BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15995_g1_i2 len=137 path=[1241:0-46 1414:47-50 1178:51-136]

Length=137
                                                                      Score     E

gb|KHN20946.1|  Beta-galactosidase 5                                  52.0    4e-06   
ref|NP_001265904.1|  beta-galactosidase 5-like precursor              52.0    5e-06   
ref|XP_003589339.1|  Beta-galactosidase                               51.6    6e-06   
gb|AAF67342.1|  beta galactosidase                                    51.6    6e-06   Vigna radiata var. radiata [golden gram]
gb|KEH40195.1|  beta-like galactosidase                               51.6    6e-06   
ref|XP_007160714.1|  hypothetical protein PHAVU_001G010900g           51.6    6e-06   
gb|KHN12675.1|  Beta-galactosidase 5                                  50.4    1e-05   
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5-like             50.4    2e-05   
ref|XP_004501212.1|  PREDICTED: beta-galactosidase 5-like             50.1    2e-05   
gb|AHL69742.1|  beta-galactosidase                                    50.1    2e-05   
ref|XP_004500970.1|  PREDICTED: beta-galactosidase 5-like isoform X2  50.1    2e-05   
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                  50.1    2e-05   
gb|KHN45883.1|  Beta-galactosidase 5                                  50.1    2e-05   
ref|XP_004500969.1|  PREDICTED: beta-galactosidase 5-like isoform X1  50.1    2e-05   
gb|KEH36209.1|  beta-galactosidase-like protein                       50.1    2e-05   
ref|XP_003523710.1|  PREDICTED: beta-galactosidase 3-like isoform 1   49.7    3e-05   
ref|XP_002306893.1|  beta-galactosidase family protein                49.7    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like             49.7    3e-05   
gb|KDO84693.1|  hypothetical protein CISIN_1g003076mg                 49.3    3e-05   
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                 49.3    4e-05   
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                 49.3    4e-05   
ref|XP_007017653.1|  Beta-galactosidase 5 isoform 3                   49.3    4e-05   
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                 49.3    4e-05   
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like             49.3    4e-05   
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg           49.3    4e-05   
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like             49.3    4e-05   
gb|AGR44466.1|  beta-D-galactosidase 7                                49.3    4e-05   
dbj|BAD91084.1|  beta-D-galactosidase                                 49.3    4e-05   Pyrus pyrifolia [sha li]
ref|XP_007136038.1|  hypothetical protein PHAVU_009G012700g           49.3    4e-05   
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                 49.3    4e-05   
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like             48.9    5e-05   
ref|XP_007017652.1|  Beta-galactosidase 5 isoform 2                   48.9    5e-05   
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                  48.9    5e-05   
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                    48.9    6e-05   
gb|KDO84692.1|  hypothetical protein CISIN_1g003076mg                 48.5    6e-05   
ref|XP_007017651.1|  Beta-galactosidase 5 isoform 1                   48.5    7e-05   
ref|XP_002510455.1|  beta-galactosidase, putative                     48.5    9e-05   Ricinus communis
gb|EPS69033.1|  beta-galactosidase                                    47.8    1e-04   
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                  47.8    1e-04   
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg           47.8    1e-04   
gb|KDP38567.1|  hypothetical protein JCGZ_04492                       47.4    2e-04   
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like             47.4    2e-04   
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                  47.4    2e-04   
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like             47.4    2e-04   
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                  47.4    2e-04   
ref|XP_010107841.1|  Beta-galactosidase 3                             47.4    2e-04   
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like             47.0    2e-04   
gb|KCW68186.1|  hypothetical protein EUGRSUZ_F01855                   47.0    2e-04   
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  47.0    3e-04   
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                  46.6    3e-04   
emb|CAD44190.1|  putative beta-galactosidase                          45.8    3e-04   Mangifera indica
gb|KGN59998.1|  hypothetical protein Csa_3G865330                     46.2    4e-04   
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                  46.2    4e-04   
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                  46.2    5e-04   Vitis vinifera
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                    45.8    7e-04   
ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like               45.4    8e-04   



>gb|KHN20946.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L QSQGG I LS++   Y
Sbjct  152  MQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEY  185



>ref|NP_001265904.1| beta-galactosidase 5-like precursor [Cicer arietinum]
 emb|CAA10128.1| beta-galactosidase [Cicer arietinum]
Length=745

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L QSQGG I LS++   Y
Sbjct  152  MQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEY  185



>ref|XP_003589339.1| Beta-galactosidase [Medicago truncatula]
 gb|AES59590.1| beta-like galactosidase [Medicago truncatula]
Length=745

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L QSQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEY  186



>gb|AAF67342.1| beta galactosidase [Vigna radiata]
Length=739

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L QSQGG I LS++   Y
Sbjct  152  MQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEY  185



>gb|KEH40195.1| beta-like galactosidase [Medicago truncatula]
Length=687

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L QSQGG I LS++   Y
Sbjct  95   MQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEY  128



>ref|XP_007160714.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
 gb|ESW32708.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
Length=739

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L QSQGG I LS++   Y
Sbjct  152  MQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEY  185



>gb|KHN12675.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIV+MMKN +L QSQGG I LS++   Y
Sbjct  152  MQGFTQKIVEMMKNEKLFQSQGGPIILSQIENEY  185



>ref|XP_004291830.1| PREDICTED: beta-galactosidase 5-like [Fragaria vesca subsp. vesca]
Length=730

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN RL  SQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKNERLFASQGGPIILSQIENEY  187



>ref|XP_004501212.1| PREDICTED: beta-galactosidase 5-like [Cicer arietinum]
Length=428

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L QSQGG I LS++   Y
Sbjct  118  MQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEY  151



>gb|AHL69742.1| beta-galactosidase [Hylocereus undatus]
Length=835

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN RL  SQGG I LS++   Y
Sbjct  150  MQGFTQKIVQMMKNERLFASQGGPIILSQIENEY  183



>ref|XP_004500970.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Cicer arietinum]
Length=627

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L QSQGG I LS++   Y
Sbjct  150  MQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEY  183



>ref|XP_011048837.1| PREDICTED: beta-galactosidase 5 [Populus euphratica]
Length=853

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ RL QSQGG I  S++   Y
Sbjct  152  MQGFTQKIVQMMKDERLFQSQGGPIIFSQIENEY  185



>gb|KHN45883.1| Beta-galactosidase 5 [Glycine soja]
Length=727

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L QSQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEY  187



>ref|XP_004500969.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Cicer arietinum]
Length=732

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L QSQGG I LS++   Y
Sbjct  150  MQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEY  183



>gb|KEH36209.1| beta-galactosidase-like protein [Medicago truncatula]
Length=733

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L QSQGG I LS++   Y
Sbjct  152  MQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEY  185



>ref|XP_003523710.1| PREDICTED: beta-galactosidase 3-like isoform 1 [Glycine max]
Length=736

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L QSQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEY  187



>ref|XP_002306893.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93889.1| beta-galactosidase family protein [Populus trichocarpa]
Length=853

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ RL QSQGG I  S++   Y
Sbjct  152  MQGFTQKIVQMMKDERLFQSQGGPIIFSQIENEY  185



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ RL +SQGG I LS++   Y
Sbjct  151  MQGFTQKIVQMMKSERLFESQGGPIILSQIENEY  184



>gb|KDO84693.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=698

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  1    MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  34



>gb|KDO84689.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=805

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>gb|KDO84690.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=809

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>ref|XP_007017653.1| Beta-galactosidase 5 isoform 3 [Theobroma cacao]
 gb|EOY14878.1| Beta-galactosidase 5 isoform 3 [Theobroma cacao]
Length=551

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  95   MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  128



>gb|KDO84688.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=850

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>ref|XP_006473573.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=850

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>ref|XP_006435076.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48316.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=850

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>ref|XP_008377189.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=852

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  187



>gb|AGR44466.1| beta-D-galactosidase 7 [Pyrus x bretschneideri]
Length=852

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  187



>dbj|BAD91084.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=852

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  187



>ref|XP_007136038.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
 gb|ESW08032.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
Length=738

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L QSQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEY  187



>gb|KDO84691.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=731

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>ref|XP_008466519.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=844

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>ref|XP_007017652.1| Beta-galactosidase 5 isoform 2 [Theobroma cacao]
 gb|EOY14877.1| Beta-galactosidase 5 isoform 2 [Theobroma cacao]
Length=671

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  95   MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  128



>ref|XP_008221339.1| PREDICTED: beta-galactosidase 5 [Prunus mume]
Length=851

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>gb|KHG23756.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=741

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  152  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  185



>gb|KDO84692.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=637

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  186



>ref|XP_007017651.1| Beta-galactosidase 5 isoform 1 [Theobroma cacao]
 gb|EOY14876.1| Beta-galactosidase 5 isoform 1 [Theobroma cacao]
Length=760

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN +L  SQGG I LS++   Y
Sbjct  184  MQGFTQKIVQMMKNEKLFASQGGPIILSQIENEY  217



>ref|XP_002510455.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF52642.1| beta-galactosidase, putative [Ricinus communis]
Length=846

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN  L  SQGG I LS++   Y
Sbjct  152  MQGFTQKIVQMMKNENLFASQGGPIILSQIENEY  185



>gb|EPS69033.1| beta-galactosidase, partial [Genlisea aurea]
Length=723

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQ F QKIVQM+KN RL +SQGG I LS++   Y
Sbjct  142  MQSFTQKIVQMLKNERLFESQGGPIILSQIENEY  175



>ref|XP_010552493.1| PREDICTED: beta-galactosidase 5 [Tarenaya hassleriana]
Length=731

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN  L  SQGG I LS++   Y
Sbjct  152  MQGFTQKIVQMMKNEGLFASQGGPIILSQIENEY  185



>ref|XP_007225291.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
 gb|EMJ26490.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
Length=851

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMKN  L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKNEMLFASQGGPIILSQIENEY  186



>gb|KDP38567.1| hypothetical protein JCGZ_04492 [Jatropha curcas]
Length=853

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF +KIVQMMKN +L  SQGG I LS++   Y
Sbjct  152  MQGFTEKIVQMMKNEKLFASQGGPIILSQIENEY  185



>ref|XP_009614464.1| PREDICTED: beta-galactosidase 3-like [Nicotiana tomentosiformis]
Length=727

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQ F QKIVQMMKN +L Q+QGG I LS++   Y
Sbjct  148  MQRFTQKIVQMMKNEKLFQTQGGPIILSQIENEY  181



>ref|XP_009335672.1| PREDICTED: beta-galactosidase 5 [Pyrus x bretschneideri]
Length=852

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L  SQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKDEKLFASQGGPIILSQIENEY  187



>ref|XP_009777047.1| PREDICTED: beta-galactosidase 3-like [Nicotiana sylvestris]
Length=726

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQ F QKIVQMMKN +L Q+QGG I LS++   Y
Sbjct  147  MQRFTQKIVQMMKNEKLFQTQGGPIILSQIENEY  180



>ref|XP_008388000.1| PREDICTED: beta-galactosidase 5 [Malus domestica]
Length=852

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L  SQGG I LS++   Y
Sbjct  154  MQGFTQKIVQMMKDEKLFASQGGPIILSQIENEY  187



>ref|XP_010107841.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC17241.1| Beta-galactosidase 3 [Morus notabilis]
Length=860

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQ F QKIVQMMK+ +L QSQGG I LS++   Y
Sbjct  153  MQKFTQKIVQMMKDEKLFQSQGGPIILSQIENEY  186



>ref|XP_004147848.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004154857.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=844

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKSEKLFASQGGPIILSQIENEY  186



>gb|KCW68186.1| hypothetical protein EUGRSUZ_F01855 [Eucalyptus grandis]
Length=692

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L  SQGG I LS++   Y
Sbjct  115  MQGFTQKIVQMMKDEQLFASQGGPIILSQIENEY  148



>ref|XP_010061261.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5 [Eucalyptus 
grandis]
Length=730

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF QKIVQMMK+ +L  SQGG I LS++   Y
Sbjct  153  MQGFTQKIVQMMKDEQLFASQGGPIILSQIENEY  186



>gb|KFK36177.1| hypothetical protein AALP_AA4G088200 [Arabis alpina]
Length=713

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKV  47
            MQGF QKIVQMMK+ +L  SQGG I LS++
Sbjct  136  MQGFTQKIVQMMKDEKLFASQGGPIILSQI  165



>emb|CAD44190.1| putative beta-galactosidase [Mangifera indica]
 emb|CAD44191.1| putative beta-galactosidase [Mangifera indica]
Length=286

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQ F QKIVQMMK+ +L +SQGG I LS++   Y
Sbjct  30   MQNFTQKIVQMMKDEKLFESQGGPIILSQIENEY  63



>gb|KGN59998.1| hypothetical protein Csa_3G865330 [Cucumis sativus]
Length=756

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKV  47
            MQGF QKIVQMMK+ +L  SQGG I LS++
Sbjct  153  MQGFTQKIVQMMKSEKLFASQGGPIILSQI  182



>ref|XP_011092826.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=732

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQ F +KIVQMMK  RL QSQGG I LS++   Y
Sbjct  153  MQRFTEKIVQMMKTERLFQSQGGPIILSQIENEY  186



>ref|XP_002263382.2| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI38026.3| unnamed protein product [Vitis vinifera]
Length=846

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQ F QKIVQMMKN +L +SQGG I +S++   Y
Sbjct  151  MQRFTQKIVQMMKNEKLFESQGGPIIISQIENEY  184



>gb|KHG11061.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=734

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGF +KIVQMMKN +L  S GG I LS++   Y
Sbjct  152  MQGFTEKIVQMMKNEKLFASHGGPIILSQIENEY  185



>ref|XP_011077976.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=729

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  136  MQGFVQKIVQMMKNGRLLQSQGGSIFLSKVRFPY  35
            MQGFV+KIV MMK+ +L +SQGG I +S++   Y
Sbjct  154  MQGFVEKIVNMMKSEKLFESQGGPIIMSQIENEY  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510661775884