVRHVGVRYNAVTLSAVLLACAHAGALRAGKCIHDQVIKMDLEYNVCVGTSII--  329

Query  758  NMFASSGRWEEANLVRKEMKDIGIK  832
            +M+   GR E A      MK+  +K
Sbjct  330  DMYCKCGRVEMAKKTFDRMKEKNVK  354



>ref|XP_010268183.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59200, chloroplastic [Nelumbo nucifera]
Length=630

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 187/276 (68%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ V W +++  + +N    KAL++F + + +G+ P E  +  VLS+C+ L A ELG+ I
Sbjct  221  KDTVCWTAMIDGFVRNGEMNKALELFREMQRDGVRPNEVTIVCVLSSCSQLGALELGKWI  280

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  V K  ++ N FVRS L+ MY +CG +++ ++ F EM E++++T+N++I G A  G +
Sbjct  281  HSYVGKYNIKLNQFVRSALISMYSRCGSLDEAQKLFVEMVEKDVVTYNSMIVGLAMHGRS  340

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            + A++LF++M +  Q + P Y+TFV VL ACS  G V+ G  IF +M   YGIEP  EHY
Sbjct  341  SEAIELFQEMVK--QGLKPTYITFVGVLNACSHGGLVDLGFKIFHSMTRDYGIEPRIEHY  398

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
             C+VD+LGR G +E AY+FI RM + P   +WGALL AC++HG  +LG++AA  L +   
Sbjct  399  GCMVDLLGRVGHLEEAYDFIGRMRVAPDHIIWGALLSACKIHGNLKLGELAAKILVEGGA  458

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSG +V+LSN++ASSG+WEEA  VR +MK+ GI+K
Sbjct  459  ADSGTYVLLSNVYASSGKWEEAARVRAKMKESGIQK  494


 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 114/247 (46%), Gaps = 39/247 (16%)
 Frame = +2

Query  71   ALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVD  250
             ++ + +   E +EP  + ++S+L AC    A + GR +HG V+K  +  N  VR  L++
Sbjct  110  GIRAYSRMVGEFVEPDPYAITSILKACGYKLALKEGREVHGRVLKLQLNSNRLVRMKLME  169

Query  251  MYGKCGCIEDCERAFYEMPE-------------------------------RNLITWNAL  337
             YGKCG   D  + F EMPE                               ++ + W A+
Sbjct  170  FYGKCGEFRDARQVFDEMPEGDVVASTVMISCYVNHGLINDAYALFYQVPVKDTVCWTAM  229

Query  338  IGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDK  517
            I G+   G  N AL+LF +M R    V PN VT VCVL++CS+ GA+E G  I  +   K
Sbjct  230  IDGFVRNGEMNKALELFREMQR--DGVRPNEVTIVCVLSSCSQLGALELGKWI-HSYVGK  286

Query  518  YGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKI  697
            Y I+      + ++ M  R G ++ A +    M +   V  + +++    +HG+      
Sbjct  287  YNIKLNQFVRSALISMYSRCGSLDEAQKLFVEM-VEKDVVTYNSMIVGLAMHGRSS----  341

Query  698  AADNLFQ  718
             A  LFQ
Sbjct  342  EAIELFQ  348



>ref|XP_009412103.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Musa acuminata subsp. malaccensis]
Length=926

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 181/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ SL+  + Q+  GE+A+KVF +   + ++P  F+ SS+L+ACA L+A+E G+ IH  
Sbjct  520  VAFTSLITAHSQSGQGEEAIKVFCEMLNQDLKPDSFVCSSLLNACASLSAYEQGKQIHVH  579

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            V+K     +VF  + LV+MY KCG +ED   AF E+PER +++W+A+IGG A  GH   A
Sbjct  580  VLKMGFMYDVFAGNALVNMYAKCGSVEDATLAFSEIPERGIVSWSAMIGGLAQHGHGKKA  639

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            LDLF  M    + + PN++T   VL AC+ AG ++     F+ M++ YG++   EHYAC+
Sbjct  640  LDLFSKML--DEGLSPNHITLTSVLCACNHAGLIDEAKQYFDLMEEMYGVQRTQEHYACM  697

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +  A E + RMP     SVWGALLGA RVHG  ELGK AA+ LF ++P+ S
Sbjct  698  IDLLGRAGRLNEAMELVHRMPFEANASVWGALLGASRVHGNIELGKQAAEMLFALEPEKS  757

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+NM+AS+  W+    VR+ MKD  +KK
Sbjct  758  GTHVLLANMYASASMWDNVAKVRRLMKDSRVKK  790


 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/307 (30%), Positives = 142/307 (46%), Gaps = 40/307 (13%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW   +A    +    +AL + ++ +  G+ P  F +SSVL ACAG    +LG  IHG 
Sbjct  318  VSWNCFIAGCVLHGHDSRALALLVEMKASGMVPNVFTLSSVLKACAGTGMLDLGMQIHGN  377

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++KA  + + FV   LVDMY KC C++D  +AFY +PE++LI+WNALI G +H G  + A
Sbjct  378  LIKAGSDSDSFVGVGLVDMYAKCNCLDDAMKAFYLIPEQDLISWNALISGCSHSGSDDEA  437

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE---------------TGMDIFEAMK  511
            L  F +M R+  +   N  T   VL + +   A+                +   +   + 
Sbjct  438  LACFSEMRREGLNF--NRTTLSAVLKSTASLQAITVTKQVHGLATRAGFLSDPHVVNGLV  495

Query  512  DKYGI-----EPGAEHYAC----------VVDMLGRAGMVERAYEFIKRM---PIRPTVS  637
            D YG      E G     C          ++    ++G  E A +    M    ++P   
Sbjct  496  DAYGKCSCLEEAGRVFEECQSGDVVAFTSLITAHSQSGQGEEAIKVFCEMLNQDLKPDSF  555

Query  638  VWGALLGACRVHGKPELGKIAADNLFQIDPQD---SGNHVILSNMFASSGRWEEANLVRK  808
            V  +LL AC      E GK    ++ ++       +GN ++  NM+A  G  E+A L   
Sbjct  556  VCSSLLNACASLSAYEQGKQIHVHVLKMGFMYDVFAGNALV--NMYAKCGSVEDATLAFS  613

Query  809  EMKDIGI  829
            E+ + GI
Sbjct  614  EIPERGI  620


 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/227 (31%), Positives = 113/227 (50%), Gaps = 4/227 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW  LLA   +N+  E+A+ +F +   +G+ P EF  S +L+AC G      GR+
Sbjct  213  DRNSVSWNGLLAGCVRNERFEEAVSLFQEMVMDGMRPNEFGFSCILNACTGSQDLSCGRA  272

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG + +     + F  + LVDMY K G  +     F ++   ++++WN  I G    GH
Sbjct  273  VHGYLTRLGYHSDPFTTNALVDMYAKLGNAKAAAMVFGKIARPDIVSWNCFIAGCVLHGH  332

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL L  +M  K   +VPN  T   VL AC+  G ++ GM I   +  K G +  +  
Sbjct  333  DSRALALLVEM--KASGMVPNVFTLSSVLKACAGTGMLDLGMQIHGNLI-KAGSDSDSFV  389

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
               +VDM  +   ++ A +    +P +  +S W AL+  C   G  +
Sbjct  390  GVGLVDMYAKCNCLDDAMKAFYLIPEQDLIS-WNALISGCSHSGSDD  435


 Score =   112 bits (281),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 105/220 (48%), Gaps = 4/220 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            +SW +L++ Y  N LG +AL  F K R  G+   EF + SVL AC+  + F  G  +H  
Sbjct  116  ISWSALISAYSNNGLGREALLSFRKMRCLGVRSNEFTLPSVLKACSVSSDFIAGTLVHAF  175

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            V+    E +VFV + LV MY   G + D +R F  + +RN ++WN L+ G         A
Sbjct  176  VIVTGFESDVFVANTLVVMYANFGLLLDSKRLFDGITDRNSVSWNGLLAGCVRNERFEEA  235

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + LF++M      + PN   F C+L AC+ +  +  G  +   +  + G          +
Sbjct  236  VSLFQEMV--MDGMRPNEFGFSCILNACTGSQDLSCGRAVHGYLT-RLGYHSDPFTTNAL  292

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            VDM  + G  + A     ++  RP +  W   +  C +HG
Sbjct  293  VDMYAKLGNAKAAAMVFGKIA-RPDIVSWNCFIAGCVLHG  331


 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 130/261 (50%), Gaps = 20/261 (8%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ +SW +L++    +   ++AL  F + R EG+      +S+VL + A L A  + + 
Sbjct  415  EQDLISWNALISGCSHSGSDDEALACFSEMRREGLNFNRTTLSAVLKSTASLQAITVTKQ  474

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGL  +A    +  V + LVD YGKC C+E+  R F E    +++ + +LI  ++  G 
Sbjct  475  VHGLATRAGFLSDPHVVNGLVDAYGKCSCLEEAGRVFEECQSGDVVAFTSLITAHSQSGQ  534

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFE---AMKDKYGIE  529
               A+ +F +M    QD+ P+  +FVC  +L AC+   A E G  I      M   Y + 
Sbjct  535  GEEAIKVFCEML--NQDLKPD--SFVCSSLLNACASLSAYEQGKQIHVHVLKMGFMYDVF  590

Query  530  PGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADN  709
             G      +V+M  + G VE A      +P R  VS W A++G    HG    GK A D 
Sbjct  591  AG----NALVNMYAKCGSVEDATLAFSEIPERGIVS-WSAMIGGLAQHGH---GKKALD-  641

Query  710  LFQ--IDPQDSGNHVILSNMF  766
            LF   +D   S NH+ L+++ 
Sbjct  642  LFSKMLDEGLSPNHITLTSVL  662


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 16/133 (12%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGL-----A  163
            ER  VSW +++    Q+  G+KAL +F K  +EG+ P    ++SVL AC  AGL      
Sbjct  617  ERGIVSWSAMIGGLAQHGHGKKALDLFSKMLDEGLSPNHITLTSVLCACNHAGLIDEAKQ  676

Query  164  AFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALI  340
             F+L   ++G      V+      + ++D+ G+ G + +     + MP E N   W AL+
Sbjct  677  YFDLMEEMYG------VQRTQEHYACMIDLLGRAGRLNEAMELVHRMPFEANASVWGALL  730

Query  341  GGYAHQGHANMAL  379
            G  A + H N+ L
Sbjct  731  G--ASRVHGNIEL  741


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 65/160 (41%), Gaps = 4/160 (3%)
 Frame = +2

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH  + K  +      R  L+ +Y +C   E   + F E P+ + I+W+ALI  Y++ G 
Sbjct  71   IHAHLAKCGLSFGPPFRHHLLTLYSRCRSPESARKLFDEFPDPDHISWSALISAYSNNGL  130

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL  F  M  +   V  N  T   VL ACS +     G  +  A     G E     
Sbjct  131  GREALLSFRKM--RCLGVRSNEFTLPSVLKACSVSSDFIAGT-LVHAFVIVTGFESDVFV  187

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
               +V M    G++  +      +  R +VS W  LL  C
Sbjct  188  ANTLVVMYANFGLLLDSKRLFDGITDRNSVS-WNGLLAGC  226



>gb|KDP21001.1| hypothetical protein JCGZ_21472 [Jatropha curcas]
Length=858

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 184/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q+  GE+ALK++L+ ++  I+P  F+ SS+L+ACA L+A+E G+ +H  
Sbjct  452  VAFTSMITAYSQDGQGEEALKLYLEMQDRKIKPDSFLCSSLLNACANLSAYEQGKQVHVH  511

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            V+K     ++F  + LV+MY KCG I+D + AF E+PER +++W+A+IGG A  GHA  A
Sbjct  512  VLKFGFISDIFAGNSLVNMYAKCGSIDDADLAFSEIPERGIVSWSAMIGGLAQHGHAKEA  571

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF  M +    V PN++T V VL AC+ AG V      F++M+  +G EP  EHYAC+
Sbjct  572  LQLFNQMLK--DGVRPNHITLVSVLCACNHAGLVAEAQQYFKSMETLFGFEPMQEHYACM  629

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG ++ A E +  MP +   SVWGALLGA R+H   ELG+ AA+ LF + P+ S
Sbjct  630  IDLLGRAGKLDEAMELVNIMPFQANASVWGALLGAARIHKNVELGEQAAEMLFALQPEKS  689

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++A++G W +   VR+ MKD  +KK
Sbjct  690  GTHVLLANIYAAAGMWSDVAKVRRLMKDSSLKK  722


 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 115/227 (51%), Gaps = 12/227 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN  G++A+  F +    G++  EF   SVL AC       LGR 
Sbjct  44   EPDLVSWSALISGYSQNGFGKEAILAFYEMHLLGVKCNEFTFPSVLKACNITKDLWLGRQ  103

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+VV    E + FV + LV +Y KCG + D  R F  + ER++++WNAL+  Y     
Sbjct  104  VHGIVVVTGFENDEFVANSLVVLYAKCGRLRDARRIFEAITERSVVSWNALLSSYVQSDS  163

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPGAE  541
               A+ LFEDM      + PN  +  C++ AC+       G  +   ++K  Y  +  + 
Sbjct  164  CREAIGLFEDML--LSGIRPNEFSLSCMINACTDLEDNVQGRKVHGYSIKLAYDFDLFSA  221

Query  542  HYACVVDMLGRAGMVE---RAYEFIKRMPIRPTVSVWGALLGACRVH  673
            +   +VDM  + G +E   RA+E I     +P V  W A+   C +H
Sbjct  222  N--ALVDMYAKVGTLEEAIRAFEEIA----KPDVVSWNAITAGCVLH  262


 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/244 (30%), Positives = 125/244 (51%), Gaps = 12/244 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ VSW +LL+ Y Q+D   +A+ +F      GI P EF +S +++AC  L     GR 
Sbjct  145  ERSVVSWNALLSSYVQSDSCREAIGLFEDMLLSGIRPNEFSLSCMINACTDLEDNVQGRK  204

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG  +K   + ++F  + LVDMY K G +E+  RAF E+ + ++++WNA+  G     +
Sbjct  205  VHGYSIKLAYDFDLFSANALVDMYAKVGTLEEAIRAFEEIAKPDVVSWNAITAGCVLHEY  264

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL+LF  M R    + PN  T    L +C+  G  E G  +   +     ++ G++ 
Sbjct  265  HHWALELFGKMNR--SGICPNMFTISIALKSCAAMGLRELGRQLHSRL---IKMDIGSDS  319

Query  545  Y--ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            +  A ++DM  +  ++  A    K MP +  ++ W  ++     +G+     I A +LF 
Sbjct  320  FVGAGLIDMYSKCDLMAEARLVFKLMPEKDLIA-WNTVISGYSQNGE----DIEAASLFP  374

Query  719  IDPQ  730
            +  Q
Sbjct  375  LMYQ  378


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 134/280 (48%), Gaps = 17/280 (6%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ ++W ++++ Y QN    +A  +F    + G+   +  +S+VL + A L   +    
Sbjct  347  EKDLIAWNTVISGYSQNGEDIEAASLFPLMYQWGVGFNQTTLSTVLKSVACLQDNQFCSQ  406

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH L VK+  E + +V + L+D YGKCG  E   R F E P  +L+ + ++I  Y+  G 
Sbjct  407  IHALSVKSGFESDSYVANSLIDTYGKCGYTEGATRVFKESPVVDLVAFTSMITAYSQDGQ  466

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL L+ +M  + + + P+  +F+C  +L AC+   A E G  +   +  K+G     
Sbjct  467  GEEALKLYLEM--QDRKIKPD--SFLCSSLLNACANLSAYEQGKQVHVHVL-KFGFISDI  521

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                 +V+M  + G ++ A      +P R  VS W A++G    HG  +     A  LF 
Sbjct  522  FAGNSLVNMYAKCGSIDDADLAFSEIPERGIVS-WSAMIGGLAQHGHAK----EALQLFN  576

Query  719  IDPQDS--GNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
               +D    NH+ L ++  +   +G   EA    K M+ +
Sbjct  577  QMLKDGVRPNHITLVSVLCACNHAGLVAEAQQYFKSMETL  616


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 72/159 (45%), Gaps = 4/159 (3%)
 Frame = +2

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH  V+K  + ++  +R++L+++Y KC       +   +  E +L++W+ALI GY+  G 
Sbjct  3    IHAHVIKFGLTQDPKIRNILINLYSKCQFFHYAWKLVDKSTEPDLVSWSALISGYSQNGF  62

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  F +M      V  N  TF  VL AC+    +  G  +   +    G E     
Sbjct  63   GKEAILAFYEM--HLLGVKCNEFTFPSVLKACNITKDLWLGRQV-HGIVVVTGFENDEFV  119

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
               +V +  + G +  A    + +  R  VS W ALL +
Sbjct  120  ANSLVVLYAKCGRLRDARRIFEAITERSVVS-WNALLSS  157



>ref|XP_008464285.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial isoform X2 [Cucumis melo]
Length=644

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 184/276 (67%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW +L+A + +   GE  +++F +   +G EPT F  SSV +ACA   + E G+ +
Sbjct  236  KNVVSWNALIAGHARKGEGEHVMRLFSQMLRQGFEPTHFTYSSVFTACASSGSLEQGKWV  295

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  V+K+  +   ++ + L+DMY K G I+D ++ F  + +R++++WN++I GYA  G  
Sbjct  296  HAHVIKSGGQPIAYIGNTLIDMYAKSGSIKDAKKVFQRLVKRDIVSWNSIISGYAQHGLG  355

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LFE + +    V PN +TF+ VLTACS +G ++ G   FE MK K+GIEP   H+
Sbjct  356  AEALQLFEQVLKA--KVQPNEITFLSVLTACSHSGLLDEGKYYFELMK-KHGIEPQVAHH  412

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              VVD+LGRAG +  A +FI+ MP+ PT +VWGALLGACR+H   +LG  AA+ +F++DP
Sbjct  413  VTVVDLLGRAGRLNEANKFIEEMPMEPTAAVWGALLGACRMHKNMDLGVYAAEKIFELDP  472

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSG HV+LSN++AS+GR  +A  VRK MK+ G+KK
Sbjct  473  HDSGPHVLLSNIYASAGRLRDAGNVRKMMKESGVKK  508


 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 119/223 (53%), Gaps = 4/223 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW  L++ Y Q+    +AL +F K    G +P EF +SS+L A     + + GR +
Sbjct  135  KDRVSWTVLISGYSQSRRASEALALFPKMLHLGFQPNEFTLSSLLKASGAGPSDDHGRQL  194

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   +K   + NV V S L+DMY + G + + +  F  +  +N+++WNALI G+A +G  
Sbjct  195  HAFSLKYGYDMNVHVGSSLLDMYARWGHMREAKVIFKSLAAKNVVSWNALIAGHARKGEG  254

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               + LF  M R  Q   P + T+  V TAC+ +G++E G  +  A   K G +P A   
Sbjct  255  EHVMRLFSQMLR--QGFEPTHFTYSSVFTACASSGSLEQGKWV-HAHVIKSGGQPIAYIG  311

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              ++DM  ++G ++ A +  +R+  R  VS W +++     HG
Sbjct  312  NTLIDMYAKSGSIKDAKKVFQRLVKRDIVS-WNSIISGYAQHG  353


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/238 (29%), Positives = 111/238 (47%), Gaps = 13/238 (5%)
 Frame = +2

Query  107  IEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCE  286
            +EP   + S +L+ C  L   + GR+IH  +  +  E +  + + +++MY KCG +E+ +
Sbjct  67   LEPERTLYSKMLNKCTYLRKLKQGRAIHAHIQSSAFENDPVLLNFILNMYAKCGSLEEAQ  126

Query  287  RAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSR  466
              F +MP ++ ++W  LI GY+    A+ AL LF  M        PN  T   +L A S 
Sbjct  127  DLFDKMPTKDRVSWTVLISGYSQSRRASEALALFPKMLH--LGFQPNEFTLSSLLKA-SG  183

Query  467  AGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWG  646
            AG  +       A   KYG +      + ++DM  R G +  A    K +  +  VS W 
Sbjct  184  AGPSDDHGRQLHAFSLKYGYDMNVHVGSSLLDMYARWGHMREAKVIFKSLAAKNVVS-WN  242

Query  647  ALLGACRVHGKPE-LGKIAADNLFQ-IDPQDSGNHVILSNMF---ASSGRWEEANLVR  805
            AL+      G+ E + ++ +  L Q  +P     H   S++F   ASSG  E+   V 
Sbjct  243  ALIAGHARKGEGEHVMRLFSQMLRQGFEP----THFTYSSVFTACASSGSLEQGKWVH  296


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW S+++ Y Q+ LG +AL++F +  +  ++P E    SVL+AC+     + G+ 
Sbjct  336  KRDIVSWNSIISGYAQHGLGAEALQLFEQVLKAKVQPNEITFLSVLTACSHSGLLDEGKY  395

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAHQG  361
               L+ K  +E  V     +VD+ G+ G + +  +   EMP E     W AL+G  A + 
Sbjct  396  YFELMKKHGIEPQVAHHVTVVDLLGRAGRLNEANKFIEEMPMEPTAAVWGALLG--ACRM  453

Query  362  HANMALDLF  388
            H NM L ++
Sbjct  454  HKNMDLGVY  462



>ref|XP_006357349.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like isoform X1 [Solanum tuberosum]
 ref|XP_006357350.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like isoform X2 [Solanum tuberosum]
 ref|XP_006357351.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like isoform X3 [Solanum tuberosum]
Length=918

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 183/272 (67%), Gaps = 2/272 (1%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            S+ SL+  Y     GE+A+K++LK ++  ++P  F+ SS+L+ACA L+A+E G+ IH  V
Sbjct  513  SFTSLITAYALLGQGEEAMKLYLKLQDMDLKPDSFVCSSLLNACANLSAYEQGKQIHAHV  572

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            +K     +VF  + LV+MY KCG IED   AF+E+P++ +++W+A+IGG A  GHA  AL
Sbjct  573  LKFGFMSDVFAGNSLVNMYAKCGSIEDASCAFHEVPKKGIVSWSAMIGGLAQHGHAKQAL  632

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
             LF +M +   DV PN++T V VL AC+ AG V      FE MKD + IEP  EHYAC++
Sbjct  633  HLFGEMLK--DDVSPNHITLVSVLYACNHAGLVAEAKKYFETMKDSFRIEPTQEHYACMI  690

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSG  739
            D+LGRAG ++ A E + +MP     SVWGALLGA R+H   E+GK AA+ LF ++P+ SG
Sbjct  691  DVLGRAGKLDDAIELVNKMPFEANASVWGALLGAARIHKNVEVGKHAAEMLFSLEPEKSG  750

Query  740  NHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             HV+L+N++AS G W +   VR+ MK+  +KK
Sbjct  751  THVLLANIYASVGLWGDVAKVRRFMKNSRVKK  782


 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 116/224 (52%), Gaps = 6/224 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW SL++ Y QN  G+ A+  FLK    G+   EF   SVL AC+      LG+ 
Sbjct  104  EPDLVSWSSLISGYSQNGFGKDAIWGFLKMHSLGLRCNEFTFPSVLKACSIEKELFLGKQ  163

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+VV    + +VFV + LV MY KCG   D    F E+PERN+++WNAL   Y     
Sbjct  164  LHGVVVVTGFDSDVFVANTLVVMYAKCGEFVDSRMLFEEIPERNVVSWNALFSCYTQNDF  223

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM-KDKYGIEPGAE  541
             + A+ +F DM      V P+  +   +L AC+  G +  G  I   + K  YG +P + 
Sbjct  224  FSEAMCMFRDMI--GSGVRPDEYSLSNILNACTGLGDILEGKKIHGYLVKLGYGSDPFSS  281

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            +   +VDM  + G ++ A    + + + P +  W A++  C +H
Sbjct  282  N--ALVDMYAKGGDLKDAITAFEGI-VVPDIVSWNAIIAGCVLH  322


 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 105/219 (48%), Gaps = 5/219 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y QND   +A+ +F      G+ P E+ +S++L+AC GL     G+ 
Sbjct  205  ERNVVSWNALFSCYTQNDFFSEAMCMFRDMIGSGVRPDEYSLSNILNACTGLGDILEGKK  264

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG +VK     + F  + LVDMY K G ++D   AF  +   ++++WNA+I G      
Sbjct  265  IHGYLVKLGYGSDPFSSNALVDMYAKGGDLKDAITAFEGIVVPDIVSWNAIIAGCVLHEC  324

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM-KDKYGIEPGAE  541
               A+D+   M R    + PN  T    L AC+     E G  +   + K    ++P   
Sbjct  325  QWQAIDMLNQMRR--SGIWPNMFTLSSALKACAALELPELGKGLHSLLIKKDIILDPFVS  382

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
                ++DM  +  + + A      MP +  +++   + G
Sbjct  383  --VGLIDMYCKCNLTKDARLIYDLMPGKDLIALNAMISG  419


 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 138/307 (45%), Gaps = 40/307 (13%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++A    ++   +A+ +  + R  GI P  F +SS L ACA L   ELG+ +H L
Sbjct  310  VSWNAIIAGCVLHECQWQAIDMLNQMRRSGIWPNMFTLSSALKACAALELPELGKGLHSL  369

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K  +  + FV   L+DMY KC   +D    +  MP ++LI  NA+I GY+     +  
Sbjct  370  LIKKDIILDPFVSVGLIDMYCKCNLTKDARLIYDLMPGKDLIALNAMISGYSQNEADDAC  429

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGA-----------VETGM--DIF--EAMK  511
            LDLF      TQ +  +  T + +L + +   A           V++G   D F   ++ 
Sbjct  430  LDLFTQTF--TQGIGFDQTTLLAILNSAAGLQAANVCKQVHGLSVKSGFLCDTFVINSLV  487

Query  512  DKYG----IEPGAE-HYAC-------------VVDMLGRAGMVERAYEFIKRMPIRPTVS  637
            D YG    ++  A   Y C                +LG+     + Y  ++ M ++P   
Sbjct  488  DSYGKCTQLDDAARIFYECPTLDLPSFTSLITAYALLGQGEEAMKLYLKLQDMDLKPDSF  547

Query  638  VWGALLGACRVHGKPELGKIAADNLFQIDPQD---SGNHVILSNMFASSGRWEEANLVRK  808
            V  +LL AC      E GK    ++ +        +GN ++  NM+A  G  E+A+    
Sbjct  548  VCSSLLNACANLSAYEQGKQIHAHVLKFGFMSDVFAGNSLV--NMYAKCGSIEDASCAFH  605

Query  809  EMKDIGI  829
            E+   GI
Sbjct  606  EVPKKGI  612


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 78/175 (45%), Gaps = 4/175 (2%)
 Frame = +2

Query  131  SSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE  310
            +++LS  +   +   G  IH  + K  +  +   R+ LV++Y KCG  +  ++   E PE
Sbjct  45   TNLLSHLSKTKSLTPGFQIHAHLTKLGLSNHSKYRNHLVNLYSKCGIFQYAQKLIDESPE  104

Query  311  RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM  490
             +L++W++LI GY+  G    A+  F  M   +  +  N  TF  VL ACS    +  G 
Sbjct  105  PDLVSWSSLISGYSQNGFGKDAIWGFLKM--HSLGLRCNEFTFPSVLKACSIEKELFLGK  162

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
             +   +    G +        +V M  + G    +    + +P R  VS W AL 
Sbjct  163  QL-HGVVVVTGFDSDVFVANTLVVMYAKCGEFVDSRMLFEEIPERNVVS-WNALF  215



>gb|KEH23680.1| PPR containing plant-like protein [Medicago truncatula]
Length=663

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/277 (45%), Positives = 178/277 (64%), Gaps = 3/277 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N V W +++A Y QN+  +++LK+F +  E G+ P E  + SVLSAC  L    LG  I
Sbjct  340  KNAVCWSAMIAGYSQNNKPKESLKLFHEMMERGVVPIEHTLVSVLSACGQLTCLNLGDWI  399

Query  188  HG-LVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            H   VV   +  +V + + +VDMY KCG I+     F  MPERNLI+WN +I GYA  G 
Sbjct  400  HQYFVVGKIIPLSVTLENAIVDMYAKCGSIDAATEVFSTMPERNLISWNTMIAGYAANGR  459

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  A+++F+ M  +     PN +TFV +LTACS  G +  G + F+ M+ KYGI+P   H
Sbjct  460  AKQAINVFDQM--RNMGFEPNNITFVSLLTACSHGGLISEGREYFDNMERKYGIKPERGH  517

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGR G++E AY+ I  MP++P  + WGALL ACR+HG  EL +++A NL ++D
Sbjct  518  YACMVDLLGRTGLLEEAYKLIANMPMQPCEAAWGALLNACRMHGNVELARLSAHNLLRLD  577

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+DSG +V+L+N  A+  +W +   VR  MKD G+KK
Sbjct  578  PEDSGIYVLLANTCANDRKWSDVRRVRSLMKDKGVKK  614


 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 114/256 (45%), Gaps = 34/256 (13%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ V+W +++  Y  +D  E+A++VF       +EP E  + +V+SAC+ +   E+G+ 
Sbjct  207  DKDVVTWTTMIDGYAAHDCSEEAMEVFELMLLSHVEPNEVTLIAVVSACSDMGNLEMGKR  266

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGC-------------------------------  271
            +H  V +  +  ++ + + L+DMY KC C                               
Sbjct  267  VHEKVEEKNMRCSLSLHNALLDMYVKCDCLVDARELFDRMATKDVYSWTSMVNGYAKCGD  326

Query  272  IEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVL  451
            +E   R F + P +N + W+A+I GY+       +L LF +M  +   VVP   T V VL
Sbjct  327  LESARRFFDQTPRKNAVCWSAMIAGYSQNNKPKESLKLFHEMMER--GVVPIEHTLVSVL  384

Query  452  TACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPT  631
            +AC +   +  G  I +       I         +VDM  + G ++ A E    MP R  
Sbjct  385  SACGQLTCLNLGDWIHQYFVVGKIIPLSVTLENAIVDMYAKCGSIDAATEVFSTMPERNL  444

Query  632  VSVWGALLGACRVHGK  679
            +S W  ++     +G+
Sbjct  445  IS-WNTMIAGYAANGR  459


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 126/279 (45%), Gaps = 13/279 (5%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            ++ N   W +++  Y+       A   F+   +  +E         L AC        G 
Sbjct  105  EQPNTFMWNTMIRGYQNARKPIFAFSFFVYMFQLRVEMDSRSFVFALKACQQFETVFEGE  164

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            S++ +V K   +  + VR+ L+  Y + G +++  + F E  +++++TW  +I GYA   
Sbjct  165  SVYCVVWKMGFDCELLVRNGLIHFYAERGLLKNARQVFDESSDKDVVTWTTMIDGYAAHD  224

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             +  A+++FE M      V PN VT + V++ACS  G +E G  + E +++K  +     
Sbjct  225  CSEEAMEVFELML--LSHVEPNEVTLIAVVSACSDMGNLEMGKRVHEKVEEK-NMRCSLS  281

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
             +  ++DM  +   +  A E   RM  +   S W ++     V+G  + G + +   F  
Sbjct  282  LHNALLDMYVKCDCLVDARELFDRMATKDVYS-WTSM-----VNGYAKCGDLESARRF-F  334

Query  722  DPQDSGNHVILSNM---FASSGRWEEANLVRKEMKDIGI  829
            D     N V  S M   ++ + + +E+  +  EM + G+
Sbjct  335  DQTPRKNAVCWSAMIAGYSQNNKPKESLKLFHEMMERGV  373


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 59/126 (47%), Gaps = 2/126 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN +SW +++A Y  N   ++A+ VF + R  G EP      S+L+AC+       GR 
Sbjct  441  ERNLISWNTMIAGYAANGRAKQAINVFDQMRNMGFEPNNITFVSLLTACSHGGLISEGRE  500

Query  185  -IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNL-ITWNALIGGYAHQ  358
                +  K  ++      + +VD+ G+ G +E+  +    MP +     W AL+      
Sbjct  501  YFDNMERKYGIKPERGHYACMVDLLGRTGLLEEAYKLIANMPMQPCEAAWGALLNACRMH  560

Query  359  GHANMA  376
            G+  +A
Sbjct  561  GNVELA  566



>gb|KHN07701.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=927

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 180/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q   GE+ALK++L+ ++  I+P  F+ SS+L+ACA L+A+E G+ +H  
Sbjct  521  VAYTSMITAYSQYGDGEEALKLYLQMQDADIKPDPFICSSLLNACANLSAYEQGKQLHVH  580

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K     ++F  + LV+MY KCG IED +RAF E+P R +++W+A+IGGYA  GH   A
Sbjct  581  AIKFGFMCDIFASNSLVNMYAKCGSIEDADRAFSEIPNRGIVSWSAMIGGYAQHGHGKEA  640

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF  M R    V PN++T V VL AC+ AG V  G   FE M+  +GI+P  EHYAC+
Sbjct  641  LRLFNQMLR--DGVPPNHITLVSVLCACNHAGLVNEGKQYFEKMEVMFGIKPTQEHYACM  698

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGR+G +  A E +  +P      VWGALLGA R+H   ELG+ AA  LF ++P+ S
Sbjct  699  IDLLGRSGKLNEAVELVNSIPFEADGFVWGALLGAARIHKNIELGQKAAKMLFDLEPEKS  758

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G WE    VRK MKD  +KK
Sbjct  759  GTHVLLANIYASAGMWENVAKVRKFMKDSKVKK  791


 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 119/236 (50%), Gaps = 4/236 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW SLL+ Y QN   E+AL VF +    G++  EF   SVL AC+      +GR 
Sbjct  113  ELDVVSWSSLLSGYVQNGFVEEALLVFNEMCLLGVKCNEFTFPSVLKACSMKRDLNMGRK  172

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+ V    E + FV + LV MY KCG ++D  R F  + ERN+++WNAL   Y     
Sbjct  173  VHGMAVVTGFESDGFVANTLVVMYAKCGLLDDSRRLFGGIVERNVVSWNALFSCYVQSEL  232

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF++M R    ++PN  +   +L AC+     + G  I   M  K G++     
Sbjct  233  CGEAVGLFKEMVR--SGIMPNEFSISIILNACAGLQEGDLGRKIHGLML-KMGLDLDQFS  289

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNL  712
               +VDM  +AG +E A    + +   P V  W A++  C +H   +L  +  D +
Sbjct  290  ANALVDMYSKAGEIEGAVAVFQDIA-HPDVVSWNAIIAGCVLHDCNDLALMLLDEM  344


 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 119/220 (54%), Gaps = 8/220 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y Q++L  +A+ +F +    GI P EF +S +L+ACAGL   +LGR 
Sbjct  214  ERNVVSWNALFSCYVQSELCGEAVGLFKEMVRSGIMPNEFSISIILNACAGLQEGDLGRK  273

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL++K  ++ + F  + LVDMY K G IE     F ++   ++++WNA+I G      
Sbjct  274  IHGLMLKMGLDLDQFSANALVDMYSKAGEIEGAVAVFQDIAHPDVVSWNAIIAGCVLHDC  333

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             ++AL L ++M  K     PN  T    L AC+  G  E G  +  ++     ++  ++ 
Sbjct  334  NDLALMLLDEM--KGSGTRPNMFTLSSALKACAAMGFKELGRQLHSSL---IKMDAHSDL  388

Query  545  YACV--VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
            +A V  VDM  +  M++ A      MP +  ++ W AL+ 
Sbjct  389  FAAVGLVDMYSKCEMMDDARRAYDSMPKKDIIA-WNALIS  427


 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/308 (28%), Positives = 138/308 (45%), Gaps = 42/308 (14%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++A    +D  + AL +  + +  G  P  F +SS L ACA +   ELGR +H  
Sbjct  319  VSWNAIIAGCVLHDCNDLALMLLDEMKGSGTRPNMFTLSSALKACAAMGFKELGRQLHSS  378

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     ++F    LVDMY KC  ++D  RA+  MP++++I WNALI GY+  G    A
Sbjct  379  LIKMDAHSDLFAAVGLVDMYSKCEMMDDARRAYDSMPKKDIIAWNALISGYSQCGDHLDA  438

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE---------------TGMDIFEAMK  511
            + LF  M   ++D+  N  T   VL + +   A++               +   +  ++ 
Sbjct  439  VSLFSKMF--SEDIDFNQTTLSTVLKSVASLQAIKVCKQIHTISIKSGIYSDFYVINSLL  496

Query  512  DKYG----IEPGAE-----------HYACVVDMLGRAGMVERAYEFIKRMP---IRPTVS  637
            D YG    I+  ++            Y  ++    + G  E A +   +M    I+P   
Sbjct  497  DTYGKCNHIDEASKIFEERTWEDLVAYTSMITAYSQYGDGEEALKLYLQMQDADIKPDPF  556

Query  638  VWGALLGACRVHGKPELGKI----AADNLFQIDPQDSGNHVILSNMFASSGRWEEANLVR  805
            +  +LL AC      E GK     A    F  D   S +   L NM+A  G  E+A+   
Sbjct  557  ICSSLLNACANLSAYEQGKQLHVHAIKFGFMCDIFASNS---LVNMYAKCGSIEDADRAF  613

Query  806  KEMKDIGI  829
             E+ + GI
Sbjct  614  SEIPNRGI  621


 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 113/226 (50%), Gaps = 8/226 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ ++W +L++ Y Q      A+ +F K   E I+  +  +S+VL + A L A ++ + 
Sbjct  416  KKDIIAWNALISGYSQCGDHLDAVSLFSKMFSEDIDFNQTTLSTVLKSVASLQAIKVCKQ  475

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH + +K+ +  + +V + L+D YGKC  I++  + F E    +L+ + ++I  Y+  G 
Sbjct  476  IHTISIKSGIYSDFYVINSLLDTYGKCNHIDEASKIFEERTWEDLVAYTSMITAYSQYGD  535

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL L+  M  +  D+ P+   F+C  +L AC+   A E G  +      K+G     
Sbjct  536  GEEALKLYLQM--QDADIKPD--PFICSSLLNACANLSAYEQGKQL-HVHAIKFGFMCDI  590

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
                 +V+M  + G +E A      +P R  VS W A++G    HG
Sbjct  591  FASNSLVNMYAKCGSIEDADRAFSEIPNRGIVS-WSAMIGGYAQHG  635


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 78/183 (43%), Gaps = 5/183 (3%)
 Frame = +2

Query  131  SSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE  310
            S +LS C    +   G  +H  ++K     +  +R+ LV +Y KC       +   E  E
Sbjct  54   SKLLSQCVASKSLTSGMELHAHLIKFGFSRDPSLRNHLVTLYSKCRRFGYARKLVDESSE  113

Query  311  RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM  490
             ++++W++L+ GY   G    AL +F +M      V  N  TF  VL ACS    +  G 
Sbjct  114  LDVVSWSSLLSGYVQNGFVEEALLVFNEMC--LLGVKCNEFTFPSVLKACSMKRDLNMGR  171

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRV  670
             +   M    G E        +V M  + G+++ +      +  R  VS W AL  +C V
Sbjct  172  KV-HGMAVVTGFESDGFVANTLVVMYAKCGLLDDSRRLFGGIVERNVVS-WNALF-SCYV  228

Query  671  HGK  679
              +
Sbjct  229  QSE  231



>ref|XP_003545972.2| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like 
[Glycine max]
Length=930

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 180/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q   GE+ALK++L+ ++  I+P  F+ SS+L+ACA L+A+E G+ +H  
Sbjct  524  VAYTSMITAYSQYGDGEEALKLYLQMQDADIKPDPFICSSLLNACANLSAYEQGKQLHVH  583

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K     ++F  + LV+MY KCG IED +RAF E+P R +++W+A+IGGYA  GH   A
Sbjct  584  AIKFGFMCDIFASNSLVNMYAKCGSIEDADRAFSEIPNRGIVSWSAMIGGYAQHGHGKEA  643

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF  M R    V PN++T V VL AC+ AG V  G   FE M+  +GI+P  EHYAC+
Sbjct  644  LRLFNQMLR--DGVPPNHITLVSVLCACNHAGLVNEGKQYFEKMEVMFGIKPTQEHYACM  701

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGR+G +  A E +  +P      VWGALLGA R+H   ELG+ AA  LF ++P+ S
Sbjct  702  IDLLGRSGKLNEAVELVNSIPFEADGFVWGALLGAARIHKNIELGQKAAKMLFDLEPEKS  761

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G WE    VRK MKD  +KK
Sbjct  762  GTHVLLANIYASAGMWENVAKVRKFMKDSKVKK  794


 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 119/236 (50%), Gaps = 4/236 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW SLL+ Y QN   E+AL VF +    G++  EF   SVL AC+      +GR 
Sbjct  116  ELDVVSWSSLLSGYVQNGFVEEALLVFNEMCLLGVKCNEFTFPSVLKACSMKRDLNMGRK  175

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+ V    E + FV + LV MY KCG ++D  R F  + ERN+++WNAL   Y     
Sbjct  176  VHGMAVVTGFESDGFVANTLVVMYAKCGLLDDSRRLFGGIVERNVVSWNALFSCYVQSEL  235

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF++M R    ++PN  +   +L AC+     + G  I   M  K G++     
Sbjct  236  CGEAVGLFKEMVR--SGIMPNEFSISIILNACAGLQEGDLGRKIHGLML-KMGLDLDQFS  292

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNL  712
               +VDM  +AG +E A    + +   P V  W A++  C +H   +L  +  D +
Sbjct  293  ANALVDMYSKAGEIEGAVAVFQDIA-HPDVVSWNAIIAGCVLHDCNDLALMLLDEM  347


 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 119/220 (54%), Gaps = 8/220 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y Q++L  +A+ +F +    GI P EF +S +L+ACAGL   +LGR 
Sbjct  217  ERNVVSWNALFSCYVQSELCGEAVGLFKEMVRSGIMPNEFSISIILNACAGLQEGDLGRK  276

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL++K  ++ + F  + LVDMY K G IE     F ++   ++++WNA+I G      
Sbjct  277  IHGLMLKMGLDLDQFSANALVDMYSKAGEIEGAVAVFQDIAHPDVVSWNAIIAGCVLHDC  336

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             ++AL L ++M  K     PN  T    L AC+  G  E G  +  ++     ++  ++ 
Sbjct  337  NDLALMLLDEM--KGSGTRPNMFTLSSALKACAAMGFKELGRQLHSSL---IKMDAHSDL  391

Query  545  YACV--VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
            +A V  VDM  +  M++ A      MP +  ++ W AL+ 
Sbjct  392  FAAVGLVDMYSKCEMMDDARRAYDSMPKKDIIA-WNALIS  430


 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/308 (28%), Positives = 138/308 (45%), Gaps = 42/308 (14%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++A    +D  + AL +  + +  G  P  F +SS L ACA +   ELGR +H  
Sbjct  322  VSWNAIIAGCVLHDCNDLALMLLDEMKGSGTRPNMFTLSSALKACAAMGFKELGRQLHSS  381

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     ++F    LVDMY KC  ++D  RA+  MP++++I WNALI GY+  G    A
Sbjct  382  LIKMDAHSDLFAAVGLVDMYSKCEMMDDARRAYDSMPKKDIIAWNALISGYSQCGDHLDA  441

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE---------------TGMDIFEAMK  511
            + LF  M   ++D+  N  T   VL + +   A++               +   +  ++ 
Sbjct  442  VSLFSKMF--SEDIDFNQTTLSTVLKSVASLQAIKVCKQIHTISIKSGIYSDFYVINSLL  499

Query  512  DKYG----IEPGAE-----------HYACVVDMLGRAGMVERAYEFIKRMP---IRPTVS  637
            D YG    I+  ++            Y  ++    + G  E A +   +M    I+P   
Sbjct  500  DTYGKCNHIDEASKIFEERTWEDLVAYTSMITAYSQYGDGEEALKLYLQMQDADIKPDPF  559

Query  638  VWGALLGACRVHGKPELGKI----AADNLFQIDPQDSGNHVILSNMFASSGRWEEANLVR  805
            +  +LL AC      E GK     A    F  D   S +   L NM+A  G  E+A+   
Sbjct  560  ICSSLLNACANLSAYEQGKQLHVHAIKFGFMCDIFASNS---LVNMYAKCGSIEDADRAF  616

Query  806  KEMKDIGI  829
             E+ + GI
Sbjct  617  SEIPNRGI  624


 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 113/226 (50%), Gaps = 8/226 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ ++W +L++ Y Q      A+ +F K   E I+  +  +S+VL + A L A ++ + 
Sbjct  419  KKDIIAWNALISGYSQCGDHLDAVSLFSKMFSEDIDFNQTTLSTVLKSVASLQAIKVCKQ  478

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH + +K+ +  + +V + L+D YGKC  I++  + F E    +L+ + ++I  Y+  G 
Sbjct  479  IHTISIKSGIYSDFYVINSLLDTYGKCNHIDEASKIFEERTWEDLVAYTSMITAYSQYGD  538

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL L+  M  +  D+ P+   F+C  +L AC+   A E G  +      K+G     
Sbjct  539  GEEALKLYLQM--QDADIKPD--PFICSSLLNACANLSAYEQGKQL-HVHAIKFGFMCDI  593

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
                 +V+M  + G +E A      +P R  VS W A++G    HG
Sbjct  594  FASNSLVNMYAKCGSIEDADRAFSEIPNRGIVS-WSAMIGGYAQHG  638


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 78/183 (43%), Gaps = 5/183 (3%)
 Frame = +2

Query  131  SSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE  310
            S +LS C    +   G  +H  ++K     +  +R+ LV +Y KC       +   E  E
Sbjct  57   SKLLSQCVASKSLTSGMELHAHLIKFGFSRDPSLRNHLVTLYSKCRRFGYARKLVDESSE  116

Query  311  RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM  490
             ++++W++L+ GY   G    AL +F +M      V  N  TF  VL ACS    +  G 
Sbjct  117  LDVVSWSSLLSGYVQNGFVEEALLVFNEMC--LLGVKCNEFTFPSVLKACSMKRDLNMGR  174

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRV  670
             +   M    G E        +V M  + G+++ +      +  R  VS W AL  +C V
Sbjct  175  KV-HGMAVVTGFESDGFVANTLVVMYAKCGLLDDSRRLFGGIVERNVVS-WNALF-SCYV  231

Query  671  HGK  679
              +
Sbjct  232  QSE  234



>gb|KHN26409.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=816

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 182/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W +++  Y QN    +AL +F + +   I+P  F + SV++A A L+     + IHGL
Sbjct  411  VTWNAMILGYAQNGCVNEALNLFCEMQSHDIKPDSFTLVSVITALADLSVTRQAKWIHGL  470

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             ++  +++NVFV + L+D + KCG I+   + F  M ER++ITWNA+I GY   GH   A
Sbjct  471  AIRTLMDKNVFVCTALIDTHAKCGAIQTARKLFDLMQERHVITWNAMIDGYGTNGHGREA  530

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            LDLF +M  +   V PN +TF+ V+ ACS +G VE GM  FE+MK+ YG+EP  +HY  +
Sbjct  531  LDLFNEM--QNGSVKPNEITFLSVIAACSHSGLVEEGMYYFESMKENYGLEPTMDHYGAM  588

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            VD+LGRAG ++ A++FI+ MP++P ++V GA+LGACR+H   ELG+ AAD LF +DP D 
Sbjct  589  VDLLGRAGRLDDAWKFIQDMPVKPGITVLGAMLGACRIHKNVELGEKAADELFDLDPDDG  648

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+NM+AS+  W++   VR  M+  GI+K
Sbjct  649  GYHVLLANMYASASMWDKVARVRTAMEKKGIQK  681


 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 91/171 (53%), Gaps = 2/171 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW +++A Y QN    +A++V L+ +E G +P    + SVL A A L A  +GRS
Sbjct  205  QRDLVSWNTVVAGYAQNGFARRAVQVVLQMQEAGQKPDSITLVSVLPAVADLKALRIGRS  264

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG   +A  E  V V + ++D Y KCG +      F  M  RN+++WN +I GYA  G 
Sbjct  265  IHGYAFRAGFEYMVNVATAMLDTYFKCGSVRSARLVFKGMSSRNVVSWNTMIDGYAQNGE  324

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDK  517
            +  A   F  M    + V P  V+ +  L AC+  G +E G  +   + +K
Sbjct  325  SEEAFATFLKML--DEGVEPTNVSMMGALHACANLGDLERGRYVHRLLDEK  373


 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 104/227 (46%), Gaps = 12/227 (5%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V + ++L  Y +N     A++ + + R + + P  +  + +L           GR IHG+
Sbjct  108  VLYHTMLKGYAKNSTLRDAVRFYERMRCDEVMPVVYDFTYLLQLSGENLDLRRGREIHGM  167

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            V+    + N+F  + +V++Y KC  IED  + F  MP+R+L++WN ++ GYA  G A  A
Sbjct  168  VITNGFQSNLFAMTAVVNLYAKCRQIEDAYKMFERMPQRDLVSWNTVVAGYAQNGFARRA  227

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + +   M    Q   P+ +T V VL A +   A+  G  I       Y    G E+   V
Sbjct  228  VQVVLQMQEAGQK--PDSITLVSVLPAVADLKALRIGRSI-----HGYAFRAGFEYMVNV  280

Query  557  ----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
                +D   + G V  A    K M  R  VS W  ++     +G+ E
Sbjct  281  ATAMLDTYFKCGSVRSARLVFKGMSSRNVVS-WNTMIDGYAQNGESE  326



>emb|CBI24015.3| unnamed protein product [Vitis vinifera]
Length=569

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 185/277 (67%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW +++A Y Q++   +A  +F + R E +   +F+ +S+LSAC GL A E G+ 
Sbjct  159  DRNSVSWNAMIAAYVQSNRLHEAFALFDRMRLENVVLDKFVAASMLSACTGLGALEQGKW  218

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG + K+ +E +  + + ++DMY KCGC+E     F E+P++ + +WN +IGG A  G 
Sbjct  219  IHGYIEKSGIELDSKLATTVIDMYCKCGCLEKASEVFNELPQKGISSWNCMIGGLAMHGK  278

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A++LF++M R+   V P+ +TFV VL+AC+ +G VE G   F+ M +  G++PG EH
Sbjct  279  GEAAIELFKEMEREM--VAPDGITFVNVLSACAHSGLVEEGKHYFQYMTEVLGLKPGMEH  336

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            + C+VD+LGRAG++E A + I  MP+ P   V GAL+GACR+HG  ELG+     + +++
Sbjct  337  FGCMVDLLGRAGLLEEARKLINEMPVNPDAGVLGALVGACRIHGNTELGEQIGKKVIELE  396

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P +SG +V+L+N++AS+GRWE+   VRK M D G+KK
Sbjct  397  PHNSGRYVLLANLYASAGRWEDVAKVRKLMNDRGVKK  433


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 108/217 (50%), Gaps = 12/217 (6%)
 Frame = +2

Query  80   VFLKAR--EEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDM  253
            +F+ +R   + + P +F    ++ AC    A E G+ IH  V+K     + F  + L+ M
Sbjct  79   IFMYSRMLHKSVSPNKFTYPPLIRACCIDYAIEEGKQIHAHVLKFGFGADGFSLNNLIHM  138

Query  254  YGKCGCIEDCERAFYEMPE--RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPN  427
            Y     +E   R F  MP+  RN ++WNA+I  Y      + A  LF+ M  + ++VV +
Sbjct  139  YVNFQSLEQARRVFDNMPQRDRNSVSWNAMIAAYVQSNRLHEAFALFDRM--RLENVVLD  196

Query  428  YVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFI  607
                  +L+AC+  GA+E G  I     +K GIE  ++    V+DM  + G +E+A E  
Sbjct  197  KFVAASMLSACTGLGALEQGKWI-HGYIEKSGIELDSKLATTVIDMYCKCGCLEKASEVF  255

Query  608  KRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
              +P +  +S W  ++G   +HGK E    AA  LF+
Sbjct  256  NELP-QKGISSWNCMIGGLAMHGKGE----AAIELFK  287



>ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica]
 gb|EMJ27978.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica]
Length=624

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 185/277 (67%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N VSW ++++ Y Q+D   +A  +F K R E +E  +FM +S+LSAC GL A E G+ 
Sbjct  214  EKNSVSWNAMISSYVQSDRFHEAFALFQKMRVEKVELDKFMAASMLSACTGLGALEQGKW  273

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG + K+ +E +  + + ++DMY KCGC+E     F  +P + + +WN +IGG A  G 
Sbjct  274  IHGYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPHKGISSWNCMIGGLAMHGK  333

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A++LFE M R    V P+ +TFV VL+AC+ +G VE G   F++M + +GIEP  EH
Sbjct  334  GEAAIELFEKMQRDM--VAPDNITFVNVLSACAHSGLVEEGQRYFQSMVEVHGIEPRKEH  391

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            + C+VD+LGRAGM+E A + I  MP+ P V V GALLGAC++HG  ELG+     + +++
Sbjct  392  FGCMVDLLGRAGMLEEARKLISEMPMSPDVGVLGALLGACKIHGNVELGEHIGRIVIELE  451

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P++SG +V+L+N++A++GRWE+   VR+ M D G+KK
Sbjct  452  PENSGRYVLLANLYANAGRWEDVANVRRLMNDRGVKK  488


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/301 (25%), Positives = 136/301 (45%), Gaps = 40/301 (13%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            + +++  Y Q  L    + ++ +  ++ + P ++   SV+ AC    A   G+ +H  VV
Sbjct  88   YNTVMRGYLQCHLPRNCIVLYSQMLQDSVTPNKYTFPSVIRACCNDDAIGEGKQVHAHVV  147

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
            K     + F ++ L+ MY K   +E+  R F +M   + ++W  LI GY+  G  + A +
Sbjct  148  KLGYGADGFCQNNLIHMYVKFQSLEEARRVFDKMLRMDAVSWTTLITGYSQCGFVDEAFE  207

Query  383  LFEDMTRKT----QDVVPNYVTF-------------------------VCVLTACSRAGA  475
            LFE M  K       ++ +YV                             +L+AC+  GA
Sbjct  208  LFELMPEKNSVSWNAMISSYVQSDRFHEAFALFQKMRVEKVELDKFMAASMLSACTGLGA  267

Query  476  VETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
            +E G  I     +K GIE  ++    ++DM  + G +E+A+E    +P +  +S W  ++
Sbjct  268  LEQGKWI-HGYIEKSGIELDSKLATTIIDMYCKCGCLEKAFEVFNGLPHK-GISSWNCMI  325

Query  656  GACRVHGKPELGKIAADNLFQIDPQD--SGNHVILSNMF---ASSGRWEEANLVRKEMKD  820
            G   +HGK E    AA  LF+   +D  + +++   N+    A SG  EE     + M +
Sbjct  326  GGLAMHGKGE----AAIELFEKMQRDMVAPDNITFVNVLSACAHSGLVEEGQRYFQSMVE  381

Query  821  I  823
            +
Sbjct  382  V  382



>ref|XP_010654317.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Vitis vinifera]
Length=1138

 Score =   265 bits (677),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 179/277 (65%), Gaps = 3/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW  ++  Y Q    E+AL++F +A  E ++  +F  SSV+  C      ELG+ 
Sbjct  203  DRNVVSWSGMIYGYSQMGEDEEALRLFKQALIEDLDVNDFTFSSVVRVCGNSTLLELGKQ  262

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL +K   + + FV S L+ +Y KCG IED    F+E+P RNL  WNA++   A   H
Sbjct  263  IHGLCLKTSYDSSSFVGSSLISLYSKCGVIEDAYLVFHEIPIRNLGMWNAMLIACAQHAH  322

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A DLF+ M  +   + PN++TF+CVL ACS AG VE G   FE MK+ YGIEPGA+H
Sbjct  323  TEKAFDLFKQM--EGVGMKPNFITFLCVLYACSHAGLVEKGQFYFELMKE-YGIEPGAQH  379

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YA +VD+LGRAG ++ A   IK+MP+ PT SVWGALL  CR+HG  EL    AD +F++ 
Sbjct  380  YASMVDLLGRAGKLKDAVSIIKKMPMEPTESVWGALLTGCRIHGDTELASFVADRVFELG  439

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P  SG HV++SN +A++GR+EEA   RK ++D G+KK
Sbjct  440  PVSSGIHVLVSNAYAAAGRYEEAARARKMLRDQGVKK  476


 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 120/226 (53%), Gaps = 4/226 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++  +W S+++ + QN+L   A+  F +  + G+ P + +  S   AC  L+  ++G+S+
Sbjct  103  KSSTTWSSVISAFAQNELPSLAIDFFRRMLDNGVRPDDHIFPSATKACGILSRCDIGQSV  162

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   VK   + +VFV S +VDMY KCG I D  + F EMP+RN+++W+ +I GY+  G  
Sbjct  163  HSFAVKTGYDCDVFVGSSMVDMYAKCGEIGDARKMFDEMPDRNVVSWSGMIYGYSQMGED  222

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF+    +  DV  N  TF  V+  C  +  +E G  I   +  K   +  +   
Sbjct  223  EEALRLFKQALIEDLDV--NDFTFSSVVRVCGNSTLLELGKQI-HGLCLKTSYDSSSFVG  279

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            + ++ +  + G++E AY     +PIR  + +W A+L AC  H   E
Sbjct  280  SSLISLYSKCGVIEDAYLVFHEIPIR-NLGMWNAMLIACAQHAHTE  324


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 66/161 (41%), Gaps = 3/161 (2%)
 Frame = +2

Query  176  GRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAH  355
            G  +HG +VK+       V   L++ Y K        + F E P ++  TW+++I  +A 
Sbjct  58   GLQLHGHIVKSGFLTIHLVCHHLINFYSKSQLPHYSRQVFEETPVKSSTTWSSVISAFAQ  117

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPG  535
                ++A+D F  M      V P+   F     AC      + G  +  +   K G +  
Sbjct  118  NELPSLAIDFFRRML--DNGVRPDDHIFPSATKACGILSRCDIGQSV-HSFAVKTGYDCD  174

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
                + +VDM  + G +  A +    MP R  VS  G + G
Sbjct  175  VFVGSSMVDMYAKCGEIGDARKMFDEMPDRNVVSWSGMIYG  215



>ref|XP_010255945.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Nelumbo nucifera]
Length=756

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 178/277 (64%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSW S+++   QN    +AL++F + +  GIEP    +  +L ACA +AA   G++
Sbjct  346  ELNVVSWTSVISSCTQNGKDIEALELFREMQISGIEPNSVTIPCLLPACANIAALMHGKA  405

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H   ++  +  +V+V S LVDMY KCG I D  + F  MP RNL+ WNA++ GYA  G 
Sbjct  406  AHCFSIRRGISSDVYVGSALVDMYAKCGKIGDARKCFDGMPTRNLVCWNAIVRGYAMHGK  465

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  A++LF+ M R  Q   P++++F C+L+ACS+ G  E G   F +M   +GIE   EH
Sbjct  466  AKDAMELFDLMQRSGQ--TPDFISFTCILSACSQRGLTEEGWYYFNSMSQDHGIEARMEH  523

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+V +L RAG +E AY+ IK+MP  P   VWGALL + R+HG   +GK AAD LF+++
Sbjct  524  YACMVTLLSRAGRIEEAYDMIKKMPSEPDACVWGALLSSSRIHGNVSMGKTAADKLFKLE  583

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P + GN+V+LSN++A+ G W E + VR  MKD+G++K
Sbjct  584  PSNPGNYVLLSNIYAAKGMWSEVDRVRDMMKDMGLRK  620


 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 109/195 (56%), Gaps = 3/195 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E +  S+ +L++ + + D  ++AL++  +    G+ P  F++ SVL AC GL+A E+GR 
Sbjct  74   EPDVFSFSTLISAFSKFDRFDQALRLVSQMLSHGLLPDNFVLPSVLKACVGLSALEMGRQ  133

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGL        + FV+S L++MY K G I +  + F  M  RN+++W+A+I GYA QG 
Sbjct  134  VHGLAYVTGFASDPFVQSSLINMYVKFGDIRNAHKVFDGMTHRNVVSWSAIIAGYAQQGF  193

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A +LF +M  +   + PN +++  ++  C+ +G     + +F+ M  + G +P    
Sbjct  194  VGEAKELFIEM--RDSGMEPNTISWNGLIAGCNHSGFSAESVALFQKMHLE-GFKPDGIS  250

Query  545  YACVVDMLGRAGMVE  589
             +C +  +G  G V+
Sbjct  251  ISCSLPAVGDLGDVK  265


 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 70/262 (27%), Positives = 117/262 (45%), Gaps = 39/262 (15%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N +SW  L+A    +    +++ +F K   EG +P    +S  L A   L   +LG  
Sbjct  210  EPNTISWNGLIAGCNHSGFSAESVALFQKMHLEGFKPDGISISCSLPAVGDLGDVKLGVQ  269

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG ++K  +  +  V S L+DMYGKCG   +  + F EM E +L + NAL+ G +  G 
Sbjct  270  IHGNIIKQGLGSDKCVVSALIDMYGKCGHTLEMWQVFDEMSEMDLGSCNALVAGLSRNGL  329

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL +F     + +++  N V++  V+++C++ G     +++F  M+   GIEP +  
Sbjct  330  VDDALRIFRQFEAQGKEL--NVVSWTSVISSCTQNGKDIEALELFREMQIS-GIEPNSVT  386

Query  545  YAC-----------------------------------VVDMLGRAGMVERAYEFIKRMP  619
              C                                   +VDM  + G +  A +    MP
Sbjct  387  IPCLLPACANIAALMHGKAAHCFSIRRGISSDVYVGSALVDMYAKCGKIGDARKCFDGMP  446

Query  620  IRPTVSVWGALLGACRVHGKPE  685
             R  V  W A++    +HGK +
Sbjct  447  TRNLV-CWNAIVRGYAMHGKAK  467



>ref|XP_006468176.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16470-like 
[Citrus sinensis]
Length=431

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/277 (42%), Positives = 171/277 (62%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ +SW +++A Y Q    E  L  + K RE G+ P ++  +S+  ACA LA  + G+ 
Sbjct  109  QKSLISWNAIIAGYVQKGFEEVGLDYYYKMRENGLRPDQYTFASIFRACATLATLDYGKR  168

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HGL++K  + ENV V S L+DMY KC  I D  + F ++  RN++TW +LI GY   G 
Sbjct  169  AHGLMIKCGIRENVVVNSALIDMYFKCSSISDGRQVFDKLSNRNVVTWTSLIAGYGQHGR  228

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                  LF  MT  ++   PNYVTF+ VL+AC   G V  G D F +M   YGI+P  +H
Sbjct  229  VVEVFQLFHRMT--SEGFRPNYVTFLAVLSACDHGGLVNKGWDYFSSMLRDYGIQPRGKH  286

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YA +VD+LGRAG ++ AYEF+   P      VWGALLGACR+HG  +L K+AA   F++D
Sbjct  287  YAAIVDLLGRAGKLQEAYEFVLSSPCMEHSVVWGALLGACRIHGDIDLVKVAAKKYFELD  346

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+++G +V+L+N +A+ G W+    VR  M+++G+ K
Sbjct  347  PENAGKYVVLANAYANVGSWDNVEEVRGMMRNLGVVK  383


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 86/192 (45%), Gaps = 4/192 (2%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDC  283
            G++  E   + +L  C     +  GR IH  +V      N ++++ L+ +Y K G +   
Sbjct  41   GLKVDEGTYALLLQECIFTKEYRKGRRIHAQMVIVGYVPNEYIKTKLLILYAKYGDLVTA  100

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
               F +  +++LI+WNA+I GY  +G   + LD +  M  +   + P+  TF  +  AC+
Sbjct  101  HVLFDKPQQKSLISWNAIIAGYVQKGFEEVGLDYYYKM--RENGLRPDQYTFASIFRACA  158

Query  464  RAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVW  643
                ++ G      M  K GI       + ++DM  +   +    +   ++  R  V+ W
Sbjct  159  TLATLDYGKRAHGLMI-KCGIRENVVVNSALIDMYFKCSSISDGRQVFDKLSNRNVVT-W  216

Query  644  GALLGACRVHGK  679
             +L+     HG+
Sbjct  217  TSLIAGYGQHGR  228



>ref|NP_001182909.1| uncharacterized protein LOC100501193 [Zea mays]
 gb|ACR35094.1| unknown [Zea mays]
Length=402

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 175/275 (64%), Gaps = 2/275 (1%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N VS  SL+  Y +    E+AL+ + +   +G+EP EF  +S++  CA     E G  +H
Sbjct  125  NVVSATSLIDGYVEAGRIEEALETYTELGRQGVEPNEFTFASMIKGCAMHDLLEQGAQLH  184

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
              V+K  +  + FV S LV MYG CG I    + F E+  R  I WNA+I  YA  GH  
Sbjct  185  AQVLKTNLISDSFVGSTLVYMYGNCGLISLSLQLFNEIGYRTEIAWNAVINVYAQHGHGW  244

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
             A+  F+ MT  +  + PN++TFVC+LTACS AG V+ G+  F +MKD +GIEP AEHY+
Sbjct  245  GAIQAFDRMT--SSGIRPNHITFVCLLTACSHAGLVDEGLGYFHSMKDAHGIEPKAEHYS  302

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQ  730
            C++DM GRAG ++ A +FI  MP++P+   W +LLGACR+ G  ELG++AA NL ++DP 
Sbjct  303  CIIDMYGRAGRLDEAEKFISEMPVKPSAYAWCSLLGACRMQGNKELGEVAAQNLMKLDPN  362

Query  731  DSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++G H+ LS ++ S G+WE+   V+K MKDI IKK
Sbjct  363  NTGIHISLSGIYTSLGQWEDVKAVKKSMKDISIKK  397


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 109/226 (48%), Gaps = 6/226 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEG-IEPTEFMVSSVLSACAGLAAFELGR  181
            +++ V+W +++  Y +N   E A+ +F   + EG +   + +  S LSA  GL     GR
Sbjct  20   QKDAVTWTTMIDGYAKNGSLEAAILIFRDMKCEGLVGADQHVFCSALSASGGLKDGWFGR  79

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER-NLITWNALIGGYAHQ  358
            S+H  ++KA  E    VR+ L+DMY K G +E+  R     P   N+++  +LI GY   
Sbjct  80   SLHCCIIKAGFELETVVRNALLDMYAKSGDLENASRVVSIDPGGWNVVSATSLIDGYVEA  139

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G    AL+ + ++ R  Q V PN  TF  ++  C+    +E G  +  A   K  +   +
Sbjct  140  GRIEEALETYTELGR--QGVEPNEFTFASMIKGCAMHDLLEQGAQL-HAQVLKTNLISDS  196

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               + +V M G  G++  + +    +  R  ++ W A++     HG
Sbjct  197  FVGSTLVYMYGNCGLISLSLQLFNEIGYRTEIA-WNAVINVYAQHG  241


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 66/151 (44%), Gaps = 11/151 (7%)
 Frame = +2

Query  251  MYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNY  430
            MY KCG + +  R F +MP+++ +TW  +I GYA  G    A+ +F DM  K + +V   
Sbjct  1    MYSKCGLLHEACRVFDQMPQKDAVTWTTMIDGYAKNGSLEAAILIFRDM--KCEGLVGAD  58

Query  431  VTFVCVLTACSRAGAVETGM--DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEF  604
                C  +A S +G ++ G           K G E        ++DM  ++G +E A   
Sbjct  59   QHVFC--SALSASGGLKDGWFGRSLHCCIIKAGFELETVVRNALLDMYAKSGDLENASRV  116

Query  605  IKRMPIRPTVSVWGALLGACRVHGKPELGKI  697
            +   P       W  +     + G  E G+I
Sbjct  117  VSIDP-----GGWNVVSATSLIDGYVEAGRI  142



>ref|XP_006663835.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Oryza brachyantha]
Length=630

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 179/277 (65%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+  V+W SL A Y QN L E+AL +F  A+  GI+ TEF VSS+LS CA LA    G  
Sbjct  220  EKTSVTWSSLFAGYVQNGLHEEALCLFRSAQRGGIQLTEFTVSSILSTCASLALIIEGTQ  279

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H ++VK+    N+FV + LVD+Y +CG IE     F +M ++N++ WNA+I  ++   H
Sbjct  280  VHAVIVKSGFHSNLFVATSLVDVYARCGQIERSYEVFADMEQKNVVLWNAMIASFSRHAH  339

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            +  A+ LFE M  +   + PN VT++ VL+ACS  G VE G   F  +     +EP   H
Sbjct  340  SWEAMILFEKM--QQVGISPNEVTYLSVLSACSHTGLVEEGRHYFNLLTSDRTVEPNVLH  397

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y+C+VD+LGR+G  + A++ +++MP  PT S+WG+LLG+CR+H    L +IAA+ LF ++
Sbjct  398  YSCMVDVLGRSGETDEAWKLLEKMPFEPTASMWGSLLGSCRIHKNVRLARIAAEQLFHLE  457

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P++ GNHV+LSN++A+SG WE   + RK ++  G KK
Sbjct  458  PENGGNHVLLSNVYAASGNWENVVMARKYLRCSGAKK  494


 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 114/238 (48%), Gaps = 4/238 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW +++A Y  N    +ALK+F +   EG + T+F +SS L ACA   A    + +
Sbjct  120  RSIVSWNTMIAGYTHNREDVEALKLFSRMHREGTQMTKFTLSSTLCACAAKYAIIECKQL  179

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + +K  ++ + FV + ++D+Y KC  I+D    F  MPE+  +TW++L  GY   G  
Sbjct  180  HTIAIKLALDSSSFVGTAVLDVYAKCNMIKDACSIFERMPEKTSVTWSSLFAGYVQNGLH  239

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF    R    +     T   +L+ C+    +  G  +  A+  K G        
Sbjct  240  EEALCLFRSAQRGGIQLTE--FTVSSILSTCASLALIIEGTQV-HAVIVKSGFHSNLFVA  296

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
              +VD+  R G +ER+YE    M  +  V +W A++ +   H       I  + + Q+
Sbjct  297  TSLVDVYARCGQIERSYEVFADME-QKNVVLWNAMIASFSRHAHSWEAMILFEKMQQV  353


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/177 (25%), Positives = 83/177 (47%), Gaps = 4/177 (2%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP  307
            + ++L  C    +  +G+S HGL +   +  +    ++L+++Y KCG  +   R F  M 
Sbjct  59   LHNLLQLCVKSRSLLVGKSCHGLAIHFGLVTDTVTCNILINLYTKCGQNDCARRVFDAMS  118

Query  308  ERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETG  487
             R++++WN +I GY H      AL LF  M R+   +     T    L AC+   A+   
Sbjct  119  VRSIVSWNTMIAGYTHNREDVEALKLFSRMHREGTQMTK--FTLSSTLCACAAKYAIIEC  176

Query  488  MDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              +   +  K  ++  +     V+D+  +  M++ A    +RMP + +V+ W +L  
Sbjct  177  KQL-HTIAIKLALDSSSFVGTAVLDVYAKCNMIKDACSIFERMPEKTSVT-WSSLFA  231


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/228 (25%), Positives = 96/228 (42%), Gaps = 21/228 (9%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +++N V W +++A + ++    +A+ +F K ++ GI P E    SVLSAC+     E GR
Sbjct  320  EQKNVVLWNAMIASFSRHAHSWEAMILFEKMQQVGISPNEVTYLSVLSACSHTGLVEEGR  379

Query  182  SIHGLVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAH  355
                L+     VE NV   S +VD+ G+ G  ++  +   +MP E     W +L+G    
Sbjct  380  HYFNLLTSDRTVEPNVLHYSCMVDVLGRSGETDEAWKLLEKMPFEPTASMWGSLLGSCRI  439

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTA---------------CSRAGAVETGM  490
              +  +A    E +     +   N+V    V  A               CS A   E G 
Sbjct  440  HKNVRLARIAAEQLFHLEPENGGNHVLLSNVYAASGNWENVVMARKYLRCSGAKK-EMGR  498

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTV  634
               EA  + +    G   +  + D+  +   +E  Y  ++R+  RP  
Sbjct  499  SWIEAKGNVHVFVVGEREHPGITDVHNK---LEEIYHEMRRISYRPNT  543



>ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
Length=624

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 185/277 (67%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +++A Y Q++   +A  +F + R E +   +F+ +S+LSAC GL A E G+ 
Sbjct  214  ERNSVSWNAMIAAYVQSNRLHEAFALFDRMRLENVVLDKFVAASMLSACTGLGALEQGKW  273

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG + K+ +E +  + + ++DMY KCGC+E     F E+P++ + +WN +IGG A  G 
Sbjct  274  IHGYIEKSGIELDSKLATTVIDMYCKCGCLEKASEVFNELPQKGISSWNCMIGGLAMHGK  333

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A++LF++M R+   V P+ +TFV VL+AC+ +G VE G   F+ M +  G++PG EH
Sbjct  334  GEAAIELFKEMEREM--VAPDGITFVNVLSACAHSGLVEEGKHYFQYMTEVLGLKPGMEH  391

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            + C+VD+LGRAG++E A + I  MP+ P   V GAL+GACR+HG  ELG+     + +++
Sbjct  392  FGCMVDLLGRAGLLEEARKLINEMPVNPDAGVLGALVGACRIHGNTELGEQIGKKVIELE  451

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P +SG +V+L+N++AS+GRWE+   VRK M D G+KK
Sbjct  452  PHNSGRYVLLANLYASAGRWEDVAKVRKLMNDRGVKK  488


 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 112/244 (46%), Gaps = 37/244 (15%)
 Frame = +2

Query  80   VFLKAR--EEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDM  253
            +F+ +R   + + P +F    ++ AC    A E G+ IH  V+K     + F  + L+ M
Sbjct  105  IFMYSRMLHKSVSPNKFTYPPLIRACCIDYAIEEGKQIHAHVLKFGFGADGFSLNNLIHM  164

Query  254  YGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKT--------  409
            Y     +E   R F  MP+R++++W +LI GY+  G  + A ++FE M  +         
Sbjct  165  YVNFQSLEQARRVFDNMPQRDVVSWTSLITGYSQWGFVDKAREVFELMPERNSVSWNAMI  224

Query  410  ---------------------QDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
                                 ++VV +      +L+AC+  GA+E G  I     +K GI
Sbjct  225  AAYVQSNRLHEAFALFDRMRLENVVLDKFVAASMLSACTGLGALEQGKWI-HGYIEKSGI  283

Query  527  EPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAAD  706
            E  ++    V+DM  + G +E+A E    +P +  +S W  ++G   +HGK E    AA 
Sbjct  284  ELDSKLATTVIDMYCKCGCLEKASEVFNELP-QKGISSWNCMIGGLAMHGKGE----AAI  338

Query  707  NLFQ  718
             LF+
Sbjct  339  ELFK  342



>emb|CAN74095.1| hypothetical protein VITISV_023708 [Vitis vinifera]
Length=906

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 184/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VS+ S++  Y Q   GE+ALK+FL+ ++  ++P  F+ SS+L+ACA L+AFE G+ +H  
Sbjct  500  VSFTSMITAYAQYGQGEEALKLFLEMQDMELKPDRFVCSSLLNACANLSAFEQGKQLHVH  559

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     ++F  + LV+MY KCG I+D  RAF E+ ER +++W+A+IGG A  GH   A
Sbjct  560  ILKYGFVLDIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIVSWSAMIGGLAQHGHGRQA  619

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF  M +  + V PN++T V VL AC+ AG V      FE+M++ +G +P  EHYAC+
Sbjct  620  LQLFNQMLK--EGVSPNHITLVSVLGACNHAGLVTEAKLYFESMEELFGFKPMQEHYACM  677

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +  A E + +MP     SVWGALLGA R+H   ELG+ AA+ LF ++P+ S
Sbjct  678  IDLLGRAGKINEAVELVNKMPFEANASVWGALLGAARIHKDVELGRRAAEMLFILEPEKS  737

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G+WE    VR+ M+D  +KK
Sbjct  738  GTHVLLANIYASAGKWENVAEVRRLMRDSKVKK  770


 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 113/227 (50%), Gaps = 4/227 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN LG  AL  F +    G++  EF  SSVL AC+ +    +G+ 
Sbjct  119  EPDLVSWSALISGYAQNGLGGGALMAFHEMHLLGVKCNEFTFSSVLKACSIVKDLRIGKQ  178

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+VV +  E +VFV + LV MY KC    D +R F E+PERN+++WNAL   Y     
Sbjct  179  VHGVVVVSGFEGDVFVANTLVVMYAKCDEFLDSKRLFDEIPERNVVSWNALFSCYVQXDF  238

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF +M      + PN  +   ++ AC+       G  I      K G +     
Sbjct  239  CGEAVGLFYEMV--LSGIKPNEFSLSSMVNACTGLRDSSRG-KIIHGYLIKLGYDWDPFS  295

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
               +VDM  + G +  A    +++  +P +  W A++  C +H   E
Sbjct  296  ANALVDMYAKVGDLADAISVFEKIK-QPDIVSWNAVIAGCVLHEHHE  341


 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 141/279 (51%), Gaps = 15/279 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ ++W ++++ Y Q     +AL +F++  +EGI   +  +S++L + AGL    + R 
Sbjct  395  EKDLIAWNAIISGYSQYWEDMEALSLFVEMHKEGIGFNQTTLSTILKSTAGLQVVHVCRQ  454

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGL VK+    +++V + L+D YGKC  +ED ER F E    +L+++ ++I  YA  G 
Sbjct  455  VHGLSVKSGFHSDIYVVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQ  514

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL LF +M    QD+      FVC  +L AC+   A E G  +   +  KYG     
Sbjct  515  GEEALKLFLEM----QDMELKPDRFVCSSLLNACANLSAFEQGKQLHVHIL-KYGFVLDI  569

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                 +V+M  + G ++ A      +  R  VS W A++G    HG    G+ A     Q
Sbjct  570  FAGNSLVNMYAKCGSIDDAGRAFSELTERGIVS-WSAMIGGLAQHGH---GRQALQLFNQ  625

Query  719  IDPQD-SGNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
            +  +  S NH+ L ++  +   +G   EA L  + M+++
Sbjct  626  MLKEGVSPNHITLVSVLGACNHAGLVTEAKLYFESMEEL  664


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 77/134 (57%), Gaps = 0/134 (0%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y Q D   +A+ +F +    GI+P EF +SS+++AC GL     G+ 
Sbjct  220  ERNVVSWNALFSCYVQXDFCGEAVGLFYEMVLSGIKPNEFSLSSMVNACTGLRDSSRGKI  279

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG ++K   + + F  + LVDMY K G + D    F ++ + ++++WNA+I G     H
Sbjct  280  IHGYLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQPDIVSWNAVIAGCVLHEH  339

Query  365  ANMALDLFEDMTRK  406
               AL+L   M R+
Sbjct  340  HEQALELLGQMKRQ  353


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/255 (27%), Positives = 116/255 (45%), Gaps = 38/255 (15%)
 Frame = +2

Query  170  ELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGY  349
            ++ R +H  ++K  +E ++FV   LVDMY KC  +ED   AF  +PE++LI WNA+I GY
Sbjct  349  QMKRQLHSSLMKMDMESDLFVSVGLVDMYSKCDLLEDARMAFNLLPEKDLIAWNAIISGY  408

Query  350  AHQGHANMALDLFEDMTRK-------TQDVVPNYVTFVCVLTACSRAG--AVETGM--DI  496
            +       AL LF +M ++       T   +      + V+  C +    +V++G   DI
Sbjct  409  SQYWEDMEALSLFVEMHKEGIGFNQTTLSTILKSTAGLQVVHVCRQVHGLSVKSGFHSDI  468

Query  497  F--EAMKDKYGIEPGAE---------------HYACVVDMLGRAGMVERAYEF---IKRM  616
            +   ++ D YG     E                +  ++    + G  E A +    ++ M
Sbjct  469  YVVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLEMQDM  528

Query  617  PIRPTVSVWGALLGACRVHGKPELGKIAADNL----FQIDPQDSGNHVILSNMFASSGRW  784
             ++P   V  +LL AC      E GK    ++    F +D   +GN ++  NM+A  G  
Sbjct  529  ELKPDRFVCSSLLNACANLSAFEQGKQLHVHILKYGFVLDIF-AGNSLV--NMYAKCGSI  585

Query  785  EEANLVRKEMKDIGI  829
            ++A     E+ + GI
Sbjct  586  DDAGRAFSELTERGI  600


 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 79/187 (42%), Gaps = 5/187 (3%)
 Frame = +2

Query  113  PTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERA  292
            PT    S +LS C    +   G  IH  + K+ + ++  +R+ L+++Y KC       + 
Sbjct  54   PTSVSYSKLLSQCCTTKSLRPGLQIHAHITKSGLSDDPSIRNHLINLYSKCRXFGYARKL  113

Query  293  FYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAG  472
              E  E +L++W+ALI GYA  G    AL  F +M      V  N  TF  VL ACS   
Sbjct  114  VDESSEPDLVSWSALISGYAQNGLGGGALMAFHEM--HLLGVKCNEFTFSSVLKACSIVK  171

Query  473  AVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGAL  652
             +  G  +   +    G E        +V M  +      +      +P R  VS W AL
Sbjct  172  DLRIGKQVHGVVVVS-GFEGDVFVANTLVVMYAKCDEFLDSKRLFDEIPERNVVS-WNAL  229

Query  653  LGACRVH  673
              +C V 
Sbjct  230  F-SCYVQ  235



>ref|XP_007148792.1| hypothetical protein PHAVU_005G014700g [Phaseolus vulgaris]
 gb|ESW20786.1| hypothetical protein PHAVU_005G014700g [Phaseolus vulgaris]
Length=814

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 183/277 (66%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++  V+W +++  Y QN    +AL +F + +   I+P  F + SV++A A L+     + 
Sbjct  405  QKTIVTWNAMILGYAQNGCINEALNLFCEMQSHDIKPDSFTLVSVVTALADLSVTRQAKW  464

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL ++  +++NVFV + LVD Y KCG I+     F  M ER++ITWNA+I  Y   GH
Sbjct  465  IHGLTIRTLMDKNVFVCTALVDTYAKCGAIQTARNLFDMMEERHVITWNAMIDAYGTHGH  524

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               ALDLF+DM + +  V PN +TF+ V+ ACS +G VE G+  FE+MK+ YG+ P  +H
Sbjct  525  GKEALDLFDDMQKGS--VKPNEITFLSVIAACSHSGLVEEGLYYFESMKENYGLRPSMDH  582

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y  +VD+LGRAG ++ A++FI+ MP++P +SV GA+LGAC++H   ELG+  AD LF++D
Sbjct  583  YGAMVDLLGRAGRLDDAWKFIQDMPVKPGISVLGAMLGACKIHKNVELGEKVADELFELD  642

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P + G HV+L+NM+AS+  WE+   VR  M+  GIKK
Sbjct  643  PDEGGYHVLLANMYASASMWEKVARVRTAMEKKGIKK  679


 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 110/228 (48%), Gaps = 4/228 (2%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +++  V + ++L  Y +N     ALK F + R + + P  +  + +L  C        GR
Sbjct  101  EQKLDVLYHTMLKGYAKNSALRDALKFFGRMRFDEVSPVVYDFTYLLQLCGDSLDLTRGR  160

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HG+V+    + N+F  + +V++Y KC  +ED  + F  MP+R+L++WN ++ G+A  G
Sbjct  161  EVHGMVITNGFQSNLFAMTAVVNLYAKCRQVEDAYKMFERMPQRDLVSWNTVVAGFAQNG  220

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             A  A+ L   M    Q   P+ +T V VL A +   A+  G  +      + G E    
Sbjct  221  LARRAVQLVLQMQEAGQK--PDSITLVTVLPALADVKALRIGKSV-HGYAFRAGFESKIN  277

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
             +  ++DM  + G V+ A    K M  R  VS W  ++     +G+ E
Sbjct  278  VWTAMLDMYFKCGSVKNARLVFKGMSSRNVVS-WNTMINGFEQNGESE  324


 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 112/217 (52%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW +++A + QN L  +A+++ L+ +E G +P    + +VL A A + A  +G+S
Sbjct  203  QRDLVSWNTVVAGFAQNGLARRAVQLVLQMQEAGQKPDSITLVTVLPALADVKALRIGKS  262

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG   +A  E  + V + ++DMY KCG +++    F  M  RN+++WN +I G+   G 
Sbjct  263  VHGYAFRAGFESKINVWTAMLDMYFKCGSVKNARLVFKGMSSRNVVSWNTMINGFEQNGE  322

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            +  A  +F  M    + V P  V+ +  L AC+  G +E G  +   +++K  +      
Sbjct  323  SEEAFAMFLKML--DEGVEPTNVSMMGALHACANLGDLERGRFVHRLLEEK-KLGSDVSV  379

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               ++ M  +   V+ A      +  + T+  W A++
Sbjct  380  MNSLISMYSKCKRVDIAASLFGNLK-QKTIVTWNAMI  415



>emb|CAN61868.1| hypothetical protein VITISV_002466 [Vitis vinifera]
Length=440

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 186/277 (67%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ +SW SL+     N   E+AL++F + R  GI P + ++++VLSACA L   E G+ 
Sbjct  30   DKDVISWTSLVTGCVHNGSYEEALRLFCEMRIMGIHPDQIVIAAVLSACAELTVLEFGKQ  89

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H   +K+ +  ++ V + LV MY KCGCIED  + F  M  +++ITW ALI GYA  G 
Sbjct  90   VHANFLKSGLGSSLSVDNSLVSMYAKCGCIEDANKVFDSMEIQDVITWTALIVGYAQNGR  149

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               +L+ + +M      V P+++TF+ +L ACS AG VE G   F++M++ YGI+PG EH
Sbjct  150  GRESLNFYNBMI--ASGVKPDFITFIGLLFACSHAGLVEHGRSYFQSMEEVYGIKPGPEH  207

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC++D+LGR+G +  A E + +M ++P  +VW ALL ACRVHG  ELG+ AA+NLF+++
Sbjct  208  YACMIDLLGRSGKLMEAKELLNQMAVQPDATVWKALLAACRVHGNVELGERAANNLFELE  267

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+++  +V+LSN+++++G+WEEA   R+ MK  G+ K
Sbjct  268  PKNAVPYVLLSNLYSAAGKWEEAAKTRRLMKLRGVSK  304


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 69/143 (48%), Gaps = 4/143 (3%)
 Frame = +2

Query  227  FVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRK  406
             V + LVDMY K G  +     F +M ++++I+W +L+ G  H G    AL LF +M  +
Sbjct  3    LVNNALVDMYAKXGYFDYAFDVFEKMTDKDVISWTSLVTGCVHNGSYEEALRLFCEM--R  60

Query  407  TQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMV  586
               + P+ +    VL+AC+    +E G  +  A   K G+         +V M  + G +
Sbjct  61   IMGIHPDQIVIAAVLSACAELTVLEFGKQV-HANFLKSGLGSSLSVDNSLVSMYAKCGCI  119

Query  587  ERAYEFIKRMPIRPTVSVWGALL  655
            E A +    M I+  ++ W AL+
Sbjct  120  EDANKVFDSMEIQDVIT-WTALI  141



>ref|XP_002273710.2| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Vitis vinifera]
Length=933

 Score =   263 bits (672),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 184/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VS+ S++  Y Q   GE+ALK+FL+ ++  ++P  F+ SS+L+ACA L+AFE G+ +H  
Sbjct  527  VSFTSMITAYAQYGQGEEALKLFLEMQDMELKPDRFVCSSLLNACANLSAFEQGKQLHVH  586

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     ++F  + LV+MY KCG I+D  RAF E+ ER +++W+A+IGG A  GH   A
Sbjct  587  ILKYGFVLDIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIVSWSAMIGGLAQHGHGRQA  646

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF  M +  + V PN++T V VL AC+ AG V      FE+M++ +G +P  EHYAC+
Sbjct  647  LQLFNQMLK--EGVSPNHITLVSVLGACNHAGLVTEAKLYFESMEELFGFKPMQEHYACM  704

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +  A E + +MP     SVWGALLGA R+H   ELG+ AA+ LF ++P+ S
Sbjct  705  IDLLGRAGKINEAVELVNKMPFEANASVWGALLGAARIHKDVELGRRAAEMLFILEPEKS  764

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G+WE    VR+ M+D  +KK
Sbjct  765  GTHVLLANIYASAGKWENVAEVRRLMRDSKVKK  797


 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 113/227 (50%), Gaps = 4/227 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN LG  AL  F +    G++  EF  SSVL AC+ +    +G+ 
Sbjct  119  EPDLVSWSALISGYAQNGLGGGALMAFHEMHLLGVKCNEFTFSSVLKACSIVKDLRIGKQ  178

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+VV +  E +VFV + LV MY KC    D +R F E+PERN+++WNAL   Y     
Sbjct  179  VHGVVVVSGFEGDVFVANTLVVMYAKCDEFLDSKRLFDEIPERNVVSWNALFSCYVQIDF  238

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF +M      + PN  +   ++ AC+       G  I      K G +     
Sbjct  239  CGEAVGLFYEMV--LSGIKPNEFSLSSMVNACTGLRDSSRG-KIIHGYLIKLGYDWDPFS  295

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
               +VDM  + G +  A    +++  +P +  W A++  C +H   E
Sbjct  296  ANALVDMYAKVGDLADAISVFEKIK-QPDIVSWNAVIAGCVLHEHHE  341


 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 141/279 (51%), Gaps = 15/279 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ ++W ++++ Y Q     +AL +F++  +EGI   +  +S++L + AGL    + R 
Sbjct  422  EKDLIAWNAIISGYSQYWEDMEALSLFVEMHKEGIGFNQTTLSTILKSTAGLQVVHVCRQ  481

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HGL VK+    +++V + L+D YGKC  +ED ER F E    +L+++ ++I  YA  G 
Sbjct  482  VHGLSVKSGFHSDIYVVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQ  541

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL LF +M    QD+      FVC  +L AC+   A E G  +   +  KYG     
Sbjct  542  GEEALKLFLEM----QDMELKPDRFVCSSLLNACANLSAFEQGKQLHVHIL-KYGFVLDI  596

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                 +V+M  + G ++ A      +  R  VS W A++G    HG    G+ A     Q
Sbjct  597  FAGNSLVNMYAKCGSIDDAGRAFSELTERGIVS-WSAMIGGLAQHGH---GRQALQLFNQ  652

Query  719  IDPQD-SGNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
            +  +  S NH+ L ++  +   +G   EA L  + M+++
Sbjct  653  MLKEGVSPNHITLVSVLGACNHAGLVTEAKLYFESMEEL  691


 Score =   111 bits (278),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 111/217 (51%), Gaps = 4/217 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y Q D   +A+ +F +    GI+P EF +SS+++AC GL     G+ 
Sbjct  220  ERNVVSWNALFSCYVQIDFCGEAVGLFYEMVLSGIKPNEFSLSSMVNACTGLRDSSRGKI  279

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG ++K   + + F  + LVDMY K G + D    F ++ + ++++WNA+I G     H
Sbjct  280  IHGYLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQPDIVSWNAVIAGCVLHEH  339

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL+L   M R    + PN  T    L AC+  G  E G  +  ++  K  +E     
Sbjct  340  HEQALELLGQMKR--SGICPNIFTLSSALKACAGMGLKELGRQLHSSLM-KMDMESDLFV  396

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
               +VDM  +  ++E A      +P +  ++ W A++
Sbjct  397  SVGLVDMYSKCDLLEDARMAFNLLPEKDLIA-WNAII  432


 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 147/306 (48%), Gaps = 38/306 (12%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++A    ++  E+AL++  + +  GI P  F +SS L ACAG+   ELGR +H  
Sbjct  325  VSWNAVIAGCVLHEHHEQALELLGQMKRSGICPNIFTLSSALKACAGMGLKELGRQLHSS  384

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K  +E ++FV   LVDMY KC  +ED   AF  +PE++LI WNA+I GY+       A
Sbjct  385  LMKMDMESDLFVSVGLVDMYSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEA  444

Query  377  LDLFEDMTRK-------TQDVVPNYVTFVCVLTACSRAG--AVETGM--DIF--EAMKDK  517
            L LF +M ++       T   +      + V+  C +    +V++G   DI+   ++ D 
Sbjct  445  LSLFVEMHKEGIGFNQTTLSTILKSTAGLQVVHVCRQVHGLSVKSGFHSDIYVVNSLIDS  504

Query  518  YGIEPGAE---------------HYACVVDMLGRAGMVERAYEF---IKRMPIRPTVSVW  643
            YG     E                +  ++    + G  E A +    ++ M ++P   V 
Sbjct  505  YGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLEMQDMELKPDRFVC  564

Query  644  GALLGACRVHGKPELGKIAADNL----FQIDPQDSGNHVILSNMFASSGRWEEANLVRKE  811
             +LL AC      E GK    ++    F +D   +GN ++  NM+A  G  ++A     E
Sbjct  565  SSLLNACANLSAFEQGKQLHVHILKYGFVLDIF-AGNSLV--NMYAKCGSIDDAGRAFSE  621

Query  812  MKDIGI  829
            + + GI
Sbjct  622  LTERGI  627


 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 79/187 (42%), Gaps = 5/187 (3%)
 Frame = +2

Query  113  PTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERA  292
            PT    S +LS C    +   G  IH  + K+ + ++  +R+ L+++Y KC       + 
Sbjct  54   PTSVSYSKLLSQCCTTKSLRPGLQIHAHITKSGLSDDPSIRNHLINLYSKCRNFGYARKL  113

Query  293  FYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAG  472
              E  E +L++W+ALI GYA  G    AL  F +M      V  N  TF  VL ACS   
Sbjct  114  VDESSEPDLVSWSALISGYAQNGLGGGALMAFHEM--HLLGVKCNEFTFSSVLKACSIVK  171

Query  473  AVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGAL  652
             +  G  +   +    G E        +V M  +      +      +P R  VS W AL
Sbjct  172  DLRIGKQVHGVVVVS-GFEGDVFVANTLVVMYAKCDEFLDSKRLFDEIPERNVVS-WNAL  229

Query  653  LGACRVH  673
              +C V 
Sbjct  230  F-SCYVQ  235



>gb|KDO45403.1| hypothetical protein CISIN_1g0074162mg, partial [Citrus sinensis]
Length=494

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 175/277 (63%), Gaps = 3/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  ++  Y Q+    +AL +F +A  E ++  +F  SSVL+ C      ELG+ 
Sbjct  201  ERNVVSWTGMIYGYAQSGETGEALSLFKQALYENLDVNDFTFSSVLNVCGNTTVLELGKQ  260

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL VK   + + FV S L+ +Y KCG IE   R F E+  RNL  WNA++   A   H
Sbjct  261  IHGLCVKTSFDSSSFVGSSLISLYSKCGVIEPAYRVFEEVRVRNLGMWNAMLIACAQHSH  320

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N   DLF++M R    + PN+++F+CVL ACS AG VE G   FE M +KYG++P A H
Sbjct  321  MNKVFDLFKEMERF--GLKPNFISFLCVLYACSHAGLVEKGKYYFELM-NKYGVDPAAHH  377

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            +A +VD+LGRAG ++ A   I++MPI PT SVWGALL  CR+HG  EL   AAD +F++ 
Sbjct  378  FASLVDLLGRAGKLQEAISVIEKMPIAPTESVWGALLTGCRIHGNTELAAYAADRVFELG  437

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
                G +V+LSN +A++GRWE+A   RK ++D G+KK
Sbjct  438  IVSPGMNVLLSNAYAAAGRWEDAAKARKMLRDQGVKK  474


 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 116/223 (52%), Gaps = 4/223 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++  +W S+++ + QN+L   AL+ F +   E   P + +  S   +CA L  F  G SI
Sbjct  101  KSATTWSSVISSFAQNELPCLALEYFRRMIGERRFPDDHIFPSATKSCAILGDFNAGASI  160

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H LVVK   + +VFV S L+DMY KCG ++   + F EMPERN+++W  +I GYA  G  
Sbjct  161  HCLVVKIGYDFDVFVNSSLLDMYAKCGQLKTARKVFDEMPERNVVSWTGMIYGYAQSGET  220

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF+    +  DV  N  TF  VL  C     +E G  I   +  K   +  +   
Sbjct  221  GEALSLFKQALYENLDV--NDFTFSSVLNVCGNTTVLELGKQI-HGLCVKTSFDSSSFVG  277

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            + ++ +  + G++E AY   + + +R  + +W A+L AC  H 
Sbjct  278  SSLISLYSKCGVIEPAYRVFEEVRVR-NLGMWNAMLIACAQHS  319



>ref|XP_006305855.1| hypothetical protein CARUB_v10010934mg [Capsella rubella]
 gb|EOA38753.1| hypothetical protein CARUB_v10010934mg [Capsella rubella]
Length=574

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 174/272 (64%), Gaps = 2/272 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
             RN V+W +L+A Y Q    +K L VF +  E  + P E  +S VLSACA + A  LGR 
Sbjct  268  SRNVVTWTALIAGYVQGRCFDKGLSVFEEMIESDVVPNEKTLSIVLSACAHVGALHLGRR  327

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  V+K  +E N  + + L+D+Y KCGC+E+    F  +PE+N+ TW A+I G A  GH
Sbjct  328  VHCYVIKNSIEINTTMGTTLIDLYAKCGCLEEAILVFERLPEKNVYTWTAMINGLAAHGH  387

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  A+DLF+ M R      PN VTF+ VL+AC+  G VE G  +F +MK+++ +EP A+H
Sbjct  388  ARGAVDLFQTMLRSHTS--PNEVTFIAVLSACAHGGLVEEGQRLFLSMKERFNLEPSADH  445

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+ GR G++E A   I++MP+ PT +VWGAL G+C +H   ELGK AA  + ++ 
Sbjct  446  YACMVDLFGRNGLLEEAKALIEKMPMEPTNAVWGALFGSCLIHKDYELGKYAASRVIKLQ  505

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKD  820
               SG + +L+N+++ S  W+E   VRK+MKD
Sbjct  506  TSHSGRYTLLANLYSESQNWDEVARVRKQMKD  537


 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 138/279 (49%), Gaps = 14/279 (5%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            ++++ VSW +++  + +N    +A+  F++ +  G    E  V SVLSA A  A    G+
Sbjct  165  EDKDVVSWTAMIDGFVRNGFASEAMAYFVEMKNTGTAANEMTVVSVLSATAKAADVRFGK  224

Query  182  SIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            S+HG  ++   V+ +VF+ S LVD YGKCGC +D ++ F EMP RN++TW ALI GY   
Sbjct  225  SVHGFYLETGRVKCDVFIGSSLVDFYGKCGCYDDAQKVFDEMPSRNVVTWTALIAGYVQG  284

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               +  L +FE+M     DVVPN  T   VL+AC+  GA+  G  +      K  IE   
Sbjct  285  RCFDKGLSVFEEMIE--SDVVPNEKTLSIVLSACAHVGALHLGRRV-HCYVIKNSIEINT  341

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
                 ++D+  + G +E A    +R+P    V  W A++     HG        A +LFQ
Sbjct  342  TMGTTLIDLYAKCGCLEEAILVFERLP-EKNVYTWTAMINGLAAHGHAR----GAVDLFQ  396

Query  719  --IDPQDSGNHVILSNMF---ASSGRWEEANLVRKEMKD  820
              +    S N V    +    A  G  EE   +   MK+
Sbjct  397  TMLRSHTSPNEVTFIAVLSACAHGGLVEEGQRLFLSMKE  435


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/201 (27%), Positives = 91/201 (45%), Gaps = 20/201 (10%)
 Frame = +2

Query  80   VFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS----IHGLVVKACVEENVFVRSVLV  247
            V+L  R  G+ P+      +L        F+L  S     H  +VK  +E + +VR+ L+
Sbjct  91   VYLNMRRNGLVPSRHTFPPLLRV-----VFKLRDSNPFQFHAHIVKFGLESDPYVRNSLI  145

Query  248  DMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPN  427
              Y   G  +   R F    ++++++W A+I G+   G A+ A+  F +M  K      N
Sbjct  146  SGYSSSGLFDFASRVFDGTEDKDVVSWTAMIDGFVRNGFASEAMAYFVEM--KNTGTAAN  203

Query  428  YVTFVCVLTACSRAGAVETGMDI----FEAMKDKYGIEPGAEHYACVVDMLGRAGMVERA  595
             +T V VL+A ++A  V  G  +     E  + K  +  G+     +VD  G+ G  + A
Sbjct  204  EMTVVSVLSATAKAADVRFGKSVHGFYLETGRVKCDVFIGSS----LVDFYGKCGCYDDA  259

Query  596  YEFIKRMPIRPTVSVWGALLG  658
             +    MP R  V+ W AL+ 
Sbjct  260  QKVFDEMPSRNVVT-WTALIA  279



>ref|NP_001172331.1| Os01g0355000 [Oryza sativa Japonica Group]
 dbj|BAD52598.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAH00928.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91061.1| Os01g0355000 [Oryza sativa Japonica Group]
Length=877

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 180/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            ++  S++    Q D GE A+K+F++   +G+EP  F++SS+L+ACA L+A+E G+ +H  
Sbjct  471  IACTSMITALSQCDHGEGAIKLFMEMLRKGLEPDPFVLSSLLNACASLSAYEQGKQVHAH  530

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     + F  + LV  Y KCG IED E AF  +PER +++W+A+IGG A  GH   A
Sbjct  531  LIKRQFMSDAFAGNALVYTYAKCGSIEDAELAFSSLPERGVVSWSAMIGGLAQHGHGKRA  590

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LF  M    + + PN++T   VL AC+ AG V+     F +MK+ +GI+   EHY+C+
Sbjct  591  LELFGRMV--DEGINPNHITMTSVLCACNHAGLVDEAKRYFNSMKEMFGIDRTEEHYSCM  648

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG ++ A E +  MP +   S+WGALLGA RVH  PELGK+AA+ LF ++P+ S
Sbjct  649  IDLLGRAGKLDDAMELVNSMPFQANASIWGALLGASRVHKDPELGKLAAEKLFILEPEKS  708

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N +AS+G W E   VRK MKD  IKK
Sbjct  709  GTHVLLANTYASAGMWNEVAKVRKLMKDSNIKK  741


 Score =   129 bits (325),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 138/271 (51%), Gaps = 12/271 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  L++ Y +ND    A++VF +    GI+PTEF  S V++AC G    E GR 
Sbjct  164  ERNAVSWNGLMSAYVKNDQCGDAIQVFGEMVWSGIQPTEFGFSCVVNACTGSRNIEAGRQ  223

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +VV+   +++VF  + LVDMY K G ++     F +MP+ ++++WNALI G    GH
Sbjct  224  VHAMVVRMGYDKDVFTANALVDMYMKMGRVDIASVIFEKMPDSDVVSWNALISGCVLNGH  283

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A++L   M  K   +VPN  T   +L ACS AGA + G  I   M         ++ 
Sbjct  284  DHRAIELLLQM--KYSGLVPNVFTLSSILKACSGAGAFDLGRQIHGFM---IKANADSDD  338

Query  545  YACV--VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            Y  V  VDM  +   ++ A +    M  R  + +  AL+  C   G+ +    A    ++
Sbjct  339  YIGVGLVDMYAKNHFLDDARKVFDWMFHRDLI-LCNALISGCSHGGRHDE---ALSLFYE  394

Query  719  IDPQDSG-NHVILSNMFASSGRWEEANLVRK  808
            +  +  G N   L+ +  S+   E A+  R+
Sbjct  395  LRKEGLGVNRTTLAAVLKSTASLEAASTTRQ  425


 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 105/221 (48%), Gaps = 8/221 (4%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW SL+  Y  N L   A++ F   R EG+   EF +  VL  C   A   LG  +H +
Sbjct  69   VSWSSLVTAYSNNGLPRSAIQAFHGMRAEGVCCNEFALPVVLK-CVPDA--RLGAQVHAM  125

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEM-PERNLITWNALIGGYAHQGHANM  373
             +      +VFV + LV MYG  G ++D  R F E   ERN ++WN L+  Y        
Sbjct  126  AMATGFGSDVFVANALVAMYGGFGFMDDARRVFNEADSERNAVSWNGLMSAYVKNDQCGD  185

Query  374  ALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYAC  553
            A+ +F +M      + P    F CV+ AC+ +  +E G  +  AM  + G +        
Sbjct  186  AIQVFGEMV--WSGIQPTEFGFSCVVNACTGSRNIEAGRQV-HAMVVRMGYDKDVFTANA  242

Query  554  VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            +VDM  + G V+ A    ++MP    VS W AL+  C ++G
Sbjct  243  LVDMYMKMGRVDIASVIFEKMPDSDVVS-WNALISGCVLNG  282


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 119/258 (46%), Gaps = 13/258 (5%)
 Frame = +2

Query  65   EKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVL  244
            ++AL +F + R+EG+      +++VL + A L A    R +H L VK     +  V + L
Sbjct  386  DEALSLFYELRKEGLGVNRTTLAAVLKSTASLEAASTTRQVHALAVKIGFIFDAHVVNGL  445

Query  245  VDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVP  424
            +D Y KC C+ D  R F E    ++I   ++I   +   H   A+ LF +M RK  +  P
Sbjct  446  IDSYWKCSCLSDANRVFEECSSGDIIACTSMITALSQCDHGEGAIKLFMEMLRKGLE--P  503

Query  425  NYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEF  604
            +      +L AC+   A E G  +   +  +  +       A +V    + G +E A   
Sbjct  504  DPFVLSSLLNACASLSAYEQGKQVHAHLIKRQFMSDAFAGNA-LVYTYAKCGSIEDAELA  562

Query  605  IKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF--QIDPQDSGNHVILSNMFAS--  772
               +P R  VS W A++G    HG    GK A + LF   +D   + NH+ ++++  +  
Sbjct  563  FSSLPERGVVS-WSAMIGGLAQHGH---GKRALE-LFGRMVDEGINPNHITMTSVLCACN  617

Query  773  -SGRWEEANLVRKEMKDI  823
             +G  +EA      MK++
Sbjct  618  HAGLVDEAKRYFNSMKEM  635


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 4/117 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAAFELG  178
            ER  VSW +++    Q+  G++AL++F +  +EGI P    ++SVL AC  AGL   E  
Sbjct  568  ERGVVSWSAMIGGLAQHGHGKRALELFGRMVDEGINPNHITMTSVLCACNHAGLVD-EAK  626

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGG  346
            R  + +     ++      S ++D+ G+ G ++D       MP + N   W AL+G 
Sbjct  627  RYFNSMKEMFGIDRTEEHYSCMIDLLGRAGKLDDAMELVNSMPFQANASIWGALLGA  683



>gb|KHN26334.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=484

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/279 (47%), Positives = 175/279 (63%), Gaps = 5/279 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEG--IEPTEFMVSSVLSACAGLAAFELG  178
             +N VSW  ++  Y Q  L E+AL +F +A E+   I   +F +SSVL  C+    FELG
Sbjct  73   HKNVVSWSGMIYGYSQMGLDEEALNLFKRALEQDYDIRVNDFTLSSVLRVCSASTLFELG  132

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            + +HGL  K   + + FV S L+ +Y KCG +E   + F E+  RNL  WNA++   A  
Sbjct  133  KQVHGLCFKTSFDSSCFVASSLISLYSKCGVVEGGYKVFEEVKVRNLGMWNAMLIACAQH  192

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
             H     +LFE+M R    V PN++TF+C+L ACS AG VE G   F  MK+ +GIEPG+
Sbjct  193  AHTGRTFELFEEMER--VGVKPNFITFLCLLYACSHAGLVEKGEHCFGLMKE-HGIEPGS  249

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            +HYA +VD+LGRAG +E A   IK MP++PT SVWGALL  CR+HG  EL    AD +F+
Sbjct  250  QHYATLVDLLGRAGKLEEAVLVIKEMPMQPTESVWGALLTGCRIHGNTELASFVADKVFE  309

Query  719  IDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +    SG  V+LSN +A++GRWEEA   RK M+D GIKK
Sbjct  310  MGAVSSGIQVLLSNAYAAAGRWEEAARARKMMRDQGIKK  348


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 78/157 (50%), Gaps = 2/157 (1%)
 Frame = +2

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
            K     +VFV S LVD Y KCG +    + F EMP +N+++W+ +I GY+  G    AL+
Sbjct  38   KTAHHHDVFVGSSLVDTYAKCGDVNLARKVFDEMPHKNVVSWSGMIYGYSQMGLDEEALN  97

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVD  562
            LF+    +  D+  N  T   VL  CS +   E G  +   +  K   +      + ++ 
Sbjct  98   LFKRALEQDYDIRVNDFTLSSVLRVCSASTLFELGKQV-HGLCFKTSFDSSCFVASSLIS  156

Query  563  MLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            +  + G+VE  Y+  + + +R  + +W A+L AC  H
Sbjct  157  LYSKCGVVEGGYKVFEEVKVR-NLGMWNAMLIACAQH  192



>ref|XP_010658203.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g25970 [Vitis vinifera]
 ref|XP_010658204.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g25970 [Vitis vinifera]
Length=766

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/278 (45%), Positives = 174/278 (63%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +ER+ VSW +L+  Y Q+ LGE+AL  F   REEG  P +F  SSVL +CA L   E GR
Sbjct  434  EERDIVSWTTLVTAYSQSSLGEEALATFCLMREEGFAPNQFTFSSVLISCASLCFLEYGR  493

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HGL+ KA ++    + S L+DMY KCG I +  + F ++   ++++W A+I GYA  G
Sbjct  494  QVHGLLCKAGLDTEKCIESALIDMYAKCGSITEAGKVFDKISNPDIVSWTAIISGYAQHG  553

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                AL LF  M  +   +  N VT +CVL ACS  G VE G+  F+ M+D YG+ P  E
Sbjct  554  LVEDALQLFRRM--ELSGIKANAVTLLCVLFACSHGGMVEEGLFYFQQMEDGYGVVPEME  611

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC++D+LGR G ++ A EFI++MP+ P   VW  LLG CRVHG  ELG+IAA  +  I
Sbjct  612  HYACIIDLLGRVGRLDDAMEFIRKMPMEPNEMVWQTLLGGCRVHGNVELGEIAARKILSI  671

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             P+ S  +V+LSN +  +G +E+   +R  MKD G+KK
Sbjct  672  RPEYSATYVLLSNTYIETGSYEDGLSLRNVMKDQGVKK  709


 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 100/218 (46%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN  SW  ++    ++ L     K F +    GI P +F  S+++ +C GL + ELG+ 
Sbjct  129  QRNVFSWTVMIVGSTEHGLFFDGFKFFCEMLNSGILPDKFAYSAIIQSCIGLDSLELGKM  188

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  +V      ++FV + L++MY K G IED    F  M E N ++WNA+I G    G 
Sbjct  189  VHAQIVMRGFATHIFVSTSLLNMYAKLGSIEDSYWVFNMMTEHNQVSWNAMISGCTSNGL  248

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A DLF  M  K     PN  T V V  A  +   V  G ++ +    + GIE     
Sbjct  249  HLEAFDLFVRM--KNGACTPNMYTLVSVSKAVGKLVDVNMGKEV-QNCASELGIEGNVLV  305

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSV-WGALL  655
               ++DM  + G +  A        I   V+  W A++
Sbjct  306  GTALIDMYSKCGSLHDARSVFDTNFINCGVNTPWNAMI  343


 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 110/222 (50%), Gaps = 5/222 (2%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            W ++++ Y Q+   ++AL+++++  + GI    +   SV +A A   + + GR +HG+V+
Sbjct  339  WNAMISGYSQSGCSQEALELYVQMCQNGITSDLYTYCSVFNAIAASKSLQFGRVVHGMVL  398

Query  203  KACVEENVF-VRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            K  ++  V  V + + D Y KCG +ED  + F  M ER++++W  L+  Y+       AL
Sbjct  399  KCGLDLMVVSVNNAIADAYSKCGFLEDVRKVFDRMEERDIVSWTTLVTAYSQSSLGEEAL  458

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
              F  M  + +   PN  TF  VL +C+    +E G  +   +  K G++      + ++
Sbjct  459  ATFCLM--REEGFAPNQFTFSSVLISCASLCFLEYGRQV-HGLLCKAGLDTEKCIESALI  515

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            DM  + G +  A +   ++   P +  W A++     HG  E
Sbjct  516  DMYAKCGSITEAGKVFDKIS-NPDIVSWTAIISGYAQHGLVE  556


 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/239 (26%), Positives = 107/239 (45%), Gaps = 18/239 (8%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSW ++++    N L  +A  +F++ +     P  + + SV  A   L    +G+ 
Sbjct  230  EHNQVSWNAMISGCTSNGLHLEAFDLFVRMKNGACTPNMYTLVSVSKAVGKLVDVNMGKE  289

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLIT------WNALIGG  346
            +     +  +E NV V + L+DMY KCG + D    F    + N I       WNA+I G
Sbjct  290  VQNCASELGIEGNVLVGTALIDMYSKCGSLHDARSVF----DTNFINCGVNTPWNAMISG  345

Query  347  YAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
            Y+  G +  AL+L+  M +    +  +  T+  V  A + + +++ G  +   M  K G+
Sbjct  346  YSQSGCSQEALELYVQMCQ--NGITSDLYTYCSVFNAIAASKSLQFG-RVVHGMVLKCGL  402

Query  527  EPGAEHY-ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIA  700
            +         + D   + G +E   +   RM  R  VS W  L+ A   + +  LG+ A
Sbjct  403  DLMVVSVNNAIADAYSKCGFLEDVRKVFDRMEERDIVS-WTTLVTA---YSQSSLGEEA  457


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 51/223 (23%), Positives = 92/223 (41%), Gaps = 13/223 (6%)
 Frame = +2

Query  35   LAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSS-------VLSACAGLAAFELGRSIHG  193
            LAV   +   +K+  V  + R E I  +E    +       VL  CA   +    +++HG
Sbjct  29   LAVSVPSQTAKKSKIVVGRNRPESIGISETYQQTQVQDLIDVLRDCAEKGSIREAKAVHG  88

Query  194  LVVKACVEEN--VFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            LV+K+  E+   + + +    +Y KC         F EMP+RN+ +W  +I G    G  
Sbjct  89   LVLKSNFEDKDLMVLFNHAAHVYSKCSEFRAACGVFDEMPQRNVFSWTVMIVGSTEHGLF  148

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
                  F +M      ++P+   +  ++ +C    ++E G  +  A     G        
Sbjct  149  FDGFKFFCEML--NSGILPDKFAYSAIIQSCIGLDSLELG-KMVHAQIVMRGFATHIFVS  205

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              +++M  + G +E +Y     M     VS W A++  C  +G
Sbjct  206  TSLLNMYAKLGSIEDSYWVFNMMTEHNQVS-WNAMISGCTSNG  247



>gb|EAZ11837.1| hypothetical protein OsJ_01713 [Oryza sativa Japonica Group]
Length=877

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 180/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            ++  S++    Q D GE A+K+F++   +G+EP  F++SS+L+ACA L+A+E G+ +H  
Sbjct  471  IACTSMITALSQCDHGEGAIKLFMEMLRKGLEPDPFVLSSLLNACASLSAYEQGKQVHAH  530

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     + F  + LV  Y KCG IED E AF  +PER +++W+A+IGG A  GH   A
Sbjct  531  LIKRQFMSDAFAGNALVYTYAKCGSIEDAELAFSSLPERGVVSWSAMIGGLAQHGHGKRA  590

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LF  M    + + PN++T   VL AC+ AG V+     F +MK+ +GI+   EHY+C+
Sbjct  591  LELFGRMV--DEGINPNHITMTSVLCACNHAGLVDEAKRYFNSMKEMFGIDRTEEHYSCM  648

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG ++ A E +  MP +   S+WGALLGA RVH  PELGK+AA+ LF ++P+ S
Sbjct  649  IDLLGRAGKLDDAMELVNSMPFQANASIWGALLGASRVHKDPELGKLAAEKLFILEPEKS  708

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N +AS+G W E   VRK MKD  IKK
Sbjct  709  GTHVLLANTYASAGMWNEVAKVRKLMKDSNIKK  741


 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 138/271 (51%), Gaps = 12/271 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  L++ Y +ND    A++VF +    GI+PTEF  S V++AC G    E GR 
Sbjct  164  ERNAVSWNGLMSAYVKNDQCGDAIQVFGEMVWSGIQPTEFGFSCVVNACTGSRNIEAGRQ  223

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +VV+   +++VF  + LVDMY K G ++     F +MP+ ++++WNALI G    GH
Sbjct  224  VHAMVVRMGYDKDVFTANALVDMYMKMGRVDIASVIFEKMPDSDVVSWNALISGCVLNGH  283

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A++L   M  K   +VPN  T   +L ACS AGA + G  I   M         ++ 
Sbjct  284  DHRAIELLLQM--KYSGLVPNVFTLSSILKACSGAGAFDLGRQIHGFM---IKANADSDD  338

Query  545  YACV--VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            Y  V  VDM  +   ++ A +    M  R  + +  AL+  C   G+ +    A    ++
Sbjct  339  YIGVGLVDMYAKNHFLDDARKVFDWMFHRDLI-LCNALISGCSHGGRHDE---ALSLFYE  394

Query  719  IDPQDSG-NHVILSNMFASSGRWEEANLVRK  808
            +  +  G N   L+ +  S+   E A+  R+
Sbjct  395  LRKEGLGVNRTTLAAVLKSTASLEAASTTRQ  425


 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 105/221 (48%), Gaps = 8/221 (4%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW SL+  Y  N L   A++ F   R EG+   EF +  VL  C   A   LG  +H +
Sbjct  69   VSWSSLVTAYSNNGLPRSAIQAFHGMRAEGVCCNEFALPVVLK-CVPDA--RLGAQVHAM  125

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEM-PERNLITWNALIGGYAHQGHANM  373
             +      +VFV + LV MYG  G ++D  R F E   ERN ++WN L+  Y        
Sbjct  126  AMATGFGSDVFVANALVAMYGGFGFMDDARRVFNEADSERNAVSWNGLMSAYVKNDQCGD  185

Query  374  ALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYAC  553
            A+ +F +M      + P    F CV+ AC+ +  +E G  +  AM  + G +        
Sbjct  186  AIQVFGEMV--WSGIQPTEFGFSCVVNACTGSRNIEAGRQV-HAMVVRMGYDKDVFTANA  242

Query  554  VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            +VDM  + G V+ A    ++MP    VS W AL+  C ++G
Sbjct  243  LVDMYMKMGRVDIASVIFEKMPDSDVVS-WNALISGCVLNG  282


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 119/258 (46%), Gaps = 13/258 (5%)
 Frame = +2

Query  65   EKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVL  244
            ++AL +F + R+EG+      +++VL + A L A    R +H L VK     +  V + L
Sbjct  386  DEALSLFYELRKEGLGVNRTTLAAVLKSTASLEAASTTRQVHALAVKIGFIFDAHVVNGL  445

Query  245  VDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVP  424
            +D Y KC C+ D  R F E    ++I   ++I   +   H   A+ LF +M RK  +  P
Sbjct  446  IDSYWKCSCLSDANRVFEECSSGDIIACTSMITALSQCDHGEGAIKLFMEMLRKGLE--P  503

Query  425  NYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEF  604
            +      +L AC+   A E G  +   +  +  +       A +V    + G +E A   
Sbjct  504  DPFVLSSLLNACASLSAYEQGKQVHAHLIKRQFMSDAFAGNA-LVYTYAKCGSIEDAELA  562

Query  605  IKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF--QIDPQDSGNHVILSNMFAS--  772
               +P R  VS W A++G    HG    GK A + LF   +D   + NH+ ++++  +  
Sbjct  563  FSSLPERGVVS-WSAMIGGLAQHGH---GKRALE-LFGRMVDEGINPNHITMTSVLCACN  617

Query  773  -SGRWEEANLVRKEMKDI  823
             +G  +EA      MK++
Sbjct  618  HAGLVDEAKRYFNSMKEM  635


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 4/117 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAAFELG  178
            ER  VSW +++    Q+  G++AL++F +  +EGI P    ++SVL AC  AGL   E  
Sbjct  568  ERGVVSWSAMIGGLAQHGHGKRALELFGRMVDEGINPNHITMTSVLCACNHAGLVD-EAK  626

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGG  346
            R  + +     ++      S ++D+ G+ G ++D       MP + N   W AL+G 
Sbjct  627  RYFNSMKEMFGIDRTEEHYSCMIDLLGRAGKLDDAMELVNSMPFQANASIWGALLGA  683



>ref|XP_010096505.1| hypothetical protein L484_017957 [Morus notabilis]
 gb|EXB64625.1| hypothetical protein L484_017957 [Morus notabilis]
Length=750

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 183/277 (66%), Gaps = 3/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW S+L  Y +    E AL++F     E  +PT+F  SS+ +ACA   + E G+ 
Sbjct  341  KRDVVSWNSMLNGYARKGETENALRLFSMMHREDFKPTDFTYSSLCTACASTGSLEQGKW  400

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  V+K+      FV + L+DMY K G IED ++ F  + +R++++WN+++ GYA  G 
Sbjct  401  VHAHVIKSGGRLVAFVGNTLLDMYAKSGSIEDAKKVFDRLVKRDVVSWNSMLRGYAQHGL  460

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                +  FE+M   T  + P  VTF+ VLTACS AG ++ G   FE MK KY +EP   H
Sbjct  461  GRKTVQHFEEMM--TSGIEPISVTFLSVLTACSHAGLLDEGRHYFELMK-KYKVEPDVLH  517

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y  +VD+LGRAG++++A  +I+ MPI P+ +VWGALLGACR+H   ELG  AA+ +F++D
Sbjct  518  YVTMVDLLGRAGLLDQAERYIREMPIEPSAAVWGALLGACRMHKNMELGAYAAERVFELD  577

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            PQDSG H++L NM+AS+GRW+EA  VRK MK+ G+KK
Sbjct  578  PQDSGPHILLYNMYASAGRWQEAAKVRKMMKESGVKK  614


 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 121/227 (53%), Gaps = 12/227 (5%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW +L+A + +    E AL++F     E  +PT F  SS+ +ACA   + E G+ +
Sbjct  241  KNEVSWNALIAGHSRKGETENALRLFSMMHREDFKPTHFTFSSLCTACASTGSLEQGKWV  300

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  V+K+      FV + L+DMY K G IED ++ F  + +R++++WN+++ GYA +G  
Sbjct  301  HAQVIKSGGRLVAFVGNTLLDMYAKSGSIEDAKKVFDRLVKRDVVSWNSMLNGYARKGET  360

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF  M R  +D  P   T+  + TAC+  G++E G  +   +     I+ G    
Sbjct  361  ENALRLFSMMHR--EDFKPTDFTYSSLCTACASTGSLEQGKWVHAHV-----IKSGGRLV  413

Query  548  ACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            A V    +DM  ++G +E A +   R+  R  VS W ++L     HG
Sbjct  414  AFVGNTLLDMYAKSGSIEDAKKVFDRLVKRDVVS-WNSMLRGYAQHG  459


 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 118/227 (52%), Gaps = 12/227 (5%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W +L++ Y Q+D  E+AL +F      G+EP +F +SS+L A       + GR +H  
Sbjct  143  VTWTALISGYSQHDQAEEALALFPLMLRRGLEPNQFTLSSLLKASGDGTTNKRGRQLHAY  202

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +K   + +V+V S LVDMY + G + +    F  +  +N ++WNALI G++ +G    A
Sbjct  203  CLKCGYDSDVYVGSSLVDMYARYGHLVEARLIFDGLVTKNEVSWNALIAGHSRKGETENA  262

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF  M R  +D  P + TF  + TAC+  G++E G  +   +     I+ G    A V
Sbjct  263  LRLFSMMHR--EDFKPTHFTFSSLCTACASTGSLEQGKWVHAQV-----IKSGGRLVAFV  315

Query  557  ----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
                +DM  ++G +E A +   R+  R  VS W ++L      G+ E
Sbjct  316  GNTLLDMYAKSGSIEDAKKVFDRLVKRDVVS-WNSMLNGYARKGETE  361


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 112/282 (40%), Gaps = 48/282 (17%)
 Frame = +2

Query  77   KVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMY  256
            K FL    E       + + +L  C  +     G+ +H   + +   ++  + + +++MY
Sbjct  62   KNFLHKSHENSGAGPPLYNRLLKRCTEMRKLREGKMVHAHFLNSQFRDDPVIGNTILNMY  121

Query  257  GKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVT  436
             KCG + D  + F EMP ++++TW ALI GY+    A  AL LF  M R+  +  PN  T
Sbjct  122  AKCGSLADARKLFDEMPLKDIVTWTALISGYSQHDQAEEALALFPLMLRRGLE--PNQFT  179

Query  437  FVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAG-MVE--------  589
               +L A       + G  +  A   K G +      + +VDM  R G +VE        
Sbjct  180  LSSLLKASGDGTTNKRGRQL-HAYCLKCGYDSDVYVGSSLVDMYARYGHLVEARLIFDGL  238

Query  590  -------------------------RAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGK  694
                                     R +  + R   +PT   + +L  AC   G  E GK
Sbjct  239  VTKNEVSWNALIAGHSRKGETENALRLFSMMHREDFKPTHFTFSSLCTACASTGSLEQGK  298

Query  695  IAADNLFQIDPQDSGNHVI------LSNMFASSGRWEEANLV  802
                 + +     SG  ++      L +M+A SG  E+A  V
Sbjct  299  WVHAQVIK-----SGGRLVAFVGNTLLDMYAKSGSIEDAKKV  335



>ref|XP_010912819.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Elaeis guineensis]
Length=663

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 188/278 (68%), Gaps = 3/278 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW S++A Y Q +  ++AL++F +     ++P +  + SVLSACA     +LGR 
Sbjct  339  ERNAVSWSSMIAAYAQANQAKEALELFHEMLGMCVKPIDATLVSVLSACAQSGCLDLGRW  398

Query  185  IHG-LVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            I+   + +  ++ ++ + +  + MY KCG I+   R F+EMPER++++WNA+I  YA  G
Sbjct  399  IYDHFIDRKIIKLSMNLANAFIGMYAKCGDIKAAARLFHEMPERDIVSWNAMIMAYAVHG  458

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
            + N AL LFE +  K++ +VP+ +TFV VL+ACS AG V  G+  F+ M+  +GIEP + 
Sbjct  459  YGNEALTLFEQL--KSEGMVPDDITFVGVLSACSHAGLVVEGLRHFKDMRSIFGIEPKSV  516

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC +D+LG+ G++E AYE ++ MP+ P  + WGALL ACR+HGK ELGK A D L  +
Sbjct  517  HYACQIDLLGKVGLLEDAYELVRSMPVEPDEAAWGALLNACRIHGKVELGKYAGDKLLGL  576

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            DP DSG +V+LS+M+A+  +W++   VR+ M+D G+KK
Sbjct  577  DPGDSGIYVLLSSMYATRNKWDDVKKVRRMMRDRGVKK  614


 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 125/255 (49%), Gaps = 34/255 (13%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW +++  Y Q  L ++AL++F +     I+P E  + +VLSA + L    LG+ 
Sbjct  207  QRDVVSWTTMIDGYSQKGLPDEALRLFYRMLLMNIQPNEVTMITVLSAISQLGHLRLGKL  266

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCE--------------------------  286
            +H  + K+ +   V + + LVD+YGKCGC++                             
Sbjct  267  VHEFIWKSEMNVTVNLMNALVDVYGKCGCVDSAREVFDSMGIKDVFSWTSMVNAYAKCGD  326

Query  287  ----RAFYE-MPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVL  451
                R F+E MPERN ++W+++I  YA    A  AL+LF +M      V P   T V VL
Sbjct  327  LQLARQFFESMPERNAVSWSSMIAAYAQANQAKEALELFHEMLGMC--VKPIDATLVSVL  384

Query  452  TACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPT  631
            +AC+++G ++ G  I++   D+  I+         + M  + G ++ A      MP R  
Sbjct  385  SACAQSGCLDLGRWIYDHFIDRKIIKLSMNLANAFIGMYAKCGDIKAAARLFHEMPERDI  444

Query  632  VSVWGALLGACRVHG  676
            VS W A++ A  VHG
Sbjct  445  VS-WNAMIMAYAVHG  458


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 120/261 (46%), Gaps = 10/261 (4%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N   W +++  Y ++     +L +F +   + +         VL AC       +G  IH
Sbjct  108  NTYIWNTMIRGYTRSKHPRSSLSLFCQMICQRVVMDSRTFVFVLKACEQFLEVFMGEEIH  167

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
             ++ K   + ++ V + L+  Y K G ++   + F E  +R++++W  +I GY+ +G  +
Sbjct  168  CMICKLGFDSDLLVENGLMHFYVKNGLLDSARKVFVESCQRDVVSWTTMIDGYSQKGLPD  227

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
             AL LF  M     ++ PN VT + VL+A S+ G +  G  + E +  K  +        
Sbjct  228  EALRLFYRML--LMNIQPNEVTMITVLSAISQLGHLRLGKLVHEFIW-KSEMNVTVNLMN  284

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQ  730
             +VD+ G+ G V+ A E    M I+   S W +++ A    G  +L +      F+  P+
Sbjct  285  ALVDVYGKCGCVDSAREVFDSMGIKDVFS-WTSMVNAYAKCGDLQLAR----QFFESMPE  339

Query  731  DSGNHVILSNMFASSGRWEEA  793
               N V  S+M A+  +  +A
Sbjct  340  R--NAVSWSSMIAAYAQANQA  358



>ref|XP_008464284.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial isoform X1 [Cucumis melo]
Length=680

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 184/276 (67%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW +L+A + +   GE  +++F +   +G EPT F  SSV +ACA   + E G+ +
Sbjct  272  KNVVSWNALIAGHARKGEGEHVMRLFSQMLRQGFEPTHFTYSSVFTACASSGSLEQGKWV  331

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  V+K+  +   ++ + L+DMY K G I+D ++ F  + +R++++WN++I GYA  G  
Sbjct  332  HAHVIKSGGQPIAYIGNTLIDMYAKSGSIKDAKKVFQRLVKRDIVSWNSIISGYAQHGLG  391

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LFE + +    V PN +TF+ VLTACS +G ++ G   FE MK K+GIEP   H+
Sbjct  392  AEALQLFEQVLKA--KVQPNEITFLSVLTACSHSGLLDEGKYYFELMK-KHGIEPQVAHH  448

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              VVD+LGRAG +  A +FI+ MP+ PT +VWGALLGACR+H   +LG  AA+ +F++DP
Sbjct  449  VTVVDLLGRAGRLNEANKFIEEMPMEPTAAVWGALLGACRMHKNMDLGVYAAEKIFELDP  508

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSG HV+LSN++AS+GR  +A  VRK MK+ G+KK
Sbjct  509  HDSGPHVLLSNIYASAGRLRDAGNVRKMMKESGVKK  544


 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 119/223 (53%), Gaps = 4/223 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW  L++ Y Q+    +AL +F K    G +P EF +SS+L A     + + GR +
Sbjct  171  KDRVSWTVLISGYSQSRRASEALALFPKMLHLGFQPNEFTLSSLLKASGAGPSDDHGRQL  230

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   +K   + NV V S L+DMY + G + + +  F  +  +N+++WNALI G+A +G  
Sbjct  231  HAFSLKYGYDMNVHVGSSLLDMYARWGHMREAKVIFKSLAAKNVVSWNALIAGHARKGEG  290

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               + LF  M R  Q   P + T+  V TAC+ +G++E G  +  A   K G +P A   
Sbjct  291  EHVMRLFSQMLR--QGFEPTHFTYSSVFTACASSGSLEQGKWV-HAHVIKSGGQPIAYIG  347

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              ++DM  ++G ++ A +  +R+  R  VS W +++     HG
Sbjct  348  NTLIDMYAKSGSIKDAKKVFQRLVKRDIVS-WNSIISGYAQHG  389


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/238 (29%), Positives = 111/238 (47%), Gaps = 13/238 (5%)
 Frame = +2

Query  107  IEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCE  286
            +EP   + S +L+ C  L   + GR+IH  +  +  E +  + + +++MY KCG +E+ +
Sbjct  103  LEPERTLYSKMLNKCTYLRKLKQGRAIHAHIQSSAFENDPVLLNFILNMYAKCGSLEEAQ  162

Query  287  RAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSR  466
              F +MP ++ ++W  LI GY+    A+ AL LF  M        PN  T   +L A S 
Sbjct  163  DLFDKMPTKDRVSWTVLISGYSQSRRASEALALFPKMLH--LGFQPNEFTLSSLLKA-SG  219

Query  467  AGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWG  646
            AG  +       A   KYG +      + ++DM  R G +  A    K +  +  VS W 
Sbjct  220  AGPSDDHGRQLHAFSLKYGYDMNVHVGSSLLDMYARWGHMREAKVIFKSLAAKNVVS-WN  278

Query  647  ALLGACRVHGKPE-LGKIAADNLFQ-IDPQDSGNHVILSNMF---ASSGRWEEANLVR  805
            AL+      G+ E + ++ +  L Q  +P     H   S++F   ASSG  E+   V 
Sbjct  279  ALIAGHARKGEGEHVMRLFSQMLRQGFEP----THFTYSSVFTACASSGSLEQGKWVH  332


 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW S+++ Y Q+ LG +AL++F +  +  ++P E    SVL+AC+     + G+ 
Sbjct  372  KRDIVSWNSIISGYAQHGLGAEALQLFEQVLKAKVQPNEITFLSVLTACSHSGLLDEGKY  431

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAHQG  361
               L+ K  +E  V     +VD+ G+ G + +  +   EMP E     W AL+G  A + 
Sbjct  432  YFELMKKHGIEPQVAHHVTVVDLLGRAGRLNEANKFIEEMPMEPTAAVWGALLG--ACRM  489

Query  362  HANMALDLF  388
            H NM L ++
Sbjct  490  HKNMDLGVY  498



>gb|KHN47346.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=413

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 182/277 (66%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V+W S++  +  N    +AL +F +   EG+EP  F V S+LSA A L A ELGR 
Sbjct  3    ERDLVAWNSMINGFALNGRPNEALTLFREMSVEGVEPDGFTVVSLLSASAELGALELGRR  62

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  ++K  + +N  V + L+D+Y KCG I + +R F EM ERN ++W +LI G A  G 
Sbjct  63   VHVYLLKVGLSKNSHVTNSLLDLYAKCGAIREAQRVFSEMSERNAVSWTSLIVGLAVNGF  122

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL+LF++M  + Q +VP+ +TFV VL ACS  G ++ G + F  MK++ GI P  EH
Sbjct  123  GEEALELFKEM--EGQGLVPSEITFVGVLYACSHCGMLDEGFEYFRRMKEECGIIPRIEH  180

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+L RAG+V++AYE+I+ MP++P   +W  LLGAC +HG   LG+IA  +L  ++
Sbjct  181  YGCMVDLLSRAGLVKQAYEYIQNMPVQPNAVIWRTLLGACTIHGHLGLGEIARSHLLNLE  240

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+ SG++V+LSN++AS  RW +  ++R+ M   G+KK
Sbjct  241  PKHSGDYVLLSNLYASERRWSDVQVIRRSMLKDGVKK  277


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 64/125 (51%), Gaps = 4/125 (3%)
 Frame = +2

Query  302  MPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVE  481
            M ER+L+ WN++I G+A  G  N AL LF +M+   + V P+  T V +L+A +  GA+E
Sbjct  1    MKERDLVAWNSMINGFALNGRPNEALTLFREMS--VEGVEPDGFTVVSLLSASAELGALE  58

Query  482  TGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
             G  +   +  K G+   +     ++D+  + G +  A      M  R  VS W +L+  
Sbjct  59   LGRRVHVYLL-KVGLSKNSHVTNSLLDLYAKCGAIREAQRVFSEMSERNAVS-WTSLIVG  116

Query  662  CRVHG  676
              V+G
Sbjct  117  LAVNG  121



>gb|KEH25607.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=1144

 Score =   264 bits (674),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 183/276 (66%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW SL++ + Q+   E+AL +F +  + G+E   F   S +SA A +A   +G+ I
Sbjct  651  KDNVSWNSLVSGFAQSGYFEEALNIFAQMNKAGLEINSFTFGSAVSAAANIANVRIGKQI  710

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG++ K   +    V + L+ +Y KCG I+D ER F+EMP++N I+WN++I GY+  G  
Sbjct  711  HGMIRKTGYDSETEVSNALITLYAKCGTIDDAERHFFEMPDKNEISWNSMITGYSQHGCG  770

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LFEDM  K  DV+PN+VTFV VL+ACS  G V+ G+  F +M + + + P  EHY
Sbjct  771  FEALKLFEDM--KQLDVLPNHVTFVGVLSACSHVGLVDEGISYFRSMSEAHNLVPKPEHY  828

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGR+G++ RA  F++ MPI+P   VW  LL AC VH   ++G+ AA +L +++P
Sbjct  829  ACVVDLLGRSGLLSRAKRFVEEMPIQPDAMVWRTLLSACNVHKNIDIGEFAASHLLELEP  888

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +DS  +V++SNM+A SG+W+  +  R+ MKD G+KK
Sbjct  889  KDSATYVLVSNMYAVSGKWDCRDRTRQMMKDRGVKK  924


 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 116/216 (54%), Gaps = 4/216 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW ++++   QN   E+A+ +F +    GI PT ++ SSVLSAC  +  FE G+ +
Sbjct  247  RDSVSWVAMISGLSQNGYEEEAMLLFCQMHTSGICPTPYIFSSVLSACTKVEFFEFGKQL  306

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGLV+K       +V + LV +Y + G +   E+ F+ M +R+ +++N+LI G A QG+ 
Sbjct  307  HGLVLKQGFSSETYVCNALVTLYSRSGNLSSAEQIFHCMSQRDRVSYNSLISGLAQQGYI  366

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
            N AL LF+ M    Q   P+ VT   +L+AC+  GA+  G   F +   K G+       
Sbjct  367  NRALALFKKMNLDCQK--PDCVTVASLLSACASVGALPNGKQ-FHSYAIKAGMTSDIVVE  423

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
              ++D+  +   ++ A+EF         V +W  +L
Sbjct  424  GSLLDLYVKCSDIKTAHEFFLACETENVV-LWNVML  458


 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 109/219 (50%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +  N V W  +L  Y Q D   K+ ++F + + EGI P +F   S+L  C  L A +LG 
Sbjct  447  ETENVVLWNVMLVGYGQLDNLNKSFQIFTQMQIEGIVPNQFTYPSILKTCTTLGATDLGE  506

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             IH  V+K   + NV+V SVL+DMY K G ++   + F  + E ++++W A+I GY    
Sbjct  507  QIHTQVLKTGFQFNVYVSSVLIDMYAKHGKLDHALKIFRRLKENDVVSWTAMIAGYTQHD  566

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                AL+LF++M  + Q +  + + F   ++AC+   A++ G  I  A     G      
Sbjct  567  KFTEALNLFKEM--QDQGIKSDNIGFASAISACAGIQALDQGRQI-HAQSCLSGYSDDLS  623

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
                +V +  R G V  AY    ++  +  VS W +L+ 
Sbjct  624  IGNALVSLYARCGKVREAYAAFDQIYAKDNVS-WNSLVS  661


 Score =   109 bits (273),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/224 (27%), Positives = 116/224 (52%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +++A Y Q+D   +AL +F + +++GI+      +S +SACAG+ A + GR 
Sbjct  549  ENDVVSWTAMIAGYTQHDKFTEALNLFKEMQDQGIKSDNIGFASAISACAGIQALDQGRQ  608

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH     +   +++ + + LV +Y +CG + +   AF ++  ++ ++WN+L+ G+A  G+
Sbjct  609  IHAQSCLSGYSDDLSIGNALVSLYARCGKVREAYAAFDQIYAKDNVSWNSLVSGFAQSGY  668

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL++F  M +   ++  N  TF   ++A +    V  G  I   M  K G +   E 
Sbjct  669  FEEALNIFAQMNKAGLEI--NSFTFGSAVSAAANIANVRIGKQI-HGMIRKTGYDSETEV  725

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               ++ +  + G ++ A      MP +  +S W +++     HG
Sbjct  726  SNALITLYAKCGTIDDAERHFFEMPDKNEIS-WNSMITGYSQHG  768


 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 118/245 (48%), Gaps = 9/245 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VS+ SL++   Q     +AL +F K   +  +P    V+S+LSACA + A   G+ 
Sbjct  347  QRDRVSYNSLISGLAQQGYINRALALFKKMNLDCQKPDCVTVASLLSACASVGALPNGKQ  406

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H   +KA +  ++ V   L+D+Y KC  I+     F      N++ WN ++ GY    +
Sbjct  407  FHSYAIKAGMTSDIVVEGSLLDLYVKCSDIKTAHEFFLACETENVVLWNVMLVGYGQLDN  466

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N +  +F  M  + + +VPN  T+  +L  C+  GA + G  I   +  K G +     
Sbjct  467  LNKSFQIFTQM--QIEGIVPNQFTYPSILKTCTTLGATDLGEQIHTQVL-KTGFQFNVYV  523

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
             + ++DM  + G ++ A +  +R+     VS W A++     H K       A NLF+ +
Sbjct  524  SSVLIDMYAKHGKLDHALKIFRRLKENDVVS-WTAMIAGYTQHDKF----TEALNLFK-E  577

Query  725  PQDSG  739
             QD G
Sbjct  578  MQDQG  582


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 94/208 (45%), Gaps = 8/208 (4%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLA-AFELGRSIHGLV  199
            W  +   +    L  +   +F +   + +E  E + + VL  C+G A +F     IH   
Sbjct  150  WNRIFNTFIAERLMGRVPGLFRRMLTKNVEFDERIFAVVLRGCSGNAVSFRFVEQIHAKT  209

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            + +  E + F+ + L+D+Y K G +   ++ F  +  R+ ++W A+I G +  G+   A+
Sbjct  210  ITSGFESSTFICNPLIDLYFKNGFLSSAKKVFENLKARDSVSWVAMISGLSQNGYEEEAM  269

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYAC--  553
             LF  M   T  + P    F  VL+AC++    E G  +   +  K G    +E Y C  
Sbjct  270  LLFCQM--HTSGICPTPYIFSSVLSACTKVEFFEFGKQL-HGLVLKQGF--SSETYVCNA  324

Query  554  VVDMLGRAGMVERAYEFIKRMPIRPTVS  637
            +V +  R+G +  A +    M  R  VS
Sbjct  325  LVTLYSRSGNLSSAEQIFHCMSQRDRVS  352


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 87/192 (45%), Gaps = 30/192 (16%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACA-------GLA  163
            ++N +SW S++  Y Q+  G +ALK+F   ++  + P       VLSAC+       G++
Sbjct  751  DKNEISWNSMITGYSQHGCGFEALKLFEDMKQLDVLPNHVTFVGVLSACSHVGLVDEGIS  810

Query  164  AFELGRSIHGLVVK----ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITW  328
             F      H LV K    ACV          VD+ G+ G +   +R   EMP + + + W
Sbjct  811  YFRSMSEAHNLVPKPEHYACV----------VDLLGRSGLLSRAKRFVEEMPIQPDAMVW  860

Query  329  NALIGGYAHQGHANMALDLFEDMTRKTQDVVP-NYVTFVCVLTACSRAGAVETGMDIFEA  505
              L+   A   H N  +D+ E       ++ P +  T+V V    + +G  +      + 
Sbjct  861  RTLLS--ACNVHKN--IDIGEFAASHLLELEPKDSATYVLVSNMYAVSGKWDCRDRTRQM  916

Query  506  MKDKYGI--EPG  535
            MKD+ G+  EPG
Sbjct  917  MKDR-GVKKEPG  927



>ref|XP_008450012.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Cucumis melo]
 ref|XP_008450013.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Cucumis melo]
 ref|XP_008450014.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Cucumis melo]
 ref|XP_008450015.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Cucumis melo]
Length=659

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 177/273 (65%), Gaps = 3/273 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFL-KAREEGIEPTEFMVSSVLSACAGLAAFELG  178
            +E++ +SW S++AVY Q+ L  +AL+VF    R  G+      +S+VL ACA   A   G
Sbjct  247  EEKDDISWNSMIAVYAQSGLSGEALEVFHGMVRHVGVRYNAVTLSAVLLACAHAGALRAG  306

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            + IH  V+K  +E+NV V + ++DMY KCG +E  ++ F  M E+N+ +W A++ GY   
Sbjct  307  KCIHDQVIKMDLEDNVCVGTSIIDMYCKCGRVEMAKKTFDRMKEKNVKSWTAMVAGYGMH  366

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            G A  ALD+F  M R    V PNY+TFV VL ACS AG VE G   F AMK KY IEPG 
Sbjct  367  GRAKEALDIFYKMVR--AGVKPNYITFVSVLAACSHAGLVEEGWHWFNAMKHKYDIEPGI  424

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            EHY C+VD+ GRAG + +AY  IK M ++P   VWG+LLGACR+H   +LG++AA  LF+
Sbjct  425  EHYGCMVDLFGRAGCLNKAYNLIKGMKMKPDFVVWGSLLGACRIHKNVDLGEVAAQKLFE  484

Query  719  IDPQDSGNHVILSNMFASSGRWEEANLVRKEMK  817
            +DP + G +V+LSN++A +GRW +   +R  MK
Sbjct  485  LDPDNCGYYVLLSNLYADAGRWADVERMRMLMK  517


 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 119/234 (51%), Gaps = 11/234 (5%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIE-------PTEFMVS-SVLSACAGLA  163
            RN VSW S++  Y QN+  + AL +F    EE  E       P + +V  SVLSAC+ ++
Sbjct  140  RNVVSWTSMITGYVQNEQADNALLLFKDLLEEETEVEDGNNVPLDSVVMVSVLSACSRVS  199

Query  164  AFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIG  343
               +   +HG VVK   + ++ V + L+D Y KCG     ++ F  M E++ I+WN++I 
Sbjct  200  GKGITEGVHGFVVKKGFDGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDISWNSMIA  259

Query  344  GYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYG  523
             YA  G +  AL++F  M R    V  N VT   VL AC+ AGA+  G  I + +  K  
Sbjct  260  VYAQSGLSGEALEVFHGMVRHV-GVRYNAVTLSAVLLACAHAGALRAGKCIHDQVI-KMD  317

Query  524  IEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +E        ++DM  + G VE A +   RM     V  W A++    +HG+ +
Sbjct  318  LEDNVCVGTSIIDMYCKCGRVEMAKKTFDRMK-EKNVKSWTAMVAGYGMHGRAK  370


 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 142/325 (44%), Gaps = 55/325 (17%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D  N  SW S++A   +     +AL+ F   R+ G+ PT       + +C+ L     GR
Sbjct  37   DISNVHSWNSVIADLARGGDSVEALRAFSSLRKLGLTPTRSSFPCTIKSCSALCDLVSGR  96

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
              H        + ++FV S L+DMY KCG ++D    F E+P RN+++W ++I GY    
Sbjct  97   MSHQQAFVFGFDTDLFVSSALIDMYSKCGQLQDARALFDEIPLRNVVSWTSMITGYVQNE  156

Query  362  HANMALDLFEDMTRKTQDV-----VP-NYVTFVCVLTACSRAGA-----------VETGM  490
             A+ AL LF+D+  +  +V     VP + V  V VL+ACSR              V+ G 
Sbjct  157  QADNALLLFKDLLEEETEVEDGNNVPLDSVVMVSVLSACSRVSGKGITEGVHGFVVKKGF  216

Query  491  D------------------------IFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAY  598
            D                        +F+ M++K  I      +  ++ +  ++G+   A 
Sbjct  217  DGSIGVGNTLMDAYAKCGQPLVSKKVFDWMEEKDDIS-----WNSMIAVYAQSGLSGEAL  271

Query  599  E----FIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS---GNHVILS  757
            E     ++ + +R       A+L AC   G    GK   D + ++D +D+   G  +I  
Sbjct  272  EVFHGMVRHVGVRYNAVTLSAVLLACAHAGALRAGKCIHDQVIKMDLEDNVCVGTSII--  329

Query  758  NMFASSGRWEEANLVRKEMKDIGIK  832
            +M+   GR E A      MK+  +K
Sbjct  330  DMYCKCGRVEMAKKTFDRMKEKNVK  354



>ref|XP_002278128.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
[Vitis vinifera]
Length=597

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 178/276 (64%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW +++A YEQN+ G  A+K+F + + E ++     + SV+SACA L A   GR +
Sbjct  293  QNLVSWNAMIAAYEQNNAGANAVKLFRRMQAEKVDFDYITMVSVISACASLGALNTGRWM  352

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H LV +  +E NV + + L+DMY KCG I+     F  +P R++++W ++IG  A  GH 
Sbjct  353  HELVKRKGLEINVSITNALIDMYAKCGNIDLAREVFERLPCRSVVSWTSMIGACASHGHG  412

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF  M  K + V PN  TF  V TAC  +G VE G   FE+M   Y I PG EH 
Sbjct  413  EDALKLFSRM--KDEGVKPNSFTFAAVFTACRHSGLVEEGRKHFESMMRDYSIMPGVEHC  470

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            AC+VD+LGRAG +  AYEFI +MP+ P VSVWGALLG+CR+H   EL ++ A+ LF +DP
Sbjct  471  ACMVDLLGRAGSLMEAYEFIDKMPVEPDVSVWGALLGSCRIHSNLELAELVAEKLFLLDP  530

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            Q    +V++SN++A +GRWE+A  +RK M++  +KK
Sbjct  531  QTVTFYVLMSNIYAEAGRWEDAARLRKLMEERELKK  566


 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 125/226 (55%), Gaps = 4/226 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN VSW +++A Y QN   ++ L VF +    G +P    + SVL ACAGL    LG+ I
Sbjct  192  RNIVSWTAVIAGYVQNRYFKEGLGVFREMVGSGTQPNAVTLVSVLPACAGLEFLNLGKLI  251

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG  +K  V+ +V + + L+ +YGKCG +E     F  M  +NL++WNA+I  Y      
Sbjct  252  HGYGIKLGVDPDVSLTNALIALYGKCGNVETARSLFDGMVVQNLVSWNAMIAAYEQNNAG  311

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+ LF  M  +  D   +Y+T V V++AC+  GA+ TG  + E +K K G+E      
Sbjct  312  ANAVKLFRRMQAEKVDF--DYITMVSVISACASLGALNTGRWMHELVKRK-GLEINVSIT  368

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
              ++DM  + G ++ A E  +R+P R  VS W +++GAC  HG  E
Sbjct  369  NALIDMYAKCGNIDLAREVFERLPCRSVVS-WTSMIGACASHGHGE  413


 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 106/220 (48%), Gaps = 6/220 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+   W +L+  Y      E+AL ++      G+ P  +    V+ +CA L+A   G+ 
Sbjct  90   KRDVFLWNTLIRGYADAGPCEEALALYSNMHGAGLFPDNYTFPFVVRSCAVLSALREGKE  149

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  +VK   + +VFV+S LV MY + G     E  F EM  RN+++W A+I GY    +
Sbjct  150  VHCNIVKHGFDSDVFVQSSLVAMYSQSGETLGMELVFGEMVVRNIVSWTAVIAGYVQNRY  209

Query  365  ANMALDLFEDMT-RKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                L +F +M    TQ   PN VT V VL AC+    +  G  +      K G++P   
Sbjct  210  FKEGLGVFREMVGSGTQ---PNAVTLVSVLPACAGLEFLNLG-KLIHGYGIKLGVDPDVS  265

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
                ++ + G+ G VE A      M ++  VS W A++ A
Sbjct  266  LTNALIALYGKCGNVETARSLFDGMVVQNLVS-WNAMIAA  304


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 84/176 (48%), Gaps = 10/176 (6%)
 Frame = +2

Query  137  VLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKC--GCIEDCERAFYEMPE  310
            +L+ C+ L   +L R IH LVV     +N+ + + L+ +   C    ++   + F +MP+
Sbjct  35   LLNCCSSLP--DLSR-IHALVVTNGCGQNLLLSTKLI-ITACCLAPTMDYARKMFDQMPK  90

Query  311  RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM  490
            R++  WN LI GYA  G    AL L+ +M      + P+  TF  V+ +C+   A+  G 
Sbjct  91   RDVFLWNTLIRGYADAGPCEEALALYSNM--HGAGLFPDNYTFPFVVRSCAVLSALREGK  148

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
            ++   +  K+G +      + +V M  ++G           M +R  VS W A++ 
Sbjct  149  EVHCNIV-KHGFDSDVFVQSSLVAMYSQSGETLGMELVFGEMVVRNIVS-WTAVIA  202



>ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Glycine max]
Length=816

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 181/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V+W +++  Y QN    +AL +F + +   I+P  F + SV++A A L+     + IHGL
Sbjct  411  VTWNAMILGYAQNGCVNEALNLFCEMQSHDIKPDSFTLVSVITALADLSVTRQAKWIHGL  470

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             ++  +++NVFV + L+D + KCG I+   + F  M ER++ITWNA+I GY   GH   A
Sbjct  471  AIRTLMDKNVFVCTALIDTHAKCGAIQTARKLFDLMQERHVITWNAMIDGYGTNGHGREA  530

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            LDLF +M  +   V PN +TF+ V+ ACS +G VE GM  FE+MK+ YG+EP  +HY  +
Sbjct  531  LDLFNEM--QNGSVKPNEITFLSVIAACSHSGLVEEGMYYFESMKENYGLEPTMDHYGAM  588

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            VD+LGRAG ++ A++FI+ MP++P ++V GA+LGACR+H   ELG+  AD LF +DP D 
Sbjct  589  VDLLGRAGRLDDAWKFIQDMPVKPGITVLGAMLGACRIHKNVELGEKTADELFDLDPDDG  648

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+NM+AS+  W++   VR  M+  GI+K
Sbjct  649  GYHVLLANMYASASMWDKVARVRTAMEKKGIQK  681


 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 91/171 (53%), Gaps = 2/171 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW +++A Y QN    +A++V L+ +E G +P    + SVL A A L A  +GRS
Sbjct  205  QRDLVSWNTVVAGYAQNGFARRAVQVVLQMQEAGQKPDSITLVSVLPAVADLKALRIGRS  264

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG   +A  E  V V + ++D Y KCG +      F  M  RN+++WN +I GYA  G 
Sbjct  265  IHGYAFRAGFEYMVNVATAMLDTYFKCGSVRSARLVFKGMSSRNVVSWNTMIDGYAQNGE  324

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDK  517
            +  A   F  M    + V P  V+ +  L AC+  G +E G  +   + +K
Sbjct  325  SEEAFATFLKML--DEGVEPTNVSMMGALHACANLGDLERGRYVHRLLDEK  373


 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 104/227 (46%), Gaps = 12/227 (5%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V + ++L  Y +N     A++ + + R + + P  +  + +L           GR IHG+
Sbjct  108  VLYHTMLKGYAKNSTLRDAVRFYERMRCDEVMPVVYDFTYLLQLSGENLDLRRGREIHGM  167

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            V+    + N+F  + +V++Y KC  IED  + F  MP+R+L++WN ++ GYA  G A  A
Sbjct  168  VITNGFQSNLFAMTAVVNLYAKCRQIEDAYKMFERMPQRDLVSWNTVVAGYAQNGFARRA  227

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + +   M    Q   P+ +T V VL A +   A+  G  I       Y    G E+   V
Sbjct  228  VQVVLQMQEAGQK--PDSITLVSVLPAVADLKALRIGRSI-----HGYAFRAGFEYMVNV  280

Query  557  ----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
                +D   + G V  A    K M  R  VS W  ++     +G+ E
Sbjct  281  ATAMLDTYFKCGSVRSARLVFKGMSSRNVVS-WNTMIDGYAQNGESE  326



>ref|XP_008225136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Prunus mume]
Length=947

 Score =   263 bits (671),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 183/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q + GE+ALK++L+ +  G +P  F+ SS+L+ACA L+A+E G+ IH  
Sbjct  541  VAFTSMITAYSQYEQGEEALKLYLQMQRRGNKPDSFVCSSLLNACASLSAYEQGKQIHVH  600

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     + F  + LV+MY KCG I+D +RAF E+P+R +++W+A+IGG A  GH   A
Sbjct  601  ILKFGFMSDAFAGNSLVNMYAKCGSIDDADRAFSEVPQRGIVSWSAMIGGLAQHGHGKRA  660

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+LF  M +    V PN++T V VL AC+ AG V      FE+MK+ +G+ P  EHYAC+
Sbjct  661  LNLFNQMLK--YGVSPNHITLVSVLCACNHAGLVTEARKYFESMKELFGVVPRQEHYACM  718

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +  A E +  MP +   SVWGALLGA R+H   ELG+ AA+ L  ++P+ S
Sbjct  719  IDLLGRAGKINEAMELVNTMPFQANASVWGALLGAARIHKNVELGQRAAEMLLALEPEKS  778

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G W+    +R+ M+D  +KK
Sbjct  779  GTHVLLANIYASAGMWDNVAKMRRLMRDGQVKK  811


 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 113/223 (51%), Gaps = 4/223 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN LG++AL  F +    G++  EF   SVL AC+      LG+ 
Sbjct  133  EPDLVSWSALISGYAQNGLGKEALSAFREMHSLGVKCNEFTFPSVLKACSITRDSVLGKQ  192

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+ +    E + FV + LV MY KCG   D  R F  +PERN+++WNAL   Y     
Sbjct  193  VHGIALLTGFESDEFVANTLVVMYAKCGEFGDSRRLFDAIPERNVVSWNALFSCYVQSDS  252

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+DLF++M      V PN  +   ++ AC+  G    G  I   M  K G E  +  
Sbjct  253  YGEAMDLFQEMI--LSGVRPNEYSLSSIINACTGLGDGSRGRKIHGYMV-KLGYESDSFS  309

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
               +VDM  +   +E A    +++  +P +  W A++  C +H
Sbjct  310  ANALVDMYAKVKGLEDAISVFEKIA-QPDIVSWNAVIAGCVLH  351


 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 112/225 (50%), Gaps = 4/225 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y Q+D   +A+ +F +    G+ P E+ +SS+++AC GL     GR 
Sbjct  234  ERNVVSWNALFSCYVQSDSYGEAMDLFQEMILSGVRPNEYSLSSIINACTGLGDGSRGRK  293

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG +VK   E + F  + LVDMY K   +ED    F ++ + ++++WNA+I G     +
Sbjct  294  IHGYMVKLGYESDSFSANALVDMYAKVKGLEDAISVFEKIAQPDIVSWNAVIAGCVLHEY  353

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL  F  M      + PN  T    L AC+  G  + G  +   +  K   E  +  
Sbjct  354  HDWALQFFGQMN--GSGICPNMFTLSSALKACAGLGFEKLGRQLHSFLL-KMDTESDSFV  410

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
               ++DM  +  M++ A      MP +  ++ W A++     +G+
Sbjct  411  NVGLIDMYCKCEMIDDARVLFNMMPKKEMIA-WNAVISGHSQNGE  454


 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 140/307 (46%), Gaps = 40/307 (13%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++A    ++  + AL+ F +    GI P  F +SS L ACAGL   +LGR +H  
Sbjct  339  VSWNAVIAGCVLHEYHDWALQFFGQMNGSGICPNMFTLSSALKACAGLGFEKLGRQLHSF  398

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K   E + FV   L+DMY KC  I+D    F  MP++ +I WNA+I G++  G    A
Sbjct  399  LLKMDTESDSFVNVGLIDMYCKCEMIDDARVLFNMMPKKEMIAWNAVISGHSQNGEDIEA  458

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAV---------------ETGMDIFEAMK  511
            + LF +M +  + +  N  T   VL + +   A+               ++ M +  ++ 
Sbjct  459  VSLFSEMYK--EGIEFNQTTLSTVLKSTASVQAIKFCEQIHALSVKSGFQSDMYVINSLL  516

Query  512  DKYGIEPGAEHYACVV------DMLGRAGMVE------------RAYEFIKRMPIRPTVS  637
            D YG     EH A +       D++    M+             + Y  ++R   +P   
Sbjct  517  DTYGKCGKVEHAAKIFEGCSTEDVVAFTSMITAYSQYEQGEEALKLYLQMQRRGNKPDSF  576

Query  638  VWGALLGACRVHGKPELGKIAADNLFQ---IDPQDSGNHVILSNMFASSGRWEEANLVRK  808
            V  +LL AC      E GK    ++ +   +    +GN ++  NM+A  G  ++A+    
Sbjct  577  VCSSLLNACASLSAYEQGKQIHVHILKFGFMSDAFAGNSLV--NMYAKCGSIDDADRAFS  634

Query  809  EMKDIGI  829
            E+   GI
Sbjct  635  EVPQRGI  641


 Score =   100 bits (248),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 137/276 (50%), Gaps = 17/276 (6%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            ++W ++++ + QN    +A+ +F +  +EGIE  +  +S+VL + A + A +    IH L
Sbjct  440  IAWNAVISGHSQNGEDIEAVSLFSEMYKEGIEFNQTTLSTVLKSTASVQAIKFCEQIHAL  499

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             VK+  + +++V + L+D YGKCG +E   + F      +++ + ++I  Y+       A
Sbjct  500  SVKSGFQSDMYVINSLLDTYGKCGKVEHAAKIFEGCSTEDVVAFTSMITAYSQYEQGEEA  559

Query  377  LDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
            L L+  M R+     P+  +FVC  +L AC+   A E G  I   +  K+G    A    
Sbjct  560  LKLYLQMQRRGNK--PD--SFVCSSLLNACASLSAYEQGKQIHVHIL-KFGFMSDAFAGN  614

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ--ID  724
             +V+M  + G ++ A      +P R  VS W A++G    HG    GK A  NLF   + 
Sbjct  615  SLVNMYAKCGSIDDADRAFSEVPQRGIVS-WSAMIGGLAQHGH---GKRAL-NLFNQMLK  669

Query  725  PQDSGNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
               S NH+ L ++  +   +G   EA    + MK++
Sbjct  670  YGVSPNHITLVSVLCACNHAGLVTEARKYFESMKEL  705


 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 83/198 (42%), Gaps = 5/198 (3%)
 Frame = +2

Query  80   VFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYG  259
            V    ++    PT    S +LS CA   +  +G  +H  +++     +  +R+ L+++Y 
Sbjct  57   VLSSVQKGNFSPTSISYSKLLSQCAASKSVGVGMEVHAHIIRCGCSGDQSLRNHLINLYS  116

Query  260  KCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTF  439
            KC       +   E  E +L++W+ALI GYA  G    AL  F +M   +  V  N  TF
Sbjct  117  KCRFFRHARKLVDESTEPDLVSWSALISGYAQNGLGKEALSAFREM--HSLGVKCNEFTF  174

Query  440  VCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMP  619
              VL ACS       G  +   +    G E        +V M  + G    +      +P
Sbjct  175  PSVLKACSITRDSVLGKQV-HGIALLTGFESDEFVANTLVVMYAKCGEFGDSRRLFDAIP  233

Query  620  IRPTVSVWGALLGACRVH  673
             R  VS W AL  +C V 
Sbjct  234  ERNVVS-WNALF-SCYVQ  249



>gb|KEH36690.1| PPR containing plant-like protein [Medicago truncatula]
Length=613

 Score =   256 bits (655),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 181/277 (65%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ V+W S++  +  N    +AL +F +   +G+EP  F V S+ SACA L A ELGR 
Sbjct  203  ERDLVAWNSVINGFALNGKPNEALSLFREMSLKGVEPDGFTVVSLFSACAELGALELGRR  262

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  ++K  +  N+ V + L+D Y KCG I + ++ F EM ERN+++W +L+ G A  G 
Sbjct  263  VHVYLLKVGLTGNLHVNNSLLDFYAKCGSIREAQQVFSEMSERNVVSWTSLVVGLAVNGF  322

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL LF++M R  Q +VP  +TFV VL ACS  G ++ G + F  MK++YGI P  EH
Sbjct  323  GEEALGLFKEMER--QKIVPREITFVGVLYACSHCGMLDEGFNYFRRMKEEYGIRPRIEH  380

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+L RAG+V+RAYE+I+ MP++P   +W  LLGAC VHG   LG+IA  +L +++
Sbjct  381  YGCMVDLLSRAGLVKRAYEYIQSMPMQPNAVIWRTLLGACTVHGDLSLGEIARSHLLKLE  440

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+ SG++V+LSN++AS  RW +   VR+ M + G+ K
Sbjct  441  PKHSGDYVLLSNLYASERRWSDVQTVRRSMIEDGVWK  477


 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 106/222 (48%), Gaps = 4/222 (2%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N  +W +++  Y ++D    AL ++ K     +EP       +L A +       G  IH
Sbjct  104  NVFTWNTMIRGYAESDNSTPALGLYRKMLGSCVEPDTHTYPFLLKAISKSLNVRDGEMIH  163

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
             + V+   E  +FVR+ L+ +Y  CG  E   + F  M ER+L+ WN++I G+A  G  N
Sbjct  164  SVTVRNGFESLIFVRNSLLHIYAACGDTESAYKVFELMGERDLVAWNSVINGFALNGKPN  223

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
             AL LF +M+ K   V P+  T V + +AC+  GA+E G  +   +  K G+        
Sbjct  224  EALSLFREMSLK--GVEPDGFTVVSLFSACAELGALELGRRVHVYLL-KVGLTGNLHVNN  280

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
             ++D   + G +  A +    M  R  VS W +L+    V+G
Sbjct  281  SLLDFYAKCGSIREAQQVFSEMSERNVVS-WTSLVVGLAVNG  321



>ref|XP_004237632.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]
 ref|XP_010319796.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]
Length=914

 Score =   262 bits (669),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 182/272 (67%), Gaps = 2/272 (1%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            S+ SL+  Y     GE+A+K++LK ++  ++P  F+ SS+L+ACA L+A+E G+ IH  V
Sbjct  509  SFTSLITAYALFGQGEEAMKLYLKLQDMDLKPDSFVCSSLLNACANLSAYEQGKQIHAHV  568

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            +K     +VF  + LV+MY KCG IED   AF+E+P++ +++W+A+IGG A  GHA  AL
Sbjct  569  LKFGFMSDVFAGNSLVNMYAKCGSIEDASCAFHEVPKKGIVSWSAMIGGLAQHGHAKQAL  628

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
             LF +M +    V PN++T V VL AC+ AG V      FE MKD + IEP  EHYAC++
Sbjct  629  HLFGEMLK--DGVSPNHITLVSVLYACNHAGLVAEAKKYFETMKDSFRIEPTQEHYACMI  686

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSG  739
            D+LGRAG ++ A E + +MP     SVWGALLGA R+H   E+GK AA+ LF ++P+ SG
Sbjct  687  DVLGRAGKLDDAIELVNKMPFEANASVWGALLGAARIHKNVEVGKHAAEMLFSLEPEKSG  746

Query  740  NHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             HV+L+N++AS G W +   VR+ MK+  +KK
Sbjct  747  THVLLANIYASVGLWGDVAKVRRFMKNSRVKK  778


 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 130/258 (50%), Gaps = 14/258 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW SL++ Y QN  G+ A+  FLK    G+   EF   SVL AC+      LG+ 
Sbjct  100  EPDLVSWSSLISGYSQNGFGKDAIWGFLKMHSLGLRCNEFTFPSVLKACSTEKELCLGKQ  159

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+VV    + +VFV + LV MY KCG   D    F E+PERN+++WNAL   Y     
Sbjct  160  LHGVVVVTGFDSDVFVANTLVVMYAKCGEFVDSRMLFEEIPERNVVSWNALFSCYTQNDF  219

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM-KDKYGIEPGAE  541
             + A+ +F DM      V P+  +   +L AC+  G +  G  I   + K  YG +P + 
Sbjct  220  FSEAMCMFHDMI--GSGVRPDEYSLSNILNACTGLGDIVEGKKIHGYLVKLGYGSDPFSS  277

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            +   +VDM  + G ++ A    + + + P +  W A++  C +H   E    A D L Q+
Sbjct  278  N--ALVDMYAKGGDLKDAITAFEGIVV-PDIVSWNAIIAGCVLH---ECQGQAIDMLNQM  331

Query  722  DPQDSGNHVILSNMFASS  775
              + SG   I  NMF  S
Sbjct  332  --RRSG---IWPNMFTLS  344


 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 105/219 (48%), Gaps = 5/219 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y QND   +A+ +F      G+ P E+ +S++L+AC GL     G+ 
Sbjct  201  ERNVVSWNALFSCYTQNDFFSEAMCMFHDMIGSGVRPDEYSLSNILNACTGLGDIVEGKK  260

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG +VK     + F  + LVDMY K G ++D   AF  +   ++++WNA+I G      
Sbjct  261  IHGYLVKLGYGSDPFSSNALVDMYAKGGDLKDAITAFEGIVVPDIVSWNAIIAGCVLHEC  320

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM-KDKYGIEPGAE  541
               A+D+   M R    + PN  T    L AC+     E G  +   + K    ++P   
Sbjct  321  QGQAIDMLNQMRR--SGIWPNMFTLSSALKACAALELPELGKGLHSLLIKKDIILDPFVS  378

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
                ++DM  +  + + A      MP +  +++   + G
Sbjct  379  --VGLIDMYCKCNLTKDARLIYDLMPGKDLIALNAMISG  415


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/307 (27%), Positives = 138/307 (45%), Gaps = 40/307 (13%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++A    ++   +A+ +  + R  GI P  F +SS L ACA L   ELG+ +H L
Sbjct  306  VSWNAIIAGCVLHECQGQAIDMLNQMRRSGIWPNMFTLSSALKACAALELPELGKGLHSL  365

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K  +  + FV   L+DMY KC   +D    +  MP ++LI  NA+I GY+     +  
Sbjct  366  LIKKDIILDPFVSVGLIDMYCKCNLTKDARLIYDLMPGKDLIALNAMISGYSQNEADDAC  425

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACS-----------RAGAVETGM--DIF--EAMK  511
            LDLF      TQ +  +  T + +L + +            A +V++G   D F   ++ 
Sbjct  426  LDLFTQTF--TQGIGFDQTTLLAILNSAAGLQAANVCKQVHALSVKSGFLCDTFVINSLV  483

Query  512  DKYG----IEPGAE-HYACVV-------------DMLGRAGMVERAYEFIKRMPIRPTVS  637
            D YG    ++  A   Y C                + G+     + Y  ++ M ++P   
Sbjct  484  DSYGKCTRLDDAARIFYECATLDLPSFTSLITAYALFGQGEEAMKLYLKLQDMDLKPDSF  543

Query  638  VWGALLGACRVHGKPELGKIAADNLFQIDPQD---SGNHVILSNMFASSGRWEEANLVRK  808
            V  +LL AC      E GK    ++ +        +GN ++  NM+A  G  E+A+    
Sbjct  544  VCSSLLNACANLSAYEQGKQIHAHVLKFGFMSDVFAGNSLV--NMYAKCGSIEDASCAFH  601

Query  809  EMKDIGI  829
            E+   GI
Sbjct  602  EVPKKGI  608


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 78/175 (45%), Gaps = 4/175 (2%)
 Frame = +2

Query  131  SSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE  310
            +++LS  +   +   G  IH  + K  +  +   R+ LV++Y KCG  +  ++   E PE
Sbjct  41   TNLLSNLSKTKSLTPGLQIHAHLTKLGLSNHSKYRNHLVNLYSKCGIFQYAQKLIDESPE  100

Query  311  RNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGM  490
             +L++W++LI GY+  G    A+  F  M   +  +  N  TF  VL ACS    +  G 
Sbjct  101  PDLVSWSSLISGYSQNGFGKDAIWGFLKM--HSLGLRCNEFTFPSVLKACSTEKELCLGK  158

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
             +   +    G +        +V M  + G    +    + +P R  VS W AL 
Sbjct  159  QL-HGVVVVTGFDSDVFVANTLVVMYAKCGEFVDSRMLFEEIPERNVVS-WNALF  211



>ref|XP_011005774.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Populus euphratica]
 ref|XP_011005775.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Populus euphratica]
 ref|XP_011005776.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Populus euphratica]
 ref|XP_011005777.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Populus euphratica]
 ref|XP_011005779.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Populus euphratica]
Length=590

 Score =   256 bits (653),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 179/276 (65%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW +L+A Y +   G+KA  +F     E ++PT F  SSVL ACA L + E G+ +
Sbjct  182  KNEVSWNALIAGYARKGQGDKAFCLFSNMLRENVKPTHFTYSSVLCACASLGSLEQGKWV  241

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L++K   +   FV + L+DMY K G IED ++    + +R++++WN++  GYA  G  
Sbjct  242  HALMIKWGEKLVAFVGNTLLDMYAKSGSIEDAKKVSDRLVKRDVVSWNSMCTGYAQPGLG  301

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
             +AL  FE+M R    + PN +TF+CVLTACS AG +  G   F+ MK KY +EP   HY
Sbjct  302  KVALQRFEEMLRIR--IAPNDITFLCVLTACSHAGLLGEGRHYFDMMK-KYNVEPQISHY  358

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              +VD+LGR G ++RA +FI  MPI+PT +VWGALLGACR+H   ELG  AA+ +F++D 
Sbjct  359  VTMVDLLGRGGHLDRAIQFISEMPIKPTAAVWGALLGACRMHKNMELGGYAAERIFELDS  418

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
               G HV+L N++A +GRW +A  VRK MK+ G+KK
Sbjct  419  HYPGTHVLLYNIYALAGRWNDAAKVRKMMKESGVKK  454


 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/249 (32%), Positives = 139/249 (56%), Gaps = 14/249 (6%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFEL--GR  181
            R+ V+W +L+  Y Q+D  + AL +  +    G++P +F ++S+L A +G+ + ++  GR
Sbjct  79   RDVVTWTALITGYSQHDRPQDALLLLPEMLRIGVKPNQFTLASLLKAASGVGSPDVLQGR  138

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HGL ++   + NV+V   ++DMY +C  +E+ +  F  M  +N ++WNALI GYA +G
Sbjct  139  QLHGLCLRYGYDLNVYVSCAILDMYARCHHLEEAQLIFDVMVSKNEVSWNALIAGYARKG  198

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
              + A  LF +M R  ++V P + T+  VL AC+  G++E G  +  A+  K+G +  A 
Sbjct  199  QGDKAFCLFSNMLR--ENVKPTHFTYSSVLCACASLGSLEQGKWV-HALMIKWGEKLVAF  255

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNL---  712
                ++DM  ++G +E A +   R+  R  VS W ++   C  + +P LGK+A       
Sbjct  256  VGNTLLDMYAKSGSIEDAKKVSDRLVKRDVVS-WNSM---CTGYAQPGLGKVALQRFEEM  311

Query  713  --FQIDPQD  733
               +I P D
Sbjct  312  LRIRIAPND  320


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 106/237 (45%), Gaps = 11/237 (5%)
 Frame = +2

Query  137  VLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERN  316
            +L  C+ L     G+ IH L++ +   +++ +++ L++MY KCG +    + F EM  R+
Sbjct  21   LLKRCSHLNKLNEGKIIHALLLNSRFRDDLVMQNTLLNMYAKCGDLVYARKLFDEMSSRD  80

Query  317  LITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGA--VETGM  490
            ++TW ALI GY+       AL L  +M R    V PN  T   +L A S  G+  V  G 
Sbjct  81   VVTWTALITGYSQHDRPQDALLLLPEMLRI--GVKPNQFTLASLLKAASGVGSPDVLQGR  138

Query  491  DIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRV  670
             +   +  +YG +        ++DM  R   +E A      M  +  VS W AL+     
Sbjct  139  QL-HGLCLRYGYDLNVYVSCAILDMYARCHHLEEAQLIFDVMVSKNEVS-WNALIAGYAR  196

Query  671  HGKPELGKIAADNLFQIDPQDSGNHVILSNMF---ASSGRWEEANLVRKEMKDIGIK  832
             G+ +       N+ + + + +  H   S++    AS G  E+   V   M   G K
Sbjct  197  KGQGDKAFCLFSNMLRENVKPT--HFTYSSVLCACASLGSLEQGKWVHALMIKWGEK  251


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 3/126 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ VSW S+   Y Q  LG+ AL+ F +     I P +     VL+AC+       GR 
Sbjct  282  KRDVVSWNSMCTGYAQPGLGKVALQRFEEMLRIRIAPNDITFLCVLTACSHAGLLGEGRH  341

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPER-NLITWNALIGGYAHQG  361
               ++ K  VE  +     +VD+ G+ G ++   +   EMP +     W AL+G  A + 
Sbjct  342  YFDMMKKYNVEPQISHYVTMVDLLGRGGHLDRAIQFISEMPIKPTAAVWGALLG--ACRM  399

Query  362  HANMAL  379
            H NM L
Sbjct  400  HKNMEL  405



>ref|XP_011072035.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial [Sesamum indicum]
Length=645

 Score =   257 bits (656),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 182/276 (66%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW +L+A Y ++  G  A+K+F   +  G EPT F  SS+ +ACA   A E G+ +
Sbjct  237  KNEVSWNALVAAYGRDGEGHNAVKLFSDMKRGGFEPTHFTYSSIFAACANSGALEQGKWV  296

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  +VK+ ++   FV + L+DMYGK G IED ++ FY + ++++++WN+++  YA  G  
Sbjct  297  HADMVKSGLKLIAFVGNTLLDMYGKAGSIEDAKKVFYRLVKKDIVSWNSMLTAYAQHGLG  356

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A+DLFE+M R      PN +TF+CVL A S AG ++ G+  FE M+ KY +EP   HY
Sbjct  357  QEAVDLFEEMRR--VGFQPNEITFLCVLNASSHAGLLDKGLYYFELMR-KYELEPDITHY  413

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              +VD+LGR G ++RA  FI+ M I+PT ++W ALL ACR+H   ELG  AA+ +F++DP
Sbjct  414  VTIVDLLGRVGQLDRAQRFIREMTIQPTAAIWTALLAACRMHKNMELGAYAAERVFELDP  473

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSG H++L N++AS+GR  +A  VR+ M + G+KK
Sbjct  474  HDSGPHMLLCNIYASAGRLRDAARVRRMMNESGVKK  509


 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 130/238 (55%), Gaps = 8/238 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ VS+  L++ Y Q++   +AL ++++    G +P EF   S L +  GL +  LG  
Sbjct  135  ERDMVSYTMLISGYSQSNEFREALGLYVEMLRTGFQPNEFTFGSALKSAGGLQSDALGSG  194

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  +K   EENV+V S LVDMY +C  +   +  F E+  +N ++WNAL+  Y   G 
Sbjct  195  IHGACLKCGYEENVYVGSALVDMYTRCKKMAMAKMIFDELKSKNEVSWNALVAAYGRDGE  254

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A+ LF DM R   +  P + T+  +  AC+ +GA+E G  +   M  K G++  A  
Sbjct  255  GHNAVKLFSDMKRGGFE--PTHFTYSSIFAACANSGALEQGKWVHADMV-KSGLKLIAFV  311

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
               ++DM G+AG +E A +   R+  +  VS W ++L A   HG   LG+ A D LF+
Sbjct  312  GNTLLDMYGKAGSIEDAKKVFYRLVKKDIVS-WNSMLTAYAQHG---LGQEAVD-LFE  364


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 107/253 (42%), Gaps = 20/253 (8%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDC  283
             +EP       +   C      + G+ +H   V +  +  V +++ +++MY KCG ++  
Sbjct  67   AMEPDARFYMELFKKCTDQGRLKEGQMVHSHFVNSRFQHYVVLQNTVLNMYAKCGDMKMA  126

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
             + F  M ER+++++  LI GY+       AL L+ +M R      PN  TF   L +  
Sbjct  127  RKVFDGMTERDMVSYTMLISGYSQSNEFREALGLYVEMLR--TGFQPNEFTFGSALKSAG  184

Query  464  RAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVW  643
               +   G  I  A   K G E      + +VDM  R   +  A      +  +  VS W
Sbjct  185  GLQSDALGSGIHGACL-KCGYEENVYVGSALVDMYTRCKKMAMAKMIFDELKSKNEVS-W  242

Query  644  GALLGACRVHGKPELGKIAADNLFQIDPQDSG---NHVILSNMFAS--------SGRWEE  790
             AL+ A   +G+   G  A   LF  D +  G    H   S++FA+         G+W  
Sbjct  243  NALVAA---YGRDGEGHNAV-KLFS-DMKRGGFEPTHFTYSSIFAACANSGALEQGKWVH  297

Query  791  ANLVRKEMKDIGI  829
            A++V+  +K I  
Sbjct  298  ADMVKSGLKLIAF  310



>ref|XP_010087050.1| hypothetical protein L484_012294 [Morus notabilis]
 ref|XP_010113226.1| hypothetical protein L484_000356 [Morus notabilis]
 gb|EXB25868.1| hypothetical protein L484_012294 [Morus notabilis]
 gb|EXC75162.1| hypothetical protein L484_000356 [Morus notabilis]
Length=773

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 184/277 (66%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ +SW +++A Y QN  GE+AL++F++ ++EG   T    +  LS CA +AA ELG+ 
Sbjct  363  QRDSISWAAIIAGYAQNGYGEEALRLFMEMKKEGERLTRSCYTCALSTCAEIAALELGKQ  422

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG +VKA  E   +V + L+ MY KCG IE+    F ++  +++++WN +I GYA  G 
Sbjct  423  LHGRLVKAGFETGCYVGNALLVMYSKCGSIEEAYNVFKDIEVKDIVSWNTMIAGYARHGF  482

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL +FE M  K   ++P+ VT V VL+ACS  G VE G   F +M   YGI P ++H
Sbjct  483  GKEALMIFESM--KAMGIIPDDVTLVGVLSACSHTGLVERGKQYFYSMNQDYGITPNSKH  540

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C++D+LGRAG ++ A + ++ MP  P  + WGALLGA R+HG  ELG+ AA  +F+++
Sbjct  541  YTCMIDLLGRAGCLDEAQDLMRNMPFEPDAATWGALLGASRIHGNTELGEKAAKIIFELE  600

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+++G +V+LSN++A+SGRW +   +R +M+D G+KK
Sbjct  601  PENAGMYVLLSNLYAASGRWTDVRKMRLKMRDTGVKK  637


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 128/304 (42%), Gaps = 44/304 (14%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVF-LKAREEGIEPTEFMVSSV-----LSACAGLAA  166
            ++N +SW SLL+ Y QN   + A ++F  KA  E +     M   V     + A      
Sbjct  177  DKNEISWNSLLSAYVQNGRIDDARRLFESKADWEVVSWNCLMGGYVRKKRLVDARKLFDQ  236

Query  167  FELGRSIHGLVVKACVEEN-----------------VFVRSVLVDMYGKCGCIEDCERAF  295
              +  ++    +  C  +N                 VF  + ++  Y + G +++  R F
Sbjct  237  MPIRDAVSWNTMITCYAQNSELAESRRLFEESPIRDVFAWTAMMSGYVQHGMLDEARRIF  296

Query  296  YEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGA  475
             EMP +N ++WNA+I GY      ++A +LFE M  +      N  ++  +LTA +++G 
Sbjct  297  DEMPVKNPVSWNAIIAGYVRCKRMDIARELFEVMPCR------NVSSWNTMLTAYAQSGD  350

Query  476  VETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPI---RPTVSVWG  646
            +     IF+ M  +  I      +A ++    + G  E A      M     R T S + 
Sbjct  351  IAQARFIFDRMPQRDSIS-----WAAIIAGYAQNGYGEEALRLFMEMKKEGERLTRSCYT  405

Query  647  ALLGACRVHGKPELGKIAADNLFQIDPQDS---GNHVILSNMFASSGRWEEANLVRK--E  811
              L  C      ELGK     L +   +     GN +++  M++  G  EEA  V K  E
Sbjct  406  CALSTCAEIAALELGKQLHGRLVKAGFETGCYVGNALLV--MYSKCGSIEEAYNVFKDIE  463

Query  812  MKDI  823
            +KDI
Sbjct  464  VKDI  467


 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 61/267 (23%), Positives = 118/267 (44%), Gaps = 25/267 (9%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V W   +  + +N   + AL+VF       +     M+S  L+       F+L R +   
Sbjct  57   VQWNMDITSHMRNGHCKAALRVFNDMSRRSVVSYNAMISGYLAN----DRFDLARDM---  109

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
              +   E ++   +V++  Y +   +      F  MPER++++WN+++ GYA  G+ + A
Sbjct  110  -FERMPERDLVSWNVMLSGYVRNRKLGAARMLFDRMPERDVVSWNSMLSGYAQYGYVDEA  168

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + +FE M  K      N +++  +L+A  + G ++    +FE+  D   +      + C+
Sbjct  169  MKIFEMMPDK------NEISWNSLLSAYVQNGRIDDARRLFESKADWEVVS-----WNCL  217

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP-QD  733
            +    R   +  A +   +MPIR  VS W  ++  C      EL +  +  LF+  P +D
Sbjct  218  MGGYVRKKRLVDARKLFDQMPIRDAVS-WNTMI-TCYAQNS-ELAE--SRRLFEESPIRD  272

Query  734  SGNHVILSNMFASSGRWEEANLVRKEM  814
                  + + +   G  +EA  +  EM
Sbjct  273  VFAWTAMMSGYVQHGMLDEARRIFDEM  299


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 118/274 (43%), Gaps = 23/274 (8%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ VSW S+L+ Y Q    ++A+K+F    E   +  E   +S+LSA       +  R 
Sbjct  146  ERDVVSWNSMLSGYAQYGYVDEAMKIF----EMMPDKNEISWNSLLSAYVQNGRIDDARR  201

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +     ++  +  V   + L+  Y +   + D  + F +MP R+ ++WN +I  YA    
Sbjct  202  L----FESKADWEVVSWNCLMGGYVRKKRLVDARKLFDQMPIRDAVSWNTMITCYAQNSE  257

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               +  LFE      +  + +   +  +++   + G ++    IF+ M  K  +   A  
Sbjct  258  LAESRRLFE------ESPIRDVFAWTAMMSGYVQHGMLDEARRIFDEMPVKNPVSWNA--  309

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
               ++    R   ++ A E  + MP R  VS W  +L A    G     +   D + Q  
Sbjct  310  ---IIAGYVRCKRMDIARELFEVMPCR-NVSSWNTMLTAYAQSGDIAQARFIFDRMPQ--  363

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIG  826
             +DS +   +   +A +G  EEA  +  EMK  G
Sbjct  364  -RDSISWAAIIAGYAQNGYGEEALRLFMEMKKEG  396



>dbj|BAK04789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=879

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/275 (44%), Positives = 182/275 (66%), Gaps = 2/275 (1%)
 Frame = +2

Query  11   NGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIH  190
            N +++ S++    Q D GE A+K+F++   +G+EP  F++SS+L+ACA L+A+E G+ +H
Sbjct  471  NIIAFTSMITALSQCDHGEDAIKLFMEMLRKGLEPDPFVLSSLLNACASLSAYEQGKQVH  530

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
              ++K     +VF  + LV  Y KCG IED + AF  +P++ +++W+A+IGG A  GH  
Sbjct  531  AHLIKRKFMTDVFAGNALVYTYAKCGSIEDADLAFSGLPDKGVVSWSAMIGGLAQHGHGK  590

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYA  550
             ALD+F  M    + + PN++T   VL AC+ AG V+     F +MK+ +GI+   EHY+
Sbjct  591  RALDVFRRMV--DERIAPNHITLTSVLCACNHAGLVDEAKGYFSSMKEMFGIDRTEEHYS  648

Query  551  CVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQ  730
            C++D+LGRAG ++ A E +  MP     +VWGALL A RVH  PELGK+AA+ LF ++P+
Sbjct  649  CMIDLLGRAGKLDDAMELVNSMPFEANAAVWGALLAASRVHRDPELGKLAAEKLFVLEPE  708

Query  731  DSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             SG HV+L+N +AS+G W+E   VRK MKD  +KK
Sbjct  709  KSGTHVLLANTYASAGMWDEVAKVRKLMKDSKVKK  743


 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 120/230 (52%), Gaps = 15/230 (7%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW  +++ + +ND    A+++F +    G+ P EF  S V++AC G    E GR 
Sbjct  164  DRNAVSWNGMMSAFVKNDRCSDAVELFGEMVWSGVRPNEFGFSCVVNACTGSRDLEAGRK  223

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +VV+   +++VF  + LVDMY K G I      F ++P+ ++++WNA I G    GH
Sbjct  224  VHAMVVRTGYDKDVFTANALVDMYSKLGDIHMAALVFGKVPKTDVVSWNAFISGCVLHGH  283

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA--  538
               AL+L   M  K+  +VPN  T   +L AC+ AGA           +  +G    A  
Sbjct  284  DQHALELLLQM--KSSGLVPNVFTLSSILKACAGAGAGAF-----ALGRQIHGFMIKACA  336

Query  539  --EHY--ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              + Y    +VDM  + G+++ A +  + +P R  + +W AL+  C  HG
Sbjct  337  DSDDYIGVALVDMYAKYGLLDDARKVFEWIP-RKDLLLWNALISGCS-HG  384


 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 107/224 (48%), Gaps = 8/224 (4%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW SL+  Y  N L  +AL  F   R  G+   EF +  VL  CA  A   LG  +H +
Sbjct  69   VSWSSLVTAYSNNALPREALAAFRAMRARGVRCNEFALPIVLK-CAPDAG--LGVQVHAV  125

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAHQGHANM  373
             V   +  ++FV + LV MYG  G +++  R F E   +RN ++WN ++  +      + 
Sbjct  126  AVSTGLSGDIFVANALVAMYGGFGFVDEARRVFDEAARDRNAVSWNGMMSAFVKNDRCSD  185

Query  374  ALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYAC  553
            A++LF +M      V PN   F CV+ AC+ +  +E G  +  AM  + G +        
Sbjct  186  AVELFGEMV--WSGVRPNEFGFSCVVNACTGSRDLEAGRKV-HAMVVRTGYDKDVFTANA  242

Query  554  VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +VDM  + G +  A     ++P    VS W A +  C +HG  +
Sbjct  243  LVDMYSKLGDIHMAALVFGKVPKTDVVS-WNAFISGCVLHGHDQ  285


 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/310 (26%), Positives = 136/310 (44%), Gaps = 44/310 (14%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELG--RSIH  190
            VSW + ++    +   + AL++ L+ +  G+ P  F +SS+L ACAG  A      R IH
Sbjct  269  VSWNAFISGCVLHGHDQHALELLLQMKSSGLVPNVFTLSSILKACAGAGAGAFALGRQIH  328

Query  191  GLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHAN  370
            G ++KAC + + ++   LVDMY K G ++D  + F  +P ++L+ WNALI G +H G   
Sbjct  329  GFMIKACADSDDYIGVALVDMYAKYGLLDDARKVFEWIPRKDLLLWNALISGCSHGGCHG  388

Query  371  MALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI--------  526
             +L LF  M ++  D+  N  T   VL + +   A+     +  A+ +K G         
Sbjct  389  ESLSLFCRMRKEGSDI--NRTTLAAVLKSTASLEAISDTTQV-HALAEKIGFLSDSHVVN  445

Query  527  --------------------EPGAEHYACVVDMLGRAGMVERAYEFIK------RMPIRP  628
                                E  +++      M+      +   + IK      R  + P
Sbjct  446  GLIDSYWKCNCLRYANKVFEEHSSDNIIAFTSMITALSQCDHGEDAIKLFMEMLRKGLEP  505

Query  629  TVSVWGALLGACRVHGKPELGKIAADNLFQ---IDPQDSGNHVILSNMFASSGRWEEANL  799
               V  +LL AC      E GK    +L +   +    +GN ++ +  +A  G  E+A+L
Sbjct  506  DPFVLSSLLNACASLSAYEQGKQVHAHLIKRKFMTDVFAGNALVYT--YAKCGSIEDADL  563

Query  800  VRKEMKDIGI  829
                + D G+
Sbjct  564  AFSGLPDKGV  573


 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 124/272 (46%), Gaps = 13/272 (5%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            W +L++         ++L +F + R+EG +     +++VL + A L A      +H L  
Sbjct  374  WNALISGCSHGGCHGESLSLFCRMRKEGSDINRTTLAAVLKSTASLEAISDTTQVHALAE  433

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
            K     +  V + L+D Y KC C+    + F E    N+I + ++I   +   H   A+ 
Sbjct  434  KIGFLSDSHVVNGLIDSYWKCNCLRYANKVFEEHSSDNIIAFTSMITALSQCDHGEDAIK  493

Query  383  LFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPGAEHYACVV  559
            LF +M RK  +  P+      +L AC+   A E G  +    +K K+  +  A +   +V
Sbjct  494  LFMEMLRKGLE--PDPFVLSSLLNACASLSAYEQGKQVHAHLIKRKFMTDVFAGN--ALV  549

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ-IDPQDS  736
                + G +E A      +P +  VS W A++G    HG    GK A D   + +D + +
Sbjct  550  YTYAKCGSIEDADLAFSGLPDKGVVS-WSAMIGGLAQHGH---GKRALDVFRRMVDERIA  605

Query  737  GNHVILSNMFAS---SGRWEEANLVRKEMKDI  823
             NH+ L+++  +   +G  +EA      MK++
Sbjct  606  PNHITLTSVLCACNHAGLVDEAKGYFSSMKEM  637



>gb|EMT13280.1| hypothetical protein F775_05245 [Aegilops tauschii]
Length=641

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 186/279 (67%), Gaps = 4/279 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKARE--EGIEPTEFMVSSVLSACAGLAAFELG  178
            E++ VSW +++A+Y QN L  +AL+++ K      GI       S+VL ACA     + G
Sbjct  69   EKDVVSWNTMIALYAQNGLSAEALELYCKMLNVGGGIRYNAVTFSAVLLACAHAGTIQTG  128

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            + +H  VV+  +EEN +V + +VDMY KCG +E   +AF ++ E+N+++W+A+I GY   
Sbjct  129  KRVHNQVVRMGLEENTYVGTSVVDMYSKCGRVEMARKAFGKIKEKNVLSWSAMITGYGMH  188

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
            GH   AL++F +M R  Q+  PNY+TF+ VL ACS AG ++ G   ++ MK+K+G+EPG 
Sbjct  189  GHGQDALEVFNEMCRSGQN--PNYITFISVLAACSHAGLLDMGRYWYKTMKNKFGVEPGV  246

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ  718
            EHY C+VD+LGRAG ++ AY  IK M ++P  ++WGALL ACRVH   EL +I+A  LF+
Sbjct  247  EHYGCMVDLLGRAGCLDEAYGLIKEMKVKPDAAIWGALLSACRVHKNVELAEISAKRLFE  306

Query  719  IDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +D  +SG +V+LSN++A +G W++   +R  +K  GI+K
Sbjct  307  LDATNSGYYVLLSNIYAEAGMWKDVERMRVLVKTRGIEK  345


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 91/180 (51%), Gaps = 3/180 (2%)
 Frame = +2

Query  140  LSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIE-DCERAFYEMPERN  316
             S+ A +    +  S+H L+VK  ++ +  V + ++D Y K G  +    R  ++  E++
Sbjct  12   FSSSARVPVRGITASLHALIVKIGLDVDAGVVNTMLDAYAKGGGRDLPAARKVFDTMEKD  71

Query  317  LITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDI  496
            +++WN +I  YA  G +  AL+L+  M      +  N VTF  VL AC+ AG ++TG  +
Sbjct  72   VVSWNTMIALYAQNGLSAEALELYCKMLNVGGGIRYNAVTFSAVLLACAHAGTIQTGKRV  131

Query  497  FEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               +  + G+E        VVDM  + G VE A +   ++  +  +S W A++    +HG
Sbjct  132  HNQVV-RMGLEENTYVGTSVVDMYSKCGRVEMARKAFGKIKEKNVLS-WSAMITGYGMHG  189



>emb|CBI25399.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/278 (45%), Positives = 174/278 (63%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +ER+ VSW +L+  Y Q+ LGE+AL  F   REEG  P +F  SSVL +CA L   E GR
Sbjct  434  EERDIVSWTTLVTAYSQSSLGEEALATFCLMREEGFAPNQFTFSSVLISCASLCFLEYGR  493

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HGL+ KA ++    + S L+DMY KCG I +  + F ++   ++++W A+I GYA  G
Sbjct  494  QVHGLLCKAGLDTEKCIESALIDMYAKCGSITEAGKVFDKISNPDIVSWTAIISGYAQHG  553

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                AL LF  M  +   +  N VT +CVL ACS  G VE G+  F+ M+D YG+ P  E
Sbjct  554  LVEDALQLFRRM--ELSGIKANAVTLLCVLFACSHGGMVEEGLFYFQQMEDGYGVVPEME  611

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYAC++D+LGR G ++ A EFI++MP+ P   VW  LLG CRVHG  ELG+IAA  +  I
Sbjct  612  HYACIIDLLGRVGRLDDAMEFIRKMPMEPNEMVWQTLLGGCRVHGNVELGEIAARKILSI  671

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             P+ S  +V+LSN +  +G +E+   +R  MKD G+KK
Sbjct  672  RPEYSATYVLLSNTYIETGSYEDGLSLRNVMKDQGVKK  709


 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 100/218 (46%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN  SW  ++    ++ L     K F +    GI P +F  S+++ +C GL + ELG+ 
Sbjct  129  QRNVFSWTVMIVGSTEHGLFFDGFKFFCEMLNSGILPDKFAYSAIIQSCIGLDSLELGKM  188

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H  +V      ++FV + L++MY K G IED    F  M E N ++WNA+I G    G 
Sbjct  189  VHAQIVMRGFATHIFVSTSLLNMYAKLGSIEDSYWVFNMMTEHNQVSWNAMISGCTSNGL  248

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A DLF  M  K     PN  T V V  A  +   V  G ++ +    + GIE     
Sbjct  249  HLEAFDLFVRM--KNGACTPNMYTLVSVSKAVGKLVDVNMGKEV-QNCASELGIEGNVLV  305

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSV-WGALL  655
               ++DM  + G +  A        I   V+  W A++
Sbjct  306  GTALIDMYSKCGSLHDARSVFDTNFINCGVNTPWNAMI  343


 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 110/222 (50%), Gaps = 5/222 (2%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            W ++++ Y Q+   ++AL+++++  + GI    +   SV +A A   + + GR +HG+V+
Sbjct  339  WNAMISGYSQSGCSQEALELYVQMCQNGITSDLYTYCSVFNAIAASKSLQFGRVVHGMVL  398

Query  203  KACVEENVF-VRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            K  ++  V  V + + D Y KCG +ED  + F  M ER++++W  L+  Y+       AL
Sbjct  399  KCGLDLMVVSVNNAIADAYSKCGFLEDVRKVFDRMEERDIVSWTTLVTAYSQSSLGEEAL  458

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
              F  M  + +   PN  TF  VL +C+    +E G  +   +  K G++      + ++
Sbjct  459  ATFCLM--REEGFAPNQFTFSSVLISCASLCFLEYGRQV-HGLLCKAGLDTEKCIESALI  515

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            DM  + G +  A +   ++   P +  W A++     HG  E
Sbjct  516  DMYAKCGSITEAGKVFDKIS-NPDIVSWTAIISGYAQHGLVE  556


 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/239 (26%), Positives = 107/239 (45%), Gaps = 18/239 (8%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSW ++++    N L  +A  +F++ +     P  + + SV  A   L    +G+ 
Sbjct  230  EHNQVSWNAMISGCTSNGLHLEAFDLFVRMKNGACTPNMYTLVSVSKAVGKLVDVNMGKE  289

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLIT------WNALIGG  346
            +     +  +E NV V + L+DMY KCG + D    F    + N I       WNA+I G
Sbjct  290  VQNCASELGIEGNVLVGTALIDMYSKCGSLHDARSVF----DTNFINCGVNTPWNAMISG  345

Query  347  YAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGI  526
            Y+  G +  AL+L+  M +    +  +  T+  V  A + + +++ G  +   M  K G+
Sbjct  346  YSQSGCSQEALELYVQMCQ--NGITSDLYTYCSVFNAIAASKSLQFG-RVVHGMVLKCGL  402

Query  527  EPGAEHY-ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIA  700
            +         + D   + G +E   +   RM  R  VS W  L+ A   + +  LG+ A
Sbjct  403  DLMVVSVNNAIADAYSKCGFLEDVRKVFDRMEERDIVS-WTTLVTA---YSQSSLGEEA  457


 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/223 (23%), Positives = 92/223 (41%), Gaps = 13/223 (6%)
 Frame = +2

Query  35   LAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSS-------VLSACAGLAAFELGRSIHG  193
            LAV   +   +K+  V  + R E I  +E    +       VL  CA   +    +++HG
Sbjct  29   LAVSVPSQTAKKSKIVVGRNRPESIGISETYQQTQVQDLIDVLRDCAEKGSIREAKAVHG  88

Query  194  LVVKACVEEN--VFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            LV+K+  E+   + + +    +Y KC         F EMP+RN+ +W  +I G    G  
Sbjct  89   LVLKSNFEDKDLMVLFNHAAHVYSKCSEFRAACGVFDEMPQRNVFSWTVMIVGSTEHGLF  148

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
                  F +M      ++P+   +  ++ +C    ++E G  +  A     G        
Sbjct  149  FDGFKFFCEML--NSGILPDKFAYSAIIQSCIGLDSLELG-KMVHAQIVMRGFATHIFVS  205

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              +++M  + G +E +Y     M     VS W A++  C  +G
Sbjct  206  TSLLNMYAKLGSIEDSYWVFNMMTEHNQVS-WNAMISGCTSNG  247



>ref|XP_009375928.1| PREDICTED: pentatricopeptide repeat-containing protein At5g59600 
[Pyrus x bretschneideri]
Length=548

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 178/267 (67%), Gaps = 1/267 (0%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW S+++   QN   +KA + F +    G+ PT   +SS+L ACAG+   + G+ IH  
Sbjct  267  VSWTSIISGCVQNFQNDKAFRTFKQMLGHGLYPTSNTISSLLPACAGVTNVKSGKEIHAY  326

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
             +   VE++V+VRS LVDMY KCG I + +  F +M ERN +TWN++I GYA+ G+ N A
Sbjct  327  ALVIGVEQDVYVRSALVDMYAKCGFIFEAKALFRKMSERNTVTWNSMIFGYANHGYCNEA  386

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            ++LF  M +   D   +Y+TF+ VLTAC  AG +E G  +F  M+++YGI P  EHYAC+
Sbjct  387  IELFNQM-KLEDDKKLDYLTFIAVLTACCHAGMIELGESLFNLMQEEYGIVPRLEHYACM  445

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            VD+LGRAG +  AY+ IK MP+ P + VWGALLGACR HG  +L ++AA +L +++P+ +
Sbjct  446  VDLLGRAGKLTEAYDMIKAMPMEPDLFVWGALLGACRNHGNIDLAEVAAKHLSEVEPESA  505

Query  737  GNHVILSNMFASSGRWEEANLVRKEMK  817
            GN ++LS+++A SG W     ++K MK
Sbjct  506  GNSLLLSSLYAGSGNWANVARLKKMMK  532


 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/276 (30%), Positives = 139/276 (50%), Gaps = 7/276 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            + N   W +L+  Y +    ++A+ VF + + EG+ P + ++ SVL AC  L+  + G  
Sbjct  92   QTNIRRWFALIGAYARCGFYQQAMGVFCEMQREGLRPNKIVIPSVLKACGHLSDVKTGEK  151

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +V++   E +VFV S LVDMY K GC+E     F  M E++L+  NA++ G+A  G 
Sbjct  152  LHAVVLRFLFEFDVFVSSALVDMYAKNGCVEKAYWVFDMMVEKDLVALNAMVSGFAQHGL  211

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  AL L E M  + + + PN +T+  ++   S+ G       +F+ M+D  GI+P    
Sbjct  212  AREALCLVEKM--QLEGINPNLITWNSLVAGFSQKGDGAMASKLFKMMRDN-GIDPDVVS  268

Query  545  YACVVDMLGRAGMVERAYEFIKRM---PIRPTVSVWGALLGACRVHGKPELGK-IAADNL  712
            +  ++    +    ++A+   K+M    + PT +   +LL AC      + GK I A  L
Sbjct  269  WTSIISGCVQNFQNDKAFRTFKQMLGHGLYPTSNTISSLLPACAGVTNVKSGKEIHAYAL  328

Query  713  FQIDPQDSGNHVILSNMFASSGRWEEANLVRKEMKD  820
                 QD      L +M+A  G   EA  + ++M +
Sbjct  329  VIGVEQDVYVRSALVDMYAKCGFIFEAKALFRKMSE  364


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/220 (27%), Positives = 102/220 (46%), Gaps = 7/220 (3%)
 Frame = +2

Query  176  GRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAH  355
             R++H  ++   +       S L+ +Y  CG I    + F ++P+ N+  W ALIG YA 
Sbjct  48   ARALHAQLITNGLASLTRFASKLIGLYVSCGQIVHARKLFDKIPQTNIRRWFALIGAYAR  107

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPG  535
             G    A+ +F +M R  + + PN +    VL AC     V+TG +   A+  ++  E  
Sbjct  108  CGFYQQAMGVFCEMQR--EGLRPNKIVIPSVLKACGHLSDVKTG-EKLHAVVLRFLFEFD  164

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG--KPELGKIAADN  709
                + +VDM  + G VE+AY     M  +  V++  A++     HG  +  L  +    
Sbjct  165  VFVSSALVDMYAKNGCVEKAYWVFDMMVEKDLVAL-NAMVSGFAQHGLAREALCLVEKMQ  223

Query  710  LFQIDPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGI  829
            L  I+P     + +++  F+  G    A+ + K M+D GI
Sbjct  224  LEGINPNLITWNSLVAG-FSQKGDGAMASKLFKMMRDNGI  262


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 73/147 (50%), Gaps = 13/147 (9%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVS-SVLSACAGLAAFELG  178
             ERN V+W S++  Y  +    +A+++F + + E  +  +++   +VL+AC      ELG
Sbjct  363  SERNTVTWNSMIFGYANHGYCNEAIELFNQMKLEDDKKLDYLTFIAVLTACCHAGMIELG  422

Query  179  RSIHGLVVKACVEENVFVR----SVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIG  343
             S+  L+ +   E  +  R    + +VD+ G+ G + +       MP E +L  W AL+G
Sbjct  423  ESLFNLMQE---EYGIVPRLEHYACMVDLLGRAGKLTEAYDMIKAMPMEPDLFVWGALLG  479

Query  344  GYAHQGHANMALDLFEDMTRKTQDVVP  424
              A + H N  +DL E   +   +V P
Sbjct  480  --ACRNHGN--IDLAEVAAKHLSEVEP  502



>ref|XP_009794124.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Nicotiana sylvestris]
Length=883

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 181/272 (67%), Gaps = 2/272 (1%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            S+ SL+  Y     GE+A+K++LK +  G++P  F+ SS+L+ACA L+A+E G+ IH  V
Sbjct  478  SFTSLITAYALLGRGEEAMKLYLKLQGMGLKPDSFVCSSLLNACANLSAYEQGKQIHAHV  537

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            +K     +VF  + LV+MY KCG IED   AF E+P + +++W+A+IGG A  G+A  AL
Sbjct  538  LKFGFMSDVFAGNSLVNMYAKCGSIEDANCAFSEVPRKGIVSWSAMIGGLAQHGYAKKAL  597

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
             LF +M +    V PN++T V VL AC+ AG VE     FE MKD +GIEP  EHYAC++
Sbjct  598  HLFGEMLK--DGVSPNHITLVSVLYACNHAGLVEEAKKYFETMKDSFGIEPTQEHYACMI  655

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDSG  739
            D+LGRAG ++ + + + +MP     SVWGALLGA R+H   E+G+ AA+ LF + P+ SG
Sbjct  656  DVLGRAGKLDDSIDLVNKMPFEANASVWGALLGAARIHKNVEVGQRAAEMLFNLQPEKSG  715

Query  740  NHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             HV+L+N++AS G W +   VR+ MKD  +KK
Sbjct  716  THVLLANIYASVGLWGDVAKVRRLMKDSRVKK  747


 Score =   123 bits (309),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 114/224 (51%), Gaps = 6/224 (3%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW SL++ Y +N  G+ A+  F K    G++  EF   SVL AC+      LG+ 
Sbjct  69   EPDLVSWSSLISGYAKNGFGKDAIWAFFKMHSLGLKCNEFTFPSVLKACSIGKELFLGKQ  128

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG+VV    E +VFV + LV MY KC  + D    F E+PERN+++WNAL   Y     
Sbjct  129  IHGIVVVTGFESDVFVANTLVVMYAKCSELLDSRMLFEEIPERNVVSWNALFSCYTQNDF  188

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAM-KDKYGIEPGAE  541
             + A+ +F DM      V P+  +   +L AC+  G +  G  I   + K  Y  +P + 
Sbjct  189  FSEAMCMFGDMI--VSGVRPDEYSLSNILNACTGLGDIVQGKKIHGCLVKLGYDSDPFSS  246

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            +   +VDM  + G ++ A      + + P +  W A++  C +H
Sbjct  247  N--ALVDMYAKGGNLKDAITVFDEI-VVPDIVSWNAIIAGCVLH  287


 Score =   102 bits (255),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 107/220 (49%), Gaps = 4/220 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y QND   +A+ +F      G+ P E+ +S++L+AC GL     G+ 
Sbjct  170  ERNVVSWNALFSCYTQNDFFSEAMCMFGDMIVSGVRPDEYSLSNILNACTGLGDIVQGKK  229

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG +VK   + + F  + LVDMY K G ++D    F E+   ++++WNA+I G      
Sbjct  230  IHGCLVKLGYDSDPFSSNALVDMYAKGGNLKDAITVFDEIVVPDIVSWNAIIAGCVLHKC  289

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A+D+   M R    + PN  T    L AC+       G  +   +  K  I+     
Sbjct  290  HHQAIDMLNQMRR--SGIWPNMFTLSSALKACAALELPGLGQGLHSLLIKKDIIQDPFVS  347

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGAC  664
               ++DM  +  + + A      MP +  +++  A++  C
Sbjct  348  VG-LIDMYCKCDLTKDARLIYDLMPGKDLIAL-NAMISGC  385


 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 85/305 (28%), Positives = 133/305 (44%), Gaps = 36/305 (12%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++A    +    +A+ +  + R  GI P  F +SS L ACA L    LG+ +H L
Sbjct  275  VSWNAIIAGCVLHKCHHQAIDMLNQMRRSGIWPNMFTLSSALKACAALELPGLGQGLHSL  334

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K  + ++ FV   L+DMY KC   +D    +  MP ++LI  NA+I G +     N  
Sbjct  335  LIKKDIIQDPFVSVGLIDMYCKCDLTKDARLIYDLMPGKDLIALNAMISGCSQNEADNAC  394

Query  377  LDLF-EDMTR------KTQDVVPNYVTFVCVLTACSRAGAVETGM----DIF--EAMKDK  517
            LDLF +  TR       T   V N  T +     C +  A+   +    D F   ++ D 
Sbjct  395  LDLFVQTFTRGIGFDQTTLLAVLNSATGLQAPNVCKQVHALSVKLGFQCDTFVINSLVDS  454

Query  518  YGIEPGAEHYACVVD------------------MLGRAGMVERAYEFIKRMPIRPTVSVW  643
            YG     +  A + D                  +LGR     + Y  ++ M ++P   V 
Sbjct  455  YGKCSQLDDAATIFDECPTPDLPSFTSLITAYALLGRGEEAMKLYLKLQGMGLKPDSFVC  514

Query  644  GALLGACRVHGKPELGKIAADNLFQIDPQD---SGNHVILSNMFASSGRWEEANLVRKEM  814
             +LL AC      E GK    ++ +        +GN ++  NM+A  G  E+AN    E+
Sbjct  515  SSLLNACANLSAYEQGKQIHAHVLKFGFMSDVFAGNSLV--NMYAKCGSIEDANCAFSEV  572

Query  815  KDIGI  829
               GI
Sbjct  573  PRKGI  577


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 63/141 (45%), Gaps = 4/141 (3%)
 Frame = +2

Query  233  RSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQ  412
            R+ L+++Y KCG  +   +   E PE +L++W++LI GYA  G    A+  F  M   + 
Sbjct  44   RNHLINLYSKCGAFDYAWKLLDESPEPDLVSWSSLISGYAKNGFGKDAIWAFFKM--HSL  101

Query  413  DVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVER  592
             +  N  TF  VL ACS    +  G  I   +    G E        +V M  +   +  
Sbjct  102  GLKCNEFTFPSVLKACSIGKELFLGKQI-HGIVVVTGFESDVFVANTLVVMYAKCSELLD  160

Query  593  AYEFIKRMPIRPTVSVWGALL  655
            +    + +P R  VS W AL 
Sbjct  161  SRMLFEEIPERNVVS-WNALF  180



>ref|XP_008370927.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Malus domestica]
Length=669

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/277 (42%), Positives = 185/277 (67%), Gaps = 3/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ VSW S++  Y Q DL  +A+++F +  E+G+ P    + SV+ AC+ LA+F+  R 
Sbjct  260  DKDLVSWSSMIEAYAQADLPLEAVELFKEMXEQGVLPDLVALLSVVXACSSLASFQQARW  319

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGLV+++     + + + +VD+Y KCG +    R F EM ERN+I+W+ +I GY   GH
Sbjct  320  IHGLVIRSFFSNCIALETSIVDLYVKCGSLMYARRVFDEMQERNIISWSTMISGYGMHGH  379

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A++LF  M      ++P+++ F+ VL+ACS  G +  G D F +M   + + P  EH
Sbjct  380  GREAVNLFHQMKAL---IIPDHIAFLSVLSACSHGGLIAEGWDCFNSMSRDFHVTPRPEH  436

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGR+G ++ A+EFI+RMP+RP   VWG+LLGACR H   EL KIAA +LF++D
Sbjct  437  YACMVDLLGRSGRLDEAFEFIERMPVRPDAGVWGSLLGACRXHSNTELAKIAAGHLFELD  496

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             ++ G +V++SN++ASSG+ ++A+ +R  MK  G++K
Sbjct  497  AENPGRYVLMSNIYASSGKQKDADDIRDLMKQRGVRK  533


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 109/227 (48%), Gaps = 35/227 (15%)
 Frame = +2

Query  23   WCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVV  202
            W  ++  +  N L  KA+ ++ K  + G+ P  F    V+ AC     + LG+ +HG V+
Sbjct  67   WNVMIRGFVDNGLYNKAIALYSKMWDVGVRPDHFTFPFVIKACGFARNWRLGKKVHGDVI  126

Query  203  KACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALD  382
            +     +VFV + L+ +YGK G +E   + FY++P+RN+++W+++IG YA  G       
Sbjct  127  ECGYALDVFVGNSLIGLYGKFGQVETARKVFYKIPQRNVVSWSSMIGVYAQNG-------  179

Query  383  LFED-----MTRKTQDVVPNYVTFV----CVLTACSRAGAV-----ETGMDIFEAMKDKY  520
             FED     +    + + PN  + +    CV    + AG V     + G+D+  ++++  
Sbjct  180  CFEDGWXXFLMMLNEKITPNRASVLNAMACVFQE-NDAGEVCGVVTDNGLDLDRSVQN--  236

Query  521  GIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGA  661
                        + M  R G ++ A  F  R+  +  VS W +++ A
Sbjct  237  ----------AAMQMYARCGRMDIAQVFFDRISDKDLVS-WSSMIEA  272


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 120/261 (46%), Gaps = 20/261 (8%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW S++ VY QN   E     FL    E I P     +SVL+A A +        
Sbjct  162  QRNVVSWSSMIGVYAQNGCFEDGWXXFLMMLNEKITPNR---ASVLNAMACVFQENDAGE  218

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            + G+V    ++ +  V++  + MY +CG ++  +  F  + +++L++W+++I  YA    
Sbjct  219  VCGVVTDNGLDLDRSVQNAAMQMYARCGRMDIAQVFFDRISDKDLVSWSSMIEAYAQADL  278

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET-----GMDIFEAMKDKYGIE  529
               A++LF++M    Q V+P+ V  + V+ ACS   + +      G+ I     +   +E
Sbjct  279  PLEAVELFKEMXE--QGVLPDLVALLSVVXACSSLASFQQARWIHGLVIRSFFSNCIALE  336

Query  530  PGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADN  709
                    +VD+  + G +  A      M  R  +S W  ++    +HG    G+ A + 
Sbjct  337  TS------IVDLYVKCGSLMYARRVFDEMQERNIIS-WSTMISGYGMHGH---GREAVNL  386

Query  710  LFQIDPQDSGNHVILSNMFAS  772
              Q+      +H+   ++ ++
Sbjct  387  FHQMKALIIPDHIAFLSVLSA  407



>ref|XP_006421438.1| hypothetical protein CICLE_v10005013mg [Citrus clementina]
 gb|ESR34678.1| hypothetical protein CICLE_v10005013mg [Citrus clementina]
Length=429

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 175/277 (63%), Gaps = 3/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  ++  Y Q+    +AL +F +A  E ++  +F  SSVL+ C      ELG+ 
Sbjct  20   ERNVVSWTGMIYGYAQSGETGEALSLFKQALYENLDVNDFTFSSVLNVCGNTTVLELGKQ  79

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHGL VK   + + FV S L+ +Y KCG IE   + F E+  RNL  WNA++   A   H
Sbjct  80   IHGLCVKTSFDSSSFVGSSLISLYSKCGVIEPAYQVFEEVRVRNLGMWNAMLIACAQHSH  139

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             N   DLF++M R    + PN+++F+CVL ACS AG VE G   FE M +KYG++P A H
Sbjct  140  MNKVFDLFKEMER--FGLKPNFISFLCVLYACSHAGLVEKGKYYFELM-NKYGVDPAAHH  196

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            +A +VD+LGRAG ++ A   I++MPI PT SVWGALL  CR+HG  EL   AAD +F++ 
Sbjct  197  FASLVDLLGRAGKLQEAISVIEKMPIAPTESVWGALLTGCRIHGNTELAAYAADRVFELG  256

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
                G +V+LSN +A++GRWE+A   RK ++D G+KK
Sbjct  257  IVSPGMNVLLSNAYAAAGRWEDAAKARKMLRDQGVKK  293


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 72/141 (51%), Gaps = 4/141 (3%)
 Frame = +2

Query  251  MYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNY  430
            MY KCG ++   + F EMPERN+++W  +I GYA  G    AL LF+    +  DV  N 
Sbjct  1    MYAKCGQLKTARKVFDEMPERNVVSWTGMIYGYAQSGETGEALSLFKQALYENLDV--ND  58

Query  431  VTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIK  610
             TF  VL  C     +E G  I   +  K   +  +   + ++ +  + G++E AY+  +
Sbjct  59   FTFSSVLNVCGNTTVLELGKQI-HGLCVKTSFDSSSFVGSSLISLYSKCGVIEPAYQVFE  117

Query  611  RMPIRPTVSVWGALLGACRVH  673
             + +R  + +W A+L AC  H
Sbjct  118  EVRVR-NLGMWNAMLIACAQH  137



>ref|XP_004139511.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Cucumis sativus]
 gb|KGN64985.1| hypothetical protein Csa_1G171070 [Cucumis sativus]
Length=678

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 184/276 (67%), Gaps = 3/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N VSW +L+A + +   GE  +++FL+   +G EPT F  SSV +ACA   + E G+ +
Sbjct  270  KNVVSWNALIAGHARKGEGEHVMRLFLQMLRQGFEPTHFTYSSVFTACASSGSLEQGKWV  329

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  V+K+  +   ++ + L+DMY K G I+D ++ F  + ++++++WN++I GYA  G  
Sbjct  330  HAHVIKSGGQPIAYIGNTLIDMYAKSGSIKDAKKVFRRLVKQDIVSWNSIISGYAQHGLG  389

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LFE M +    V PN +TF+ VLTACS +G ++ G   FE MK K+ IE    H+
Sbjct  390  AEALQLFEQMLKA--KVQPNEITFLSVLTACSHSGLLDEGQYYFELMK-KHKIEAQVAHH  446

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              VVD+LGRAG +  A +FI+ MPI+PT +VWGALLG+CR+H   +LG  AA+ +F++DP
Sbjct  447  VTVVDLLGRAGRLNEANKFIEEMPIKPTAAVWGALLGSCRMHKNMDLGVYAAEQIFELDP  506

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             DSG HV+LSN++AS+GR  +A  VRK MK+ G+KK
Sbjct  507  HDSGPHVLLSNIYASAGRLSDAAKVRKMMKESGVKK  542


 Score =   119 bits (299),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 117/223 (52%), Gaps = 4/223 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            ++ VSW  L++ Y Q+    +AL +F K    G +P EF +SS+L A     +   GR +
Sbjct  169  KDMVSWTVLISGYSQSGQASEALALFPKMLHLGFQPNEFTLSSLLKASGTGPSDHHGRQL  228

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H   +K   + NV V S L+DMY +   + + +  F  +  +N+++WNALI G+A +G  
Sbjct  229  HAFSLKYGYDMNVHVGSSLLDMYARWAHMREAKVIFNSLAAKNVVSWNALIAGHARKGEG  288

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
               + LF  M R  Q   P + T+  V TAC+ +G++E G  +  A   K G +P A   
Sbjct  289  EHVMRLFLQMLR--QGFEPTHFTYSSVFTACASSGSLEQGKWV-HAHVIKSGGQPIAYIG  345

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              ++DM  ++G ++ A +  +R+ ++  +  W +++     HG
Sbjct  346  NTLIDMYAKSGSIKDAKKVFRRL-VKQDIVSWNSIISGYAQHG  387


 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 108/238 (45%), Gaps = 11/238 (5%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDC  283
             +EP   + S +L+ C  L   + GR+IH  +  +  E+++ + + +++MY KCG +E+ 
Sbjct  100  SLEPERTLYSKMLNKCTYLRKLKQGRAIHAHIQSSTFEDDLVLLNFILNMYAKCGSLEEA  159

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
            +  F +MP +++++W  LI GY+  G A+ AL LF  M        PN  T   +L A  
Sbjct  160  QDLFDKMPTKDMVSWTVLISGYSQSGQASEALALFPKMLH--LGFQPNEFTLSSLLKASG  217

Query  464  RAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVW  643
               +   G  +  A   KYG +      + ++DM  R   +  A      +  +  VS W
Sbjct  218  TGPSDHHGRQL-HAFSLKYGYDMNVHVGSSLLDMYARWAHMREAKVIFNSLAAKNVVS-W  275

Query  644  GALLGACRVHGKPELGKIAADNLFQIDPQD-SGNHVILSNMF---ASSGRWEEANLVR  805
             AL+     H +   G+       Q+  Q     H   S++F   ASSG  E+   V 
Sbjct  276  NALIAG---HARKGEGEHVMRLFLQMLRQGFEPTHFTYSSVFTACASSGSLEQGKWVH  330



>ref|XP_003578890.2| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 
[Brachypodium distachyon]
Length=638

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 176/277 (64%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER  V+W SL A Y QN L E+AL +F  A+ EG+E TEF +S++LSACA LA    G  
Sbjct  228  ERTLVTWSSLFAGYVQNGLHEEALHLFRCAQREGVELTEFTLSAILSACASLALKIEGIQ  287

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +++K     N FV + LVD+Y +CG IE     F  M  +N++ WNA+I  ++   H
Sbjct  288  LHAVILKCGFHGNFFVAASLVDVYARCGQIEKAYALFAYMEHKNVVIWNAMIASFSRHAH  347

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            +  A+ LFE M  +   + PN VT++ VL+ CS AG VE G   F  +     +EP   H
Sbjct  348  SWEAMILFEKM--QQLGIFPNEVTYLSVLSVCSHAGLVEKGRHYFSLLMSDRTVEPNVLH  405

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y+C+VD+LGR+G  + A+E + +MP  PT S+WG+LLG+CR +    L +IAA+ LFQ++
Sbjct  406  YSCMVDVLGRSGKTDEAWELLNKMPFEPTASMWGSLLGSCRNYNNIRLARIAAEQLFQLE  465

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P + GNHV+LSN++A+SG WE   + RK +KD G KK
Sbjct  466  PDNGGNHVLLSNVYAASGNWENVLMARKYLKDSGAKK  502


 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 117/238 (49%), Gaps = 4/238 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW +++A Y  +    +ALK+F +   EG   +EF +SS + ACA   A    + +
Sbjct  128  RSIVSWNTMIAGYTHSGEDVQALKLFSRMHREGTHMSEFTLSSTICACAAKYAINECKQL  187

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H + +K  ++ N FV + ++D+Y KC  I+D    F +MPER L+TW++L  GY   G  
Sbjct  188  HTIALKLALDSNSFVGTAILDVYAKCNMIKDACWVFEKMPERTLVTWSSLFAGYVQNGLH  247

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL LF    R+  ++     T   +L+AC+       G+ +  A+  K G        
Sbjct  248  EEALHLFRCAQREGVELTE--FTLSAILSACASLALKIEGIQL-HAVILKCGFHGNFFVA  304

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            A +VD+  R G +E+AY     M     V +W A++ +   H       I  + + Q+
Sbjct  305  ASLVDVYARCGQIEKAYALFAYME-HKNVVIWNAMIASFSRHAHSWEAMILFEKMQQL  361


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 86/178 (48%), Gaps = 6/178 (3%)
 Frame = +2

Query  128  VSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYE-M  304
            +S  L  CA   +  +G+S HGL +   +  +    ++L+++Y KCG   DC R  ++ M
Sbjct  67   ISQRLQLCAKRKSLLVGKSCHGLAIHFGLVTDTLTCNILINLYTKCG-RNDCARLVFDIM  125

Query  305  PERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVET  484
              R++++WN +I GY H G    AL LF  M R+   +  +  T    + AC+   A+  
Sbjct  126  HVRSIVSWNTMIAGYTHSGEDVQALKLFSRMHREGTHM--SEFTLSSTICACAAKYAINE  183

Query  485  GMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
               +   +  K  ++  +     ++D+  +  M++ A    ++MP R  V+ W +L  
Sbjct  184  CKQL-HTIALKLALDSNSFVGTAILDVYAKCNMIKDACWVFEKMPERTLVT-WSSLFA  239


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (47%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            + +N V W +++A + ++    +A+ +F K ++ GI P E    SVLS C+     E GR
Sbjct  328  EHKNVVIWNAMIASFSRHAHSWEAMILFEKMQQLGIFPNEVTYLSVLSVCSHAGLVEKGR  387

Query  182  SIHGLVVK-ACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAH  355
                L++    VE NV   S +VD+ G+ G  ++      +MP E     W +L+G   +
Sbjct  388  HYFSLLMSDRTVEPNVLHYSCMVDVLGRSGKTDEAWELLNKMPFEPTASMWGSLLGSCRN  447

Query  356  QGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTA  457
              +  +A    E + +   D   N+V    V  A
Sbjct  448  YNNIRLARIAAEQLFQLEPDNGGNHVLLSNVYAA  481



>ref|XP_003575265.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like 
[Brachypodium distachyon]
Length=877

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/273 (44%), Positives = 182/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            +++ S++    Q D GE A+K+F++   +G++P  F++SS+L+ACA L+A+E G+ +H  
Sbjct  471  IAFTSMITALSQCDHGEDAIKLFMEMLRKGLDPDPFVLSSLLNACASLSAYEQGKQVHAH  530

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     +VF  + LV  Y KCG IED + AF  +PE+ +++W+A+IGG A  GH   A
Sbjct  531  LIKRQFMSDVFAGNALVYTYAKCGSIEDADLAFSGLPEKGVVSWSAMIGGLAQHGHGKRA  590

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            LD+F  M    + + PN++T   VL AC+ AG V+     F +MK+ +GIE   EHYAC+
Sbjct  591  LDVFHRMV--DEHISPNHITMTSVLCACNHAGLVDEAKRYFNSMKEMFGIERTEEHYACM  648

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG ++ A E +  MP +   +VWGALL A RVH  PELG++AA+ LF ++P+ S
Sbjct  649  IDLLGRAGKLDDAMELVNSMPFQTNAAVWGALLAASRVHRDPELGRLAAEKLFILEPEKS  708

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N +AS+G W++   VRK MKD  +KK
Sbjct  709  GTHVLLANTYASAGMWDDVAKVRKLMKDSKVKK  741


 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 121/226 (54%), Gaps = 9/226 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW  L++ Y +ND    A+KVF +    G++P EF  S V++AC G    E GR 
Sbjct  164  ERNTVSWNGLMSAYVKNDRCSHAVKVFGEMVWGGVQPNEFGFSCVVNACTGSRDLEAGRK  223

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H +V++   +++VF  + LVDMY K G I      F ++PE ++++WNA I G    GH
Sbjct  224  VHAMVIRTGYDKDVFTANALVDMYSKLGDIRMAAVVFGKVPETDVVSWNAFISGCVLHGH  283

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL+L   M  K+  +VPN  T   +L AC+ +GA   G  I   M         +++
Sbjct  284  DQHALELLLQM--KSSGLVPNVFTLSSILKACAGSGAFNLGRQIHGFMVKA---NADSDN  338

Query  545  YAC--VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            Y    +VDM  + G+++ A +    +P R  V +W AL+  C  HG
Sbjct  339  YIAFGLVDMYAKHGLLDDAKKVFDWIPQRDLV-LWNALISGCS-HG  382


 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 107/203 (53%), Gaps = 3/203 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW + ++    +   + AL++ L+ +  G+ P  F +SS+L ACAG  AF LGR 
Sbjct  265  ETDVVSWNAFISGCVLHGHDQHALELLLQMKSSGLVPNVFTLSSILKACAGSGAFNLGRQ  324

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG +VKA  + + ++   LVDMY K G ++D ++ F  +P+R+L+ WNALI G +H   
Sbjct  325  IHGFMVKANADSDNYIAFGLVDMYAKHGLLDDAKKVFDWIPQRDLVLWNALISGCSHGAQ  384

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL LF  M ++  DV  N  T   VL + +   A+     +  A+ +K G    +  
Sbjct  385  HAEALSLFCRMRKEGFDV--NRTTLAAVLKSTASLEAISDTRQV-HALAEKLGFLSDSHV  441

Query  545  YACVVDMLGRAGMVERAYEFIKR  613
               ++D   +   +  AY   ++
Sbjct  442  VNGLIDSYWKCDCLNYAYRVFEK  464


 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 104/224 (46%), Gaps = 8/224 (4%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW SL+  Y  N +   AL  F   R   +   EF++  VL  CA  A F  G  +H L
Sbjct  69   VSWSSLVTAYSNNAMPRDALGAFRSMRSCSVRCNEFVLPVVLK-CAPDAGF--GTQLHAL  125

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALIGGYAHQGHANM  373
             +   +  ++FV + LV MYG  G +++    F E   ERN ++WN L+  Y      + 
Sbjct  126  AMATGLGGDIFVANALVAMYGGFGFVDEARMVFDEAGCERNTVSWNGLMSAYVKNDRCSH  185

Query  374  ALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYAC  553
            A+ +F +M      V PN   F CV+ AC+ +  +E G  +  AM  + G +        
Sbjct  186  AVKVFGEMV--WGGVQPNEFGFSCVVNACTGSRDLEAGRKV-HAMVIRTGYDKDVFTANA  242

Query  554  VVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
            +VDM  + G +  A     ++P    VS W A +  C +HG  +
Sbjct  243  LVDMYSKLGDIRMAAVVFGKVPETDVVS-WNAFISGCVLHGHDQ  285


 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 132/283 (47%), Gaps = 14/283 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ V W +L++         +AL +F + R+EG +     +++VL + A L A    R 
Sbjct  366  QRDLVLWNALISGCSHGAQHAEALSLFCRMRKEGFDVNRTTLAAVLKSTASLEAISDTRQ  425

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L  K     +  V + L+D Y KC C+    R F +    ++I + ++I   +   H
Sbjct  426  VHALAEKLGFLSDSHVVNGLIDSYWKCDCLNYAYRVFEKHGSYDIIAFTSMITALSQCDH  485

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPGAE  541
               A+ LF +M RK  D  P+      +L AC+   A E G  +    +K ++  +  A 
Sbjct  486  GEDAIKLFMEMLRKGLD--PDPFVLSSLLNACASLSAYEQGKQVHAHLIKRQFMSDVFAG  543

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQ-  718
            +   +V    + G +E A      +P +  VS W A++G    HG    GK A D   + 
Sbjct  544  N--ALVYTYAKCGSIEDADLAFSGLPEKGVVS-WSAMIGGLAQHGH---GKRALDVFHRM  597

Query  719  IDPQDSGNHVILSNMFAS---SGRWEEANLVRKEMKDI-GIKK  835
            +D   S NH+ ++++  +   +G  +EA      MK++ GI++
Sbjct  598  VDEHISPNHITMTSVLCACNHAGLVDEAKRYFNSMKEMFGIER  640



>ref|XP_008793549.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Phoenix dactylifera]
Length=745

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 186/277 (67%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +RN VSW S+++ + QN    +AL+ F+  R+EG +P     +  LSACA LAA ++G+ 
Sbjct  416  KRNTVSWNSIISGFTQNGFYTEALRYFVLMRKEGKKPDWSTFACGLSACANLAALQVGKQ  475

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L+ K+   +++F  + L+ MY +CG I    + F EM   +L++WN+LI  YA  G+
Sbjct  476  LHQLLQKSGHVDDLFAGNALIAMYARCGRISRARQIFDEMGVVDLVSWNSLIAAYALNGY  535

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+ LF++M  +T  V P+ VTFV VL+AC+ AG V+ G+D+F A+   Y I+P AEH
Sbjct  536  GREAISLFQEM--ETNGVRPDEVTFVSVLSACNHAGIVDEGLDLFNAISRAYLIKPVAEH  593

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YACVVD+LGRAG +E A++ ++ MPI+ T  +WGALLGACR+H  PEL   AA+ LF+++
Sbjct  594  YACVVDLLGRAGRLEEAFKLVQGMPIKATAGIWGALLGACRIHKNPELANFAAEKLFELE  653

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P  + N+V+LSN+ A +G W+E   VR  MK+ G++K
Sbjct  654  PHKTSNYVLLSNIHADAGSWDEVERVRVLMKERGVQK  690


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/276 (23%), Positives = 119/276 (43%), Gaps = 54/276 (20%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFE-LGR  181
            ERN VSW +++A Y Q+   E+A ++F++  E        M+S  +       A E L R
Sbjct  261  ERNVVSWNAMIAGYVQSLQIEEASRLFMEMPERNSVSWTTMISGFVRVGKLKDARELLDR  320

Query  182  SIHGLVVKACVEENVFVRS----------------------VLVDMYGKCGCIEDCERAF  295
                 V       N +VRS                       ++  Y +CG +++    F
Sbjct  321  MPFKNVAAQTAMINGYVRSNRMDDAHQLFEQISTRDVVCWNTMISAYAQCGRMDEAMLLF  380

Query  296  YEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRK------------TQDVV------  421
             +MP++++++WN +  GYA +G  + A+ +FE ++++            TQ+        
Sbjct  381  KKMPKKDVVSWNTMTAGYAQEGRMDEAVGIFEQISKRNTVSWNSIISGFTQNGFYTEALR  440

Query  422  -----------PNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDML  568
                       P++ TF C L+AC+   A++ G  + + ++    ++      A ++ M 
Sbjct  441  YFVLMRKEGKKPDWSTFACGLSACANLAALQVGKQLHQLLQKSGHVDDLFAGNA-LIAMY  499

Query  569  GRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
             R G + RA +    M +   VS W +L+ A  ++G
Sbjct  500  ARCGRISRARQIFDEMGVVDLVS-WNSLIAAYALNG  534


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 75/328 (23%), Positives = 133/328 (41%), Gaps = 70/328 (21%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            RN +SW +++A Y  ND  ++A ++F +  +  +     M+S     C      ELG++ 
Sbjct  75   RNLISWNAMIAGYSHNDCVQEAFELFERMPKRDVFSWTLMIS-----CYARNG-ELGKA-  127

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
              L  +   E++    + +V  Y K    ED  +   EMP R+L++WN+++ GY      
Sbjct  128  RCLFDRMPGEKSSVCYNAMVSGYAKNRRFEDAIKLLNEMPYRDLVSWNSVLAGYTQDEQV  187

Query  368  NMALDLFEDMTRKTQDVV---------------------------PNYVTFVCVLTACSR  466
             +AL  F+DM  +  DV                            PN V++V +L    R
Sbjct  188  GLALKFFDDMPDR--DVFSWNLMVDGFVRIGDMDTALEFFRRIPCPNVVSWVTMLNGYCR  245

Query  467  AGAVETGMDIFEAMKDKYGI--------------------------EPGAEHYACVVDML  568
            +G +     IF+ M ++  +                          E  +  +  ++   
Sbjct  246  SGRIIEARRIFDQMPERNVVSWNAMIAGYVQSLQIEEASRLFMEMPERNSVSWTTMISGF  305

Query  569  GRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLF-QIDPQDSGNH  745
             R G ++ A E + RMP +   +    + G  R +   +     A  LF QI  +D    
Sbjct  306  VRVGKLKDARELLDRMPFKNVAAQTAMINGYVRSNRMDD-----AHQLFEQISTRDVVCW  360

Query  746  VILSNMFASSGRWEEANLVRKEM--KDI  823
              + + +A  GR +EA L+ K+M  KD+
Sbjct  361  NTMISAYAQCGRMDEAMLLFKKMPKKDV  388


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 116/263 (44%), Gaps = 25/263 (10%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW S+LA Y Q++    ALK F    +  +     MV   +       A E  R I
Sbjct  169  RDLVSWNSVLAGYTQDEQVGLALKFFDDMPDRDVFSWNLMVDGFVRIGDMDTALEFFRRI  228

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
                   C   NV     +++ Y + G I +  R F +MPERN+++WNA+I GY      
Sbjct  229  ------PC--PNVVSWVTMLNGYCRSGRIIEARRIFDQMPERNVVSWNAMIAGYVQSLQI  280

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              A  LF +M  +      N V++  +++   R G ++   ++ + M  K          
Sbjct  281  EEASRLFMEMPER------NSVSWTTMISGFVRVGKLKDARELLDRMPFK-----NVAAQ  329

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              +++   R+  ++ A++  +++  R  V  W  ++ A    G+ +   +    LF+  P
Sbjct  330  TAMINGYVRSNRMDDAHQLFEQISTRDVV-CWNTMISAYAQCGRMDEAML----LFKKMP  384

Query  728  -QDSGNHVILSNMFASSGRWEEA  793
             +D  +   ++  +A  GR +EA
Sbjct  385  KKDVVSWNTMTAGYAQEGRMDEA  407


 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 70/157 (45%), Gaps = 17/157 (11%)
 Frame = +2

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            +       N    + ++  Y K G I +  R F  MP RNLI+WNA+I GY+H      A
Sbjct  37   IFDGMTSRNTVTYNSMISAYAKNGRIAEARRLFDRMPFRNLISWNAMIAGYSHNDCVQEA  96

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
             +LFE M ++      +  ++  +++  +R G +     +F+ M       PG +   C 
Sbjct  97   FELFERMPKR------DVFSWTLMISCYARNGELGKARCLFDRM-------PGEKSSVCY  143

Query  557  VDML---GRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
              M+    +    E A + +  MP R  VS W ++L 
Sbjct  144  NAMVSGYAKNRRFEDAIKLLNEMPYRDLVS-WNSVLA  179



>ref|XP_008784571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485 
[Phoenix dactylifera]
Length=903

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 179/278 (64%), Gaps = 2/278 (1%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            +E++ VSW +++A Y QN L E +LK+F +   +G EP+   ++    ACA L+A  LGR
Sbjct  492  EEKDPVSWNAMIAGYSQNGLPEDSLKLFRRLLRDGYEPSMIAMTGAFMACAELSALRLGR  551

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
              HG  +KA V E+ FV   ++DMY KCG IE     F  +  R+ ++W  +I GY   G
Sbjct  552  EAHGFALKANVSEDAFVGCSIIDMYAKCGSIEQACSFFSNLKNRDAVSWTVMITGYGING  611

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                A++LF++M R  + + P+  T+V +L ACS AG VE G+  FE MK+K G+EP  E
Sbjct  612  FGAEAINLFDEMRR--EGLKPDAFTYVGILLACSHAGMVEEGLRYFEEMKNKDGVEPKLE  669

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
            HYACV DMLGRAG +  A   ++ MP+ P   +WGALLGACR+HG   LG   A+ L ++
Sbjct  670  HYACVADMLGRAGRLAEAARLVEEMPVEPDCRIWGALLGACRIHGDVSLGGKVAEKLLEL  729

Query  722  DPQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            +P  + +HV+ SN++AS+GRW++A  VRK MK+IG++K
Sbjct  730  EPDRAEHHVLASNLYASAGRWDDARRVRKRMKEIGLRK  767


 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/230 (29%), Positives = 114/230 (50%), Gaps = 4/230 (2%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLK-AREEGIEPTEFMVSSVLSACAGLAAFELG  178
            + RN   W ++++ Y +N+L + A+ +F +      ++P  F +  VL +C GL   E+G
Sbjct  83   ERRNLFQWNAMISGYARNELWDAAIDLFYRLMSTTDLKPDNFTLPCVLKSCGGLLDVEMG  142

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            R++HG+ +K  +  + F+ + L+ +YGKCG I+D  + F  M  RNL++WN +I G +  
Sbjct  143  RTVHGIALKLGLGSDTFISNSLISVYGKCGFIDDAAQVFETMSARNLVSWNTMICGLSEN  202

Query  359  GHANMALDLFEDMTRKTQ-DVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPG  535
            G      D F  M    +  + P+  T V VL  C+  G +E G  +   +  K G+   
Sbjct  203  GSLQEGFDFFRKMISVGEGSMRPDEATVVTVLPMCAGEGWLEMGRAV-HGLSAKLGLVHE  261

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
                  ++DM  +   +  A     R   R  VS W A++G C  +G  +
Sbjct  262  LRVSNALIDMYAKCCCLFEARRLFGRTLGRNVVS-WNAMIGGCARNGDAD  310


 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 105/219 (48%), Gaps = 4/219 (2%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLV  199
            SW +L+  Y QN    KA+ +FL+    G EP  F + S+L ACA       G+SIHG V
Sbjct  397  SWNALIGGYAQNGDPRKAIDLFLQMASLGEEPDWFSIGSLLLACARSKDLLNGKSIHGFV  456

Query  200  VKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMAL  379
            ++  +E + F++  L+ +Y +CG        F  + E++ ++WNA+I GY+  G    +L
Sbjct  457  LRNGLERDSFIKISLLSLYIQCGETSASRVLFDAVEEKDPVSWNAMIAGYSQNGLPEDSL  516

Query  380  DLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVV  559
             LF  + R   +  P+ +       AC+   A+  G +       K  +   A     ++
Sbjct  517  KLFRRLLRDGYE--PSMIAMTGAFMACAELSALRLGREA-HGFALKANVSEDAFVGCSII  573

Query  560  DMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
            DM  + G +E+A  F   +  R  VS W  ++    ++G
Sbjct  574  DMYAKCGSIEQACSFFSNLKNRDAVS-WTVMITGYGING  611


 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 111/229 (48%), Gaps = 8/229 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLK---AREEGIEPTEFMVSSVLSACAGLAAFELG  178
            RN VSW +++    +N   ++    F K     E  + P E  V +VL  CAG    E+G
Sbjct  187  RNLVSWNTMICGLSENGSLQEGFDFFRKMISVGEGSMRPDEATVVTVLPMCAGEGWLEMG  246

Query  179  RSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQ  358
            R++HGL  K  +   + V + L+DMY KC C+ +  R F     RN+++WNA+IGG A  
Sbjct  247  RAVHGLSAKLGLVHELRVSNALIDMYAKCCCLFEARRLFGRTLGRNVVSWNAMIGGCARN  306

Query  359  GHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPG  535
            G A+    L  +M+ +   V+ N VT +  L AC     +    ++   A++++   +  
Sbjct  307  GDADGTFHLLREMSVE-DGVMANEVTVLNALPACLGPSELPNVKELHGYAIRNELQTDDL  365

Query  536  AEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKP  682
              +   ++    + G +E A      M ++ TV  W AL+G    +G P
Sbjct  366  VSN--ALIAAYAKCGSLESAGHVFNGMEMK-TVGSWNALIGGYAQNGDP  411


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 105/227 (46%), Gaps = 5/227 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLK-AREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            RN VSW +++    +N   +    +  + + E+G+   E  V + L AC G +     + 
Sbjct  291  RNVVSWNAMIGGCARNGDADGTFHLLREMSVEDGVMANEVTVLNALPACLGPSELPNVKE  350

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG  ++  ++ +  V + L+  Y KCG +E     F  M  + + +WNALIGGYA  G 
Sbjct  351  LHGYAIRNELQTDDLVSNALIAAYAKCGSLESAGHVFNGMEMKTVGSWNALIGGYAQNGD  410

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+DLF  M    ++  P++ +   +L AC+R+  +  G  I      + G+E  +  
Sbjct  411  PRKAIDLFLQMASLGEE--PDWFSIGSLLLACARSKDLLNGKSI-HGFVLRNGLERDSFI  467

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
               ++ +  + G    +      +  +  VS W A++     +G PE
Sbjct  468  KISLLSLYIQCGETSASRVLFDAVEEKDPVS-WNAMIAGYSQNGLPE  513


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 90/196 (46%), Gaps = 4/196 (2%)
 Frame = +2

Query  107  IEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKAC-VEENVFVRSVLVDMYGKCGCIEDC  283
            + P    + ++L AC+     ++GR +H L+  +  +  N  + + L+ MY  CG   D 
Sbjct  16   LAPHAEAIGTLLQACSSNRELDVGRRVHELISSSKELMSNAVLTTRLLTMYSMCGSPSDS  75

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
               F  +  RNL  WNA+I GYA     + A+DLF  +   T D+ P+  T  CVL +C 
Sbjct  76   RHVFEGLERRNLFQWNAMISGYARNELWDAAIDLFYRLM-STTDLKPDNFTLPCVLKSCG  134

Query  464  RAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVW  643
                VE G  +   +  K G+         ++ + G+ G ++ A +  + M  R  VS W
Sbjct  135  GLLDVEMGRTV-HGIALKLGLGSDTFISNSLISVYGKCGFIDDAAQVFETMSARNLVS-W  192

Query  644  GALLGACRVHGKPELG  691
              ++     +G  + G
Sbjct  193  NTMICGLSENGSLQEG  208



>ref|XP_008358674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Malus domestica]
Length=928

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 181/273 (66%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q + GE+ALK++L+  E   +P  F+ SS+L+ACA L+A+E G+ IH  
Sbjct  522  VAFTSMITAYSQYEQGEEALKLYLQMLERENKPDSFVCSSLLNACANLSAYEQGKQIHVH  581

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     + F  + LV+MY KCG IED +RAF E+PER +++W+A+IGG A  GH   A
Sbjct  582  ILKFGFMSDAFAGNSLVNMYAKCGSIEDADRAFAEVPERGIVSWSAMIGGLAQHGHGREA  641

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L+ F  M +    V PN++T V VL AC+ AG V      FE+M++ +G+ P  EHYAC+
Sbjct  642  LNFFTQMLK--DGVPPNHITLVSVLCACNHAGLVTEAKKYFESMRELFGVVPRQEHYACM  699

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG +  A E +  MP +   SVWGALLGA R+H   ELG+ AA+ L  ++P+ S
Sbjct  700  IDLLGRAGKINEAMELVNTMPFQANASVWGALLGAARIHKNVELGERAAEMLLVLEPEKS  759

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS+G W+    +RK MKD  +KK
Sbjct  760  GTHVLLANIYASAGMWDNVAKMRKLMKDDQVKK  792


 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 112/223 (50%), Gaps = 4/223 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN LG++AL  F +    G++  EF   SVL AC+      LG  
Sbjct  114  EPDLVSWSALISGYAQNGLGKEALSAFREMHSLGVKCNEFTFPSVLKACSITKDLGLGTQ  173

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+ +    E + FV + LV MY KCG   D  R F  +PERN+++WNAL   Y     
Sbjct  174  VHGVALLTGFESDEFVANTLVVMYAKCGEFGDSRRLFDAIPERNVVSWNALFSCYVQSDF  233

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+DLF++M      V PN  +   ++ AC+  G    G  I   M  K G E  +  
Sbjct  234  HGEAMDLFQEMV--LSGVRPNEYSLSSIINACTGFGDGSRGRKIHGYMI-KLGYESDSFS  290

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
               +VDM  +   +E A    +++  +P +  W A++  C +H
Sbjct  291  ANALVDMYAKVKSLEDAVTVFEKIE-QPDIVSWNAVIAGCVLH  332


 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 88/308 (29%), Positives = 138/308 (45%), Gaps = 42/308 (14%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            VSW +++A    ++   +ALK F + +  GI P  F +SS L ACAGL   +LGR +H  
Sbjct  320  VSWNAVIAGCVLHEYHGRALKFFRQMKGSGIRPNMFTLSSALKACAGLGFKKLGRQLHSF  379

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K   E + FV   L+DMY KC  + +    F  MP++++I WNA+I G++  G    A
Sbjct  380  LIKMDTESDSFVNVGLIDMYCKCEMMSNARVLFDMMPKKDMIAWNAVISGHSQNGEDIEA  439

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            + LF +M +  + V  N  T   VL A +   A++    +  A+  K G E        +
Sbjct  440  VSLFSEMYK--EGVEFNQTTLSTVLKATASLQAIDVCEQV-HALSVKTGFESDMYVINSL  496

Query  557  VDMLGRAGMVERAYEFIKRMPI----------------------------------RPTV  634
            +D  G+ G VE A    K  PI                                  +P  
Sbjct  497  LDTYGKCGKVEDAARIFKECPIEDVVAFTSMITAYSQYEQGEEALKLYLQMLERENKPDS  556

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQ---IDPQDSGNHVILSNMFASSGRWEEANLVR  805
             V  +LL AC      E GK    ++ +   +    +GN ++  NM+A  G  E+A+   
Sbjct  557  FVCSSLLNACANLSAYEQGKQIHVHILKFGFMSDAFAGNSLV--NMYAKCGSIEDADRAF  614

Query  806  KEMKDIGI  829
             E+ + GI
Sbjct  615  AEVPERGI  622


 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 110/225 (49%), Gaps = 4/225 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ERN VSW +L + Y Q+D   +A+ +F +    G+ P E+ +SS+++AC G      GR 
Sbjct  215  ERNVVSWNALFSCYVQSDFHGEAMDLFQEMVLSGVRPNEYSLSSIINACTGFGDGSRGRK  274

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG ++K   E + F  + LVDMY K   +ED    F ++ + ++++WNA+I G     +
Sbjct  275  IHGYMIKLGYESDSFSANALVDMYAKVKSLEDAVTVFEKIEQPDIVSWNAVIAGCVLHEY  334

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL  F  M  K   + PN  T    L AC+  G  + G  +  +   K   E  +  
Sbjct  335  HGRALKFFRQM--KGSGIRPNMFTLSSALKACAGLGFKKLGRQL-HSFLIKMDTESDSFV  391

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
               ++DM  +  M+  A      MP +  ++ W A++     +G+
Sbjct  392  NVGLIDMYCKCEMMSNARVLFDMMPKKDMIA-WNAVISGHSQNGE  435


 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 118/226 (52%), Gaps = 8/226 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ ++W ++++ + QN    +A+ +F +  +EG+E  +  +S+VL A A L A ++   
Sbjct  417  KKDMIAWNAVISGHSQNGEDIEAVSLFSEMYKEGVEFNQTTLSTVLKATASLQAIDVCEQ  476

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VK   E +++V + L+D YGKCG +ED  R F E P  +++ + ++I  Y+    
Sbjct  477  VHALSVKTGFESDMYVINSLLDTYGKCGKVEDAARIFKECPIEDVVAFTSMITAYSQYEQ  536

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL L+  M  +     P+  +FVC  +L AC+   A E G  I   +  K+G    A
Sbjct  537  GEEALKLYLQMLERENK--PD--SFVCSSLLNACANLSAYEQGKQIHVHIL-KFGFMSDA  591

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
                 +V+M  + G +E A      +P R  VS W A++G    HG
Sbjct  592  FAGNSLVNMYAKCGSIEDADRAFAEVPERGIVS-WSAMIGGLAQHG  636


 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 85/196 (43%), Gaps = 5/196 (3%)
 Frame = +2

Query  89   KAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCG  268
            K       PT  + S +LS C    +  +GR IH  +++    E+  +R+ L+++Y KC 
Sbjct  41   KTLNPNFTPTSVLYSKLLSQCTASKSVGVGREIHAHMIRFGCSEDPNLRNHLINLYAKCR  100

Query  269  CIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCV  448
                  +   E PE +L++W+ALI GYA  G    AL  F +M   +  V  N  TF  V
Sbjct  101  FFRHARKLVDESPEPDLVSWSALISGYAQNGLGKEALSAFREM--HSLGVKCNEFTFPSV  158

Query  449  LTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRP  628
            L ACS    +  G  +   +    G E        +V M  + G    +      +P R 
Sbjct  159  LKACSITKDLGLGTQV-HGVALLTGFESDEFVANTLVVMYAKCGEFGDSRRLFDAIPERN  217

Query  629  TVSVWGALLGACRVHG  676
             VS W AL  +C V  
Sbjct  218  VVS-WNALF-SCYVQS  231


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 66/133 (50%), Gaps = 16/133 (12%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSAC--AGLAA----  166
            ER  VSW +++    Q+  G +AL  F +  ++G+ P    + SVL AC  AGL      
Sbjct  619  ERGIVSWSAMIGGLAQHGHGREALNFFTQMLKDGVPPNHITLVSVLCACNHAGLVTEAKK  678

Query  167  -FELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMP-ERNLITWNALI  340
             FE  R + G+V +   +E+    + ++D+ G+ G I +       MP + N   W AL+
Sbjct  679  YFESMRELFGVVPR---QEHY---ACMIDLLGRAGKINEAMELVNTMPFQANASVWGALL  732

Query  341  GGYAHQGHANMAL  379
            G  A + H N+ L
Sbjct  733  G--AARIHKNVEL  743



>gb|KDP45013.1| hypothetical protein JCGZ_01513 [Jatropha curcas]
Length=634

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 183/277 (66%), Gaps = 3/277 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKARE-EGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ++ +SW +L+  Y QN L  +A++V+    E + I P +    S+L A + L A + G  
Sbjct  224  KDVISWNTLITGYAQNGLASEAVEVYHMMEECKEIIPNQGTWVSILPAYSHLGALQQGMK  283

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG V+K  +  +VFV + LVDMYGKCG ++D    FYE+P ++ I WN +I  +   GH
Sbjct  284  IHGRVIKNSLYLDVFVGTCLVDMYGKCGKLDDAMSLFYEVPRKDSIPWNTIISCHGVHGH  343

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL+LF +M    + V P++VTFV +L+ACS +G V  G   F  M++ YGI+P  +H
Sbjct  344  GEKALELFREMI--AEGVTPDHVTFVSLLSACSHSGLVSDGQQCFHMMQEIYGIKPDVKH  401

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            Y C+VD+ GRAG +++AYEFIK MPI+P  S+WGAL+ ACR+HG  ELG+ A+D LF++D
Sbjct  402  YGCMVDLYGRAGYLDKAYEFIKNMPIQPDASMWGALISACRIHGNMELGQYASDQLFEVD  461

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
             ++ G +V+LSN++A+ G+WE AN VR   +  G++K
Sbjct  462  SENVGYYVLLSNIYATVGKWEGANKVRSLARGRGLRK  498


 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 121/229 (53%), Gaps = 8/229 (3%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+ VSW S++A YEQN     A   F K ++    P    + S+ S  A L      RSI
Sbjct  122  RDTVSWNSIIAAYEQNHDVVTARLFFDKMQKAAARPDILTLVSLASIVAQLNDHRNSRSI  181

Query  188  HGLVVKA--CVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
            HG + +A    E+NV + + ++DMY K G  +   + F  +P +++I+WN LI GYA  G
Sbjct  182  HGFITRAGWLFEDNV-IGNAVIDMYAKLGVTDSARKVFERLPIKDVISWNTLITGYAQNG  240

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPGA  538
             A+ A++++  M  + ++++PN  T+V +L A S  GA++ GM I    +K+   ++   
Sbjct  241  LASEAVEVYH-MMEECKEIIPNQGTWVSILPAYSHLGALQQGMKIHGRVIKNSLYLDVFV  299

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
                C+VDM G+ G ++ A      +P + ++  W  ++    VHG  E
Sbjct  300  G--TCLVDMYGKCGKLDDAMSLFYEVPRKDSIP-WNTIISCHGVHGHGE  345


 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 108/216 (50%), Gaps = 3/216 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R+  SW ++++ Y QN    +AL V  + R EG+      V+S+L  CA L+    G+ I
Sbjct  21   RDSGSWNAMISGYCQNGNPAEALDVAGEMRLEGVAVDPVTVASILPVCAQLSDILSGKLI  80

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H LV+K  +E  +FV + L++MY K GC+   ++ F +M  R+ ++WN++I  Y  Q H 
Sbjct  81   HLLVIKCGLECELFVSNALINMYAKFGCLGQAQKLFDQMVTRDTVSWNSIIAAY-EQNHD  139

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
             +   LF D  +K     P+ +T V + +  ++         I   +     +       
Sbjct  140  VVTARLFFDKMQKAA-ARPDILTLVSLASIVAQLNDHRNSRSIHGFITRAGWLFEDNVIG  198

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALL  655
              V+DM  + G+ + A +  +R+PI+  +S W  L+
Sbjct  199  NAVIDMYAKLGVTDSARKVFERLPIKDVIS-WNTLI  233


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 68/137 (50%), Gaps = 4/137 (3%)
 Frame = +2

Query  251  MYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNY  430
            MY + G +      F EMP R+  +WNA+I GY   G+   ALD+  +M  + + V  + 
Sbjct  1    MYSRFGLVGAARELFDEMPIRDSGSWNAMISGYCQNGNPAEALDVAGEM--RLEGVAVDP  58

Query  431  VTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIK  610
            VT   +L  C++   + +G  +   +  K G+E        +++M  + G + +A +   
Sbjct  59   VTVASILPVCAQLSDILSG-KLIHLLVIKCGLECELFVSNALINMYAKFGCLGQAQKLFD  117

Query  611  RMPIRPTVSVWGALLGA  661
            +M  R TVS W +++ A
Sbjct  118  QMVTRDTVS-WNSIIAA  133



>ref|XP_010550535.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 isoform X2 [Tarenaya hassleriana]
Length=571

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/277 (42%), Positives = 179/277 (65%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R+ V W  +++VY  ND+  +A++++ +  + GIEP    V++VL AC   ++  +G+ 
Sbjct  161  KRSLVPWNVMISVYMNNDMPAEAVELYSQIEDHGIEPDAVSVATVLPACGDTSSLLIGKK  220

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH  V +  +  N+ + + L+DMY KCGC+E     F +M  R++++W A+I  Y  +G 
Sbjct  221  IHEYVKRKNLTPNLLIENALIDMYAKCGCLEGARGVFAKMKSRDVVSWTAMISAYGIRGR  280

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL+ F  M  +   +VP+ + FV +L+ACS AG +E G   F+ M D Y I P  EH
Sbjct  281  GHEALEFFSKM--QESGLVPDSIAFVSILSACSHAGLLEEGRYHFKLMTDHYKIAPRIEH  338

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            +AC+VD+LGRAG ++ AY F++ MP+ P   VWGALLGACRVH   ++G IAAD LFQ+ 
Sbjct  339  FACMVDILGRAGKMKEAYSFVQEMPMEPNERVWGALLGACRVHSDMDIGLIAADKLFQLA  398

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+ SG +V+LSN++A +GRWE+   +R  MK  G+KK
Sbjct  399  PEQSGYYVVLSNIYAKAGRWEDVTKIRSLMKRKGLKK  435


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/243 (25%), Positives = 106/243 (44%), Gaps = 37/243 (15%)
 Frame = +2

Query  32   LLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKAC  211
            ++  Y  N    + + VF    E  + P  +    VL AC+      +G+ IHG   KA 
Sbjct  1    MIRSYVNNGFYREGISVFGTMFEFDVRPDHYTFPCVLKACSCSENVVVGKKIHGSATKAG  60

Query  212  VEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFE  391
            +   ++V + LV MYGKCG + +      EMP R++++WN+L+ GYA     + AL++  
Sbjct  61   LCSTLYVGNGLVAMYGKCGFLSESRLVLDEMPRRDVVSWNSLVAGYARNRRFDDALEVCR  120

Query  392  DMTRKTQDVVPNYVTFVCVLTACSRAGA--VETGMDIFEAMKDK----------------  517
            +M  +T ++  +  T   +L A +      V    D+F+ M  +                
Sbjct  121  EM--ETMNITHDAGTMASLLPAVTNTAQENVLYVKDMFQRMGKRSLVPWNVMISVYMNND  178

Query  518  --------------YGIEPGAEHYACVVDMLGRAGMV---ERAYEFIKRMPIRPTVSVWG  646
                          +GIEP A   A V+   G    +   ++ +E++KR  + P + +  
Sbjct  179  MPAEAVELYSQIEDHGIEPDAVSVATVLPACGDTSSLLIGKKIHEYVKRKNLTPNLLIEN  238

Query  647  ALL  655
            AL+
Sbjct  239  ALI  241



>gb|EYU32070.1| hypothetical protein MIMGU_mgv1a017635mg, partial [Erythranthe 
guttata]
Length=728

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 181/277 (65%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ +SW SL+  Y  N   E+ALK+F + R  G  P + + SSVLS+CA LA  +LG+ 
Sbjct  318  EKDLISWTSLITGYAHNGSHEEALKLFCEMRVNGTHPDQVVASSVLSSCAELACLDLGQQ  377

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG+ +K+  + ++ V + L+ +Y  CG +E  +R F  M  RN+I+W ALI GYA  G 
Sbjct  378  IHGIAIKSGHDSSLSVDNSLLSLYAHCGYLEYADRVFNFMKVRNVISWTALIIGYAQNGK  437

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               +L L++ M      V P+YVTF+ +L ACS AG  E G   FE+M   YGI PG +H
Sbjct  438  GVNSLQLYDQMI--ASGVKPDYVTFIGLLFACSHAGLTEQGQSFFESMSTNYGITPGPDH  495

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+VD+LGR+G  + A + + +MP+ P  +VW +LL ACR+HG  EL K A+  L ++D
Sbjct  496  YACMVDLLGRSGKFQEAEDLLGKMPVVPDATVWKSLLAACRLHGNVELAKRASTALIELD  555

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            PQDS ++V+LSN +++ G+W+EA  VR++MK  G++K
Sbjct  556  PQDSVSYVMLSNTYSAVGKWKEAAHVRRKMKSKGVRK  592


 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 111/232 (48%), Gaps = 12/232 (5%)
 Frame = +2

Query  2    DERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGR  181
            D +N V+W +++  Y  N    +A++ F   RE G E  ++    VLSAC  L+    G 
Sbjct  115  DGKNHVTWTAMINGYSLNGDFVRAIQCFKGMRENGSEANQYTFPGVLSACTALSNLGFGA  174

Query  182  SIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQG  361
             +HG +V      NVFV+S LVDMY KCG +    R    M   ++I+WNA+I G   QG
Sbjct  175  QVHGCIVNGGFSANVFVQSSLVDMYTKCGDLSSAWRVIESMEVNDVISWNAMIVGCVRQG  234

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
             ++ AL LF +M  K  D+  +  T+  VL A +     + G  +   +     I+ G  
Sbjct  235  FSDKALSLFREMHSK--DMKLDEFTYPSVLNALASKNDAKNGYSLHSLV-----IKSGFG  287

Query  542  HYACV----VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPE  685
             Y  V    +DM  +   ++ AY+    +  +  +S W +L+     +G  E
Sbjct  288  SYTLVSNALIDMYAKQNNLDSAYKLFDFLVEKDLIS-WTSLITGYAHNGSHE  338


 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/225 (28%), Positives = 110/225 (49%), Gaps = 5/225 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +R  ++W SL++ Y +     ++ ++F + + EG  P++F + SVL  C+          
Sbjct  14   KRTAITWSSLVSGYCKIGCEVESFQLFYEMQYEGYRPSQFTLGSVLRLCSIKGLLSRAEQ  73

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPE-RNLITWNALIGGYAHQG  361
            IHG  VK   + +VFV + L+D+Y KC  I + E  F ++ + +N +TW A+I GY+  G
Sbjct  74   IHGFAVKTHFDTDVFVVTGLIDVYAKCSRIIEAESLFDKISDGKNHVTWTAMINGYSLNG  133

Query  362  HANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAE  541
                A+  F+ M     +   N  TF  VL+AC+    +  G  +   + +  G      
Sbjct  134  DFVRAIQCFKGMRENGSEA--NQYTFPGVLSACTALSNLGFGAQVHGCIVNG-GFSANVF  190

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
              + +VDM  + G +  A+  I+ M +   +S W A++  C   G
Sbjct  191  VQSSLVDMYTKCGDLSSAWRVIESMEVNDVIS-WNAMIVGCVRQG  234


 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 106/221 (48%), Gaps = 4/221 (2%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            +SW +++    +    +KAL +F +   + ++  EF   SVL+A A     + G S+H L
Sbjct  221  ISWNAMIVGCVRQGFSDKALSLFREMHSKDMKLDEFTYPSVLNALASKNDAKNGYSLHSL  280

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            V+K+       V + L+DMY K   ++   + F  + E++LI+W +LI GYAH G    A
Sbjct  281  VIKSGFGSYTLVSNALIDMYAKQNNLDSAYKLFDFLVEKDLISWTSLITGYAHNGSHEEA  340

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L LF +M  +     P+ V    VL++C+    ++ G  I   +  K G +        +
Sbjct  341  LKLFCEM--RVNGTHPDQVVASSVLSSCAELACLDLGQQI-HGIAIKSGHDSSLSVDNSL  397

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
            + +    G +E A      M +R  +S W AL+     +GK
Sbjct  398  LSLYAHCGYLEYADRVFNFMKVRNVIS-WTALIIGYAQNGK  437



>ref|XP_007212726.1| hypothetical protein PRUPE_ppa018986mg, partial [Prunus persica]
 gb|EMJ13925.1| hypothetical protein PRUPE_ppa018986mg, partial [Prunus persica]
Length=397

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 171/277 (62%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E++ VSW +++A Y Q  L +  L ++ K R  G+ P ++  +SV  ACA LA  E G+ 
Sbjct  68   EKSLVSWNAIIAGYVQKGLEDVGLSLYYKMRHSGLIPDQYTFASVFRACASLATLEHGKQ  127

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG+++K  + ENV V S L+DMY KC  + D +R F     RN ITW ALI GY   G 
Sbjct  128  AHGIMIKCQIGENVVVNSALMDMYFKCSDLCDGQRVFNTCQNRNAITWTALISGYGQHGR  187

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
                LD+F  M  K++   PNYVTF+ VL+ACS  G V+   + F +M   YGI P A+H
Sbjct  188  VVEVLDIFHRM--KSEGFRPNYVTFISVLSACSHGGLVDEAWEYFSSMTRDYGIHPRAQH  245

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YA +VD+LGRAG +E AYEF+   P +    +WGA L ACR+HG  +L K+AA   F+++
Sbjct  246  YAALVDLLGRAGQLEEAYEFVSNSPCKEHSVMWGAFLWACRIHGDRDLLKLAAKKYFELE  305

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P+++G +V+LSN +A+ G W+    +R  M D G++K
Sbjct  306  PENAGKYVVLSNAYATFGLWDNVAKLRSMMTDSGMRK  342


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 65/127 (51%), Gaps = 4/127 (3%)
 Frame = +2

Query  107  IEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCE  286
            ++P  + +  +L  C     ++ G+ IH  ++      N ++++ L+ +Y K G +    
Sbjct  3    VDPDTYAL--LLQECIFRKEYKKGKIIHAQIIVVGFVLNEYLKTKLLILYAKSGNLGTAH  60

Query  287  RAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSR  466
                ++ E++L++WNA+I GY  +G  ++ L L+  M  +   ++P+  TF  V  AC+ 
Sbjct  61   ILLDKLLEKSLVSWNAIIAGYVQKGLEDVGLSLYYKM--RHSGLIPDQYTFASVFRACAS  118

Query  467  AGAVETG  487
               +E G
Sbjct  119  LATLEHG  125



>ref|XP_006449392.1| hypothetical protein CICLE_v10018358mg [Citrus clementina]
 gb|ESR62632.1| hypothetical protein CICLE_v10018358mg [Citrus clementina]
Length=942

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 182/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q  LGE+ALK++L+ ++  I P  F+ SS+L+ACA L+A+E G+ +H  
Sbjct  536  VAFTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVH  595

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     + F  + LV+MY KCG I+D +RAF E+P+R +++W+A+IGG A  G    A
Sbjct  596  IIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEA  655

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L +F  M      V+PN++T V VL AC+ AG V      FE+M+ K+GI+P  EHYAC+
Sbjct  656  LQMFGQMLE--DGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACM  713

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG  + A E +  MP +   SVWGALLGA R++   E+G+ AA+ LF I+PQ S
Sbjct  714  IDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPQKS  773

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
              HV+LSN++AS+G W+    VR+ MKD  +KK
Sbjct  774  STHVLLSNIYASAGMWDNVAKVRRFMKDNKLKK  806


 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 108/223 (48%), Gaps = 4/223 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN LGE+A   F K    G++  EF   SVL AC       LG  
Sbjct  128  EPDLVSWSALISGYAQNGLGEEAALAFQKMHLLGLKCNEFTFPSVLKACTSKKDLFLGLQ  187

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+VV    E + FV + LV MY KCG   D  R F  +PER++++WN+L   Y H   
Sbjct  188  VHGIVVVTGFESDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDF  247

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               A+  F++M      + PN  +   ++ AC+ +G    G  I      K G +     
Sbjct  248  LEEAVCFFKEMV--LSGIRPNEFSLSSMINACAGSGDSLLGRKI-HGYSIKLGYDWDMFS  304

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
               +VDM  + G +E A    K +   P +  W A++  C +H
Sbjct  305  VNALVDMYAKVGNLEDAVAVFKDIE-HPDIVSWNAVIAGCVLH  346


 Score =   115 bits (288),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 112/218 (51%), Gaps = 4/218 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ VSW SL + Y   D  E+A+  F +    GI P EF +SS+++ACAG     LGR 
Sbjct  229  ERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRK  288

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG  +K   + ++F  + LVDMY K G +ED    F ++   ++++WNA+I G     H
Sbjct  289  IHGYSIKLGYDWDMFSVNALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEH  348

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL LF+ M  K+ ++ PN  T+   L AC+     E G  +  ++  K  I+     
Sbjct  349  NDWALKLFQQM--KSSEINPNMFTYTSALKACAGMELKELGRQLHCSLI-KMDIKSDPIV  405

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLG  658
               +VDM  + G  + A      MP +  ++ W  ++ 
Sbjct  406  GVGLVDMYAKCGSTDEARMIFHLMPEKNLIA-WNTVIS  442


 Score =   108 bits (271),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 88/308 (29%), Positives = 142/308 (46%), Gaps = 42/308 (14%)
 Frame = +2

Query  17   VSWCSLLA---VYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            VSW +++A   ++E ND    ALK+F + +   I P  F  +S L ACAG+   ELGR +
Sbjct  334  VSWNAVIAGCVLHEHNDW---ALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQL  390

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H  ++K  ++ +  V   LVDMY KCG  ++    F+ MPE+NLI WN +I G+   G  
Sbjct  391  HCSLIKMDIKSDPIVGVGLVDMYAKCGSTDEARMIFHLMPEKNLIAWNTVISGHLQNGED  450

Query  368  NMALDLFEDMTRK--------TQDVVPNYVTFVCV-----LTACSRAGAVETGMDIFEAM  508
              A  LF  M R+           V+ +  +F  +     + A S   A E+   I  ++
Sbjct  451  MEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSL  510

Query  509  KDKYG----IEPGAEHY--ACVVDMLGRAGMVERAYEF------------IKRMPIRPTV  634
             D YG    +E   + +  +  VD++    M+    +F            ++   I P  
Sbjct  511  IDAYGKCGHVEDAVKIFKESSAVDLVAFTSMITAYAQFGLGEEALKLYLEMQDREINPDS  570

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQ---IDPQDSGNHVILSNMFASSGRWEEANLVR  805
             V  +LL AC      E GK    ++ +   +    +GN ++  NM+A  G  ++A+   
Sbjct  571  FVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLV--NMYAKCGSIDDADRAF  628

Query  806  KEMKDIGI  829
             E+ D GI
Sbjct  629  SEIPDRGI  636


 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 113/227 (50%), Gaps = 8/227 (4%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E+N ++W ++++ + QN    +A  +F     EG+   +  +S+VL + A   A  + + 
Sbjct  431  EKNLIAWNTVISGHLQNGEDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQ  490

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VK   E + ++ + L+D YGKCG +ED  + F E    +L+ + ++I  YA  G 
Sbjct  491  VHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVAFTSMITAYAQFGL  550

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVC--VLTACSRAGAVETGMDIFEAMKDKYGIEPGA  538
               AL L+ +M    QD   N  +FVC  +L AC+   A E G  +   +  K+G     
Sbjct  551  GEEALKLYLEM----QDREINPDSFVCSSLLNACANLSAYEQGKQVHVHII-KFGFMSDT  605

Query  539  EHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
                 +V+M  + G ++ A      +P R  VS W A++G    HG+
Sbjct  606  FAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVS-WSAMIGGLAQHGR  651


 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 81/187 (43%), Gaps = 5/187 (3%)
 Frame = +2

Query  113  PTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERA  292
            PT    S +LS C    +  LG+ IH  +++  + ++   ++ L++ Y K        + 
Sbjct  63   PTSIRYSKLLSQCTISKSVNLGKEIHAHLIRFGLLKDPKNKNNLINFYAKLQFFLYARKL  122

Query  293  FYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAG  472
              E PE +L++W+ALI GYA  G    A   F+ M      +  N  TF  VL AC+   
Sbjct  123  VDESPEPDLVSWSALISGYAQNGLGEEAALAFQKM--HLLGLKCNEFTFPSVLKACTSKK  180

Query  473  AVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGAL  652
             +  G+ +   +    G E        +V M  + G    +      +P R  VS W +L
Sbjct  181  DLFLGLQV-HGIVVVTGFESDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVS-WNSL  238

Query  653  LGACRVH  673
              +C VH
Sbjct  239  F-SCYVH  244



>ref|XP_010931126.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Elaeis guineensis]
Length=624

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 178/276 (64%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R  VSW  +++ Y QN    KAL++F+  +  G++PT   V+S+L ACA +   +LG  +
Sbjct  217  RTAVSWTVMISTYAQNGKFAKALELFICMQAYGVKPTAVTVASMLPACADMMHIKLGMKV  276

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HG  +K   + ++ + + LVDMY KCGCI +  R F EMPERN+++WNA+I  +   G  
Sbjct  277  HGYSIKNGFDLDIIMSTALVDMYAKCGCIAEARRVFDEMPERNIVSWNAMINAFGLHGQV  336

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL+ F  M  +   + PN  TFV +++ACS AG V  G++ F++M   Y + P  +HY
Sbjct  337  MDALEWFAMM--QLNGMKPNGSTFVSLISACSHAGMVAEGLECFKSMSKDYDLVPETKHY  394

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
            ACVVD+LGRAG ++ AYE IK MP+ P  S WGALLGACRVH   ELGK+AA    ++ P
Sbjct  395  ACVVDLLGRAGRLKEAYELIKAMPLEPDDSAWGALLGACRVHKDVELGKMAALKALELKP  454

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            ++ G +V+L+N++A SGRW +A  +R+ MK+  I K
Sbjct  455  REPGYYVLLTNIYAGSGRWADAQKLREVMKEKKILK  490


 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 108/224 (48%), Gaps = 4/224 (2%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            +N V W +L+A Y  N+   +A+  F    E G EP    ++SVL A   L   E G+ +
Sbjct  116  KNTVCWNALIAGYAYNESDVEAVDAFKWMIELGFEPNSSTMASVLPAVGRLGDLEEGKLM  175

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            H L+++  VE    V + L+ MYGKCG +E   + F EM  R  ++W  +I  YA  G  
Sbjct  176  HKLIIEKGVEIKEPVINSLIAMYGKCGEMETARQLFDEMLGRTAVSWTVMISTYAQNGKF  235

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              AL+LF  +  +   V P  VT   +L AC+    ++ GM +      K G +      
Sbjct  236  AKALELF--ICMQAYGVKPTAVTVASMLPACADMMHIKLGMKV-HGYSIKNGFDLDIIMS  292

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
              +VDM  + G +  A      MP R  VS W A++ A  +HG+
Sbjct  293  TALVDMYAKCGCIAEARRVFDEMPERNIVS-WNAMINAFGLHGQ  335


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/221 (29%), Positives = 107/221 (48%), Gaps = 5/221 (2%)
 Frame = +2

Query  20   SWCSLLAVYEQNDLGEKALKVFLKA-REEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            ++ +++  Y  +   EKAL ++ K    +   P +F    +L +CA L+A    R  HG 
Sbjct  18   AYNAMIRGYSTHGFFEKALFLYSKMLYSDSTPPDKFTFPFILKSCAALSAPSEAREAHGR  77

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K  +  +V + + LVD Y K G +    + F ++P +N + WNALI GYA+      A
Sbjct  78   IIKTGLASDVHISTSLVDFYMKLGEVGIARQVFDKIPLKNTVCWNALIAGYAYNESDVEA  137

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            +D F+ M     +  PN  T   VL A  R G +E G  + + + +K G+E        +
Sbjct  138  VDAFKWMIELGFE--PNSSTMASVLPAVGRLGDLEEGKLMHKLIIEK-GVEIKEPVINSL  194

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGK  679
            + M G+ G +E A +    M  R  VS W  ++     +GK
Sbjct  195  IAMYGKCGEMETARQLFDEMLGRTAVS-WTVMISTYAQNGK  234



>emb|CAN63659.1| hypothetical protein VITISV_008415 [Vitis vinifera]
Length=760

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 178/277 (64%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSW S++A   QN    +AL++F + +  G++P    +  +L AC  +AA   G++
Sbjct  348  ELNVVSWTSMIACCSQNGRDMEALELFREMQIAGVKPNSVTIPCLLPACGNIAALMHGKA  407

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H   ++  +  +V+V S L+DMY KCG I+     F  +P +NL+ WNA+I GYA  G 
Sbjct  408  AHCFSLRRGISTDVYVGSALIDMYAKCGRIQASRICFDGIPTKNLVCWNAVIAGYAMHGK  467

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            A  A+++F+ M R  Q   P+ ++F CVL+ACS++G  E G   F +M  KYGIE   EH
Sbjct  468  AKEAMEIFDLMQRSGQK--PDIISFTCVLSACSQSGLTEEGSYYFNSMSSKYGIEARVEH  525

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+V +L RAG +E+AY  I+RMP+ P   VWGALL +CRVH    LG++AA+ LF+++
Sbjct  526  YACMVTLLSRAGKLEQAYAMIRRMPVNPDACVWGALLSSCRVHNNVSLGEVAAEKLFELE  585

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P + GN+++LSN++AS G W E N VR  MK+ G++K
Sbjct  586  PSNPGNYILLSNIYASKGMWNEVNRVRDMMKNKGLRK  622


 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 95/189 (50%), Gaps = 3/189 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N  S+ +L+  + +      AL  F +    G+ P   ++ S + ACAGL+A +  R 
Sbjct  76   EPNVFSFSTLIYAFSKFHQFHHALSTFSQMLTRGLMPDNRVLPSAVKACAGLSALKPARQ  135

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +HG+   +  + + FV+S LV MY KC  I D  R F  M E ++++W+AL+  YA QG 
Sbjct  136  VHGIASVSGFDSDSFVQSSLVHMYIKCNQIRDAHRVFDRMFEPDVVSWSALVAAYARQGC  195

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + A  LF +M      V PN +++  ++   + +G     + +F  M  + G EP    
Sbjct  196  VDEAKRLFSEM--GDSGVQPNLISWNGMIAGFNHSGLYSEAVLMFLDMHLR-GFEPDGTT  252

Query  545  YACVVDMLG  571
             + V+  +G
Sbjct  253  ISSVLPAVG  261



>ref|XP_007025555.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY28177.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=946

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 182/273 (67%), Gaps = 2/273 (1%)
 Frame = +2

Query  17   VSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSIHGL  196
            V++ S++  Y Q+  GE+ALK++L+  + GIEP  F+ SS+L+ACA L+A+E G+ +H  
Sbjct  540  VAFTSMITAYAQSGQGEEALKLYLEMLDRGIEPDPFVGSSLLNACANLSAYEQGKQVHVH  599

Query  197  VVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMA  376
            ++K     ++F  + LV+MY KCG I+D +R F ++PER +++W+++IGG A  GH   A
Sbjct  600  ILKFGFMSDIFAGNSLVNMYAKCGSIDDADRVFSKIPERGIVSWSSMIGGLAQHGHGKEA  659

Query  377  LDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACV  556
            L +F  M +    V PN +T V VL AC+ AG +      F +M++ +G EP  EHYAC+
Sbjct  660  LRVFNQMLK--YGVSPNQITLVSVLCACNHAGLITEAKRYFGSMRELFGFEPMQEHYACM  717

Query  557  VDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDPQDS  736
            +D+LGRAG ++ A E    MP +   SVWGALLGA R+H   ELG++AA+ LF ++P+ S
Sbjct  718  IDLLGRAGRLDEAMELANTMPFQADASVWGALLGAARIHKNVELGQLAAEMLFTLEPEKS  777

Query  737  GNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            G HV+L+N++AS G WE    VR+ MKD  +KK
Sbjct  778  GTHVLLANIYASVGMWENVAKVRRLMKDCNVKK  810


 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 115/228 (50%), Gaps = 14/228 (6%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E + VSW +L++ Y QN  G++A+  F +    G+   +F   SVL AC      ELGR 
Sbjct  132  EPDLVSWSALISGYAQNGFGKEAILAFYEMHLLGVRCNDFTFPSVLKACTFTRDLELGRQ  191

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IH +VV    E + +V + LV MY KCG   D  R F +MPER++++WNAL+  Y    +
Sbjct  192  IHAVVVVTGFECDEYVANSLVVMYAKCGEFGDSRRLFEDMPERSVVSWNALLSCYVQSDY  251

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTAC-----SRAGAVETGMDIFEAMKDKYGIE  529
               A++LF +M   +  + PN  +   ++ A      S  G    G  I    K  Y  +
Sbjct  252  CGEAVELFHEMV--SSGIKPNEFSLSSMINAYTGLEDSGQGRKTHGFLI----KLGYDSD  305

Query  530  PGAEHYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVH  673
            P +++   +VDM  + G +E A  F+     RP +  W A++  C +H
Sbjct  306  PFSKN--ALVDMCAKVGSLEDAV-FVFEEIARPDIVSWNAVIAGCVLH  350


 Score =   108 bits (271),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 80/279 (29%), Positives = 139/279 (50%), Gaps = 13/279 (5%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            ER+ VSW +LL+ Y Q+D   +A+++F +    GI+P EF +SS+++A  GL     GR 
Sbjct  233  ERSVVSWNALLSCYVQSDYCGEAVELFHEMVSSGIKPNEFSLSSMINAYTGLEDSGQGRK  292

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             HG ++K   + + F ++ LVDM  K G +ED    F E+   ++++WNA+I G     +
Sbjct  293  THGFLIKLGYDSDPFSKNALVDMCAKVGSLEDAVFVFEEIARPDIVSWNAVIAGCVLHEN  352

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIF-EAMKDKYGIEPGAE  541
             + AL+LF  M R      PN  T    L AC+  G  + G  +    +K   G +P  +
Sbjct  353  HDWALELFGQMRRSGTH--PNMFTLSSALKACAGTGHKKLGRQLHCNLIKINVGSDPFVD  410

Query  542  HYACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQI  721
                ++DM  +  ++  A      MP +  ++ W A++     +G+     + A +LF +
Sbjct  411  --VGLIDMYSKTYLMNDARMVFNLMPDKDLIA-WNAVISGHSQNGE----DMEAISLFPL  463

Query  722  DPQD--SGNHVILSNMFASSGRWEEANLVRKEMKDIGIK  832
              ++    N   LS +  S     +AN V K++  + +K
Sbjct  464  MYKEGIGFNQTTLSTVLKSIACL-QANNVCKQVHALSVK  501


 Score = 97.1 bits (240),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 113/224 (50%), Gaps = 4/224 (2%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            +++ ++W ++++ + QN    +A+ +F    +EGI   +  +S+VL + A L A  + + 
Sbjct  435  DKDLIAWNAVISGHSQNGEDMEAISLFPLMYKEGIGFNQTTLSTVLKSIACLQANNVCKQ  494

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            +H L VK+  E + +V + L+D YGKC  +ED  R F E    +L+ + ++I  YA  G 
Sbjct  495  VHALSVKSGFESDNYVVNSLIDAYGKCALLEDATRIFRECLIVDLVAFTSMITAYAQSGQ  554

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
               AL L+ +M  +   + P+      +L AC+   A E G  +   +  K+G       
Sbjct  555  GEEALKLYLEMLDR--GIEPDPFVGSSLLNACANLSAYEQGKQVHVHIL-KFGFMSDIFA  611

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHG  676
               +V+M  + G ++ A     ++P R  VS W +++G    HG
Sbjct  612  GNSLVNMYAKCGSIDDADRVFSKIPERGIVS-WSSMIGGLAQHG  654


 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 86/206 (42%), Gaps = 6/206 (3%)
 Frame = +2

Query  62   GEKALKVFLKAREEGIEPTEF-MVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRS  238
            G K+       +E    P      S +LS C        G  IH + +K    ++   R+
Sbjct  49   GSKSNPFLSSTQEPNFTPISVPYYSKLLSKCNATKNPSPGMQIHAITIKFGSTKDPKSRN  108

Query  239  VLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDV  418
            +L+ +Y KC       +   E PE +L++W+ALI GYA  G    A+  F +M      V
Sbjct  109  LLISLYAKCKLFRYARKLVDESPEPDLVSWSALISGYAQNGFGKEAILAFYEM--HLLGV  166

Query  419  VPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGRAGMVERAY  598
              N  TF  VL AC+    +E G  I  A+    G E        +V M  + G    + 
Sbjct  167  RCNDFTFPSVLKACTFTRDLELGRQI-HAVVVVTGFECDEYVANSLVVMYAKCGEFGDSR  225

Query  599  EFIKRMPIRPTVSVWGALLGACRVHG  676
               + MP R  VS W ALL +C V  
Sbjct  226  RLFEDMPERSVVS-WNALL-SCYVQS  249



>ref|XP_007227203.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica]
 gb|EMJ28402.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica]
Length=654

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 175/277 (63%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N VSW S++A   QN    +AL++F + + EG+EP    +  +L AC  +AA   G++
Sbjct  244  ELNIVSWTSIIASCSQNGKDMEALELFREMQVEGVEPNSVTIPCLLPACGNIAALMHGKA  303

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
             H   ++  +  +V+V S L+DMY KCG I      F EMP RNL+ WNA++GGYA  G 
Sbjct  304  AHCFSLRRGISNDVYVGSSLIDMYAKCGKIRLSRLCFDEMPTRNLVCWNAVMGGYAMHGK  363

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
            AN  +++F  M R  Q   P++++F CVL+ACS+ G  + G   F +M  ++G+E   EH
Sbjct  364  ANETMEVFRLMQRSGQK--PDFISFTCVLSACSQKGLTDEGWYYFNSMSKEHGLEARVEH  421

Query  545  YACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQID  724
            YAC+V +L R+G +E AY  IK+MP  P   VWGALL +CRVH    LGK  A  LF ++
Sbjct  422  YACMVTLLSRSGKLEEAYSMIKQMPFEPDACVWGALLSSCRVHSNVTLGKYVAKKLFNLE  481

Query  725  PQDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835
            P++ GN+++LSN++AS G W E + VR +MK +G++K
Sbjct  482  PKNPGNYILLSNIYASKGMWSEVDKVRDKMKSLGLRK  518


 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 114/260 (44%), Gaps = 39/260 (15%)
 Frame = +2

Query  5    ERNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRS  184
            E N V W  ++A + Q+ L    + V  K   EG +P    +SS L A   L    +G  
Sbjct  108  EPNVVLWNGMIAGFNQSKLYADTVAVLQKMHSEGFQPDGSSISSALPAVGHLEDLGMGIQ  167

Query  185  IHGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGH  364
            IHG VVK  +  +  V S L+DMYGKC C  +  + F+EM + ++   NAL+ G +  G 
Sbjct  168  IHGYVVKQGLGSDKCVVSALIDMYGKCACSFETSQVFHEMDQMDVGACNALVTGLSRNGL  227

Query  365  ANMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEH  544
             + AL +F     K Q +  N V++  ++ +CS+ G     +++F  M+ + G+EP +  
Sbjct  228  VDNALKVFRQF--KDQGMELNIVSWTSIIASCSQNGKDMEALELFREMQVE-GVEPNSVT  284

Query  545  YAC-----------------------------------VVDMLGRAGMVERAYEFIKRMP  619
              C                                   ++DM  + G +  +      MP
Sbjct  285  IPCLLPACGNIAALMHGKAAHCFSLRRGISNDVYVGSSLIDMYAKCGKIRLSRLCFDEMP  344

Query  620  IRPTVSVWGALLGACRVHGK  679
             R  V  W A++G   +HGK
Sbjct  345  TRNLV-CWNAVMGGYAMHGK  363


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/246 (25%), Positives = 118/246 (48%), Gaps = 9/246 (4%)
 Frame = +2

Query  104  GIEPTEFMVSSVLSACAGLAAFELGRSIHGLVVKACVEENVFVRSVLVDMYGKCGCIEDC  283
            G+ P  F+  SV+ ACAGL A + G+ +H +   + +  + FV+S LV MY KC  I D 
Sbjct  5    GLVPDSFLFPSVVKACAGLPASKAGKQVHAIASVSGLASDSFVQSSLVHMYIKCDQIRDA  64

Query  284  ERAFYEMPERNLITWNALIGGYAHQGHANMALDLFEDMTRKTQDVVPNYVTFVCVLTACS  463
             + F  +P+R++I  +ALI GY+ +G  + A+ L  +M  +   + PN V +  ++   +
Sbjct  65   RKLFDRVPQRDVIICSALISGYSRRGCVDEAMQLLSEM--RGMCLEPNVVLWNGMIAGFN  122

Query  464  RAGAVETGMDIFEAMKDKYGIEPGAEHYACVVDMLGR---AGMVERAYEFIKRMPIRPTV  634
            ++      + + + M  + G +P     +  +  +G     GM  + + ++ +  +    
Sbjct  123  QSKLYADTVAVLQKMHSE-GFQPDGSSISSALPAVGHLEDLGMGIQIHGYVVKQGLGSDK  181

Query  635  SVWGALLGACRVHGKPELGKIAADNLFQIDPQDSGNHVILSNMFASSGRWEEANLVRKEM  814
             V  AL+    ++GK       +    ++D  D G    L    + +G  + A  V ++ 
Sbjct  182  CVVSALID---MYGKCACSFETSQVFHEMDQMDVGACNALVTGLSRNGLVDNALKVFRQF  238

Query  815  KDIGIK  832
            KD G++
Sbjct  239  KDQGME  244



>ref|XP_008445930.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 
isoform X1 [Cucumis melo]
Length=821

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/276 (43%), Positives = 186/276 (67%), Gaps = 2/276 (1%)
 Frame = +2

Query  8    RNGVSWCSLLAVYEQNDLGEKALKVFLKAREEGIEPTEFMVSSVLSACAGLAAFELGRSI  187
            R  VSW +++  Y QN    +AL  F + +  G++P  F + SV+ A A L+     + I
Sbjct  413  RTHVSWNAMILGYAQNGRVSEALNCFSEMKSLGMKPDSFTMVSVILALADLSITRHAKWI  472

Query  188  HGLVVKACVEENVFVRSVLVDMYGKCGCIEDCERAFYEMPERNLITWNALIGGYAHQGHA  367
            HGLV+++C+++N+FV + LVDMY KCG I    + F  + +R++ITWNA+I GY   G  
Sbjct  473  HGLVIRSCLDKNIFVTTALVDMYAKCGAIHMARKLFDMINDRHVITWNAMIDGYGTHGLG  532

Query  368  NMALDLFEDMTRKTQDVVPNYVTFVCVLTACSRAGAVETGMDIFEAMKDKYGIEPGAEHY  547
              ALDLF+ M + T  V PN +T++ V++ACS +G V+ G+  F++MK  YG+EP  +HY
Sbjct  533  RAALDLFDKMKKGT--VEPNDITYLSVISACSHSGLVDEGLHHFKSMKQDYGLEPSMDHY  590

Query  548  ACVVDMLGRAGMVERAYEFIKRMPIRPTVSVWGALLGACRVHGKPELGKIAADNLFQIDP  727
              +VD+LGRAG ++ A++FI+ MPI P ++V+GA+LGAC++H   E G+ AA+ LF+++P
Sbjct  591  GTMVDLLGRAGRIKEAWDFIENMPISPGITVYGAMLGACKIHKNVEFGEKAANKLFELNP  650

Query  728  QDSGNHVILSNMFASSGRWEEANLVRKEMKDIGIKK  835